(data stored in ACNUC7421 zone)

EMBL: CP000830

ID   CP000830; SV 1; circular; genomic DNA; STD; PRO; 3789584 BP.
XX
AC   CP000830; AAVE01000000-AAVE01000027;
XX
PR   Project:PRJNA17417;
XX
DT   06-OCT-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Dinoroseobacter shibae DFL 12, complete genome.
XX
KW   .
XX
OS   Dinoroseobacter shibae DFL 12 = DSM 16493
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Dinoroseobacter.
XX
RN   [1]
RP   1-3789584
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Thompson L.S., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Tapia R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Richardson P.;
RT   "Complete sequence of chromosome of Dinoroseobacter shibae DFL 12";
RL   Unpublished.
XX
RN   [2]
RP   1-3789584
RA   Wagner-Doebler I., Ballhausen B., Baumgart M., Brinkhoff T., Buchholz I.,
RA   Bunk B., Cypionka H., Daniel R., Drepper T., Gerdts G., Hahnke S., Han C.,
RA   Jahn D., Kalhoefer D., Kiss H., Klenk H.-P., Kyrpides N., Liebl W.,
RA   Liesegang H., Meincke L., Pati A., Petersen Jr., Piekarski T.,
RA   Pommerenke C., Pradella S., Pukall R., Rabus R., Stackebrandt E., Thole S.,
RA   Thompson L., Tielen P., Tomasch J., von Jan M., Wanphrut N., Wichels A.,
RA   Zech H., Simon M.;
RT   "The complete genome sequence of the algal symbiont Dinoroseobacter shibae
RT   - a hitchhiker`s guide to life in the sea";
RL   Unpublished.
XX
RN   [3]
RP   1-3789584
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Thompson L.S., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Tapia R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Richardson P.;
RT   ;
RL   Submitted (21-SEP-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-3789584
RA   Liesegang H., Wagner-Doebler I.;
RT   ;
RL   Submitted (06-JUN-2009) to the INSDC.
RL   HZI-Braunschweig, Braunschweig, Germany
XX
DR   MD5; 32bac941d369643edbcdfee10c30c96a.
DR   BioSample; SAMN02598387.
DR   EnsemblGenomes-Gn; Dshi_6001.
DR   EnsemblGenomes-Gn; Dshi_6002.
DR   EnsemblGenomes-Gn; Dshi_6003.
DR   EnsemblGenomes-Gn; Dshi_6004.
DR   EnsemblGenomes-Gn; Dshi_6005.
DR   EnsemblGenomes-Gn; Dshi_6006.
DR   EnsemblGenomes-Gn; Dshi_6007.
DR   EnsemblGenomes-Gn; Dshi_6008.
DR   EnsemblGenomes-Gn; Dshi_6009.
DR   EnsemblGenomes-Gn; Dshi_6010.
DR   EnsemblGenomes-Gn; Dshi_6011.
DR   EnsemblGenomes-Gn; Dshi_6012.
DR   EnsemblGenomes-Gn; Dshi_6013.
DR   EnsemblGenomes-Gn; Dshi_6014.
DR   EnsemblGenomes-Gn; Dshi_6015.
DR   EnsemblGenomes-Gn; Dshi_6016.
DR   EnsemblGenomes-Gn; Dshi_6017.
DR   EnsemblGenomes-Gn; Dshi_6018.
DR   EnsemblGenomes-Gn; Dshi_6019.
DR   EnsemblGenomes-Gn; Dshi_6020.
DR   EnsemblGenomes-Gn; Dshi_6021.
DR   EnsemblGenomes-Gn; Dshi_6022.
DR   EnsemblGenomes-Gn; Dshi_6023.
DR   EnsemblGenomes-Gn; Dshi_6024.
DR   EnsemblGenomes-Gn; Dshi_6025.
DR   EnsemblGenomes-Gn; Dshi_6026.
DR   EnsemblGenomes-Gn; Dshi_6027.
DR   EnsemblGenomes-Gn; Dshi_6028.
DR   EnsemblGenomes-Gn; Dshi_6029.
DR   EnsemblGenomes-Gn; Dshi_6030.
DR   EnsemblGenomes-Gn; Dshi_6031.
DR   EnsemblGenomes-Gn; Dshi_6032.
DR   EnsemblGenomes-Gn; Dshi_6033.
DR   EnsemblGenomes-Gn; Dshi_6034.
DR   EnsemblGenomes-Gn; Dshi_6035.
DR   EnsemblGenomes-Gn; Dshi_6036.
DR   EnsemblGenomes-Gn; Dshi_6037.
DR   EnsemblGenomes-Gn; Dshi_6038.
DR   EnsemblGenomes-Gn; Dshi_6039.
DR   EnsemblGenomes-Gn; Dshi_6040.
DR   EnsemblGenomes-Gn; Dshi_6041.
DR   EnsemblGenomes-Gn; Dshi_6042.
DR   EnsemblGenomes-Gn; Dshi_6043.
DR   EnsemblGenomes-Gn; Dshi_6044.
DR   EnsemblGenomes-Gn; Dshi_6045.
DR   EnsemblGenomes-Gn; Dshi_6046.
DR   EnsemblGenomes-Gn; Dshi_6047.
DR   EnsemblGenomes-Gn; Dshi_6048.
DR   EnsemblGenomes-Gn; Dshi_6049.
DR   EnsemblGenomes-Gn; Dshi_6050.
DR   EnsemblGenomes-Gn; EBG00001062398.
DR   EnsemblGenomes-Gn; EBG00001062399.
DR   EnsemblGenomes-Gn; EBG00001062400.
DR   EnsemblGenomes-Gn; EBG00001062401.
DR   EnsemblGenomes-Gn; EBG00001062402.
DR   EnsemblGenomes-Gn; EBG00001062403.
DR   EnsemblGenomes-Gn; EBG00001062404.
DR   EnsemblGenomes-Gn; EBG00001062405.
DR   EnsemblGenomes-Gn; EBG00001062406.
DR   EnsemblGenomes-Gn; EBG00001062407.
DR   EnsemblGenomes-Gn; EBG00001062408.
DR   EnsemblGenomes-Gn; EBG00001062409.
DR   EnsemblGenomes-Gn; EBG00001062410.
DR   EnsemblGenomes-Gn; EBG00001062411.
DR   EnsemblGenomes-Gn; EBG00001062412.
DR   EnsemblGenomes-Gn; EBG00001062413.
DR   EnsemblGenomes-Gn; EBG00001062414.
DR   EnsemblGenomes-Gn; EBG00001062415.
DR   EnsemblGenomes-Gn; EBG00001062416.
DR   EnsemblGenomes-Gn; EBG00001062417.
DR   EnsemblGenomes-Gn; EBG00001062418.
DR   EnsemblGenomes-Gn; EBG00001062419.
DR   EnsemblGenomes-Gn; EBG00001062420.
DR   EnsemblGenomes-Gn; EBG00001062421.
DR   EnsemblGenomes-Gn; EBG00001062422.
DR   EnsemblGenomes-Gn; EBG00001062423.
DR   EnsemblGenomes-Gn; EBG00001062424.
DR   EnsemblGenomes-Gn; EBG00001062425.
DR   EnsemblGenomes-Gn; EBG00001062426.
DR   EnsemblGenomes-Gn; EBG00001062427.
DR   EnsemblGenomes-Gn; EBG00001062428.
DR   EnsemblGenomes-Gn; EBG00001062429.
DR   EnsemblGenomes-Gn; EBG00001062430.
DR   EnsemblGenomes-Gn; EBG00001062431.
DR   EnsemblGenomes-Gn; EBG00001062432.
DR   EnsemblGenomes-Gn; EBG00001062433.
DR   EnsemblGenomes-Gn; EBG00001062434.
DR   EnsemblGenomes-Gn; EBG00001062435.
DR   EnsemblGenomes-Gn; EBG00001062436.
DR   EnsemblGenomes-Gn; EBG00001062437.
DR   EnsemblGenomes-Gn; EBG00001062438.
DR   EnsemblGenomes-Gn; EBG00001062439.
DR   EnsemblGenomes-Gn; EBG00001062440.
DR   EnsemblGenomes-Gn; EBG00001062441.
DR   EnsemblGenomes-Gn; EBG00001062442.
DR   EnsemblGenomes-Gn; EBG00001062443.
DR   EnsemblGenomes-Gn; EBG00001062444.
DR   EnsemblGenomes-Gn; EBG00001062445.
DR   EnsemblGenomes-Gn; EBG00001062446.
DR   EnsemblGenomes-Gn; EBG00001062447.
DR   EnsemblGenomes-Gn; EBG00001062448.
DR   EnsemblGenomes-Gn; EBG00001062449.
DR   EnsemblGenomes-Gn; EBG00001062450.
DR   EnsemblGenomes-Gn; EBG00001062451.
DR   EnsemblGenomes-Gn; EBG00001062452.
DR   EnsemblGenomes-Gn; EBG00001062453.
DR   EnsemblGenomes-Gn; EBG00001062454.
DR   EnsemblGenomes-Tr; Dshi_6001-1.
DR   EnsemblGenomes-Tr; Dshi_6002-1.
DR   EnsemblGenomes-Tr; Dshi_6003-1.
DR   EnsemblGenomes-Tr; Dshi_6004-1.
DR   EnsemblGenomes-Tr; Dshi_6005-1.
DR   EnsemblGenomes-Tr; Dshi_6006-1.
DR   EnsemblGenomes-Tr; Dshi_6007-1.
DR   EnsemblGenomes-Tr; Dshi_6008-1.
DR   EnsemblGenomes-Tr; Dshi_6009-1.
DR   EnsemblGenomes-Tr; Dshi_6010-1.
DR   EnsemblGenomes-Tr; Dshi_6011-1.
DR   EnsemblGenomes-Tr; Dshi_6012-1.
DR   EnsemblGenomes-Tr; Dshi_6013-1.
DR   EnsemblGenomes-Tr; Dshi_6014-1.
DR   EnsemblGenomes-Tr; Dshi_6015-1.
DR   EnsemblGenomes-Tr; Dshi_6016-1.
DR   EnsemblGenomes-Tr; Dshi_6017-1.
DR   EnsemblGenomes-Tr; Dshi_6018-1.
DR   EnsemblGenomes-Tr; Dshi_6019-1.
DR   EnsemblGenomes-Tr; Dshi_6020-1.
DR   EnsemblGenomes-Tr; Dshi_6021-1.
DR   EnsemblGenomes-Tr; Dshi_6022-1.
DR   EnsemblGenomes-Tr; Dshi_6023-1.
DR   EnsemblGenomes-Tr; Dshi_6024-1.
DR   EnsemblGenomes-Tr; Dshi_6025-1.
DR   EnsemblGenomes-Tr; Dshi_6026-1.
DR   EnsemblGenomes-Tr; Dshi_6027-1.
DR   EnsemblGenomes-Tr; Dshi_6028-1.
DR   EnsemblGenomes-Tr; Dshi_6029-1.
DR   EnsemblGenomes-Tr; Dshi_6030-1.
DR   EnsemblGenomes-Tr; Dshi_6031-1.
DR   EnsemblGenomes-Tr; Dshi_6032-1.
DR   EnsemblGenomes-Tr; Dshi_6033-1.
DR   EnsemblGenomes-Tr; Dshi_6034-1.
DR   EnsemblGenomes-Tr; Dshi_6035-1.
DR   EnsemblGenomes-Tr; Dshi_6036-1.
DR   EnsemblGenomes-Tr; Dshi_6037-1.
DR   EnsemblGenomes-Tr; Dshi_6038-1.
DR   EnsemblGenomes-Tr; Dshi_6039-1.
DR   EnsemblGenomes-Tr; Dshi_6040-1.
DR   EnsemblGenomes-Tr; Dshi_6041-1.
DR   EnsemblGenomes-Tr; Dshi_6042-1.
DR   EnsemblGenomes-Tr; Dshi_6043-1.
DR   EnsemblGenomes-Tr; Dshi_6044-1.
DR   EnsemblGenomes-Tr; Dshi_6045-1.
DR   EnsemblGenomes-Tr; Dshi_6046-1.
DR   EnsemblGenomes-Tr; Dshi_6047-1.
DR   EnsemblGenomes-Tr; Dshi_6048-1.
DR   EnsemblGenomes-Tr; Dshi_6049-1.
DR   EnsemblGenomes-Tr; Dshi_6050-1.
DR   EnsemblGenomes-Tr; EBT00001665079.
DR   EnsemblGenomes-Tr; EBT00001665080.
DR   EnsemblGenomes-Tr; EBT00001665081.
DR   EnsemblGenomes-Tr; EBT00001665082.
DR   EnsemblGenomes-Tr; EBT00001665083.
DR   EnsemblGenomes-Tr; EBT00001665084.
DR   EnsemblGenomes-Tr; EBT00001665085.
DR   EnsemblGenomes-Tr; EBT00001665086.
DR   EnsemblGenomes-Tr; EBT00001665087.
DR   EnsemblGenomes-Tr; EBT00001665088.
DR   EnsemblGenomes-Tr; EBT00001665089.
DR   EnsemblGenomes-Tr; EBT00001665090.
DR   EnsemblGenomes-Tr; EBT00001665091.
DR   EnsemblGenomes-Tr; EBT00001665092.
DR   EnsemblGenomes-Tr; EBT00001665093.
DR   EnsemblGenomes-Tr; EBT00001665094.
DR   EnsemblGenomes-Tr; EBT00001665095.
DR   EnsemblGenomes-Tr; EBT00001665096.
DR   EnsemblGenomes-Tr; EBT00001665097.
DR   EnsemblGenomes-Tr; EBT00001665098.
DR   EnsemblGenomes-Tr; EBT00001665099.
DR   EnsemblGenomes-Tr; EBT00001665100.
DR   EnsemblGenomes-Tr; EBT00001665101.
DR   EnsemblGenomes-Tr; EBT00001665102.
DR   EnsemblGenomes-Tr; EBT00001665103.
DR   EnsemblGenomes-Tr; EBT00001665104.
DR   EnsemblGenomes-Tr; EBT00001665105.
DR   EnsemblGenomes-Tr; EBT00001665106.
DR   EnsemblGenomes-Tr; EBT00001665107.
DR   EnsemblGenomes-Tr; EBT00001665108.
DR   EnsemblGenomes-Tr; EBT00001665109.
DR   EnsemblGenomes-Tr; EBT00001665110.
DR   EnsemblGenomes-Tr; EBT00001665111.
DR   EnsemblGenomes-Tr; EBT00001665112.
DR   EnsemblGenomes-Tr; EBT00001665113.
DR   EnsemblGenomes-Tr; EBT00001665114.
DR   EnsemblGenomes-Tr; EBT00001665115.
DR   EnsemblGenomes-Tr; EBT00001665116.
DR   EnsemblGenomes-Tr; EBT00001665117.
DR   EnsemblGenomes-Tr; EBT00001665118.
DR   EnsemblGenomes-Tr; EBT00001665119.
DR   EnsemblGenomes-Tr; EBT00001665120.
DR   EnsemblGenomes-Tr; EBT00001665121.
DR   EnsemblGenomes-Tr; EBT00001665122.
DR   EnsemblGenomes-Tr; EBT00001665123.
DR   EnsemblGenomes-Tr; EBT00001665124.
DR   EnsemblGenomes-Tr; EBT00001665125.
DR   EnsemblGenomes-Tr; EBT00001665126.
DR   EnsemblGenomes-Tr; EBT00001665127.
DR   EnsemblGenomes-Tr; EBT00001665128.
DR   EnsemblGenomes-Tr; EBT00001665129.
DR   EnsemblGenomes-Tr; EBT00001665130.
DR   EnsemblGenomes-Tr; EBT00001665131.
DR   EnsemblGenomes-Tr; EBT00001665132.
DR   EnsemblGenomes-Tr; EBT00001665133.
DR   EnsemblGenomes-Tr; EBT00001665134.
DR   EnsemblGenomes-Tr; EBT00001665135.
DR   EuropePMC; PMC5730936; 29194520.
DR   EuropePMC; PMC6382689; 30837961.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01727; SAM-SAH.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000830.
DR   SILVA-SSU; CP000830.
DR   StrainInfo; 387730; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002768
CC   Source DNA and bacteria available from Irene Wagner-Dobler
CC   (Irene.Wagner-Doebler@helmholtz-hzi.de)
CC   Contacts: Irene Wagner-Dobler
CC   (Irene.Wagner-Doebler@helmholtz-hzi.de)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3789584
FT                   /organism="Dinoroseobacter shibae DFL 12 = DSM 16493"
FT                   /strain="DFL 12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:398580"
FT   gene            128..1567
FT                   /gene="gltD"
FT                   /locus_tag="Dshi_0001"
FT   CDS_pept        128..1567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="Dshi_0001"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases, TIGRFAM: glutamate synthase, small
FT                   subunit PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase KEGG: rde:RD1_0063 glutamate synthase, small
FT                   subunit, involved in nitrogen metabolism PATH: rn00910 and
FT                   Glutamate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91750"
FT                   /db_xref="GOA:A8LJS4"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJS4"
FT                   /protein_id="ABV91750.1"
FT                   /translation="MANQPMLKFVKIPKDMPEKRDADTRKQDFDEIYQEYAAEKAAEQA
FT                   SRCSQCGVPYCQSHCPLHNNIPDWLKLTAEGRLEEAYELSQATNTFPEICGRICPQDRL
FT                   CEGNCVIEKSGHGTVTIGSVEKYITDTAWEKGWVKPITPAQERPESVGIIGAGPGGLAA
FT                   ADVLRRQGVQVTIYDRYDRAGGLLTYGIPGFKLEKDVVMRRNDQLEQGGVTFELNCDVG
FT                   TDISFDKIREKHDAVLIATGVYKSRDLGGPGAGAGGIVRAIDYLTASNRKSFGDAVPEF
FT                   DSGELNAEGKRVVVIGGGDTAMDCVRTATRQGATSVKCLYRRDRANMPGSQREVQNAEE
FT                   EGVEFVWLTAPQGFAGDTDVTGVMVQKMRLGAPDATGRQAPELIEGADYVEDADLVIKA
FT                   LGFEPEDLPTLWGTPELEVTRWGTIKADFRTHETALPGVYAAGDIVRGASLVVWAIRDG
FT                   REAAEAMLEKFNAKATSMAAE"
FT   gene            1782..6320
FT                   /gene="gltB"
FT                   /locus_tag="Dshi_0002"
FT   CDS_pept        1782..6320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="Dshi_0002"
FT                   /product="glutamate synthase"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase KEGG:
FT                   sit:TM1040_2823 glutamate synthase (ferredoxin), involved
FT                   in nitrogen metabolism PATH: rn00910"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91751"
FT                   /db_xref="GOA:A8LJS5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJS5"
FT                   /protein_id="ABV91751.1"
FT                   /translation="MTKYDANWAAAEEAKRKWLAENGMYSEQEEHSSCGVGLVVNVKGE
FT                   KSRAVVEAGITALKAIWHRGAVDADGKTGDGAGIHVQIPVEFFYDQVRNTGHEPEMDQL
FT                   MAVGQVFLPRTDHGAQETCRTIVESEVLRLGYHIYGWRHVPVDISCLGEKANATRPEIE
FT                   QIIISNSKGVDEETFERELYVIRRRIEKAAAAAQVAGLYICSLSCRSIIYKGMMLAEQV
FT                   AEFYPDLQDARFVSAFAIYHQRYSTNTFPQWWLAQPFRMLAHNGEINTLKGNINWMKSH
FT                   EIRMASAAFGEMAEDIKPIIPGGSSDSAALDAVFEVMVRSGRNAPMAKTLLVPESWSKQ
FT                   AVELPQAWRDMYSYCNSVMEPWDGPAALAMTDGRWVCAGLDRNGLRPMRYVVTGDGLVI
FT                   AGSEAGMVPVNEANLVEKGALGPGQLLAVDMEEGRLFHDTEIKDKLAASQPFGEWVGKI
FT                   TDLDSALAKVTEVAIHEGGELRKRQIAAGYSIEELEQILVPMAEDGKETLASMGDDTPP
FT                   AVLSNQYRPLSHFFRQNFSQVTNPPIDSLREYRVMSLKTRFGNLKNVLDETSEQTEILV
FT                   LESPFVGNAQFERLIAQFGESVCYIDCTFPAGKDRDTLRRELGRIRAEAEDAVRSGAAH
FT                   IVLSDLGQSEDRVPMPMILATSAVHSWLTRKGLRTFCSLNVRAAECVDPHYFAVLIGCG
FT                   ATTVNAYLAEDSLADRIRRGLLDCTLTEAVARYRNAIDQGLLKIMAKMGISVISSYRGG
FT                   LNFEAVGLSRAMVAEYFPGMTSRISGIGTTGIQTKLEEVHARGWRGGQDVLPIGGFYKS
FT                   RRSGEKHAWEAQTMHLMQAACNRSSYELWKQYSKAMQANPPIHLRDLLAISPLGAPVPI
FT                   EEVESVTAIRKRFVTPGMSLGALSPEAHKTLNVAMNRIGARSDSGEGGEDPAHFVPEPN
FT                   GDNPSAKIKQVASGRFGVTAEYLNHCEELEIKVAQGAKPGEGGQLPGMKVTDLIARLRH
FT                   STKGVTLISPPPHHDIYSIEDLAQLIYDLKQINPRCKVTVKLVASSGVGTIAAGVAKAK
FT                   ADVILISGHNGGTGASPATSIKYAGLPWEMGLTEAHQVLAMNNLRDRVTLRTDGGLRTG
FT                   RDIVMAALMGAEEYGIGTAALIAMGCIMVRQCQSNTCPVGVCTQDEELRAKFTGNADKV
FT                   VNLITFYAQEVREVLAAIGARSLDEVIGRADLLRQVSRGSAHLDDLDLNPLLISVDGAQ
FT                   HIVYDRNKPRNPVPDTLDAQIVSDAARFLKDGEKMQLSYAVQNTLRTIGTRTSSHIVTN
FT                   FGMRNALQPDHLTVKLEGSAGQSLGAFGAPGLKLEVSGDANDYVGKGLSGATVVVKPVL
FT                   GSPLKADENTIIGNTVLYGATDGYLFAAGRAGERFAVRNSGAKVVIEGCGSNGCEYMTG
FT                   GVAVILGEIGANFGAGMTGGMAYLYDPAGRAPDMMNMETLVTCPVTVDHWEGQLKGLIE
FT                   RHLAETGSRKAADILQHWDIEKANFLQVCPKEMLVHIPAPLGIEDSAIPAE"
FT   gene            complement(7257..8114)
FT                   /locus_tag="Dshi_0004"
FT   CDS_pept        complement(7257..8114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein KEGG:
FT                   sil:SPO3342 decarboxylase family protein, Homologous
FT                   Superfamily (CATH Code: 3.40.50.80), Nucleotide-binding
FT                   domain of ferredoxin-NADP reductase (FNR) module"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91753"
FT                   /db_xref="GOA:A8LJS7"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJS7"
FT                   /protein_id="ABV91753.1"
FT                   /translation="MRDDHKQGPFRDAHQDVETAESIPDTPQTRAPAYRLAFDDPDFLC
FT                   REELRPVRLQLELLKPQMVLDERGVESTIVMFGGARIPAPADKASARTETLAELSGYYE
FT                   EARKFAYAMTQKSMETYGRENVIVTGGGPGVMEAGNLGAHEAGGASIGLSIVLPHEQAP
FT                   NTYVTPDLCFNFHYFAIRKMHFLMRAKAIAVFPGGFGTLDELFESLTLIQTGRMSRLPF
FT                   LLFGTEFWKTIINWDALAEAGTISEEDLDLFRMVDTAEEAVALIEAWDRKAGWHDSPPG
FT                   QPAL"
FT   gene            8220..8924
FT                   /locus_tag="Dshi_0005"
FT   CDS_pept        8220..8924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0005"
FT                   /product="hypothetical protein"
FT                   /note="interPro: short signalpeptide N-terminal, bad
FT                   swissprot hit to Sterol 3-beta-glucosyltransferase from
FT                   Candida albicans and bad Ref NP hit to
FT                   4-alpha-glucanotransferase from Fusobacterium nucleatum
FT                   subsp. nucleatum ATCC 25586"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91754"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJS8"
FT                   /protein_id="ABV91754.1"
FT                   /translation="MLAGPRGTGVICAGGRGRFCWLGVRVALSIAVGTRSLDVVPFERF
FT                   DDFRGFSAHWAARLVPGPAVLNHWDHGARAWRAPPLEAPITLRPAVQCLVSDGFGVRDG
FT                   AAERAMMARICDGLGVSGAALHAAVEAELPPARFAVDTHAALTAEQRAAGSWEVLGQAH
FT                   FEHLVLRGAVGRLGDWILVSVAVDFTLSARTVARALRGPDGPGGALTERRPDDLRARSG
FT                   EAERHAGSRAGR"
FT   gene            9028..9855
FT                   /gene="dapD"
FT                   /locus_tag="Dshi_0006"
FT   CDS_pept        9028..9855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="Dshi_0006"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: sit:TM1040_3009
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase PFAM: transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91755"
FT                   /db_xref="GOA:A8LJS9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LJS9"
FT                   /protein_id="ABV91755.1"
FT                   /translation="MSNAQLETAIEAAWEARDTISPATTGETREAIEETLNALDSGALR
FT                   VAERGADGSWHVNQWAKKAVLLGFRIKDMEAQSGGPQGGGWWDKVDSKFLGWNSGAWEK
FT                   AGFRAVPSCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLS
FT                   GGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRE
FT                   TGEVMYGEVPPYSVVVAGSMPSKNGVNLYCAVIVKRVDERTRSKTGINELLRD"
FT   gene            10683..11255
FT                   /locus_tag="Dshi_0008"
FT   CDS_pept        10683..11255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0008"
FT                   /product="hypothetical protein"
FT                   /note="bad swissprot to LPS-assembly protein precursor
FT                   (Organic solvent tolerance protein) from Pseudomonas
FT                   aeruginosa UCBPP-PA14 and bad ref ZP hit to putative
FT                   chemotaxis protein from Erythrobacter sp. NAP1, short
FT                   signalpeptide and transmembranedomain, conserved domain:
FT                   Guanylate kinase/L-type calcium channel region (Active
FT                   enzymes catalyze ATP-dependent phosphorylation of GMP to
FT                   GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91757"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT1"
FT                   /protein_id="ABV91757.1"
FT                   /translation="MRNRLLGILLSAVVYTLPAHAWFFQPPPGSVSEETLARFQEAAVN
FT                   TLEGLALIHQVLLQIEQAETSVNSLEATSAAIERLTSAAELFQDLQTDDLQALVVSIEA
FT                   VAQIDEGAIQLVRNAEIETAADLARYSSDQSLALAELMGRLQEIDFGPDAAANSEGRTT
FT                   VNRVVSNISTMMIVVNSVSGALALETQ"
FT   gene            complement(11747..11953)
FT                   /gene="csp2"
FT                   /locus_tag="Dshi_0009"
FT   CDS_pept        complement(11747..11953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csp2"
FT                   /locus_tag="Dshi_0009"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding SMART: Cold
FT                   shock protein KEGG: rde:RD1_1402 cold shock protein
FT                   CspA-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91758"
FT                   /db_xref="GOA:A8LJT2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT2"
FT                   /protein_id="ABV91758.1"
FT                   /translation="MATGTVKWFNATKGFGFIAPDGGSRDVFVHISAVERAGLTGLEDN
FT                   QKVTFDIESGRDGRESAANLALA"
FT   gene            complement(12121..12642)
FT                   /locus_tag="Dshi_0010"
FT   CDS_pept        complement(12121..12642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0010"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305 KEGG:
FT                   psa:PST_3374 hypothetical protein, conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91759"
FT                   /db_xref="GOA:A8LJT3"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT3"
FT                   /protein_id="ABV91759.1"
FT                   /translation="MTQHDTAHTGAHKSGTGANYGRFLAMIATSTAVMYGLMYLNTYAL
FT                   DHVFFSQTRAWMALYMGGAMAVVMLAFMLGMYSNRRANIAVFTGAVLAFAAGVFLVRSQ
FT                   DTVGDVAWMKAMIPHHSIAILTSERATLSDPRVRALADEIIATQRAEIAEMKRYISQIE
FT                   TAAEASDPAS"
FT   gene            12777..13124
FT                   /locus_tag="Dshi_0011"
FT   CDS_pept        12777..13124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0047 hypothetical protein, bad
FT                   swissprot hit to Multiple PDZ domain protein from rattus
FT                   norvegicus involved in cell junction/cell projection;
FT                   Immunoglobulin V-Type, subgroup domain (Eukaryota) from T
FT                   cell surface glycoproteins, junction adhesion molecules ,
FT                   cell surface presentation?"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91760"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT4"
FT                   /protein_id="ABV91760.1"
FT                   /translation="MARNPKTDKPAKRPHQVYTLLVEVGRAKDDGLPKAATGAALMCYA
FT                   SGVDEAEAVRETVALLKQADLNPLEVTGYGTLDERLEDGHDISDEERALMQRALDENSV
FT                   VVAQTTAFYED"
FT   gene            13129..14268
FT                   /gene="dapE1"
FT                   /locus_tag="Dshi_0012"
FT   CDS_pept        13129..14268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE1"
FT                   /locus_tag="Dshi_0012"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein
FT                   KEGG: rsh:Rsph17029_2789 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91761"
FT                   /db_xref="GOA:A8LJT5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LJT5"
FT                   /protein_id="ABV91761.1"
FT                   /translation="MTDPVALTADLIRCPSVTPEEGGALSLLEARLSAAGFACTRVDRN
FT                   GIANLFARWGEKGHARSFGFNGHTDVVPVGARADWRFDPFGAQVEGDWMYGRGAVDMKS
FT                   AVAAFAAAAMDFVADTPPDGAVILAITGDEEGDAKDGTVALLDWMAAQGEAMDVCLVGE
FT                   PTCPDEMGEMMKIGRRGSMTFFFEALGVQGHSAYPHRAKNPLPALAKLVDRLAGLELDT
FT                   GTDHFDPSTLAVTTFDTGNPANNVIPAACRATVNIRFNDAHSSESLTAMVRGIAAEVAA
FT                   ETGIEITDRVSVSGESFITPPGRLSDLVAAAVETETGRVPVLSTSGGTSDARFVQHHCP
FT                   VVEFGLVGKSMHQVDERVAIAQIPQLKAIYTRILRDYFA"
FT   gene            14265..14693
FT                   /gene="elaA"
FT                   /locus_tag="Dshi_0013"
FT   CDS_pept        14265..14693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elaA"
FT                   /locus_tag="Dshi_0013"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase KEGG:
FT                   rsh:Rsph17029_2788 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91762"
FT                   /db_xref="GOA:A8LJT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT6"
FT                   /protein_id="ABV91762.1"
FT                   /translation="MSTVREISGPQELALCRTLRREVFIEEQAVPEAEEWDGLDAEARH
FT                   WLVFDGAVPVATMRLRVLGEVGKIERVCVRAAHRGSGHGLALMRAALAALAETPGVTEA
FT                   RLGAQLHAIPFYEALGFTAHGAEFMDGGMPHRWMTKPL"
FT   gene            14693..15271
FT                   /locus_tag="Dshi_0014"
FT   CDS_pept        14693..15271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO3331 hypothetical protein,
FT                   Uncharacterized protein conserved in bacteria COG3222, bad
FT                   swissprot hit to Carboxylesterase bioH (Biotin synthesis
FT                   protein bioH) from Escherichia coli, Also displays a weak
FT                   thioesterase activity. Can form a complex with CoA, and may
FT                   be involved in the condensation of CoA and pimelic acid
FT                   into pimeloyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91763"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT7"
FT                   /protein_id="ABV91763.1"
FT                   /translation="MRPTLVVMVKEPRPGRVKTRLGREIGMVGAAWWFRHQGARLIRRL
FT                   RDPRWELVLAVSPDTEGLASRVWPADLPRWPQGRGDLGDRMGRALRGFGPGPVAVIGAD
FT                   IPGIDRARITEAFAALGRADAVLGPAPDGGYWLIGWAGRRALPAATFESVRWSTEHTRA
FT                   DTIRSLGDCRIAHVAELQDVDTVEDLRRV"
FT   gene            15472..17727
FT                   /gene="rnr"
FT                   /locus_tag="Dshi_0015"
FT   CDS_pept        15472..17727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="Dshi_0015"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: sit:TM1040_2994 ribonuclease R TIGRFAM: VacB
FT                   and RNase II family 3-5 exoribonuclease; ribonuclease R
FT                   PFAM: ribonuclease II; RNA binding S1 domain protein, high
FT                   sw hit to Ribonuclease R (RNase R) (VacB protein homolog)
FT                   from Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91764"
FT                   /db_xref="GOA:A8LJT8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT8"
FT                   /protein_id="ABV91764.1"
FT                   /translation="MDRFPTKDEVLAWIEDNPARANKREIARAFGIKGAARIDLKRLLK
FT                   ELEGKGHLEKRKRSYRDPESLPPVSVLKVGDADGDGDLFARPLDWQGAGAEPACLIIPR
FT                   KGDPALAEGDRILARLTRVEGEDYAYEARLIRRIGTGPRKILGILRKTAEGGRIVPIDK
FT                   GADREWRVAQGGLLGAQDGDLVEAEQAGPKGRMGLPLARVTQVLGDPGGAKSVSLIAIH
FT                   QHGILDEFPEAALAEAEAVTAPELGARTDLRDLPLITIDPPDARDRDDAVCAIPDDDPA
FT                   NPGGFVLWVAIADVAAAVRPGGALDREARKRGNSTYFPDRVVPMLPDSLSGDLCSLHED
FT                   VDRACMAVRMVIDAEGTKRGQTFHRGLMRSRASLAYGEVQAAVDGDPTERTEPLLEPIL
FT                   RPLFAAYEALKAARARRQPLDLDLPERRIALSETGEVTSVAFRDRLEVHRLIEEFMVLA
FT                   NVAAAETLAKKRTPLLYRVHEEPAETKLDALRETVQAAGLTLAKGRVLRTADLNRLLAQ
FT                   AAGTDDAELINISTLRSMTQAYYSPENFGHFGLALQNYAHFTSPIRRYADLIVHRALIT
FT                   AHGFGEDGLSEADIERLDETGKLISEAERRSMAAERDTIDRYLAAYLADRVGNEFSARI
FT                   SGVARFGAFARLDETGADGLIPIRTIGAEFFHFDADAQALVGSDTGFRLAMGQRVTVRL
FT                   AEAVPVTGGIGLELLAVEDETVPTGRRRGKSRPVRRKIAAKKAKAGKLKKKLKRKRV"
FT   gene            18179..19426
FT                   /gene="mltB2"
FT                   /locus_tag="Dshi_0016"
FT   CDS_pept        18179..19426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltB2"
FT                   /locus_tag="Dshi_0016"
FT                   /product="lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="TIGRFAM: lytic murein transglycosylase PFAM:
FT                   Peptidoglycan-binding domain 1 protein KEGG: rde:RD1_0181
FT                   transglycosylase, putative, good sw hit to Membrane-bound
FT                   lytic murein transglycosylase B precursor from E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91765"
FT                   /db_xref="GOA:A8LJT9"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJT9"
FT                   /protein_id="ABV91765.1"
FT                   /translation="MIRATLAALSVAITLPVAAMATPLAQSPHPTARPGAVVQAVALPA
FT                   RFEAWIGAFERRARAAGIRPATFRAAFAGVDYLPDVIRRDRSQAEFTKQIWEYLDSAVS
FT                   DARLRNGRAAFAARRDTLRAIERRYGVEAEVVTAIWGLESAYGSYRGATPTLSAMATLA
FT                   YEGRRAAFFEDQLIAALKILQDGDTTPGRMTGSWAGAMGHTQFMPTSYLDYAVDFTGDG
FT                   RRDIWGEDPTDALASTAAYLEAFGWTRGQPWGVEVRLPAGFDYSLTGEKVKRSPADWAR
FT                   LGVLDMDGRAVPNHGRASILLPAGARGAAFMIFDNFHVIERYNTADAYVIAVGVLSDRI
FT                   AGGQGIRADWPRGDRALSFTEKKEMQRLLGRAGFDTGKVDGIIGPNTIDAVRRYQASIG
FT                   VVPDGYASLDILRRLR"
FT   gene            complement(19516..20166)
FT                   /locus_tag="Dshi_0017"
FT   CDS_pept        complement(19516..20166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0593 hypothetical protein, one single
FT                   bad swissprot hit to ATP synthase protein 8 (ATPase subunit
FT                   8) from mitochondrion Artemia franciscana, short
FT                   signalpeptide and transmembrane domains, uDENN Domain:
FT                   found in a variety of signalling proteins, is a good
FT                   candidate for a GTP/GDP exchange activity"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91766"
FT                   /db_xref="GOA:A8LJU0"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU0"
FT                   /protein_id="ABV91766.1"
FT                   /translation="MSAHTPHAALARQPGFLALLAWIGVIGVGALLTGTVIGPLFVPAH
FT                   DPMADTISDLAAGRGEIIMDVALYGFAAGLFALALACAHVHQGGLAWSAGTLCLAVLAA
FT                   TIVVVGARNEYGDGDAEGVVIHEYLVYGLGVLFTAMPLCLAPRAARLLPWSRPALIGTG
FT                   LLWAVMSPVFFLLPTDVDGGYERLLGGVACAQVLILATALFAHARQAQPEHAR"
FT   gene            complement(20326..22629)
FT                   /locus_tag="Dshi_0018"
FT   CDS_pept        complement(20326..22629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0018"
FT                   /product="multicopper oxidase"
FT                   /note="PFAM: multicopper oxidase type 2 KEGG: hch:HCH_03584
FT                   putative multicopper oxidases, diverse cupredoxin and
FT                   multicopper oxidase 1-3 domains, bad swissprot hit to Blue
FT                   copper oxidase cueO precursor (Copper efflux oxidase) from
FT                   Escherichia coli O157:H7, Copper resistance protein A
FT                   (copA) from a plasmid in Pseudomonas syringae. This protein
FT                   seems to be involved in the resistance of the microbial
FT                   host to copper"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91767"
FT                   /db_xref="GOA:A8LJU1"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU1"
FT                   /protein_id="ABV91767.1"
FT                   /translation="MAAHVSTFTRRAFLGLLGTTALVRATGGPGRAQARTTGSFRAPPL
FT                   MTPAPTTGPGQFDAPAWATYADSFADFVETWRDQPIARERPPLDLAPGDYARIDRFYAV
FT                   AALSRDGVELTRADGTTARLWSPVYADRIAPEAASLRAVGPTMEFTRGEITGVWLTNDL
FT                   QVCGTNPEIAPDAPDAGYTPHNFNYTNLHTHGLHVTPRAPSDDVLVTVVPDEIKEICLK
FT                   HPDAITAEDPATFPYFYDVPDDHPVGTFWYHPHMHGAVASQVGAGMAGALLIRSKPGEI
FT                   DLDEALAIHCNITRDDERIMVLQQIAYNTRPEAGTGIYVADNFYASTPAQNFACTPSIL
FT                   PGSPTYQAGSAVTAVTSVNGMVTPTLAMAPGEILRFRMINATNGTNYIPKFRILGDAPA
FT                   GQPLPEVYAIAVDGIPLYPVNPADDPEGRFAPDAPWFPIDYDQPRPEDGDTSHAARRYW
FT                   TTAELITLAPAQRLDLLVKAPDIQGAEEVRFALAGVPQYDTPASGTSPGTAARSAPNVL
FT                   DNEEAGKAATDGIVTVVVSGPPRTDQSLPHMAFFEVAALRRLPGLGQANLVRPELPLAD
FT                   MPGAAQPDSLSVAEMLARWRASFAAAAETVTTPSLGVTDPHWKSLNFAFVAEPDPDGTP
FT                   ANFQINGQSFDADLSDDPQLMLPASDWTAWELYSSSDLHMFHIHINSFMVLGRYRVSAP
FT                   DDPEAITSFIPYLLPIWRDTVYFDAGNDATATPLTGRRVAALSYQVDFTGEFVFHCHSL
FT                   YHEDNGMMFTVEIA"
FT   gene            22866..24683
FT                   /locus_tag="Dshi_0019"
FT   CDS_pept        22866..24683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0019"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein KEGG: rde:RD1_2707 GTP-binding protein
FT                   TypA, putative, high swissprot hit to GTP-binding protein
FT                   TypA/BipA homolog from Helicobacter pylori, diverse
FT                   translation and elongation factor domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91768"
FT                   /db_xref="GOA:A8LJU2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU2"
FT                   /protein_id="ABV91768.1"
FT                   /translation="MDLRNIAIIAHVDHGKTTLVDELLKQSGTYRDNQATTERAMDSND
FT                   LERERGITILAKATSVEWKGTRINIVDTPGHADFGGEVERILSMVDGVVLLVDAAEGPM
FT                   PQTKFVTSKALALGLRPIVVLNKVDKPDAEPDRALDECFDLFANLDADDDQLDFPHLYA
FT                   SGRSGWADAELDGPRKDLAALFDLIVHHVPKPRQIAHLDEDFRMLATTLSADPFVGRIL
FT                   TGRVESGTLKVGATVQALSRIGQKIEQFRVTKIRAFRGLGHADIEEAQAGDIVSIAGMS
FT                   KATVADTICALAVDTPLDAQPIDPPTITVTFGINDSPLAGRDGKKVQSRVIRDRLMKEA
FT                   ESNVAIKIADTPGGEAFEVSGRGELQMGVLIENMRREGFELSISRPQVIMREVDGVKME
FT                   PIEEATIDVDDEYSGTVIEKLTGARKGDLVEMKPAGAGKTRIVAHVPSRGLIGYHGEFL
FT                   TDTRGTGVLNRVFHDWAPYKGPIPGRRAGVLISMENGTSVAYALWNLEERGRMFIGAQE
FT                   AVYTGMIIGEHSRENDLEVNPLKGKKLTNVRASGTDDAVRLTTPITLSLEEAIAYIDDD
FT                   ELVEVTPNAIRLRKRYLDPHERKRQARAG"
FT   gene            complement(25297..26019)
FT                   /locus_tag="Dshi_0020"
FT   CDS_pept        complement(25297..26019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0020"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: sil:SPO3454 hypothetical protein, no
FT                   significant swissprot hit, next good Ref YP hit to putative
FT                   transcriptional regulator, CadC from Silicibacter sp.
FT                   TM1040, three domains to trans_reg_C, Effector domain of
FT                   response regulator, CadC, DNA-binding winged-HTH domains
FT                   and OmpR, Response regulators consisting of a CheY-like
FT                   receiver domain; CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91769"
FT                   /db_xref="GOA:A8LJU3"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU3"
FT                   /protein_id="ABV91769.1"
FT                   /translation="MQNGKTMPDPITSASRTLRTGTRVVTLGLAAIVAILLVAAVVLFR
FT                   SLPDANAFNRQVEQIFVENDALTTTDQIRLLEILAQSGTAFSDVLASYRVVIFVLLVFS
FT                   AALLVAALASLVALVTVNRRVSEIDKKGIIVSSLLISREERLVVLNDMEFKLTEAAMET
FT                   LSVLAEARMDGDILSGAALEGMIQGRDASDCEEAAGATRIKRLRDALGNQMVSELLVRN
FT                   ISRKGYLLSVDKTAIKMI"
FT   gene            complement(25973..26377)
FT                   /locus_tag="Dshi_0021"
FT   CDS_pept        complement(25973..26377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6002 hypothetical protein, one single
FT                   transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91770"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU4"
FT                   /protein_id="ABV91770.1"
FT                   /translation="MPRPSPRPRRAGNNRPPPADDGPALLNIGAAAVTIFPMDKIRLPL
FT                   LAACFALLAAPAQAACYADYKAKQDDPLRLHYGVIALSDGACDDRRAASEEAARKIAAG
FT                   GWTLLNIVSTFGEDGLAERKDNAGPYYLRF"
FT   gene            26400..26954
FT                   /locus_tag="Dshi_0022"
FT   CDS_pept        26400..26954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0022"
FT                   /product="hypothetical protein"
FT                   /note="no swissprot hit, next ref ZP hit to hypothetical
FT                   protein RB2150_13021 from Rhodobacterales bacterium
FT                   HTCC2150, short signalpeptide and two transmembrane
FT                   regions, NO hit to Sodium/hydrogen exchanger family
FT                   Pfam00999"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91771"
FT                   /db_xref="GOA:A8LJU5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU5"
FT                   /protein_id="ABV91771.1"
FT                   /translation="MTQTFCTRGLRAAAALLLSAVIGATSLAATASPARALERETLGQL
FT                   LFGAAAIALAAKVYNDREDRKARERAARAAPPPVQVVEADRWRAYGPRGRVVYGPGTRP
FT                   GQAFEGAGTRREALTRRIQCQRKLQTETGWVKFYSQACLDRVGADVDVPQTCLRQRWAQ
FT                   GRWVQYFSRGCLRRFGIVDAV"
FT   gene            26998..27618
FT                   /gene="rnhB"
FT                   /locus_tag="Dshi_0023"
FT   CDS_pept        26998..27618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="Dshi_0023"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII KEGG: sil:SPO3452
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91772"
FT                   /db_xref="GOA:A8LJU6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LJU6"
FT                   /protein_id="ABV91772.1"
FT                   /translation="MSRPHFQFETDLAARGYLRIAGVDEVGRGPLAGPVMAAAVVLDPG
FT                   AIPEGLNDSKQVTAKRREALAAQLAQVAQVGVGVAEVAEIDRLNIRRAAHLAMLRALDA
FT                   LPAPPDMALIDGRDRPDDLPCAAHAIIKGDTKSLSIAAASIVAKVARDRVMTALAAEFP
FT                   GYGWETNAGYPTQAHRAALLDIGVSPHHRRSFRPVHNILYQEK"
FT   gene            27713..28819
FT                   /gene="dam"
FT                   /locus_tag="Dshi_0024"
FT   CDS_pept        27713..28819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="Dshi_0024"
FT                   /product="adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein KEGG:
FT                   rsq:Rsph17025_0066 DNA methylase N-4/N-6 domain protein,
FT                   high swissprot hit to Modification methylase CcrMI
FT                   (Adenine-specific methyltransferase CcrMI from Caulobacter
FT                   vibrioides (Caulobacter crescentus)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91773"
FT                   /db_xref="GOA:A8LJU7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU7"
FT                   /protein_id="ABV91773.1"
FT                   /translation="MKTKTKQPEAGMLPLNEILAGDCIEVMNSLPEASVDLIFADPPYN
FT                   LQLKGDLHRPDNSKVDAVDDAWDRFASFDSYDRFSADWLAAARRLLKPNGAIWVIGSYH
FT                   NIFRVGAALQNTGYWILNDVVWRKSNPMPNFRGKRLTNAHETLIWASKSEGAKYTFNYE
FT                   ALKQLNEGIQMRSDWVLPICTGHERLKDEAGDKAHPTQKPESLLHRVIVATTNPGDVVL
FT                   DPFFGTGTTGAVAKKLGRDFIGIEREEAYRKVAEARLADVRKYDRESLAVTQSKRSEPR
FT                   VPFGQLVERGMLRPGEVLTSPGGKVAKVRADGTLVADQVAGSIHQVGAALEHAPSCNGW
FT                   TYWHFKRDGKSVPIDLLRQQIRAEMRAN"
FT   gene            29143..29814
FT                   /gene="chrR2"
FT                   /locus_tag="Dshi_0025"
FT   CDS_pept        29143..29814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrR2"
FT                   /locus_tag="Dshi_0025"
FT                   /product="transcriptional activator anti-ECFsigma factor"
FT                   /note="KEGG: abo:ABO_0664 hypothetical protein, Cupin,
FT                   RmlC-type domain, best swissprot hit to Transcriptional
FT                   activator chrR from Rhodobacter sphaeroides 2.4.1 and high
FT                   similarity to Predicted transcription negative regulator
FT                   (refZP hit) from Roseovarius sp. 217"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91774"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU8"
FT                   /protein_id="ABV91774.1"
FT                   /translation="MKLNADFTRRVVVRPEDYAWVDSPASGVQRMMLDRIGDEVARATS
FT                   LVRFAPNSQFDAHSHGGGEEFLVLEGVFSDEHADYPAGSYVRNPIGTAHTPHIGPEGAT
FT                   ILVKLHQFDPEDTEQKVIDTRVAAFLPGAAPGLSVLPLHTVPGESVALVRWAPGTRFAA
FT                   HRHWGGEEIFVLEGVFQDEHGDYPAGSWLRSPHQSEHAPFSEEGCLIYVKTGHLPMQEA
FT                   A"
FT   gene            29888..30529
FT                   /locus_tag="Dshi_0026"
FT   CDS_pept        29888..30529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0026"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: jan:Jann_0393 NAD-dependent
FT                   epimerase/dehydratase, best swissprot hit to Flavin
FT                   reductase (FR) (NADPH-dependent diaphorase) from Mus
FT                   musculus"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91775"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJU9"
FT                   /protein_id="ABV91775.1"
FT                   /translation="MQKILVIGGSKGIGLEAVKIALEQGFAVRVMARKPEAVGLEHADL
FT                   ELVAGDATDAMAVSDALAGCEAVISAIGIPKSLPALARPTTVFSDATAVLIPAMKAAGI
FT                   TRLLAVTGFGAGESNAAMSTLERLGHKALLGRAYADKAVQEEMIKGSGLDWTIARPGIL
FT                   TNNARTGQYRVLSDPAEWRNGLISRADVGDFLIRALKEGSHIHDAPVLVR"
FT   gene            complement(30653..31807)
FT                   /gene="alkB1"
FT                   /locus_tag="Dshi_0027"
FT   CDS_pept        complement(30653..31807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB1"
FT                   /locus_tag="Dshi_0027"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase KEGG: sit:TM1040_2646
FT                   alkane-1 monooxygenase, good swissprot hit to Alkane
FT                   1-monooxygenase (Alkane omega-hydroxylase) from Pseudomonas
FT                   oleovorans, also fatty acid desaturase typ 1 domain
FT                   Pfam00487"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91776"
FT                   /db_xref="GOA:A8LJV0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV0"
FT                   /protein_id="ABV91776.1"
FT                   /translation="MSTPDTASIPPARMARLTRALPFWLSLGLFPAILLAAEYGGWALL
FT                   LPPLASWGLFSLLDALAGLETGNADTGTPEEALGWYRAITLAWFPLQAAMLIWLLATVP
FT                   AAAHLGAAEKVGVFFGMGVASGTVGITYAHELMHQKNRLERWLGDLLMASVLYGHFRSE
FT                   HLLVHHRYVGTPRDPVTARYNEGFHRFYPRVLWQCLASAWRAEAAMLARRNRPVWHPAN
FT                   PFWRYAALQAGWLALAFALGGSSGVALFAVQAATAIWQLELVNYVEHYGLTRKHLGDGR
FT                   YEHVQPRHSWNAAQKASNWLLINLQRHSDHHYKPDRRFPLLQTYGPEEAPQLPFGYPVM
FT                   TMAAMVPPLWRRIMNPRVRAWRRQYYPEIEDWGPYKRAETPLPR"
FT   gene            complement(31815..32909)
FT                   /gene="mutY"
FT                   /locus_tag="Dshi_0028"
FT   CDS_pept        complement(31815..32909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="Dshi_0028"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein KEGG:
FT                   sit:TM1040_2645 A/G-specific adenine glycosylase, swissprot
FT                   to A/G-specific adenine glycosylase from Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91777"
FT                   /db_xref="GOA:A8LJV1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV1"
FT                   /protein_id="ABV91777.1"
FT                   /translation="MHKKIASDAAAAALSSTLLDWYDAHARVMPWRVGPAERAAGTRPD
FT                   PYRVWLSEVMLQQTTVAAVRDYFRAFTDRWPRVTDLAAAADADVMAAWAGLGYYARARN
FT                   LLKCARVVTQDHGGRFPDTAEGLRALPGIGPYTSAAIAAIAFDRPETVVDGNVERVMAR
FT                   LRGIETPLPPAKPELTEAAAALTPDKRPGDYAQAVMDLGATICTPRNPACGICPWRDPC
FT                   VARATGIAAELPRKLPKKPKPTRFGLVYVARHPDGAWLLETRPDRGLLGGMLAYPSTDW
FT                   TEEAPADAPPVAADWHDPALEVRHTFTHFHLRLALRTAITDAPPARGRFVPRAAFRPAD
FT                   LPTVFRKAHDLAAAHLDTGFPSPL"
FT   gene            32995..33507
FT                   /locus_tag="Dshi_0029"
FT   CDS_pept        32995..33507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0029"
FT                   /product="protein of unknown function DUF1159"
FT                   /note="PFAM: protein of unknown function DUF1159 KEGG:
FT                   sit:TM1040_2644 protein of unknown function DUF1159"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91778"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV2"
FT                   /protein_id="ABV91778.1"
FT                   /translation="MATGTRRRGYGFRQTGQLLETRIRTAGESRGFAVSKLLTHWEEVA
FT                   GPDMAAKVRPVTVNYGRKGFGATLTVLTSGAFAPLLEMQKERLREKVNACYGYNAISRI
FT                   KITQTASTGFAEPGADFTPAPRREGPPKPKPVTEAARAVAGAVQDPGLRDALARLGSNI
FT                   LNSKHPS"
FT   gene            33519..34190
FT                   /gene="dsbA1"
FT                   /locus_tag="Dshi_0030"
FT   CDS_pept        33519..34190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA1"
FT                   /locus_tag="Dshi_0030"
FT                   /product="putative thiol-disulfide oxidoreductase D"
FT                   /note="KEGG: rde:RD1_0295 thiol-disulfide oxidoreductase D,
FT                   putative, swissprot hit to Putative protein-disulfide
FT                   oxidoreductase RBE_1288 precursor from Rickettsia bellii
FT                   RML369-C, conserved domains: dsbA: a monomeric thiol
FT                   disulfide oxidoreductase protein and dsbG:
FT                   Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91779"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV3"
FT                   /protein_id="ABV91779.1"
FT                   /translation="MARKLTSLALGVAIAAAGAYWYTSQSGVPTAGVTLNPVGSVEAQE
FT                   VDTSGIVEMTLGAADAPITVVEYASFTCPHCATFHQNVFPELKENYIETGKVQFIYREV
FT                   YFDRFGLWAGMVARCGGEERYFGITDMLYEQQSEWTGNGSPAEVADNLRRIGRVAGMSD
FT                   EQVDACLQDGEKAQALVAWYQQNAEADGINSTPSFVINGENYSNMNFRDFAAVLDGLLE
FT                   E"
FT   gene            complement(34226..35239)
FT                   /gene="lpxK"
FT                   /locus_tag="Dshi_0031"
FT   CDS_pept        complement(34226..35239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="Dshi_0031"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: rsp:RSP_1462 putative
FT                   tetraacyldisaccharide-1-P 4-kinase TIGRFAM:
FT                   tetraacyldisaccharide 4-kinase PFAM:
FT                   Tetraacyldisaccharide-1-P 4-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91780"
FT                   /db_xref="GOA:A8LJV4"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LJV4"
FT                   /protein_id="ABV91780.1"
FT                   /translation="MRPPGFWHAPPDALGWRARALAPLGALYAAATARRVARPPAHRPG
FT                   IPVICVGNINAGGTGKTPTVIALQMILAARGIAAHVVSRGYGGRLEGPVAVDPRRHDAA
FT                   EVGDEPLLLAAFGPTWVARDRAAGARAAEGAGAQAILLDDGFQNPTLAKDLSLVVVDAQ
FT                   RGFGNGRVIPAGPLREPVARGLARADLLLTIGPPAAQARFDALWGPATVTLPHLRGALT
FT                   PLQTGMRWEGLRAVAFAGIGHPQKFFDTLQDQGVILCATHPLDDHQPLDARLITRLLAD
FT                   AKAQGAQLVTTEKDAVRLPAELRGQVLSLPVRLALADDTALTAALDTLFPNATRRL"
FT   gene            complement(35239..36555)
FT                   /gene="kdtA"
FT                   /locus_tag="Dshi_0032"
FT   CDS_pept        complement(35239..36555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="Dshi_0032"
FT                   /product="three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /EC_number="2.-.-.-"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein KEGG: jan:Jann_0400
FT                   three-deoxy-D-manno-octulosonic-acid transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91781"
FT                   /db_xref="GOA:A8LJV5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV5"
FT                   /protein_id="ABV91781.1"
FT                   /translation="MSAAFPRSAALWLYLAVNARLTGWAERKIAERREAGKEDPDRYGE
FT                   RLGRPGLPRPDGPLIWMHAASVGEALSVQELIRRLREERPDTTILLTTGTRTSAELLAT
FT                   RLPQGAIHQFAPVDTKPAIAGFLDHWKPDLAIWIESELWPRMIHDTADRGIPMMLMNAR
FT                   MSPDSYRRWRWMRGLSHALLSRFRRILAQDKDTMRLLARLGAPQDRLRTIGTLKEGAQL
FT                   LPYSQTQYASFLDEIDGRPLWLASSTHAGEEEMMSDAHRSLVRRMHRLLMVLVPRHPER
FT                   GPEIARALRAEGWEVALRSDDDSVDLDTQIYVADTLGELGLWYRLAPVSFIGGSLTEVG
FT                   GHNPFEPAALGSAIVHGPHVFNFADIYDRLTQAGGARQVDGPVTLAETIDDLLAPHNAA
FT                   AMAHAAWEVSSRGAQVTDLALSEVLDQLDGAEPAARKAP"
FT   gene            complement(36716..36907)
FT                   /locus_tag="Dshi_0033"
FT   CDS_pept        complement(36716..36907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0033"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343 KEGG:
FT                   sit:TM1040_0056 protein of unknown function DUF343, DUF343
FT                   domain: Trm112p-like protein, The function of this family
FT                   is uncertain. The bacterial members are about 60-70 amino
FT                   acids in length. The C terminus contains the strongest
FT                   conservation. Trm112p is required for tRNA methylation n S.
FT                   cerevisiae and is found in complexes with 2 tRNA methylases
FT                   (TRM9 and TRM11) also with putative methyltransferase
FT                   YDR140W."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91782"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV6"
FT                   /protein_id="ABV91782.1"
FT                   /translation="MSADEIEAEFDRHMLESLVCPVTRAPLTYDAEAQELISRAAHLAF
FT                   PIRNGIPVMIEDEARKLD"
FT   gene            complement(36904..37551)
FT                   /locus_tag="Dshi_0034"
FT   CDS_pept        complement(36904..37551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0034"
FT                   /product="ATP-dependent protease La (LON) domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein KEGG:
FT                   rsq:Rsph17025_2895 peptidase S16, lon domain protein,
FT                   swissprot hit to ATP-dependent protease La 2 from
FT                   Myxococcus xanthus, COG2802: Uncharacterized protein,
FT                   similar to the N-terminal domain of Lon protease and
FT                   LON-domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91783"
FT                   /db_xref="GOA:A8LJV7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV7"
FT                   /protein_id="ABV91783.1"
FT                   /translation="MKLSAADLPDTIPVFPLPGALLLPRARLPLHIFEPRYLAMLEDAL
FT                   KTPHRLIGMVQPREVPGSKDRRLHSIGCAGRVSAFSETEDGRYMITLNGMSRFRITREV
FT                   SGFTPYLKADVTWDDFGRDLGKTEEDPGFQRGAFLDLLRRFFEDQDMRTDWDSLSEAED
FT                   ELLINSLSMLCPFDPEDKQALLEAPSLSTRRETLVTLIEFALRGGSSEELLQ"
FT   gene            complement(37578..38489)
FT                   /gene="trxA2"
FT                   /locus_tag="Dshi_0035"
FT   CDS_pept        complement(37578..38489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA2"
FT                   /locus_tag="Dshi_0035"
FT                   /product="thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain KEGG: rsp:RSP_1489 protein
FT                   containing thioredoxin domain, swissprot hit to Thioredoxin
FT                   (TRX) from Pasteurella multocida"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91784"
FT                   /db_xref="GOA:A8LJV8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV8"
FT                   /protein_id="ABV91784.1"
FT                   /translation="MLEFGQTGGGAPAAGDLVKDTTEATFMADVVDASQEIPVIVDFWA
FT                   PWCGPCKTLGPALEAEVTAAKGKVRMVKVNVDEAQMIAGQMRIQSIPTVYAFHKGQPVD
FT                   GFQGAITPAEIKDFVSRVAALGGDDGLGEAVEAAEAMLTEGAAVDAAQTFAAILGEEPE
FT                   NAAAYGGLVRAHLAMDELDKAEALIAAAPDAVAKSPELDAARAQLELARQAAQAGPVAE
FT                   LRAKVTADPDDHQARFDLAQALYANGDTQAAVDELLDLFRRDRDWRDGAAKTQLFTIFD
FT                   ALKPEDPIALQGRRRLSSMIFA"
FT   gene            complement(38563..39351)
FT                   /gene="xthA"
FT                   /locus_tag="Dshi_0036"
FT   CDS_pept        complement(38563..39351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="Dshi_0036"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth PFAM:
FT                   Endonuclease/exonuclease/phosphatase KEGG: sit:TM1040_0053
FT                   exodeoxyribonuclease III, best swissprot hit to
FT                   Exodeoxyribonuclease III (Exonuclease III) from Escherichia
FT                   coli"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91785"
FT                   /db_xref="GOA:A8LJV9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJV9"
FT                   /protein_id="ABV91785.1"
FT                   /translation="MSITIATWNINSVRLRADLVARLLRDEAPDVLCLQECKSPVDKIP
FT                   LETFAARGYGHMVARGQKGYNGVAILSRLPLEDAGHRDFVGKGDARHVAARLENGLTIH
FT                   NYYVPAGGDVPDRDVNEKFGHKLDFLAEMRAWFTDTAPEKSVLVGDLNIAPREDDVWSH
FT                   KQLLKVVSHTPIEVDTFETTREAGNWVDVTRADIPEGQLYSWWSYRARDWSAADKGRRL
FT                   DHVWASADIAAAAHGSRILREVRGWDQPSDHAPVFASFDL"
FT   gene            39692..40216
FT                   /locus_tag="Dshi_0037"
FT   CDS_pept        39692..40216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0037"
FT                   /product="hypothetical protein"
FT                   /note="unsure, bad GC frame plot, no significant Ref hits;
FT                   some kind of LPxTG anchor domains detected by TIGRfam, but
FT                   unconvincing; some leucine repeats at C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91786"
FT                   /db_xref="InterPro:IPR022472"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW0"
FT                   /protein_id="ABV91786.1"
FT                   /translation="MRKLLLTSLVALCPAVASATTLAGDTVNLALPGFGAVDVVVGSGI
FT                   EFDLDGTTFDLNPNGTNNLLVVDGDVFGTVGNVSSLVISDMNFNDGSELTGFLVTQTNL
FT                   VNLQVSFTADSLTFTFDPNTDSPNGILLEGAYLTQLPGAGPTPVPLPATAPLLLLAAGG
FT                   LAVMRRRKARG"
FT   gene            complement(40432..41118)
FT                   /locus_tag="Dshi_0038"
FT   CDS_pept        complement(40432..41118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0038"
FT                   /product="two component transcriptional regulator"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein KEGG: jan:Jann_0417 two component
FT                   transcriptional regulator, winged helix family, Response
FT                   regulators consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain, best swissprot hit to
FT                   Transcriptional regulatory protein yycF from Bacillus
FT                   subtilis; winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91787"
FT                   /db_xref="GOA:A8LJW1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW1"
FT                   /protein_id="ABV91787.1"
FT                   /translation="MATLRKILLVDDDEDLREALSEQLVMTEDFDVFEAGSGAEAMEKT
FT                   KAGLYDLVILDVGLPDTDGRELCRLMRKQGVKCPVLMLTGHDSDADTILGLDAGANDYI
FT                   SKPFKLPVLLARIRAQLRQHEQSEDAVFTLGPYTFKPAMKLLETEDERKIRLTEKETNI
FT                   LKFLYRATEGVVARDVLLHEVWGYNAGVTTHTLETHIYRLRQKIEPDPSNARLLVTESG
FT                   GYRLVA"
FT   gene            41277..42347
FT                   /gene="ribA"
FT                   /locus_tag="Dshi_0039"
FT   CDS_pept        41277..42347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="Dshi_0039"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II KEGG: sil:SPO3427
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91788"
FT                   /db_xref="GOA:A8LJW2"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW2"
FT                   /protein_id="ABV91788.1"
FT                   /translation="MSLTPDPRELRARAWADLRMGVPVVLHSEGRAVLALAGETLKPAR
FT                   LSVVAGMAEAVLAITARRAETLRAVPYDGDIARIALPGNADAHWVRAVADPADDLRMPM
FT                   KGPFRVLRDGDAVLHRLALTLCKEARLLPAAVVAPVVPGFGPAEGLTVLDAADLRVPMV
FT                   MDEVVSARVPLSVSEAGRLHVFRPEDGSEEHYAVEIGTPPRDQPVLARLHSACFTGDLL
FT                   GSLKCDCGPQLRGALAQMGAEGAGVLLYLNQEGRGIGLANKMRAYALQDQGFDTVEANH
FT                   RLGFEDDERDFRIGAELLRRLGFSATRLMTNNPAKVAMMENCGIAVTERVPLKVGETPQ
FT                   NAGYLATKAAKSGHLL"
FT   gene            42375..42662
FT                   /locus_tag="Dshi_0040"
FT   CDS_pept        42375..42662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0040"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330 KEGG:
FT                   sit:TM1040_1707 protein of unknown function DUF1330, no
FT                   significant swissprot hit, best ref ZP hit to hypothetical
FT                   protein OM2255_07195 from alpha proteobacterium HTCC2255"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91789"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW3"
FT                   /protein_id="ABV91789.1"
FT                   /translation="MPKGYIVASIRSNDMETIGRFAAAAGPVIAEYGGRVLARDPQPEV
FT                   REGADTGIAVLVEFDDVATARRFYESAGYTAAKAIREAVAETDLRIVTGL"
FT   gene            42669..43163
FT                   /locus_tag="Dshi_0041"
FT   CDS_pept        42669..43163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_0044 hypothetical protein, no
FT                   significant swissprot hit, conserved domain found in
FT                   several roseobacter function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91790"
FT                   /db_xref="GOA:A8LJW4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW4"
FT                   /protein_id="ABV91790.1"
FT                   /translation="MGPRDLVLTPMGLRFGGRVLPCTIGRGGVTDRKREGDGATPRGVH
FT                   RLVGMLYRPDRMARPADWALPIRPRDGWSDDVRDPDYNLMVTRPHGFGHERLWRADPLY
FT                   DLVILTDWNWPSARKGAGSAIFIHQWRGPGRATEGCVALSRADLRWLAPRIRYETRLIV
FT                   V"
FT   gene            complement(43160..43816)
FT                   /locus_tag="Dshi_0042"
FT   CDS_pept        complement(43160..43816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0042"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein KEGG:
FT                   jan:Jann_0414 protein of unknown function UPF0001,
FT                   swissprot hit to UPF0001 protein yggS from E. coli O6
FT                   related to PLP dependent enzymes class III"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91791"
FT                   /db_xref="GOA:A8LJW5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW5"
FT                   /protein_id="ABV91791.1"
FT                   /translation="MGVSEITARIGAAARKAGRDPAEITLIAVSKVQPLDRVEAVLAEG
FT                   HRVYGENRVQEAQGKWPAFREKYSGIDLHLIGPLQSNKTRPAVELFDAIHTVDRAKLAR
FT                   RLADHAQERGQSPDIFVQVNTGDETQKAGCALSEVDALVTECRALDLPLKGLMCIPPID
FT                   EEPSLHFALLAKLAARNGLTGLSMGMSGDFESAIAQGATHIRVGSAIFGDRVKPA"
FT   gene            complement(43903..44862)
FT                   /locus_tag="Dshi_0043"
FT   CDS_pept        complement(43903..44862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0043"
FT                   /product="porin"
FT                   /note="swissprot hit to porin from Rhodobacter capsulatus
FT                   and high ref ZP hit to putative porin from D. shibae
FT                   DshiDRAFT_2133 which doesnt exist in the finished sequence
FT                   and to outer membrane porin, putative from Roseobacter sp.
FT                   CCS2, also conserved domain to porin, Gram-negative type
FT                   (interPro); Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91792"
FT                   /db_xref="GOA:A8LJW6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW6"
FT                   /protein_id="ABV91792.1"
FT                   /translation="MKKLLIASTALVATSGFAYADVTLGGSAQFGIIYIEDRADPVDPT
FT                   EDEELFLDYELQFDFSASGETDGGLGFGMSAELESDSDAEGNQLSDNNVDPEIFITSGF
FT                   GTLTVGALDTAPDQAGFGNTRDPGYDGVGVDNLIDAILFLDAGALFNADEGGKSNIMYQ
FT                   GSFGGLSLTATAHAHEQDFGIVAEYDFGAFRAGLSYMEVDEVEIDGDLGGGDTIGVTVG
FT                   GTFAGFDLDFVYADHSNDFDVDAEAYGLSGAYDLGAYGITFGVNQVEIGDVDGTTYGIG
FT                   VEYDLGGGAELQAGVASLWDPEDDDNFTTASFGIAMSF"
FT   gene            45163..45633
FT                   /locus_tag="Dshi_0044"
FT   CDS_pept        45163..45633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91793"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW7"
FT                   /protein_id="ABV91793.1"
FT                   /translation="MAQRFNRSAWLGLPVVFLTACGLGPSAPRDQLPTNIDDAPGTDST
FT                   IWDLFDARDDPNTTVEVNKYIWAAALDVLDFLPIETVDPFTGVIVTGFGTAPGSSRAYR
FT                   ATVYVQDPALDARSLRLALATRSGPADPDTVLAVEDAILTRARQLRLQDSRL"
FT   gene            complement(45640..46014)
FT                   /locus_tag="Dshi_0045"
FT   CDS_pept        complement(45640..46014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0045"
FT                   /product="hypothetical protein"
FT                   /note="bad BLAST hits to hypothetical proteins, no
FT                   significant swissprot hit, no domains detected by TIGRfam
FT                   (no UspA domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91794"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW8"
FT                   /protein_id="ABV91794.1"
FT                   /translation="MAVTYTADSQARVVELTVSGKITHAEFEEVVPKLEAELARGPLSL
FT                   VEVIDSFEGFDARTLWDGLKFDLAHWSEFRRVAVVSDLTWFSPFTRLADRLTHLQIREF
FT                   KRDQLEEARAWARNWTSLDD"
FT   gene            46315..46704
FT                   /locus_tag="Dshi_0046"
FT   CDS_pept        46315..46704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0046"
FT                   /product="hypothetical protein"
FT                   /note="no Interpro hits reported, unsure, bad GC frame
FT                   plot, bad ref ZP hits to hypothetical protein ROS217_08770
FT                   from Roseovarius sp. 217"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91795"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJW9"
FT                   /protein_id="ABV91795.1"
FT                   /translation="MTRRYFRPIQEDTIVSVLHFLRQEAVRDGCNTLPHIDALLEMRGV
FT                   NPSALTVPRKTPKAFKKGELRRLVLQALREGPKTGRQIADYVEAARSDLPKGAAYKRVY
FT                   VCLAQLRGHGMVKRKNGEWFAGECE"
FT   gene            complement(46984..47406)
FT                   /locus_tag="Dshi_0047"
FT   CDS_pept        complement(46984..47406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0047"
FT                   /product="hypothetical protein"
FT                   /note="no Interpro hits reported, unsure, bad GC frame
FT                   plot, bad ref XP hits to hypothetical protein MGG_12456
FT                   from Magnaporthe grisea 70-15 (Fungi)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91796"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX0"
FT                   /protein_id="ABV91796.1"
FT                   /translation="MKAQTIIEVYDEDLVELFASRRPELEVGTLPFEVRKYLGCSRDTI
FT                   FLSDQSARHIIQAHGDHITNTQLKLLPKILCEGLWLSDNRATHAVVSCNVYEVDYKTVI
FT                   KVTEDRTRTYVKTLHRTSDRQKRALLRKTNVLRNRW"
FT   gene            complement(47483..48445)
FT                   /locus_tag="Dshi_0048"
FT   CDS_pept        complement(47483..48445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0048"
FT                   /product="putative transposase"
FT                   /note="KEGG: rpc:RPC_0725 putative transposase, good ref ZP
FT                   hit to possible transposase from Roseovarius sp. 217,
FT                   InterPro:several Zinc finger domains (DNA binding?)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91797"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX1"
FT                   /protein_id="ABV91797.1"
FT                   /translation="MAQHFLLSAASRTLSLRSIYKAGEDAAYNVFCEMRWPETNGEAVC
FT                   PRCSHGETYSISTRRKFKCKNCHHQFSVTSGTIFASRKMDFVDLLAAICILVNASKGVS
FT                   MIQLSRDLDCQYKTAFVLAHKLREAMAQEVQTGEVLEGHVEIDGAYFGGHIRPENRKED
FT                   RKDRRLKENQTGKRRVVVALREREGRTLPFVTKLESEGVALANENVCRMATVSADEASH
FT                   WDMLHNGWDVQRVNHSQVYSDHGKHTNLVESFFSRLRRMVQGQHHHVSPQYLYQYANHA
FT                   AWLEDNRRKDNGALASALITNAMDAPVSRRWKGYWQRAA"
FT   gene            48547..48753
FT                   /locus_tag="Dshi_0049"
FT   CDS_pept        48547..48753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: har:HEAR2212 hypothetical protein, no InterPro
FT                   hit, no good swissprot hit, Ref ZP hit to hypothetical
FT                   protein ROS217_08790 fromRoseovarius sp. 217, next Ref ZP
FT                   hit to GMP synthase, PP-ATPase domain/subunit from
FT                   Magnetospirillum magnetotacticum MS-1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91798"
FT                   /db_xref="GOA:A8LJX2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX2"
FT                   /protein_id="ABV91798.1"
FT                   /translation="MADQTEWEAKAANLLKAELKRKGVTYAQLADMIGDKEANIRNKLS
FT                   RGKFSAAYMMQCLDAVGVSEVRL"
FT   gene            complement(48750..49232)
FT                   /locus_tag="Dshi_0050"
FT   CDS_pept        complement(48750..49232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0050"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955 KEGG:
FT                   mag:amb3753 predicted Zn peptidase, no significant
FT                   swissprot hit, good ref Yp hit to Predicted Zn peptidase
FT                   from Magnetospirillum magneticum AMB-1, DUF955 domain shows
FT                   similarity to Peptidase_M48"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91799"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX3"
FT                   /protein_id="ABV91799.1"
FT                   /translation="MTLTYPEQLEVIQKHQASAPVQTVALADDLGLKVWHVPNWPDDLS
FT                   GKIVKSADQGGPSGYAIYVNKGHHVNRRRFTTAHEIAHFILHRQFIGDGLVDDGLYRSR
FT                   LSNSMEAQANKLAADILMPRNLLNQHIANGVTSVARLAEIFQVSESAMSIRVGAPN"
FT   gene            complement(49229..49645)
FT                   /locus_tag="Dshi_0051"
FT   CDS_pept        complement(49229..49645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0051"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, short signal peptide and
FT                   two transmembrane regions, bad GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91800"
FT                   /db_xref="GOA:A8LJX4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX4"
FT                   /protein_id="ABV91800.1"
FT                   /translation="MRFVKRLLILFIAAVGAANLAFFVYWYSASEVTAIMPVSPNGYTI
FT                   EALALNVTILEMILVLVGFVFAALGLFGYTEIKSAAVRAAVKAAEREAKDTVSEQLKLL
FT                   DAVRGRSDTSAPEYGGDYRLGDQTTEGATPAKDE"
FT   gene            complement(49656..49868)
FT                   /locus_tag="Dshi_0052"
FT   CDS_pept        complement(49656..49868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0052"
FT                   /product="hypothetical protein"
FT                   /note="no hits reported for InterPro Scan, BLAST hits
FT                   similar to several hypothetical proteins in Roseobacter
FT                   strains, bad GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91801"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX5"
FT                   /protein_id="ABV91801.1"
FT                   /translation="MDQPDAPPLCPLCDRPIPPGAPQSLHHLVPKLRGGKGGPTVLLHQ
FT                   ICGLMYQAHQALSPRKSLLCLPSRG"
FT   gene            49943..51163
FT                   /locus_tag="Dshi_0053"
FT   CDS_pept        49943..51163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0053"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase KEGG: sil:SPO3436
FT                   hypothetical protein, best ref ZP hit to hypothetical
FT                   protein ISM_02290 from Roseovarius nubinhibens ISM: related
FT                   to COG2081 Predicted flavoproteins, HI0933 like domain:
FT                   This is a family of conserved hypothetical proteins that
FT                   may include proteins with a dinucleotide-binding motif
FT                   (Rossman fold), including oxidoreductases and
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91802"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX6"
FT                   /protein_id="ABV91802.1"
FT                   /translation="MTGIAPLPEIETDALVVGAGPAGLMAAEQLAQAGFSVRIAEQMPS
FT                   AGRKFLMAGKSGLNLTKDEEMPAFLGAYGGAAAWLAPMLEAFGPDAVQDWARGLGQPVF
FT                   TGSTGRVFPEAMKASPLLRAWLARLAGLGVRLDTRWRCLGWQDGALRFETPAGPVRVRA
FT                   RAVVLGLGGASWRRLGSDGAWAGWIGAACAPFAPANVGLRVDWSPHMARHFGAPVKGAA
FT                   LSSGGVVSRGEVVVSARGLEGGGLYPLCPALREGAGLRVDLCPDLEVGALAARLARVPA
FT                   KASGASRLRKGAGLSPVKQALVQECARPLSRDPADLARVLKDLGVPHQGVRPLDEAISV
FT                   AGGVARAALDDRLMLRDRPGVFACGEMLDWEAPTGGYLLTGCFATGRWAGLGAVDWLRG
FT                   AQAAARA"
FT   gene            complement(51142..51732)
FT                   /gene="gst2"
FT                   /locus_tag="Dshi_0054"
FT   CDS_pept        complement(51142..51732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst2"
FT                   /locus_tag="Dshi_0054"
FT                   /product="glutathione S-transferase like protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="PFAM: Glutathione S-transferase domain KEGG:
FT                   pde:Pden_2769 glutathione S-transferase, N-terminal domain
FT                   and C-terminal domain; Thioredoxin fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91803"
FT                   /db_xref="GOA:A8LJX7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX7"
FT                   /protein_id="ABV91803.1"
FT                   /translation="MPDYTLYGTPRSRAFRVLWMLHELELPFNHHPEPPQSAAVRAVHP
FT                   GGKIPVLVADGTPISDSSAILTYLVDRHGGLTHPAGTLDRARQDALHFRILDEIDALLW
FT                   TAARHSFVLPEAERVPAIKDSLKTEFTRNAARLADDLGAAPFLMGDTLSLPDIVLGHCL
FT                   GWAKLAKFPALPDPLDAYLARMRARPAYARAAA"
FT   gene            complement(51747..52772)
FT                   /gene="holA"
FT                   /locus_tag="Dshi_0055"
FT   CDS_pept        complement(51747..52772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="Dshi_0055"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sit:TM1040_0043 DNA polymerase III, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91804"
FT                   /db_xref="GOA:A8LJX8"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX8"
FT                   /protein_id="ABV91804.1"
FT                   /translation="MKLAPRDLPGFVARPEPGRAGILLYGADAMRVSLRRQALLKALVG
FT                   EKGDEEMRLTRLHGPDLRRDPAALMDAMKAISMYPGPRAVHVDAATDQAAPAITAALGD
FT                   WREGDAVLVVTAGSLGAKSALRKAFEGHRNAYAAGIYDDPPDRAEIEALLRSAGIAEVG
FT                   RDAMSDLTDLSRAVDPGDFAQIVEKLALYKHGDASPITPEDLAAVAPATTEAEIDALLH
FT                   AVAEAEVARIPPLVARLSGQGEGAVRLCIGAVMHFRRLYTAAIDPGGPAAGISRARPPV
FT                   FGPARNRMIRQAQSWGAPKLETALSILTETDLALRSSQKAPQMALMERALIRLAMLNAQ
FT                   R"
FT   gene            complement(52769..53263)
FT                   /locus_tag="Dshi_0056"
FT   CDS_pept        complement(52769..53263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3136 hypothetical protein, best
FT                   ref ZP hit to lipoprotein, putative from Sulfitobacter sp.
FT                   NAS-14.1, no significant InterPro Scan hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJX9"
FT                   /protein_id="ABV91805.1"
FT                   /translation="MSSFDRRTLLILLAAAPLAACGFTPVYAPGAEATRLRGAVRMPDP
FT                   ETPDEFDIVREIEARLGRPDTPLYELTITPRVTEDSLTLVGARDITRFNLIGTARYSLR
FT                   PIGSETDLLSGEVNSLTSYSATGTTVSTLSAERDARSRLMIILADLVVTRLLANADSLP
FT                   Q"
FT   gene            complement(53250..55859)
FT                   /gene="leuS"
FT                   /locus_tag="Dshi_0057"
FT   CDS_pept        complement(53250..55859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Dshi_0057"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase KEGG: sil:SPO3432
FT                   leucyl-tRNA synthetase; tRNA synthetases class I (I, L, M
FT                   and V)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91806"
FT                   /db_xref="GOA:A8LJY0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LJY0"
FT                   /protein_id="ABV91806.1"
FT                   /translation="MPADTPAGSAPARFDPAQIEPKWRAAWDLAGTFTATPDPAKQKYY
FT                   VLEMFPYPSGRIHMGHVRNYTMGDVIARYKASCGFSVLHPMGWDAFGMPAENAAMATGG
FT                   HPKDWTYANIAEMRAQMKPLGLSIDWSREFATCDEAYYGQQQSMFLDFLEKGLVYRKNA
FT                   VVNWDPVDMTVLANEQVIDGKGWRSGAEVERRELTQWFFKISDFADDLLSALDGLENWP
FT                   EKVRLMQANWIGKSRGLEFAFARTDGGDPIPVYTTRPDTLMGASFVGISPGHPIAKALA
FT                   AQRPEVADFLAEVARGGTTEAALETAPKLGFDTGITVRHPLDPNWELPVWIANFILMDY
FT                   GTGAIFACPAHDQRDLDFCRKYDLPVIDTFFALDDPTPVGDTAFVPPKTEPVRWVEHFA
FT                   GLDIATGQEAIEATIDFAEAAGWGRGVEQFRLRDWGLSRQRYWGCPIPVVHCDKCGVVP
FT                   ERKENLPIALPYDEDGRPIDFSIPGNPLDRHPSWRDCACPACGAPARRETDTMDTFVDS
FT                   SWYFARFTAPRAETPTDPAEVGYWMNVDQYIGGVEHAILHLLYSRFFARAMHLCGHLPE
FT                   SAREPFDALFTQGMVTHAIYKTTGTDGRPVYHYPEEVETTEEGAVLKKTGAPVDIVPSA
FT                   KMSKSKNNVVDPLAIIDAYGADTARWFVMSDSPPERDVEWTASGAEAAFKHLGRVWRLA
FT                   EDLRRNAEEAATAGSAEEARALARASARAIAEVTAGIEGFAFNKSVAKLYEFTNTIQKS
FT                   KAPRAEKRAALKTMAQLMSPMTPHLAEEVWSMLGGIGLVAEAPWPEADPALLVEDTVTL
FT                   PIQINGKRRSELAVPKDMPREEVEKLALADAAVLKALAGGAPRKLIVVPGRIVNVVI"
FT   gene            complement(55941..56645)
FT                   /gene="lolA"
FT                   /locus_tag="Dshi_0058"
FT   CDS_pept        complement(55941..56645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="Dshi_0058"
FT                   /product="outer membrane lipoprotein carrier protein"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA KEGG: rsq:Rsph17025_2901 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91807"
FT                   /db_xref="GOA:A8LJY1"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY1"
FT                   /protein_id="ABV91807.1"
FT                   /translation="MPRHLRTPPHGRNRAEVSRPLWHSSPAPLTSGCMNRRQFTALTLA
FT                   GLATPGLARAASLIPLPEIAAYLRGLDLVQARFTQRNADGSTSTGTLYLRRPGRARFEY
FT                   DPPAEVLVMVGGGTVAIFDAKGDPTPESYPLRRTPLNVILSREVDLEGSDAIFGHQLDG
FT                   DLTTVLAHDPAHPEYGRIALQFAADPVRLARWVIVGETGEQTVIELGPLTRPAQLSSNL
FT                   FNIPGETNRRRN"
FT   gene            complement(56686..59673)
FT                   /gene="ftsK"
FT                   /locus_tag="Dshi_0059"
FT   CDS_pept        complement(56686..59673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="Dshi_0059"
FT                   /product="DNA translocase"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE KEGG: rde:RD1_0033
FT                   cell division protein FtsK; very good swissprot hit to DNA
FT                   translocase ftsK from Agrobacterium tumefaciens str. C58"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91808"
FT                   /db_xref="GOA:A8LJY2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY2"
FT                   /protein_id="ABV91808.1"
FT                   /translation="MAYHPARQRDPLLDTSTQAALEKRGRELLGLGLLALAAMLGLALA
FT                   SYVPDDPGWMSTSQAPAENWMGRPGATVAAPLNIIIGHGAWALVAILAVWGGRFLLHRG
FT                   SERFVGRMIFAPIAVACAAVYAATLVPGSDWTHSFGLGGLFGDTVLGALLGVSPLGAAA
FT                   GLKLASLTLAVGMIALLLYVAGFVRSELARIGVFLLVGLVNVYEATLAGLGKASSRAVA
FT                   AGTAGWEARKTRAAEQAGAQDAYKAAAIAAVRRDPVVSGHAPARVLRAEPVLTENTPAN
FT                   ATEPQDPAALAAEFAPEVALPAKPSLLARVKARALARPSPTAEATADTPEGETQEPDRI
FT                   SAAITDAITRRRNRVTGRALILPKDAPAAEAALPPEPPLRRATIPPMAATLGKAPLAPE
FT                   EWSPEPQDPPASYMDTDVLDDLDAPFDDASDDDLPPPAPTPQVLDRTAPTFQRPRAPEP
FT                   KSVVQHPPRKATPPSRAAQDEAQPALQFDPAPAPDYEAPPLSLLTNPVSIERLHLSDEA
FT                   LEENARMLESVLDDYGVKGEIVSVRPGPVVTMYELEPAPGLKASRVIGLADDIARSMSA
FT                   LSARVSTVPGRSVIGIELPNAQREKVVLREILAGRDFGDSNLRLPLALGKDIGGEPVVA
FT                   NLAKMPHLLIAGTTGSGKSVAINTMILSLLYKLSPEECRLIMIDPKMLELSVYDGIPHL
FT                   LSPVVTDPKKAVVALKWVVAEMEERYRKMSKMGVRNIEGYNGRVKDALSKGEMFTRTVQ
FT                   TGFDDETGEPVFETEHSQPVALPYIVVIVDEMADLMMVAGKEIEACIQRLAQMARASGI
FT                   HLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGMGDMLYMAG
FT                   GSRITRVHGPFVSDEEVEEVVTHLKSFGPPEYMSGVVEGVDEDKEGDIDLVLGLGGNTD
FT                   GEDALYDQAVAVVIKDRKCSTSYIQRKLAIGYNKAARLVEQMEEEGLVSPANHVGKREI
FT                   LVPEQG"
FT   gene            complement(59687..60868)
FT                   /locus_tag="Dshi_0060"
FT   CDS_pept        complement(59687..60868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0060"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II KEGG:
FT                   sil:SPO3417 aminotransferase, classes I and II; swissprot
FT                   hit to Putative aminotransferase aatC from Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91809"
FT                   /db_xref="GOA:A8LJY3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY3"
FT                   /protein_id="ABV91809.1"
FT                   /translation="MDFPERFSALPEYAFPRLRALLDGHPPGGSTLAMSIGEPQHPFPQ
FT                   IATDALAEALPLFNKYPPNDGAPELCAAIADWVQGRYGVKLDPARQVLALNGTREGLFA
FT                   ACLALCPDTKAGGQPLVAMPNPFYQVYAVGAQAAGARPLFVNATAETGFLPNLTTLPPE
FT                   TLDRIAIAYVCSPSNPQGAVADAGYWRALIGLAEKHDFYVFADECYAEIYRETPPCGAL
FT                   EIATAMGADPERVVIFHSLSKRSNLPGLRSGFAAGGPRAMAEMKKLRAYAGAPLPGPLH
FT                   PVATAVWRDEAHVVENRALYAAKFDTADTILGAVPGYTSPAAGFFLWLPVEDGEAAALK
FT                   LWTETGVRVLPGAYLSRDTETGNPGAGFIRVALVADAPDVARGLTLIRDSLYS"
FT   gene            complement(60992..62323)
FT                   /locus_tag="Dshi_0061"
FT   CDS_pept        complement(60992..62323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0061"
FT                   /product="amidase"
FT                   /note="PFAM: Amidase KEGG: rsq:Rsph17025_2898 amidase;
FT                   COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
FT                   and related amidases; best swissprot hit to
FT                   Glutamyl-tRNA(Gln) amidotransferase subunit A from
FT                   Dehalococcoides ethenogenes 195 : function: Furnishes a
FT                   means for formation of correctly charged Gln-tRNA(Gln)
FT                   through the transamidation of misacylated Glu-tRNA(Gln) in
FT                   organisms which lack glutaminyl-tRNA synthetase. The
FT                   reaction takes place in the presence of glutamine and ATP
FT                   through an activated gamma-phospho-Glu-tRNA(Gln) (By
FT                   similarity)."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91810"
FT                   /db_xref="GOA:A8LJY4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY4"
FT                   /protein_id="ABV91810.1"
FT                   /translation="MDKSWLTASAAAQGRAIAEGTLDPVALTEAYLDKIASRAESPRIY
FT                   ARTTPDRALSEAMAAHDRARSQTRHGPLDGVPISWKDLFDTAGVATESGTALLKGRTPD
FT                   RDAEVLANATAAGLVCLGKTHLSELAFSGLGLNPITATPPNINDPGAVPGGSSSGAAAS
FT                   VAFGLAAAGIGSDTGGSVRIPSAWNDLVGLKTTSGLLSLEGAVPLASAFDTVGPLTRTV
FT                   EDAALLLGALGGTKAPDLRGATLTGTHLAVLRTGAFEDIRPEPEQAFAAAVARLAEAGA
FT                   QITELHAPEVDEALALSGVLFATEAYGIWKDVIEAAPEKMFPPILDRFRGGRDYDAPAY
FT                   VAGWRKLVELRAVWADRTRAFDGVLLPTAPTLPPNVDRLLSEKAYFVEENLLALRNTRI
FT                   GNLMGVCALNLPTGTPSCGLSIMGQPFGEAALLRLGAAAEAALT"
FT   gene            62385..63650
FT                   /gene="ubiH"
FT                   /locus_tag="Dshi_0062"
FT   CDS_pept        62385..63650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="Dshi_0062"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family PFAM: monooxygenase FAD-binding
FT                   KEGG: sil:SPO3419 ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; 2-polyprenyl-6-methoxyphenol
FT                   hydroxylase and related FAD-dependent oxidoreductases
FT                   COG0654; best swissprot hit to 2-octaprenyl-6-methoxyphenol
FT                   hydroxylase from Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91811"
FT                   /db_xref="GOA:A8LJY5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY5"
FT                   /protein_id="ABV91811.1"
FT                   /translation="MDNALTQGISKSMADFDSDILIVGGGLNGPTLALALAQAGLRSTV
FT                   IDAHSVDRRADPAFDGRSYALALASQRMLAALGLWDGLEERAQPMLRIKVSDGRPGEGA
FT                   APWWMQFDHAEIEEGPMGFMVEDRYLRRALLAAMEECAEIAHLSETIVIGQQVDADGVI
FT                   VTLADGTSRRGRLLVGCDGRASGTARRAGIGRTGWGYDQTALVCAVSHELPHEGTAHQF
FT                   FMPGGPLAILPLPGNRSSIVWSERTAQAERFAALDDAAFLEALRPRFGDFLGEIALVGA
FT                   RFTYPLSLTLANAMVADRLALVGDAAHGVHPIAGQGLNLGFRDVGALAEVLADAARRGE
FT                   DIAARDVLDRYARWRRFDTATLAVATDAVNRLFSNDNPLLRLGRDLGMGLVNALPGARR
FT                   TFIREAAGLTGDVPRLLQGRPV"
FT   gene            complement(63773..64567)
FT                   /gene="suhB2"
FT                   /locus_tag="Dshi_0063"
FT   CDS_pept        complement(63773..64567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB2"
FT                   /locus_tag="Dshi_0063"
FT                   /product="inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase KEGG: sil:SPO3443
FT                   inositol monophosphatase family protein; COG0483 Archaeal
FT                   fructose-1,6-bisphosphatase and related enzymes of inositol
FT                   monophosphatase family; best BLAST hits to inositol
FT                   monophosphatase family protein from Oceanicola batsensis
FT                   HTCC2597 (refZP) and Inositol-1-monophosphatase (IMPase)
FT                   from Sinorhizobium meliloti (Rhizobium meliloti)
FT                   (swissprot)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91812"
FT                   /db_xref="GOA:A8LJY6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY6"
FT                   /protein_id="ABV91812.1"
FT                   /translation="MPAPDLALLIDAAQAAGRIAEKHWRQDPEAWDKAGGAGPVTEADL
FT                   EVDRMLRTELLAARPDYGWLSEETEDTPDRLDRERVFVVDPIDGTRSFMAGQRTFAHAL
FT                   AVVENGIPVAGVVYLPLRDKLYTAARGAGAALNGTVLRISTRSEVAGATVLAARPNLEG
FT                   HHWGGTPPALDRHFRSSLAYRLALTGEGRFDAMLTLRNSWEWDIAAGCLIVEEAGGQTT
FT                   DRHGAGLRFNNPSAQTKGVVAANPRLHAELSAKLTSMSERSS"
FT   gene            complement(64554..65900)
FT                   /gene="pmbA"
FT                   /locus_tag="Dshi_0064"
FT   CDS_pept        complement(64554..65900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="Dshi_0064"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase KEGG:
FT                   sit:TM1040_2639 peptidase U62, modulator of DNA gyrase;
FT                   COG0312 Predicted Zn-dependent proteases and their
FT                   inactivated homologs; good swissprot hit to Protein pmbA
FT                   (Protein tldE) from Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91813"
FT                   /db_xref="GOA:A8LJY7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY7"
FT                   /protein_id="ABV91813.1"
FT                   /translation="MPQDLSALTDALLSAAKAAGAEAADAMAVKGTSVSIDVRAGALEQ
FT                   AERSEGIDLGLRVLLGQKQALVSASDTSGDTIREMAERAVAMAAEAPDDPYIGLADPDA
FT                   LATSWDIDALELQDPSPEPDPAALEDDARRAEAAALALPGISQVQSASAGYGRRAVHLA
FT                   TSDGFSGGYARTDRGLSAVAITGTGTGMERDYAGESRIFQADLPSPEEVGKRAAERTLA
FT                   RAGARKPPTGAFPVLYDERISSALIGHLLAAISGSAIARGSSWLRDALGTQVLPAGLSL
FT                   VEDPHRPRATGSRPFDAEGLPTARRLIVDNGVLQGWTLDLATGRKLGLPSTANAARGTS
FT                   SPPSPSVTNVALTQGDKPAEALARDMGTGLWVTSMIGASINPTTGDYSRGASGFWVEKG
FT                   EIAYPVNECTIAGNLRDMLKTLVPGNDARPHLSRVIPSLLVEGLTIAGA"
FT   gene            complement(65978..67468)
FT                   /locus_tag="Dshi_0065"
FT   CDS_pept        complement(65978..67468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO3441 hypothetical protein, no swissprot
FT                   hit, ref hits to several hypothetical proteins in
FT                   roseobacter strains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91814"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY8"
FT                   /protein_id="ABV91814.1"
FT                   /translation="MRFPLLRRAGFSALSLLVLGLPAPALALTAAQVWEEMQQISERGG
FT                   LRQRAAVATPGAGTLTLEGVTLISEEDAPRVTTLIDRLTLRELDTGGVEIVYPPQLRIL
FT                   LEDDSGVGIDRAELLLETTDLVTLASGAPGDMSFDTTTPAAVLRLSAFEDDGTAEVSEF
FT                   TWTFTDLALSSAYGAEIADSAFSVAQMSGAVALSAPEDDSALRLQIALTDYAFSDRGSA
FT                   LLMSPTADTAALLTGQTPYSFESRHARLSLAVGGQIDGVAGGAALSTTGGGSAVSFADG
FT                   QVSVASRAQGLDIQALVPSLASPLDAAAANMALQITLPATPTEDVRPIGLGLKLQELTV
FT                   DEEVWAMFDPVGLLPRSPATLEVDLTGEGRASDDLLDPRAGARTMLDLDSLSINRLVLD
FT                   AAGARITAEGGFDVDLSRGGTMPGLPALSGRIGMTSRGLNGLLDNLAELGLLRPSDVMG
FT                   ARMVIAMLTTPSNDPDTLSAEIELKPDGGLVANGMRLR"
FT   gene            67584..68342
FT                   /locus_tag="Dshi_0066"
FT   CDS_pept        67584..68342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0066"
FT                   /product="dehydrogenase/reductase"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein KEGG: sil:SPO3440 20-beta-hydroxysteroid
FT                   dehydrogenase, putative, BLAST hits to several
FT                   dehydrogenase proteins: swissprot hit to Uncharacterized
FT                   oxidoreductase SSP1627 from Staphylococcus saprophyticus
FT                   subsp. saprophyticus ATCC 15305 (Belongs to the short-chain
FT                   dehydrogenases/reductases (SDR) family and ref hits to
FT                   20-beta-hydroxysteroid dehydrogenase, putative from
FT                   Silicibacter pomeroyi DSS-3"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91815"
FT                   /db_xref="GOA:A8LJY9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJY9"
FT                   /protein_id="ABV91815.1"
FT                   /translation="MSQVSGKSVLITGASTGIGEAAARAFAAAGAHVTLLARNGEACTR
FT                   IAKEIGGGALAIPGDVSDPATLPAAVSQVCATYGKLDILINNAGVITPIAPLETVDATA
FT                   WSALIDINLKGVFYGMRAALPVMKARGAGTIITISSGAAHNPLEGWSAYCASKAGAAML
FT                   TRCAHHEAGGSGLRIMGLSPGTVATEMQSVIKGSGVNPVSQLDWSVHIPADWPARALVW
FT                   MCGPEADAYIGTEISLRDEDLRQKIGLTSP"
FT   gene            68339..69085
FT                   /gene="caiD"
FT                   /locus_tag="Dshi_0067"
FT   CDS_pept        68339..69085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="Dshi_0067"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase KEGG:
FT                   rsh:Rsph17029_2572 enoyl-CoA hydratase/isomerase; COG1024
FT                   Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91816"
FT                   /db_xref="GOA:A8LJZ0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ0"
FT                   /protein_id="ABV91816.1"
FT                   /translation="MIETTHGDGQCVITLNRPDKANALTAPMLEALERALIEAEAAGLR
FT                   VVVLTGAGKVFSAGADLEAARNGGLTTHPVWERVSSRIAGYPGLTVAALNGTCAGGALG
FT                   MMLACDLRVAVPTAKVFYPVLKNGFLPQPSDPPRLAALCGVSRAKMILLGGAKVAAETA
FT                   LSWGLFDRIAAPEELMEAVDGFTVDAKGASPGLLAQIKALCHGDQPGRDRPGPSPAPAM
FT                   QRHPQPLGTEAVFTASAPSAEQDTGR"
FT   gene            complement(69090..69674)
FT                   /locus_tag="Dshi_0068"
FT   CDS_pept        complement(69090..69674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0068"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sil:SPO3414 lipoprotein, putative; Lytic
FT                   Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL)
FT                   domain. LTs catalyze the cleavage of the
FT                   beta-1,4-glycosidic bond between N-acetylmuramic acid
FT                   (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do
FT                   goose-type lysozymes. However, in addition to this, they
FT                   also make a new glycosidic bond with the C6 hydroxyl group
FT                   of the same muramic acid residue."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91817"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ1"
FT                   /protein_id="ABV91817.1"
FT                   /translation="MSSKLRLSMVFLLLAACGGSGSNPPSRLDDACAIVAQRPAYLKAM
FT                   ERTERKWDVPVPVQMATIYQESRFKSDARTPYRFALGVIPMGRVSSAYGYSQALDGTWD
FT                   EYLAEEGRWRAKRNNIRDATDFMGWYMTKTEQRNGIPKTDARRQYLAYHEGHTGYARGS
FT                   YNQKAWLMRVANNVAARAAMYDRQLKSCNKR"
FT   gene            complement(69751..70632)
FT                   /locus_tag="Dshi_0069"
FT   CDS_pept        complement(69751..70632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0069"
FT                   /product="auxin efflux carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; COG0679 Predicted
FT                   permeases, good Ref ZP hit to auxin efflux carrier family
FT                   protein fromSulfitobacter sp. EE-36, swissprot hit to
FT                   Uncharacterized transporter MTH_1382 from
FT                   Methanothermobacter thermautotrophicus str. Delta H"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91818"
FT                   /db_xref="GOA:A8LJZ2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ2"
FT                   /protein_id="ABV91818.1"
FT                   /translation="MNLLLTVLNIVAPVFLLAGLGFGWVRLGWDYPLEFVTRMGMTLAV
FT                   PCLIFTALMQTEIDPAALSTVSLATLSAYIAITVVFSIYIRAVGDRQRDYLAPLTFGNT
FT                   GNLGLPLALFAFGETGLSYGVVVFAAMAIYSFTFGTWVVAGGGSLRKVIQEPMVAATLL
FT                   GALFLWQGWQTPVFLTNALELIGQLAIPLMLITLGVAIAGLRPGRIGKALWLSVFKLVV
FT                   CVGISWTIGRAFALEPVAFGVLVLQVSTPVAVTSYLMAQKYRADADAVAGLVVVSTLVS
FT                   VVALPLLLAFVI"
FT   gene            70719..71045
FT                   /gene="yccV"
FT                   /locus_tag="Dshi_0070"
FT   CDS_pept        70719..71045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccV"
FT                   /locus_tag="Dshi_0070"
FT                   /product="hemimethylated DNA binding protein"
FT                   /note="TIGRFAM: hemimethylated DNA binding protein PFAM:
FT                   Hemimethylated DNA-binding region KEGG: sil:SPO3412
FT                   hypothetical protein, no swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91819"
FT                   /db_xref="GOA:A8LJZ3"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ3"
FT                   /protein_id="ABV91819.1"
FT                   /translation="MLKAQAKYNLGQVVRHRKHPFRGVVFDIDPEFSNTEEWYDAIPED
FT                   SRPRKDQPFYHLLAENDQSYYVAYVSEQNLVVDAAGGPVDHPDVPDLFGDFDGRQYPLH
FT                   FQMN"
FT   gene            complement(71093..72676)
FT                   /gene="ggt1"
FT                   /locus_tag="Dshi_0071"
FT   CDS_pept        complement(71093..72676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt1"
FT                   /locus_tag="Dshi_0071"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase KEGG:
FT                   sit:TM1040_0064 gamma-glutamyltransferase, good swissprot
FT                   hit to Gamma-glutamyltranspeptidase precursor from Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91820"
FT                   /db_xref="GOA:A8LJZ4"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ4"
FT                   /protein_id="ABV91820.1"
FT                   /translation="MRDFHLPGRSAVFASNAMCATSHPLAAKVALDILRDGGNALDAAI
FT                   AGAVLLGLCEPQMTGIGGDCFALIKPAGSEDVLGLNGSGKAPAALDPAALRAAGHTTMP
FT                   PAAAASVTVPGAVDAFCHMSERWGRAGLDAILAPAIHYAEQGIPVAPRVAFDWATDSAR
FT                   LNGTARDHYLIAGKPPVAGAMFRAPRQAEVLRKIAREGRDGFYTGAVAEDMVASLRAAG
FT                   GTHTRDDFAATACMDATPIRGDYKGSELVELPPNSHGATAILMANILARFDLPALDPFG
FT                   AARAHLEAEAAKLAYDARNRFVADPDHTTRLDHMLRPETADALAALIDPKRAMADPAAL
FT                   SEHVHRETIFITVVDADRMAVSLIYSIFDGFGSGIASDRYGILFHNRGAGFNLTPGHPN
FT                   EAGGGKRPMHTIIPAMLRRNDRLVMPFGVMGGPYQANGHARVLTNLVDYGLHPQANLDA
FT                   PRSFHDPRYGLQVERGYSDAVRAELSAMGHEVIVPDTPIGGAQAIWIDPETGVLQGASD
FT                   PRKDGCALGY"
FT   gene            complement(72738..73247)
FT                   /gene="rsbW"
FT                   /locus_tag="Dshi_0072"
FT   CDS_pept        complement(72738..73247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="Dshi_0072"
FT                   /product="serine-protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: rde:RD1_0027 serine-protein kinase, putative;
FT                   COG2172 Anti-sigma regulatory factor (Ser/Thr protein
FT                   kinase); ATP-binding region is related to ATPase domains of
FT                   histidine kinase; Anti-sigma-B factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91821"
FT                   /db_xref="GOA:A8LJZ5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ5"
FT                   /protein_id="ABV91821.1"
FT                   /translation="MACKTRCAARPDTAQPSATRRSLWVKEFEKTYEFPSRYAQVRETL
FT                   AELLAALRDAGVESEDAGIVEVVLAEAMNNVVEHAYRESPDEVVRLRCALEETGLRVVL
FT                   HDSGVAMPGLNLPEGRCPTSDTPLQDLPEGGFGWHLIHTLTEELIYTRAAERNETRFII
FT                   PFAAGG"
FT   gene            complement(73262..73594)
FT                   /locus_tag="Dshi_0073"
FT   CDS_pept        complement(73262..73594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0073"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS KEGG:
FT                   rsq:Rsph17025_2906 anti-sigma-factor antagonist, SpoIIAA
FT                   domain: The establishment of differential gene expression
FT                   in sporulating Bacillus subtilis involves four protein
FT                   components one of which is SpoIIAA (). The four components
FT                   regulate the sporulation sigma factor F. Early in
FT                   sporulation, SpoIIAA is in the phosphorylated state
FT                   (SpoIIAA-P), as a result"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91822"
FT                   /db_xref="GOA:A8LJZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ6"
FT                   /protein_id="ABV91822.1"
FT                   /translation="MQVTTTAHGNTIVAVVHEDRIDASSAVQFKDTMQAIGRTAHGRVI
FT                   LDLAQVQFLDSSGLGAVVAVMKAYAPGKRLELAGLNPVVQKVFRLTRMDKVFKVYESSA
FT                   QALEAA"
FT   gene            73694..74872
FT                   /gene="thlA"
FT                   /locus_tag="Dshi_0074"
FT   CDS_pept        73694..74872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thlA"
FT                   /locus_tag="Dshi_0074"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: jan:Jann_4050 acetyl-CoA C-acetyltransferase
FT                   TIGRFAM: acetyl-CoA acetyltransferase PFAM: Thiolase; good
FT                   swissprot hit to Acetyl-CoA acetyltransferase
FT                   (Acetoacetyl-CoA thiolase) from Clostridium acetobutylicum;
FT                   found domain accords to thiolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91823"
FT                   /db_xref="GOA:A8LJZ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ7"
FT                   /protein_id="ABV91823.1"
FT                   /translation="MRTVAICGAARTPMGGFQGVFSDVSAAQLGGAAIAGALADAGVAP
FT                   AQVNELLMGCVLPAGQGQAPARQAGYAAGLGDAVPATTLNKMCGSGMKAAMIACDQIAL
FT                   GQSDLVVAGGMESMTNAPYLLDKMRGGARIGHGQVIDHMFLDGLEDAYDKGRLMGTFAE
FT                   DCAEAFQFTRAAQDTYALGSLENALAAEASEAFAMELVPVTVSGRKGETVVIRDEQPAA
FT                   ARPEKIPHLKPAFRKDGTVTAANSSSISDGAAALVLADAGQAEAHGLPVRARVLGHASH
FT                   AQKPALFPTAPVPAARKLLDRLGWCVADVDLWEVNEAFAVVPMAFMHEMGVPREKMNVN
FT                   GGACALGHPIGASGARILVTLLNAMEARDLKRGVAAICIGGGEGTAIALERD"
FT   gene            complement(75136..75378)
FT                   /locus_tag="Dshi_0075"
FT   CDS_pept        complement(75136..75378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_0777 hypothetical protein; bad BLAST
FT                   hits, no swissprot: Calcium-binding EF-hand domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91824"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ8"
FT                   /protein_id="ABV91824.1"
FT                   /translation="MSRVAVCAMVAALCAAPAIASVSELDTDGDNLASYEEMTPIYPDL
FT                   TEDLFGEIDTSGDGFVDDAELTAALDAEKLTPAAE"
FT   gene            75771..76007
FT                   /locus_tag="Dshi_0076"
FT   CDS_pept        75771..76007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3561 IstB domain protein
FT                   ATP-binding protein; no IPR domain, best Blast hit to
FT                   Integrase, catalytic region from Rhodobacter sphaeroides
FT                   ATCC 17025; bad GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91825"
FT                   /db_xref="UniProtKB/TrEMBL:A8LJZ9"
FT                   /protein_id="ABV91825.1"
FT                   /translation="MPHTILFDNMKTVLIDRNAYGPGQHRFHAGFREFAKHHGFSPRMC
FT                   APYPAIPLSPRVCPVCIAEDRSRGDGQEYLRTQ"
FT   gene            76020..76910
FT                   /locus_tag="Dshi_0077"
FT   CDS_pept        76020..76910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0077"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot, IPR
FT                   found small domain of intermediate filament from
FT                   eukaryotes, integrated by Dshi_0076 possible integrase?"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91826"
FT                   /db_xref="UniProtKB/TrEMBL:A8LK00"
FT                   /protein_id="ABV91826.1"
FT                   /translation="MGACPEHAVLLEPLPRPPGYRGAKDLHLCLGLWPDRHLPDPRPVA
FT                   SHELDLAVQTFLADGTDRVGGWSLAEALATAPLLGCFVEIGPVKLKELGEADLQRCTET
FT                   GFSLLRDGPGALKDAVGWRIRKRLAEGARSPEDVLGCLNGTLRHFRDVPAYRPLLDAVH
FT                   GAATRHMQRHWAYSFLNRVIPAFDHATVETLSQSHGVSRGSVRFALAADKVPTVGHVSA
FT                   FGKTYRVYDRSAAERAIARVQDTVSFDEARQLLGMRRFTFEKVWPARVLGRASSWPQRK
FT                   SRPWRHEVVALRDAF"
FT   gene            76953..77537
FT                   /locus_tag="Dshi_0078"
FT   CDS_pept        76953..77537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0078"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot, no
FT                   InterPro Scan hits detected, but good RBS binding site
FT                   AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91827"
FT                   /db_xref="UniProtKB/TrEMBL:A8LK01"
FT                   /protein_id="ABV91827.1"
FT                   /translation="MSLSAFARTSRQGPAATARLLLDGALAPAVRCPDDHGWEAIRVLE
FT                   TQINRHRKPLARSLRHADGQLTTEALAASYGLRYVTITRLVELTLLPPADRHKVDGRRM
FT                   EGYPVAAVEQLFAHHRTLSDLAAAHGCSPHLMAPLLARLGVRPLIAEKGHTRLYAIADL
FT                   PPAIRLAEEVAKAQARTARFKTPQKGALSQE"
FT   gene            complement(77867..77943)
FT                   /locus_tag="Dshi_6001"
FT   tRNA            complement(77867..77943)
FT                   /locus_tag="Dshi_6001"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCG"
FT   gene            78091..78972
FT                   /locus_tag="Dshi_0079"
FT   CDS_pept        78091..78972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0079"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase KEGG:
FT                   sil:SPO1058 acyltransferase, HtrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91828"
FT                   /db_xref="GOA:A8LK02"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A8LK02"
FT                   /protein_id="ABV91828.1"
FT                   /translation="MTRRARLSYLISFAPIYVFLKLARLVPFRRRVALGGALAGLALRH
FT                   FPPARKRVMANLARIYPDMAPEAARARCRAIGRQLGRTLTEILFGTEHQTKHLPFTVSG
FT                   PGLEAIRAAHAAGKPILLVSAHFGQWDAARIYLRDTLGIEVGALYRPNNNPYYEPYLAE
FT                   GAAASGTPLVPKGNDGFRMLLRHLKGGGAFAIMADQYHFTGAVLPFMGADARTALTPAE
FT                   LALRYKAPLVPCFGIRRDAEGRIDVVFEAPIEGETPEEMMRAFNDRATARIEADPDQWL
FT                   WPHRRWKGMEGG"
FT   gene            complement(78969..79955)
FT                   /locus_tag="Dshi_0080"
FT   CDS_pept        complement(78969..79955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0080"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6 transmembrane
FT                   KEGG: jan:Jann_0131 protein of unknown function DUF6,
FT                   transmembrane; good hits to putative transporter, RhaT
FT                   family, DMT superfamily from Loktanella vestfoldensis
FT                   SKA53; also middle-rate swissprot hit to
FT                   S-adenosylmethionine uptake transporter from Rickettsia
FT                   typhi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91829"
FT                   /db_xref="GOA:A8LK03"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8LK03"
FT                   /protein_id="ABV91829.1"
FT                   /translation="MTLSSNLKGALLGLAAFAVFAVHDVVVKTLGGSYTPFQIVFFGVL
FT                   FSFPLTTVMMMREKAHGNLRPRHPWWIALRTGAAVITGLTAFYAFTVLPLAQVYAILFA
FT                   SPLLITVLSIPILGETVRLRRWLAVIVGLIGVVVVLRPGAVDLTLGHVAALTAAVGGAL
FT                   ASVVVRKVGREERSVVLLLYPMVANFVLMACLMPFFYRPMPVGDLAAVGLMAALGFGAS
FT                   LLLIAAYRAGEAAIIAPMQYSQILWASLFGFVLFGEGIDLNTALGAAIVIASGLYIVAR
FT                   ESRSSVSDNMPVLRTRSRPETGTMPRVGPLLPDTAKPDLPGDKPDAD"
FT   gene            complement(80080..81186)
FT                   /gene="imdh"
FT                   /locus_tag="Dshi_0081"
FT   CDS_pept        complement(80080..81186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imdh"
FT                   /locus_tag="Dshi_0081"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: sil:SPO0210 3-isopropylmalate dehydrogenase
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase, high swissprot
FT                   hit to 3-isopropylmalate dehydrogenase (Beta-IPM
FT                   dehydrogenase) (IMDH) from Silicibacter pomeroyi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91830"
FT                   /db_xref="GOA:A8LKI7"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKI7"
FT                   /protein_id="ABV91830.1"
FT                   /translation="MSTASLLILAGDGIGPEVMAEVRKIIDWYGAKRDLAFDVSEDLVG
FT                   GAAYDVHGVPLADETMAKAQAVDAVLLGAVGGPKYDTLDFSLKPERGLLRLRKEMDLFA
FT                   NLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIHKEGNERVGINTQR
FT                   YTESEIARVARSAFELAKKRGNKVCSMEKANVMESGILWRDVVTEIHAAEYADVELSHM
FT                   YADAGAMQLVRAPKQFDVIVTDNLFGDLLSDAAAMLTGSLGMLPSASLGLPMENGRPKA
FT                   LYEPVHGSAPDIAGQGKANPCACILSFAMALRYSFDQGAEADRLEAAVNQVLAQGIRTA
FT                   DLMQAGDTAPASTSQMGDAVIAALDASL"
FT   gene            complement(81262..82386)
FT                   /locus_tag="Dshi_0082"
FT   CDS_pept        complement(81262..82386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_0227 hypothetical protein, small
FT                   signalpeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91831"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKI8"
FT                   /protein_id="ABV91831.1"
FT                   /translation="MRLARLFRFCLVLALLVGPLRLTAETVRVAYFHTELSARGPGLLL
FT                   RDLRRDEAPDQLAAVLDILVETAPDIVLLADIDYDAGQATLAALQTALAQRGLPLPHGF
FT                   TAAPNTGVPTGLDLDRDGKWDEPEDTQAFGEFRGAGGLVLLSRYPILRDEITDLSGLLW
FT                   AEFPAASLPETYGPEEQAVIRLSATGHWDVPVRLPSGDVLRLLTLHATPPVFDGPEDRN
FT                   GRRNADQMRLWADYLNGWRPEGTAPPLGKAVVLGTLNADPQDGEARPGALARLRAHPRL
FT                   QDPAPQATGAAAATRAQGGVNARHGGDPAHDTVDWPDTRPTDPGNLRVDYILPTRDLTV
FT                   TGAGLHWPDPEDAAALARTETASRHRLIWVDLRP"
FT   gene            complement(82492..83097)
FT                   /gene="ipmi2"
FT                   /locus_tag="Dshi_0083"
FT   CDS_pept        complement(82492..83097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipmi2"
FT                   /locus_tag="Dshi_0083"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit PFAM: aconitate hydratase domain protein KEGG:
FT                   jan:Jann_0123 3-isopropylmalate dehydratase, small subunit;
FT                   high swissprot hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91832"
FT                   /db_xref="GOA:A8LKI9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKI9"
FT                   /protein_id="ABV91832.1"
FT                   /translation="MEKFTKLTGIAAPMPLVNIDTDMIIPKQFLKTIKRSGLGVNLFDE
FT                   MRYDRQGNENPDFVLNKPQYRDAQILVTGENFGCGSSREHAPWALLDFGIRCVIAPSFA
FT                   DIFYNNCFKNGILPIALPQEEVDKLMDDAARGANATVTVDLENQTISGPDGGTISFEVD
FT                   AFKKHCLLNGLDDIGLSLEKVASIDAFEAQASAARPWV"
FT   gene            complement(83135..83662)
FT                   /locus_tag="Dshi_0084"
FT   CDS_pept        complement(83135..83662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr2987 hypothetical protein,
FT                   uncharacterized conserved protein function unknown,
FT                   transmembrane regions, signalpeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91833"
FT                   /db_xref="GOA:A8LKJ0"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ0"
FT                   /protein_id="ABV91833.1"
FT                   /translation="MKWALLGLLSLVCGVIVLGNTVLASIAVTGLTGALFLIAGGAQIV
FT                   GGLGEEGFGSKAFSIGMGVLAAFLGLSFLFNPLQGAISLALLITILLAVSGGARIVFAW
FT                   TMKQTQFFWPMLISGALSILLAAYIMANFATASVQLLGVLLGVELLFNGMGFVVLGFFL
FT                   RSHPELAKPKKD"
FT   gene            complement(83697..85100)
FT                   /gene="ipmi1"
FT                   /locus_tag="Dshi_0085"
FT   CDS_pept        complement(83697..85100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipmi1"
FT                   /locus_tag="Dshi_0085"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: rde:RD1_0616 3-isopropylmalate dehydratase,
FT                   large subunit TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit PFAM: aconitate hydratase domain protein; Dshi_0083
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91834"
FT                   /db_xref="GOA:A8LKJ1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKJ1"
FT                   /protein_id="ABV91834.1"
FT                   /translation="MTARTLYDKIWDAHLAHEAEDGTCLLYIDRHLVHEVTSPQAFEGL
FT                   RMAGRTVRAPDKTIAVPDHNVPTTLGRENPDQMTEDSRIQVEALDKNAKDFGIHYYPVS
FT                   DIRQGIVHIVGPEQGWTLPGMTVVCGDSHTATHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKSKNMKVEITGKLRPGVTAKDITLSVIGATGTAGGTGYVIEYCGEAIRDLSMEGRMTV
FT                   CNMAIEGGARAGLIAPDEKTYEYVQGRPHAPKGAQWEAALAWWKTLYSDDDAHWDKVVT
FT                   IKGEDIAPVVTWGTSPEDVLPISAMVPAPEDFTGGKVDAARRSLDYMGLTPGTPLSEIE
FT                   IDTVFIGSCTNGRIEDLRAAAEILKGKKIAVKRAMVVPGSGLVRAQAEEEGLADIFKQA
FT                   GFEWRMAGCSMCLAMNPDQLSEGERCASTSNRNFEGRQGYKGRTHLVSPAMAAAAAVTG
FT                   KLTDVRDLM"
FT   gene            85412..86014
FT                   /locus_tag="Dshi_0086"
FT   CDS_pept        85412..86014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0086"
FT                   /product="SOUL heme-binding protein"
FT                   /note="PFAM: SOUL heme-binding protein KEGG: bra:BRADO5496
FT                   putative heme-binding protein, SOUL family, swissprot hit
FT                   to Heme-binding-like protein At3g10130 chloroplast
FT                   precursor from Arabidopsis thaliana"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91835"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ2"
FT                   /protein_id="ABV91835.1"
FT                   /translation="MIRTTHIALMLGMMVAAVSVGAEAQLYRGYETPSYEVTVKKGDFE
FT                   RRSYAPQVVAEVYVQGDREEAVSRGFRVLADYIFGGNVDEAKVAMTTPVSQQAADDDDA
FT                   GLWVVRFGMPRGYTLENLPKPQSAAIRLTETPAEDQLVVQFTGRWSEAQLTQKELELRA
FT                   FAAAHGLDASGAPRFYFYDGPFTLPWTRRNEVALVLN"
FT   gene            86213..86545
FT                   /locus_tag="Dshi_0087"
FT   CDS_pept        86213..86545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0087"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein PFAM: Iojap-related
FT                   protein KEGG: sit:TM1040_2506 iojap-related protein; good
FT                   ref ZP hit to iojap-related protein from Rhodobacterales
FT                   bacterium HTCC2654"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91836"
FT                   /db_xref="GOA:A8LKJ3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ3"
FT                   /protein_id="ABV91836.1"
FT                   /translation="MSDRILALTLTSLDQDKAEDVVSINLRGKSSMADHMVVCSGRSTR
FT                   QVAAISEKLVERLKAELGVACKVEGKGQGDWVLIDTGDVVVHVFRPEVREFYQLEKMWM
FT                   TPAAQA"
FT   gene            86564..87034
FT                   /locus_tag="Dshi_0088"
FT   CDS_pept        86564..87034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0088"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163 KEGG:
FT                   sit:TM1040_2505 protein of unknown function DUF163; good
FT                   swissprot hit to UPF0247 protein TM1040_2505 from
FT                   Silicibacter sp. TM1040 (function uncharacterized)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91837"
FT                   /db_xref="GOA:A8LKJ4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKJ4"
FT                   /protein_id="ABV91837.1"
FT                   /translation="MKVTLCVVGRLRAGPERDLINDYLQRFDRTGRGLGLGPASVVEVE
FT                   DRKGGGKAAEADLLRKAVPRGAVICALDERGKTMSSPQFADSLAGWRDAGRSDLAFLIG
FT                   GADGLDKALRAQAEARLSFGAMVWPHMLARVMLAEQLYRAAAILAGTPYHRV"
FT   gene            87158..88675
FT                   /gene="ipgm"
FT                   /locus_tag="Dshi_0089"
FT   CDS_pept        87158..88675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipgm"
FT                   /locus_tag="Dshi_0089"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: rsh:Rsph17029_2593 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain
FT                   protein;swissprot:high similarity to
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate mutase
FT                   (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) from
FT                   Silicibacter pomeroyi; 2,3-bisphosphoglycerate-independent"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91838"
FT                   /db_xref="GOA:A8LKJ5"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKJ5"
FT                   /protein_id="ABV91838.1"
FT                   /translation="MTAPKPVVLCILDGWGLDPDGPANAPLLADTPVMDRLMATCPNAT
FT                   LTTFGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDGSFARNPALTGFIDR
FT                   LKSSGGTAHLMGVASDGGVHGHTDHIIAAAKAVAGAGVPVVLHAITDGRDVAPKSADRF
FT                   MPALEAALPEGARIGTVIGRYYAMDRDNRWDRVARAFVAMVRAQGETAESAQAAVAAAY
FT                   GRGETDEFIAPTVIGGYAGMRDGDGIFCLNFRADRAREILRAMAQPDFDAFDPAGLPDF
FT                   AAKLGMVSYSDEHDGWFDIVFPKREIVNTLGAWVAKQGLRQFRLAETEKYPHVTFFLNG
FT                   GQETPETGEDRFMPDSPKVATYDLQPEMSAEEVSDSFVAAIEAGYDLIVVNYANPDMVG
FT                   HTGDLEAAKAACTAVDTGLGRALAALEVAGGAMIVTADHGNCETMIDPETGGTHTAHTL
FT                   NPVPVILVGGPEGATLAPGRLADLAPTILHLMHLPQPVEMTGRSLIR"
FT   gene            88672..89775
FT                   /locus_tag="Dshi_0090"
FT   CDS_pept        88672..89775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0090"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B KEGG: rsh:Rsph17029_2592
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91839"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ6"
FT                   /protein_id="ABV91839.1"
FT                   /translation="MRRAAVLLCALLAAPVAAQTDPVARASQAAALLAEAETALAGAGS
FT                   APDRIAALTDAVRGFEAGLEAVRESARQAVIREEAITARLAAEQARLGALLGVLQTLDQ
FT                   TPPPALLLHPDGPLSLARAEMMVSDVTPAVAAEAAALRATLQELSTVRMIRTSASAQLE
FT                   GALRDIQAARVALAETMAERVRLPEGAAPDPVLLGVLSASSRTLEDFAAGLADIPAPPA
FT                   PLTDFASLRGALPLPVAARVLRRFGEADLAGIARPGLVLAAPAQALVTAPFAATVRYTG
FT                   TLLDYGNVIVLEPQTGVLLILAGLDALYVDGGDVLAPGAPLGLMGGDPAQQTGFASGQT
FT                   RQETLYLELRESGAPVDPEDWFVTDKD"
FT   gene            89783..91120
FT                   /gene="prc"
FT                   /locus_tag="Dshi_0091"
FT   CDS_pept        89783..91120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prc"
FT                   /locus_tag="Dshi_0091"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: rde:RD1_0333 carboxyl-terminal protease family
FT                   protein, putative TIGRFAM: carboxyl-terminal protease PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41, high swissprot
FT                   hit to Carboxy-terminal-processing protease precursor from
FT                   Bartonella bacilliformis KC583; RBS site AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91840"
FT                   /db_xref="GOA:A8LKJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ7"
FT                   /protein_id="ABV91840.1"
FT                   /translation="MKKFVMAALGGTVAGALLTTQVAGPLLAQDNARNTSVYEQLDLFG
FT                   DIFERIRAQYVEQVDEGELIEAAINGMLTSLDPHSSYLAPKDFGDMQVQTRGEFGGLGI
FT                   EVTQEDGFVKVVSPIDDTPAAEAGIEAGDFITHVDGESVLGLTLDAAVTMMRGPVGSEI
FT                   VITVVREGFDEPFDVTITRDTIKLTAVRSRVVRDTVVMRITTFNDQTFPNLEEKMAEEV
FT                   AELGGMEAVSGFVIDLRNNPGGLLTQAIKVSDAFLDKGEIVSTRGRDPQDGERFNATPG
FT                   DLAEGKPIVVLINGGSASASEIVAGALQDHRRAIVVGTKSFGKGSVQSVVPLRGDGAMR
FT                   LTTARYYTPSGRSIQSLGVSPDIVVAQPPRRVEAEEDEEANNRPRRSEADLRGALDNDS
FT                   ISEAEREQLLKERQKAEDAAELREEDYQLAYAIDILKGLNALGPTD"
FT   gene            91122..91604
FT                   /locus_tag="Dshi_0092"
FT   CDS_pept        91122..91604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0092"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: NUDIX hydrolase KEGG: rde:RD1_0960 hydrolase,
FT                   NUDIX family domain; good swissprot hit to Probable
FT                   (di)nucleoside polyphosphate hydrolase from Silicibacter
FT                   pomeroyi and Ap4A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91841"
FT                   /db_xref="GOA:A8LKJ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKJ8"
FT                   /protein_id="ABV91841.1"
FT                   /translation="MTPDDIAALPYRKCVGVVLWDGAGRVFTGQRYDSELPAWQMPQGG
FT                   IEDGEDARTAALRELVEETGVAVEKVEVLAETPDWIKYDLPPEIVPRIWKGRYKGQAQR
FT                   WVLMKFLGSDADINIETKHPEFSEWRWLEPASVLDSIVPFKRDVYEQVFDAFSDWL"
FT   gene            complement(91896..92264)
FT                   /locus_tag="Dshi_0093"
FT   CDS_pept        complement(91896..92264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0093"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hit, small signalpeptide, bad
FT                   GC frame plot, Dshi_0100 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91842"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKJ9"
FT                   /protein_id="ABV91842.1"
FT                   /translation="MANTKDALLAIALADLQAAQAKTDAAQIAQKRALNSLSKVLHSHE
FT                   LDAATPRGNAHLANHRTGVPAKIDSDPELEAFLMDRIHNTGFVQLAAEVAEHFPPERRV
FT                   GKSAINTWWNRKLRPDLV"
FT   gene            complement(92411..93343)
FT                   /locus_tag="Dshi_0094"
FT   CDS_pept        complement(92411..93343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_0345 hypothetical protein, domain of
FT                   protease I prophage; no swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91843"
FT                   /db_xref="InterPro:IPR012106"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK0"
FT                   /protein_id="ABV91843.1"
FT                   /translation="MALETSLCAAVDLPEGRAPGKVHLLPLGRIRGRDGRVFELSDPDE
FT                   LVALFHQGGIDLPIDYEHQGDDPARQKNGPVPAAGWIKGLEVRPDGIWGDVSWTAKARE
FT                   MLEAREYRFLSPVLMHTKTGGRITRLKGASLVHRPNLDLTALASEGDDMTDPEDTSALA
FT                   AIAEALELEPAADADAIMAAIAELRSKAETAEPDPAKYVPIAALKELMQDRGATKATLS
FT                   EYLVEARVTEALHAGYITPAMRSWATALCAQDPDSFEDFIASTTPAYGHLFKRAAIPGL
FT                   PADASAPPETVVQSLCDQLGLKPSDFDIR"
FT   gene            complement(93348..94247)
FT                   /locus_tag="Dshi_0095"
FT   CDS_pept        complement(93348..94247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_0344 hypothetical protein, no
FT                   swissprot, no IPR Scan result, COG4397 Mu-like prophage
FT                   major head subunit gpT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91844"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK1"
FT                   /protein_id="ABV91844.1"
FT                   /translation="MILNDANVDLAFQGFKTIYTDAYTNAPAHYSKVAMTVASGNRQET
FT                   YGWLGQFPQLREWLDGERVIKDLEAHSFTILNRKFESTVDIRREDFEDDRLGLLKPMFA
FT                   EMGHLARQHPDELIFGLLKDGFTTPCFDGQNYFDTEHQTPDADGNMVPVSNMADGTDAP
FT                   WFLLDTSRAIRPLIWQARVDYTFDMVNRPNDERVFMTDKYLYGVRARVNAGFGLWQMAY
FT                   ASKQPLNLETYSSARAAMMELRGDKGRILGITPTTLVVPPSLEHQARLVLNTETSDGGG
FT                   SNPWKNTAELIVTPYVTV"
FT   gene            complement(94244..94774)
FT                   /locus_tag="Dshi_0096"
FT   CDS_pept        complement(94244..94774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0096"
FT                   /product="hypothetical protein"
FT                   /note="unsure GC frame plot, no significant BLAST hits, no
FT                   IPR Scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91845"
FT                   /db_xref="GOA:A8LKK2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK2"
FT                   /protein_id="ABV91845.1"
FT                   /translation="MPWWGSDHLAAPPAKCRGRQVAGRAGITGRMIASPAELLYPTAAE
FT                   CRRIGLYMPPMIADMERAVGAQTTRAFLIQHGGKDLLIPVKVKPGHAHNAALTWLLKTY
FT                   GAGRLSIPFGPASRTARMRWTAYRHFEAGRSVRVIAQALDTTERSVTRHRRRLVEAGAL
FT                   APRPFQTSEETDP"
FT   gene            complement(95154..95567)
FT                   /locus_tag="Dshi_0097"
FT   CDS_pept        complement(95154..95567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_0343 hypothetical protein, no
FT                   swissprot, no IPR results, DUF1018 domain: This family
FT                   consists of several bacterial and phage proteins of unknown
FT                   function."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91846"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK3"
FT                   /protein_id="ABV91846.1"
FT                   /translation="MMTITKNQLKLIWVAKSKLGMSDEGFRAALVQIAGVTSTKELDQD
FT                   GLNAMMGFFEFCGFAPLRTKGPSYGTRPGMASFAQIELIRVLWQEYTLGKAGEAELNLW
FT                   LERYWKLSSLRFLSAATAPKIITALKAMKARAA"
FT   gene            complement(95564..96019)
FT                   /locus_tag="Dshi_0098"
FT   CDS_pept        complement(95564..96019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0098"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hit, unsure GC frame plot, no
FT                   IPR scan result"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91847"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK4"
FT                   /protein_id="ABV91847.1"
FT                   /translation="MANGCWRPCAPNWRATTLSSRTSRRLSGLPSRPISRRTRCTVSSR
FT                   AAPSCGNRKGAQMTDIDLTEWESFHLRAHRAKAVADAAAEVEYTLGEFAGALKLLKLMV
FT                   TDMDTHDPGTLIFLLDLLSNYAERRAATEGAVLSEVASYMRSTMRNP"
FT   gene            complement(96161..96931)
FT                   /locus_tag="Dshi_0099"
FT   CDS_pept        complement(96161..96931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs4946 putative DNA transposition
FT                   protein, bad BLAST hits, AAA ATPase domain (COG2842
FT                   Uncharacterized ATPase, putative transposase )"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91848"
FT                   /db_xref="GOA:A8LKK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009084"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036733"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK5"
FT                   /protein_id="ABV91848.1"
FT                   /translation="MAEHLQLINPGSVPPPAGMVMTETASNILRSLRLVADEPGTLTMV
FT                   AGVPGVGKSETLRRYTHESKNAQMFTMVAGEGRIWDLANVMMERLELGAPNSRRLREDR
FT                   YRIMDAIGAEQVVIFDEAQYLANYNPRGGFNFDAYEWVRAMAEEACFSVVFCGDLSLAD
FT                   TISSVPQLRRRMVRPVVIRSVPKPDVLAVVRSRGITDPAICDALSVMARRYGGLADVQR
FT                   TLAQAAKHASSDKIAASDVKAAMLYLGLSGQGGF"
FT   gene            complement(96999..98882)
FT                   /locus_tag="Dshi_0100"
FT   CDS_pept        complement(96999..98882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0100"
FT                   /product="putative transposase"
FT                   /note="KEGG: rde:RD1_0339 transposase, putative; swissprot
FT                   hit to Transposase from Enterobacteria phage Mu; pfam02914
FT                   Mu_transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91849"
FT                   /db_xref="GOA:A8LKK6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR004189"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015126"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK6"
FT                   /protein_id="ABV91849.1"
FT                   /translation="MRREDIPLEPYKNSYLVAVQDLPDCLRFSLLNAELEHLHLSPGTY
FT                   DAAAHEAFFEASPSRRDRAERRAAVARVLVALGPGVRWSDRLRIVHEKFGAKGLSKPCL
FT                   REILRRVEGIDPINFAPALLDEYKGTTKRAEFTDEAWRFFLTQIRDAAPEWPLAEAWRR
FT                   TRDAGRELGWKVPPYITVYRRWMELSEVQKLHARQGTAETAKNLSIPVQRDKTSLLALD
FT                   VVSLDGREIDVFVDWGDGKAVRPVMLVLVDVSSNAVLDFELAPSENATATVRLIKRACA
FT                   NHGIFDKLYTDNGSAFAGHKVAGGTPHRFRNGVAKGVQPMGICEVLGIDVQFALPGNAQ
FT                   AKIAERLYAIMSRSDDDGPDFKGAHTGHKPGARPNSETNPIPVDECKALLARGVRRLNR
FT                   EEGRRNQGAQGRSYDQVLRDGLTKRAELGRPVRYPTKDQLYRAGLIWTPATVDRNTQIK
FT                   VDHWTYGGPETQEALAPYRRGGAKNLKGGTKILLARDPDDLSAPAIAYDAERNFICDQI
FT                   EPVRRGDYNSSDGIREAARNRKAARDAARKAEEANAYLEDAEYLRAKAALDAASREDDM
FT                   PPPAPGKVVGARFGGPLKAAKPKPETDNEAEVLKQFDRVTGFDPVRVLRGQ"
FT   gene            99281..99538
FT                   /locus_tag="Dshi_0101"
FT   CDS_pept        99281..99538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0101"
FT                   /product="hypothetical protein"
FT                   /note="unsure GC frame plot, no significant BLAST hits, no
FT                   IPR Scan result"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91850"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK7"
FT                   /protein_id="ABV91850.1"
FT                   /translation="MAEAIQFTISVRDTLAQHLPRLSADHALLRILTEEEPGSEIWRRE
FT                   LNNDFAYRVAKRAYKDYVDARAKAGVVVGEPIDVSQSREP"
FT   gene            99840..102824
FT                   /gene="dnaE1"
FT                   /locus_tag="Dshi_0102"
FT   CDS_pept        99840..102824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE1"
FT                   /locus_tag="Dshi_0102"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rde:RD1_0336 DNA polymerase III, alpha subunit
FT                   TIGRFAM: DNA polymerase III, alpha subunit PFAM: DNA
FT                   polymerase III alpha subunit SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91851"
FT                   /db_xref="GOA:A8LKK8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK8"
FT                   /protein_id="ABV91851.1"
FT                   /translation="MFVELCALSNFTFLTGASHPEDYAQKAALLGLPAFAIADVNSVAG
FT                   IVRAHTELKEIARQIDLCATAEARDGPIGPPWPGPRSEDSAAVRNLPRLLPAARLRLRE
FT                   GTEITALPEDRAAWGRLSRLLTLGQRRAPKGRCHLDLADVLDEADGMQLLLHGLPEAPP
FT                   VQLGAGRTWPQAEALTRRFPGKVSLLMTPAYDGQDRVRFDRWAALADTLGLPTVASAAP
FT                   LFHCATHRRLADVLTAIRNGCRVEDLGRTAQAHAEQRLRSEAEMLRLFRGHEDAVHRTA
FT                   EIAARCSFCLSQLRYEYPSETRGGETAQDRLSRLAHEGLRWRYRNGAPPKVRKMLDHEL
FT                   RLIGKLGYAPYFLTVNDIVAFARSRDILCQGRGSAANSVVCYCLGITSVSPEVGTMVFE
FT                   RFVSEARDEPPDIDVDFEHERREEVIQHIYERYGRHRAGLCATVIHYRGKRAVREVGRA
FT                   MGLSSDTLSALSSQIWGFGSVRGIEETRLREIGLDPTDRRLRQTIDLIYRIQGFPRHLS
FT                   QHVGGFIITEGRLDELVPVENATMVDRTVVCWDKDDLDSLGILKIDILALGMLSCVRKA
FT                   FDLIAHHHGAKFSLATLPVEDPAVYDMLCRADSIGVFQVESRAQMNFLPRMRPRCFYDL
FT                   VIQVAIVRPGPIQGDMVHPFIRRRNGEEQVEFPSDALGEVLSKTLGVPLFQEQAMQIAI
FT                   VGAGFDPSEADRLRRALATFKKHGNVSEFRTRFLKGMAQNGYDTAFAERCFSQIEGFGS
FT                   YGFPESHAASFALLVYASAWIKCHHPGIFACALLNAQPMGFYAPAQIMRDAREHGVTVR
FT                   PVCVNASFWDNTMEPDGQGGLALRLGFRQVKGLAQEDAEWLVSARGNGYGTVADLWRRA
FT                   GLGQAVLTRLAEADAFAELGLGRRDALWQARAIRGDAPLPLFSGDMDGEGGAEPPVVLP
FT                   PMSLGEEVVEDFVAMRLSLRAHPVALLRHVLTPGMGDPELAGRVQGPRGAGRSEGPAPR
FT                   APRDI"
FT   gene            102930..104042
FT                   /gene="adhI"
FT                   /locus_tag="Dshi_0103"
FT   CDS_pept        102930..104042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhI"
FT                   /locus_tag="Dshi_0103"
FT                   /product="alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="TIGRFAM: Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein KEGG: sil:SPOA0272
FT                   glutathione-dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91852"
FT                   /db_xref="GOA:A8LKK9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKK9"
FT                   /protein_id="ABV91852.1"
FT                   /translation="MRTKAAVAIAAGKPLEVMEVNLEGPKAGEVLVEIKATGICHTDEF
FT                   TLSGADPEGLFPAILGHEGAGVVMEVGPGVTSLKPGDHVIPLYTPECRECEYCLNPKTN
FT                   LCQSIRTTQGAGLMPDGTSRFSTLDGDPILHYMGCSTFANHTVLPEIALAKVRPDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGSRAIVFGLGGIGLNVIQGLRLAGADQIVGVDLNP
FT                   DKIPMAERFGMTDFVNPAEVEGDLVPYLVDLTKGGADYTFDATGNVQVMRAALESAHKG
FT                   WGESIIIGVAPAGAEIATRPFQLVTGRVWRGTAFGGARGRTDVPKIVDWYMEGKIEIDP
FT                   MITHTMPLSDINTGFDLMHAGESIRSVVIY"
FT   gene            104039..104527
FT                   /locus_tag="Dshi_0104"
FT   CDS_pept        104039..104527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0104"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: GCN5-related N-acetyltransferase KEGG:
FT                   rle:pRL110290 putative acetyltransferase, no significant
FT                   swissprot, but middle Ref YP hit to putative
FT                   acetyltransferase from Rhizobium leguminosarum bv. viciae
FT                   3841"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91853"
FT                   /db_xref="GOA:A8LKL0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL0"
FT                   /protein_id="ABV91853.1"
FT                   /translation="MNVTVRTAEVSDWPAVWEMLRPVFRSGETYAVAPDISEHDARNYW
FT                   LAPSRRTFVAEDEGAVVGTYYLAANFDGNADHICNCGYVTAAAARGRGVARRMLAHSLE
FT                   AAREAGFRAMQYNCVVSNNLSAIALWKSGGFRIIATLPEAFRHPADGLVDAYVMWKQL"
FT   gene            104539..105249
FT                   /locus_tag="Dshi_0105"
FT   CDS_pept        104539..105249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: protein of unknown function DUF88 KEGG:
FT                   jan:Jann_0048 protein of unknown function DUF88; no
FT                   swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91854"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL1"
FT                   /protein_id="ABV91854.1"
FT                   /translation="MPNRDRPLLAVLIDADNVPAKFAEAILKEVASIGEPALRRVYGDW
FT                   SSGRLRNWADKVLSLGLVAHQDTANTTGKNASDIGLVIDAMDILHGGRFDGFVLVSSDS
FT                   DFTSLANRLREDGKEVIGIGEKKAPESLRNVCNRFIFIENIVQAGPDAAGSGKAAPQEQ
FT                   ITDAVPLILNAMDEINQDDEWYPLGQLGQYIVAVNPDFDTRSYGHRKLSSLIGELKRFE
FT                   TKKVGNQLMVRRLD"
FT   gene            complement(105246..105869)
FT                   /locus_tag="Dshi_0106"
FT   CDS_pept        complement(105246..105869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0106"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein TetR KEGG:
FT                   rsh:Rsph17029_2507 transcriptional regulator, TetR family;
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91855"
FT                   /db_xref="GOA:A8LKL2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL2"
FT                   /protein_id="ABV91855.1"
FT                   /translation="MNLTSPVKRGRKYDEVLSGARHVFLRDGFDGASVDDIARAAGVSK
FT                   ATVYSYFSDKRLLFLEIARAEIATLTDRAMTDIDRTAPPAQVLTQAGQTIIGFSLSVVG
FT                   LGIFRLCIAEGERFPELAQAFFEAGPMATQAALCDYFAEAQARGELRIEDPELAADQFV
FT                   ELCRADLQMRLLMRVPPPPSPRDVERVLTGAVEMFLARYATGPV"
FT   gene            105989..106960
FT                   /locus_tag="Dshi_0107"
FT   CDS_pept        105989..106960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0107"
FT                   /product="ferritin-like protein"
FT                   /note="PFAM: Rubrerythrin; protein of unknown function
FT                   DUF125 transmembrane KEGG: sil:SPO3842 hypothetical
FT                   protein, may be Rubrerythrin, but Rub has a C-terminal
FT                   domain homologous to rubredoxin PUBMED:1657933, which is
FT                   not detected in this case, just the CCC1 like domain at
FT                   C-terminal, which could be involved in iron and manganese
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91856"
FT                   /db_xref="GOA:A8LKL3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL3"
FT                   /protein_id="ABV91856.1"
FT                   /translation="MLPLLSRKRFSDLTEEEILALAISSEEDDARIYRSYAQRLGTEFP
FT                   DTAAVFLGMADEEDTHRARLIELFRQRFGETIPLIRREHVAGFYARRPVWLTENLGLER
FT                   IREEAAIMERDAGAFYHAAAQRSQDAGTRKLLGWLAAAEDAHARKAETLTGKVSSEAAE
FT                   QEEAVAKRQFVLTWVQPGLAGLMDGSVSTLAPIFAAAFATGDTWSTFLVGLAASVGAGI
FT                   SMGFTEAASDDGALSGRGAPWKRGLASGVMTTLGGLGHALPYLIPDFWTATTIAVIVVF
FT                   FELWAIAWIQKTYMETPFFRAALQVVVGGALVLAAGILIGSG"
FT   gene            complement(106968..107909)
FT                   /locus_tag="Dshi_0108"
FT   CDS_pept        complement(106968..107909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syw:SYNW1655 hypothetical protein, best ref ZP
FT                   hit to Methyltransferase type 11 from Methylobacterium sp.
FT                   4-46, no IPR scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL4"
FT                   /protein_id="ABV91857.1"
FT                   /translation="MALPIELSDALTGPEVEKRLSHALDERLPFSFVRIGDGEGMALAR
FT                   QGGRHDPLRPSILQAFGTAYDQPRADALGEHLDRAVGHASILGLRAEVLYLSLTADDFK
FT                   APKDAFLLRYKRSTEGHEPAEKKHDYQSALRLAHMVFALERLGVSNARPVSSAWVHYDL
FT                   LASGYLARLVLKAPRIGLISCRRSVARKITTARTGPTLFFPVLEHFGREKTLGVTPEHW
FT                   WQSMETVSRSLTDVRPGDVFLIGAGIWGKAYCEQVRAQGGIAIDMGSALDIWAGINTRP
FT                   SVMPLWFEAFPDTPPGEVPRELRLESQLAALA"
FT   gene            108100..109035
FT                   /locus_tag="Dshi_0109"
FT   CDS_pept        108100..109035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0109"
FT                   /product="auxin efflux carrier"
FT                   /note="PFAM: Auxin Efflux Carrier KEGG: jan:Jann_0051 auxin
FT                   efflux carrier, best swissprot hit to Putative malonate
FT                   transporter from Sinorhizobium meliloti (Rhizobium
FT                   meliloti) and best ref YP hit to Auxin Efflux Carrier from
FT                   Jannaschia sp. CCS1; COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91858"
FT                   /db_xref="GOA:A8LKL5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL5"
FT                   /protein_id="ABV91858.1"
FT                   /translation="MVAIFLQTLPFFAIIALGYGAGRTNFFSPEATAYLTKFVFYFALS
FT                   AMLFRFAANLTLSDILDWQFVWAYLWATGVIYLLATAVALIRKLNVSEAAVEAQCAVIG
FT                   NVGFLGIPMLVLLLGEAAVGPVMLVLTVDLIVFGSLIVILITGSRDGRVSLGVLQSVGL
FT                   GLLKNPMIVSISLGLAWSALRLPIPGPMNAFLDIIGSAATPGALFAIGASLATKSAERL
FT                   EVAGWLSFCKLVLHPAAVALAALVIFPVEDAYAAGVMIAAAALPTAGNVYILAQHYGVA
FT                   PARVSATILVSTALSILTLSAVIAWVGPMG"
FT   gene            109035..109487
FT                   /locus_tag="Dshi_0110"
FT   CDS_pept        109035..109487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0110"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188 KEGG:
FT                   rde:RD1_0321 YaiI/YqxD family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91859"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL6"
FT                   /protein_id="ABV91859.1"
FT                   /translation="MALYIDADACPVKVEAERVATRHGVKMFVVSNGGLRPSQNPLVEM
FT                   VFVPDGPDLADMWIAERAEPGDVVVTGDIPLAAKCVEAGAEVLKHNGERLTRANIGNVL
FT                   ATRDLMSDLRAADPFRQGGGRAFSKADRSRFLDALERAIRAAKTAG"
FT   gene            complement(109578..110813)
FT                   /locus_tag="Dshi_0111"
FT   CDS_pept        complement(109578..110813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0111"
FT                   /product="transmembrane transporter"
FT                   /note="PFAM: major facilitator superfamily MFS_1 KEGG:
FT                   rde:RD1_0325 transmembrane transporter, major facilitator
FT                   family, putative, COG2814 Arabinose efflux permease; major
FT                   facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91860"
FT                   /db_xref="GOA:A8LKL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL7"
FT                   /protein_id="ABV91860.1"
FT                   /translation="MEHRAPLVTPVLLAGCVIILVSFAIRSAFGVFQIPIQEEFGWLRA
FT                   EFSLAIAIQNLAWGIGAPLFGAIAERFTDRKAIMLGIALYTVGLLLSAVATTPMQHNLL
FT                   EMLVGFGIAGTGMGLILAIVGRASSDENRSMALAIATAAASGGQIFGPPVAEALLSIVS
FT                   LQAVFVIFALAVLSTLLVLPALKARPGATPTLSESMGPAVARALKDPNFTLIFLGFFSC
FT                   GYQLGFITAHFPAFVTELCGPISPGGMLAGLGITTNSALGAIAISLIGVANIAGVLAAG
FT                   WAGKRYRKKSLLAGIYLARTLVAAAFIMVPITPETVILFSLGMGALWLATVPLTSGLVA
FT                   HLYGVRYMGTLYGVVFLSHQIGSFTGVWLGGRLHDLYGDYTLVWWVGVGVGLFSALVHL
FT                   PIKERPASPLPA"
FT   gene            110834..112003
FT                   /locus_tag="Dshi_0112"
FT   CDS_pept        110834..112003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0112"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase KEGG: rde:RD1_0326 ATPase,
FT                   AFG1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91861"
FT                   /db_xref="GOA:A8LKL8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL8"
FT                   /protein_id="ABV91861.1"
FT                   /translation="MRRGQINNSGPSHQDRLTVSPRQRPRERQMTDLIARYHALVADGE
FT                   ITADAAQVAALHVLEEVGAALAAPVPKRSFLKRFAKPQAPEGKRGAYLWGGVGRGKSML
FT                   MDLFFAAAPIAEKRRVHFHAFMQEMHAALHAARQTGVEDALAPVAADVARTTRLLCFDE
FT                   MQITDITDAMLVGRLFDLLFADGVVIVTTSNRVPDDLYKNGLNRDLFLPFIETIKERLI
FT                   VHELVSETDYRQNRLTGAQRYFALRGAEAREKLDAIWEDLTGGENHPLTLTVKGRAVEI
FT                   PRYHNGVARMRFWELCGQPLGAGDYLALAGAVRVLMIDDIPQLGRSNFNEAKRFVTLID
FT                   ALYEAKVQLICSAAAAPEMLYIEGEGTFEFERTASRLREMQDADWGRTD"
FT   gene            complement(112059..112541)
FT                   /gene="ahpC"
FT                   /locus_tag="Dshi_0113"
FT   CDS_pept        complement(112059..112541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="Dshi_0113"
FT                   /product="redoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein KEGG:
FT                   rsh:Rsph17029_2558 redoxin domain protein; good swissprot
FT                   hit to Peroxiredoxin-2E-2, chloroplast precursor from Oryza
FT                   sativa and Ref ZP hit toantioxidant, AhpC/Tsa family,
FT                   putative from Roseobacter sp. AzwK-3b"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91862"
FT                   /db_xref="GOA:A8LKL9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKL9"
FT                   /protein_id="ABV91862.1"
FT                   /translation="MQVGDKLPEADLIKLGADGPETVSVSSLTAGRKVILFAVPGAYTP
FT                   TCHSAHVPSFVRTKDAFAAKGVDEIICVSVNDPFVMKAWGEATGAADAGITMLGDPGSE
FT                   FTKAIGMDFDAPPAGLHARSKRYALYAEDGVVKVLHAEENPGVCETSGGEAMLDAI"
FT   gene            112628..113833
FT                   /locus_tag="Dshi_0114"
FT   CDS_pept        112628..113833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0114"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase KEGG: sil:SPO3737 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein; also
FT                   good swissprot hits to Rhodocoxin reductase from
FT                   Rhodococcus erythropolis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91863"
FT                   /db_xref="GOA:A8LKM0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM0"
FT                   /protein_id="ABV91863.1"
FT                   /translation="MSHIVVIGAGQAGASLVAKLRVLGHQGAVTLVGEEPVPPYQRPPL
FT                   SKGYLLGDMAEERLYLRPARYYAENGITLKLGTPVKAVDTGACEVFLGDERLSYDQLAF
FT                   TTGSVPRRLPASIGGTLDGVFTVRTLADVDAMAPQMSAGKHVLIVGGGYIGLEAAAVAS
FT                   KLGLRVTLVEMADRILQRVAAPETSAFFRKLHADHGVDLREGVGLDRLTGEGAVTGARL
FT                   SDGSELALDLVIVGVGIAPATDLAAAAGVALDNGIAVDALGRTSAPGVWAAGDCASLPH
FT                   RGARIRLESVQNAIDQAEAVAANMLGAETPYVPKPWFWSDQYDVKLQIAGLNTGYDRVV
FT                   VRDDAGAISHWYYAGNTLLAVDAMNAPRAYMVGKRLIDGGKSPDATLVADPATELKDLM
FT                   RA"
FT   gene            113830..114387
FT                   /locus_tag="Dshi_0115"
FT   CDS_pept        113830..114387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0115"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase PFAM: conserved
FT                   hypothetical protein KEGG: sil:SPO3738 methyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91864"
FT                   /db_xref="GOA:A8LKM1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM1"
FT                   /protein_id="ABV91864.1"
FT                   /translation="MRIIAGRFGGRKLASLGKGDAAAHLRPTPDRVREALFSSLTSGAY
FT                   GDPITGARVLDLFAGTGALGLEALSRGAAHVTFVETGRVAQRLLADNIRSLGVAAETRV
FT                   RRSDACKLGPPEVAPFALVFLDPPYGQGLGVRALAQRDWIAPGALIVWEEGAPQDPLPG
FT                   FDLRDQRRYGGTHVTVLEARDV"
FT   gene            complement(114678..115730)
FT                   /locus_tag="Dshi_0116"
FT   CDS_pept        complement(114678..115730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0116"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit
FT                   KEGG: pol:Bpro_2121 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91865"
FT                   /db_xref="GOA:A8LKM2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM2"
FT                   /protein_id="ABV91865.1"
FT                   /translation="MTFLSKTAALTMLAVSATSLPSLAQEVTLRFQHFVSPLSANPTYF
FT                   MEPWARKIEADSNGRIKVELYPFMQLGGKAPNMYDLIRDGAVDGGWVIPGYQPGRFPEA
FT                   EALELPFMTTKTGEDASKAAWVYTQKHLMDDFADVKVIAAHMHGRGLVHKKGPAIAELS
FT                   DFEGLKLRGPSRPATLLLREMGATPVGMAVPAFPEALSRGVVDGGVITWEMSPSLKLDE
FT                   LTDSHTDVAGDKSLYNLFFLWAMNKAKYDSLPDDLKAVIDANSGFAASAWAGRAHDTGD
FT                   AEGKQAMADAGNEIATMSEELTAEIVTLGEAVTETWIAEMTDKGLDGAGLVADARAAVQ
FT                   VTRSDNQPLN"
FT   gene            complement(116582..117397)
FT                   /gene="map"
FT                   /locus_tag="Dshi_0117"
FT   CDS_pept        complement(116582..117397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="Dshi_0117"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: sit:TM1040_2469 methionine aminopeptidase,
FT                   type I TIGRFAM: methionine aminopeptidase, type I PFAM:
FT                   peptidase M24; also high swissprot to Methionine
FT                   aminopeptidase (MAP) (Peptidase M) from Rickettsia
FT                   prowazekii"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91866"
FT                   /db_xref="GOA:A8LKM3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM3"
FT                   /protein_id="ABV91866.1"
FT                   /translation="MNEQPRTTLTKDGIRLYERADFAGMHTAGKLAAQILDDIAPHVVP
FT                   GVTTGELDRIITEQVEAAGATSATIGYKGYQHGSCISINHVVCHGIPGEKKLKDGDILN
FT                   IDVTVIVDGWFGDTSRMYVAGKLNRRAERLIEVTHDALMEGIKAVRPGNTFGDIGNAIQ
FT                   TFVESHRMSVVRDFCGHGLGRVFHAPPNVLHYGRKGTGPVLEEGMFFTIEPMVNLGRPE
FT                   TKVLADDWTAVTRDKSLSAQFEHSIGVTADGCEIFTLSPGGLFHPTYKA"
FT   gene            complement(117444..118178)
FT                   /gene="sfsA"
FT                   /locus_tag="Dshi_0118"
FT   CDS_pept        complement(117444..118178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="Dshi_0118"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein KEGG:
FT                   jan:Jann_0284 sugar fermentation stimulation protein, good
FT                   swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91867"
FT                   /db_xref="GOA:A8LKM4"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKM4"
FT                   /protein_id="ABV91867.1"
FT                   /translation="MRFQTPLVPARLVRRYNRFLSDAVLEDTGEEVRAHCPNPGAMLGL
FT                   KDAGQRIWLEPNDDPKKKLRYGWRLVELADGHMAGIDTSVPNKVVGEALAARAITELAA
FT                   YGTIRAEVKYGTNSRVDFLATEPGLPDTYVEVKNVHLRRAEDWAEFPDSVTTRGAKHLA
FT                   ELARMVEAGHRAVMLYLVQRTDCTRLRLAPDLDPSYARAFDAARATGVEMLCYGTLIDT
FT                   GGVTLGRALPVDPAAQAPQNED"
FT   gene            118227..118955
FT                   /gene="mogA"
FT                   /locus_tag="Dshi_0119"
FT   CDS_pept        118227..118955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="Dshi_0119"
FT                   /product="molybdenum cofactor biosynthesis protein MogA"
FT                   /note="PFAM: molybdopterin binding domain KEGG:
FT                   rsh:Rsph17029_2583 molybdopterin binding domain COG1058 -
FT                   Predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91868"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM5"
FT                   /protein_id="ABV91868.1"
FT                   /translation="MATPTAAMIVIGDEILSGRTQDKNMHHLAGELTAKGIPLTEARVI
FT                   SDEAATITATVRELSRRYTHVFTSGGIGPTHDDITADAVAAAFDAPIDVREDARALLAA
FT                   HYAKSGTELNAARLRMARIPEGATLIDNPVSAAPGFTLGNVHVMAGVPSVFRAMVASIL
FT                   PTLTGGAPVLSESLRVIRPEGEIAGPLGALAAEFPDLSFGSYPFIKDGVFGANVVVRGT
FT                   DASALAKAVAALRVTFPDAA"
FT   gene            118952..119677
FT                   /locus_tag="Dshi_0120"
FT   CDS_pept        118952..119677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0120"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: GCN5-related N-acetyltransferase KEGG:
FT                   rsq:Rsph17025_2991 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91869"
FT                   /db_xref="GOA:A8LKM6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM6"
FT                   /protein_id="ABV91869.1"
FT                   /translation="MSGIWDAIDATWAAPRLHRVGPFTLREGQGGGQRVSAATTDQVPK
FT                   PAEIAAAAQAMRALGQRPLFMVRGAQRAFDSALEAAGYEVNDPVIVMEAPIDTVARDGP
FT                   PPVSAFPIWPPLQIMQEIWAEGGIGPERLAIMAGSCDPKTAILGRVKDRAAGCAFVAIH
FT                   AGIAVMHAVEVAPALRRLGTARNMARGGADWARRHDATRFAILTVADNAASQGVFTSLG
FT                   MVPVEHYHYRRDPNWTETP"
FT   gene            119674..120249
FT                   /locus_tag="Dshi_0121"
FT   CDS_pept        119674..120249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0121"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme PFAM:
FT                   Carboxymuconolactone decarboxylase KEGG: sit:TM1040_2465
FT                   uncharacterised peroxidase-related, no swissprot, but high
FT                   Ref hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91870"
FT                   /db_xref="GOA:A8LKM7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM7"
FT                   /protein_id="ABV91870.1"
FT                   /translation="MTDTPDLVTALNLPQVDPLPPETAKYFAICEEKLGLVPNVLRAYA
FT                   FDIDKLNTFAALYNDLMLAESGLTKLERELIAVVVSSVNRCYYCQVAHGAAVRELSGNP
FT                   ELGEQMVMNYRVANLSPRTMAMLDYAVALTEASAKVTETDRARLREHGFTDRDIWDISA
FT                   VTGFFNMTNRLASGVDMRPNPEYHGAHR"
FT   gene            120246..121178
FT                   /locus_tag="Dshi_0122"
FT   CDS_pept        120246..121178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0122"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein KEGG:
FT                   rsh:Rsph17029_2585 OmpA/MotB domain protein; COG2885 Outer
FT                   membrane protein and related peptidoglycan-associated
FT                   (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91871"
FT                   /db_xref="GOA:A8LKM8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM8"
FT                   /protein_id="ABV91871.1"
FT                   /translation="MKLWAGLALAWLAGSAHALELALPDGAMQAHDASVPAARYALPTG
FT                   PAKAGTVPLRQVEGTLRHRVWHLSPPQTLAVLLASLRAQLEEAGYEVLLDCTARGCGGY
FT                   DFRFAVEDVGPPQMMVDLGRYGYLSARNSGTGHYAVILVSETRSLGYVQLTEITPAEIA
FT                   LDLDTTPDAQVPGAALARSGDIARPLADLLLSQGRVVLEDLRFATGNATLENGQYPSLT
FT                   ALAGFLTENPDLVIALVGHTDAEGSIDANLALSMRRAEAVRDRLVADYGVASERLRAEG
FT                   VGYLAPRATNRTEEGRRANRRVEAVLTQP"
FT   gene            complement(121186..122094)
FT                   /locus_tag="Dshi_0123"
FT   CDS_pept        complement(121186..122094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0123"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding KEGG: sit:TM1040_2460 transcriptional
FT                   regulator, LysR family, good RBS site AGGAT; LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91872"
FT                   /db_xref="GOA:A8LKM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKM9"
FT                   /protein_id="ABV91872.1"
FT                   /translation="MDRLTEMEAFATVVDQGGFTDAARKMGISKSAVSKHVSSLEARLG
FT                   ARLLNRTTRRVSPTEIGLAYYDRARHVLNDAGEADAMVNAMQSEPNGLLRISVATDFGV
FT                   KHLSPVLAGFLHQFPEIQINMVLNNRYVELISEGFDLALRVGDLEDSTLRARKLATTSK
FT                   RMIAAPSYLEKFGHPKRIDDLSDHKLLHYSNQSSGNLWKITAPSGEKRQVRTGGWLTVN
FT                   DGQSLLNAAKTGLGIAYLPSFLFEDALGRGDVVEVLPDLPYDDLGIYAVYPPGRFTQPK
FT                   VRAFIDFLVREFSAEKQAMSA"
FT   gene            complement(122240..122824)
FT                   /locus_tag="Dshi_0124"
FT   CDS_pept        complement(122240..122824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0124"
FT                   /product="intracellular protease"
FT                   /note="TIGRFAM: intracellular protease, PfpI family PFAM:
FT                   ThiJ/PfpI domain protein KEGG: jan:Jann_1867 peptidase C56,
FT                   PfpI; PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91873"
FT                   /db_xref="GOA:A8LKN0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN0"
FT                   /protein_id="ABV91873.1"
FT                   /translation="MDTRRETDMTEITKARILIIATHGFEQSELEVPRDKLRDAGAQVH
FT                   VASPDGNEIKGWDGDGWGRMAEVDLRIEDADSTQYDALVLPGGQINPDILRLDPAAIAL
FT                   IQAFRDRDRPVAAICHAPWLLIEAGLVAGREVTSWPSLRTDLANAGAQVVDVPVARDRG
FT                   LITSRNPDDFDAFVAAIIEEVEKGQIRADAA"
FT   gene            complement(122863..124881)
FT                   /gene="fadH"
FT                   /locus_tag="Dshi_0125"
FT   CDS_pept        complement(122863..124881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="Dshi_0125"
FT                   /product="NADPH:2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.3.1.34"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide oxidoreductase
FT                   KEGG: sit:TM1040_2458 NADH:flavin oxidoreductase/NADH
FT                   oxidase, high swissprot to 2,4-dienoyl-CoA reductase
FT                   [NADPH] from Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91874"
FT                   /db_xref="GOA:A8LKN1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN1"
FT                   /protein_id="ABV91874.1"
FT                   /translation="MTAYPNLLRPLELGHTTLRNRVLMGSMHTGLEETRDWNRVAEFYA
FT                   ARARGGAALMVTGGMAPNPEGGVFPGAAGLYTPEDIANHRVVTDRVHDADGKIAMQILH
FT                   AGRYAYSPDCVAPSAVKSPISPFAPRELDEAGIEKQIADIVTAAARAREAGYDGVEVMG
FT                   SEGYFLNQFLVTHTNRREDRWGGPYENRMRLPVEVVRRVRAAVGDDFIVIYRLSMIDLI
FT                   PNGSTWDEVVQLAHAIEGAGASILNTGIGWHEARIPTIATSVPRKAFAWVTRKLMGEVG
FT                   IPVITSNRINTPEIAEEVLAEGCADMVSMARPFLADPDFVAKAAAGRAATIAPCIACNQ
FT                   ACLDHTFSGKLSSCLVNPRACHETELRYEPTETPRRIAVVGAGPGGLSAALVAAERGHA
FT                   VTLFDRADRIGGQLNMARQIPGKEEFHGLVDWYETMVAERGIALRLNTDATPETVAGFD
FT                   EVIVATGVLPRDPGIPGQDAPNVLSYIDVLRRKAPVGDRVAIVGAGGIGFDVAEYLAHE
FT                   GESPTEVPELWRREWGVADPEDIRGGLAAEGPQPTPSPRQITLLQRKAEKLGKRLGKTT
FT                   GWIHRASLQMKGVRMLGGVQYEGIGPEGLRILRDGTPETLEVDTIVLCAGQVPERSLAD
FT                   ALSARGVPVHVIGGADVASELDAKRAIDQGARLAAAL"
FT   gene            complement(124985..125401)
FT                   /locus_tag="Dshi_0126"
FT   CDS_pept        complement(124985..125401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2681 hypothetical protein, bad
FT                   BLAST hits, no IPR Scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91875"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN2"
FT                   /protein_id="ABV91875.1"
FT                   /translation="MTETASGAGPTPFELVKTRFQGGLWEGRLTARAQVAGAPALRLIQ
FT                   DGTDHPAPRVTAVAGAPNAWDVRFAIPVSALGEGVSVFLVTDAETGAVLARVPLLAGED
FT                   LADDLRAEVALLRAELDQLRGAFQTAMRARLPND"
FT   gene            complement(125398..126168)
FT                   /locus_tag="Dshi_0127"
FT   CDS_pept        complement(125398..126168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2680 hypothetical protein; no
FT                   swissprot, no IPR Scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91876"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN3"
FT                   /protein_id="ABV91876.1"
FT                   /translation="MMLRRLNAWMSGGGERAAPPEWQDVMAPPAGCDRSVEVQQRDAAR
FT                   RARARADAEAREAEARLRQTQRPRPDLPTGAVWAQRPTAWHQATEDPIRIGPANGTRIT
FT                   PDLTLFHDCPKAEMILRQSLAPASAPAPFALILDTLHFEGSFLSLVTGLPDSEAAALSD
FT                   RDVLRIELRLEASAPTKLYGRLNMEQGPNTAQMLSEFSAPESGTCHAAFDLAYGDLRAQ
FT                   PVDHAWIDLIVERPAMLRLTLHDVLLSRYPRAEM"
FT   gene            complement(126287..126946)
FT                   /locus_tag="Dshi_0128"
FT   CDS_pept        complement(126287..126946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0063 hypothetical protein, no
FT                   significant swissprot, middle Ref hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91877"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN4"
FT                   /protein_id="ABV91877.1"
FT                   /translation="MKNTSTPISEIGGRMLAGLALLALAGCAELDGLGLAGGPVPPEAT
FT                   VTVSRSAVTISGPRGFCVDPSATKDRDGQAFVLLGNCAAITRSGAAPQPRIRALLTAAV
FT                   RETQAIEVAEQAPLLEAFLRSDNGRAMLSRESDPATVDILESFQQGDVLYVHARDDSEG
FT                   YAPGMSSDHWRAIFDLDGRVVSVAVLGFEANPLSRAEGLRAVREFAARIQRDNPAL"
FT   gene            complement(126918..128651)
FT                   /gene="ilvD1"
FT                   /locus_tag="Dshi_0129"
FT   CDS_pept        complement(126918..128651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD1"
FT                   /locus_tag="Dshi_0129"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: rde:RD1_0332 dihydroxy-acid dehydratase
FT                   TIGRFAM: dihydroxy-acid dehydratase PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase; Swissprot: high
FT                   similarity to dihydroxyacid dehydratase from Loktanella
FT                   vestfoldensis SKA53"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91878"
FT                   /db_xref="GOA:A8LKN5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKN5"
FT                   /protein_id="ABV91878.1"
FT                   /translation="MLKRSFDKSKLPSRHVTEGPSRAPHRSYYYAMGMTEEEIHQPLVG
FT                   VATCWNEAAPCNIALSRQAQAVKMGVKQASGTPREFTTITVTDGIAMGHEGMRSSLASR
FT                   EAIADTVELTMRGHCYDAIVGLAGCDKSLPGMMMAMVRLNVPSVFIYGGSILPGRLNGE
FT                   DVTVQDVFEAVGKHQAGNYTDAELEVLERVACPSAGACGGQFTANTMACVSEAIGLALP
FT                   NSAGAPAPYESRDQYGEASGRAVMDLIEKGIRARDIVTRKSLENAARIVACTGGSTNAG
FT                   LHLPAIAHEAGIEFTLQDVCDIFRDTPYFVDLKPGGKYVAKDMYEAGGVPVVMRELRRA
FT                   GLIHEDCMTVTGYSIGEELDKVTLEADGRVIYPVDTPLSTTGGVVGLEGNLAPEGAIVK
FT                   IAGMSDDQLVFTGPARVFECEEDAFEAVQNRAYAEGDVFVIRNEGPAGGPGMREMLATT
FT                   AALSGQGMGKKVALITDGRFSGATRGFCVGHVGPEAAHGGPIAMLKDGDMITIDALKGE
FT                   LSVALSEDELAARKDAWSGPRETIYASGALWKYAQLVGGARLGAVTHPGAKDEKHIYAD
FT                   L"
FT   gene            128795..129697
FT                   /gene="abi"
FT                   /locus_tag="Dshi_0130"
FT   CDS_pept        128795..129697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abi"
FT                   /locus_tag="Dshi_0130"
FT                   /product="abortive infection protein"
FT                   /note="PFAM: Abortive infection protein KEGG: jan:Jann_0061
FT                   abortive infection protein, no significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91879"
FT                   /db_xref="GOA:A8LKN6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN6"
FT                   /protein_id="ABV91879.1"
FT                   /translation="MSLSRSLWTPEFDHFTEPARRRAGLGWLVLGCVLVIGIYAASLMG
FT                   IFGAIGLIGGEGAAAQWLLRVQTAAGPTATLLLLATFGGLVLGLWACLRLVHRRPLGSV
FT                   IGAREQTARDFRRASVITLAGMGLSLLLFLPGMEILPNLPLGIWVSFLPLALLMIALQT
FT                   GAEEMLFRGYLQQQLAARFSSPLVWMLLPSALFGAAHYDPTTAGDTALQVALAAGIFGL
FT                   MAADLTRLTGNIGAAWGMHFANNCMAILGVSVQGTIPGLSLYTTELAISDTAEISVLLW
FT                   QDMALTLLFYLAIRWVVTR"
FT   gene            129763..130725
FT                   /gene="accD"
FT                   /locus_tag="Dshi_0131"
FT   CDS_pept        129763..130725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="Dshi_0131"
FT                   /product="acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit KEGG: pde:Pden_1987 acetyl-CoA
FT                   carboxylase, carboxyl transferase, beta subunit, high
FT                   swissprot; carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91880"
FT                   /db_xref="GOA:A8LKN7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKN7"
FT                   /protein_id="ABV91880.1"
FT                   /translation="MNWISNYVRPTINSLFSRREVPENLWRKCPECGTMLFHRELSDNL
FT                   FVCISCDHHMAITPRQRFEALFDGGVFSEVKVPAPIADPLQFKDQKKYPERMKSAVKAT
FT                   GEPEAMLVAEGEIGRTPIVAAAQDFSFMGGSMGMYVGNAIIAAAERAVALKRPLILFSA
FT                   AGGARMQEGILSLMQMPRTTVAVQMLKEAGLPYIVVLTHPTTGGVTASYAMLGDVQIAE
FT                   PNALICFAGPRVIEQTIREKLPEGFQRAEYLLDHGMLDRVTHRMKLRDELIRITRMLLG
FT                   LGPAIVGDLPAPDPAPATPEPQKAAPSAPAQDKPGAGRS"
FT   gene            130730..131998
FT                   /gene="folC"
FT                   /locus_tag="Dshi_0132"
FT   CDS_pept        130730..131998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Dshi_0132"
FT                   /product="folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="TIGRFAM: FolC bifunctional protein PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein KEGG: sil:SPO3818 FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91881"
FT                   /db_xref="GOA:A8LKN8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN8"
FT                   /protein_id="ABV91881.1"
FT                   /translation="MNAPGSDLLLERLMTLHPKIIDLTLDRVWRLLATLDHPERRLPPV
FT                   VHIAGTNGKGSTLAMIRAGLEGAGQTCHAYTSPHLARFHERIRLAGELISEPDLAALLA
FT                   ECETANGGAPITYFEITTVAALLAFARTPADWTLLEVGLGGRLDATNVIDTPALCVITP
FT                   VSYDHQQFLGDTLPEIAGEKAGILKRGVTCVVGPQQDAALEVIEDRAARVGAPLRAHGQ
FT                   HWHVSVEHERLVYQDETGLLDLPLPVLPGPHQIENAGMALAALRALGTGDPEPALTKAQ
FT                   WPARMQRLRHGPLVELAPEVELWLDGGHNPAAGLALAATLAGLPERPTYLICGMLKTKD
FT                   VAGFLRPLAARAKALHAVSIPGEAATLTAAETAAHAAALGLPSLQAANVAAALAQIAAE
FT                   DPGARVVICGSLYLAGAVLRENG"
FT   gene            132102..133061
FT                   /locus_tag="Dshi_0133"
FT   CDS_pept        132102..133061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0133"
FT                   /product="putative type I secretion target repeat protein"
FT                   /note="KEGG: sil:SPO2586 type I secretion target repeat
FT                   protein, middle Ref ZP hit, no swissprot, hedgehog domain:
FT                   in eukaryotes involved in cell growth and differentiation"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91882"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKN9"
FT                   /protein_id="ABV91882.1"
FT                   /translation="MAKSDGDHTYTSLGWPNDAYYLAEGTELNVMKMSLVDKDEDGDIG
FT                   PGDMINGLEVTDSYLGDWIGFDSGEGEQWVYGVTFYLEDGSQVFMATDGTQLQDAKSTG
FT                   CKWVLESTDVPVKQITAPCFVAGTRILTPEGVVPVETLRPGDLVQTRDHGAQPVLWVGR
FT                   RTLPGSEALAPIRFSPDALGSDRPLYVSPQHRMLLSDPRLLLLFEEAEVLAAALHLVNG
FT                   HSVVQAPRARVTYIHLLFARHEIVYAEGIPSESFHPGMAGLAGFGDAARDELLGFFPQL
FT                   ADLDAGFGPCARRVLRAHEAAVAAQLVIGRGAHAAMAA"
FT   gene            complement(133058..133351)
FT                   /gene="pcd"
FT                   /locus_tag="Dshi_0134"
FT   CDS_pept        complement(133058..133351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcd"
FT                   /locus_tag="Dshi_0134"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="PFAM: transcriptional coactivator/pterin dehydratase
FT                   KEGG: rde:RD1_0944 pterin-4-alpha-carbinolamine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91883"
FT                   /db_xref="GOA:A8LKP0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKP0"
FT                   /protein_id="ABV91883.1"
FT                   /translation="MAQKLDDSTRDEHLAPLMRAGWEMVEGRDAIKKTFVFGDFTEAFA
FT                   FMTGTALWAEKWDHHPEWSNVYKTVEVTLTTHDVGGLSELDIKLASKMDNLA"
FT   gene            complement(133351..134571)
FT                   /locus_tag="Dshi_0135"
FT   CDS_pept        complement(133351..134571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0135"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482 KEGG:
FT                   sil:SPO3732 hypothetical protein, no swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91884"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP1"
FT                   /protein_id="ABV91884.1"
FT                   /translation="MIPDPLPDPDRAAARETQIEISVVGRLDEIGAADWDACACPEVAD
FT                   GGRPDDPFTTYRFLHALEASGSIGAGSGWGPRYLVARTEDQVIAVAPLYAKSHSQGEFI
FT                   FDHNWAHAYERAGGRYYPKLQIAVPFTPATGRRLLVRPGYEGIGQSALVQGAVQVAAEA
FT                   EVSSLHITFCTEAEAEAGAAMGLMHRVSQQFHWVNRGYADFDGFLADLSSRKRKNIRKE
FT                   RQTAHAFGGEIQQITRDDLRPEHWDAFWVFYQDTGARKWGTPYLTRRFFDIAQETLRDD
FT                   MMLVLAHRAGRPVAGALNFVGRDALYGRYWGCVEDHPCLHFEACYYQAIEFAIAHGLGT
FT                   VEAGAQGAHKLARGYLPAQTHSLHWVRDQGFAEAIQRYLEAEKDAVGEEIEVMTSYGPF
FT                   KKTLSED"
FT   gene            complement(134622..135395)
FT                   /gene="ugpQ"
FT                   /locus_tag="Dshi_0136"
FT   CDS_pept        complement(134622..135395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="Dshi_0136"
FT                   /product="cytosolic glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase
FT                   KEGG: jan:Jann_0436 glycerophosphoryl diester
FT                   phosphodiesterase PRK: ugpQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91885"
FT                   /db_xref="GOA:A8LKP2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP2"
FT                   /protein_id="ABV91885.1"
FT                   /translation="MTPPLPRAFVTRPLAHRGLHDPTTARIENSRAAIEAAMQAGYGIE
FT                   IDVQLTADGAALVFHDAELDRLTGETGPVRARSLAALQAIRLRGAADGPPELSEVMAHV
FT                   GGRVPLLIELKDQSGSLGPESEALAAAVAGVIGAATDNIAVMSFNPHTVQHLARLLPSV
FT                   PRGLTTMDFRTENTLSPEQQVRLNAIATFDAVGASFISHDRRSLDMDAVTRLRHRGVPV
FT                   LTWTITSPAEAREALQAADNITFEGFLPPRPVPEA"
FT   gene            complement(135392..135859)
FT                   /locus_tag="Dshi_0137"
FT   CDS_pept        complement(135392..135859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0137"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP COG0251-Putative
FT                   translation initiation inhibitor, yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91886"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP3"
FT                   /protein_id="ABV91886.1"
FT                   /translation="MSGKFETRLAELGVSLPDAAAPAANYVPFVIVGNMVHVSGQLPAA
FT                   DGNMVLGKLGADLDVDAGAAAAKRCAINLLAQVKVACGGDLDRLERVVKLVGFVNSTPD
FT                   FEDQPKVINGASDFMVEALGDTGRHARSAVSAAALPFGVAVEIEGLFQIRP"
FT   gene            complement(135882..137189)
FT                   /gene="hlyD"
FT                   /locus_tag="Dshi_0138"
FT   CDS_pept        complement(135882..137189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyD"
FT                   /locus_tag="Dshi_0138"
FT                   /product="type I secretion membrane fusion protein"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family PFAM: secretion protein HlyD family protein
FT                   KEGG: sil:SPO3729 type I secretion membrane fusion protein,
FT                   HlyD family; also middle swissprot hit to Proteases
FT                   secretion protein prtE from Erwinia chrysanthemi; HlyD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91887"
FT                   /db_xref="GOA:A8LKP4"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP4"
FT                   /protein_id="ABV91887.1"
FT                   /translation="MTGPAAKKFPARRQLLIGGIALAILVGGFGSWSVMANIAGAIIAP
FT                   GQIEVDQNRQVVQHPDGGVVQRIAVDEGDTVATGDLLIQLDPTLLQTDLSIVEGQLFEL
FT                   MARRALLVAERDGQEEVIFDEELLLVSATSPEVADVMDGQRRLFEARNTSVETETEQLT
FT                   RRRAQIGNQIEGIEAQQTALTQQLDLIEQELADQQSLLDRGLAQASRVLSLQREQARLL
FT                   GSVGELTASKAEFEGRQTEIDIEILKLSTSRREEAISRLRDTQAQESELKQQRQALRER
FT                   LSRLDIRAPLGGIVYDLSVFAERSVIRPAEPVLYIVPQDRPLIITSRVNPINVDEVYVG
FT                   QEVNLRFSAFDQRLTPELKGKVVSVSPDAFVDEATGASFYRVETAPQEGEMEKLEGLDL
FT                   IPGMPVEAFIRTADRTPIEYFVKPLSDYFNRAFREG"
FT   gene            complement(137186..138925)
FT                   /locus_tag="Dshi_0139"
FT   CDS_pept        complement(137186..138925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0139"
FT                   /product="type I secretion system ATPase"
FT                   /note="TIGRFAM: type I secretion system ATPase PFAM: ABC
FT                   transporter related contains:pfam00005 pfam00664"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91888"
FT                   /db_xref="GOA:A8LKP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP5"
FT                   /protein_id="ABV91888.1"
FT                   /translation="MAPRTSPNAGKGLEELGAIRRANMPLFAWVFVFSIFVNALMLTGP
FT                   LYMLQVYDRVLGSQSEETLLALSVLVAFLFLMMGILDWARGRVLARAGARMQDTLDQRV
FT                   FSASLRKSLRQGQTTASTGLRDLESMQRLLSSPALLAVFDIPWTPLFVAAIFMFHPWLG
FT                   YLALVGGTFLILVTVLNQWLTSRPVSKANEASARAEMMSQQLAGGAETVESLGMRGAAF
FT                   TRWSKVRAESLSETLTSSDRTGGFSTLTKTFRLFLQSAMLGLGAYLVLQGQLTAGAMIA
FT                   GSILMGRALAPIEMAIGQWPLVQRAMKGRRDLIELLDAIPPDPERTPLPKPKARLVVEQ
FT                   LIVVPPGEAQAALRSVSFTVSPGEACGVIGQSGAGKSTLARALTGIWPVAGGKIRLDGA
FT                   ALDQFGPDVLGTHIGYLPQQVVLFDGTIAENIARLAPQPDAQAVVDAAKRADAHEMILK
FT                   LPKGYDTMLLGSQTRLSGGQMQRIGLARALYGDPVLLVLDEPNSNLDNSGSQALNAAVA
FT                   RMKKDGKAVLIMAHRPAAIEQCDTLLVLEGGSRKAFGPRDEVLKSMVSNHKEILKKAAG
FT                   GVS"
FT   gene            139098..139919
FT                   /locus_tag="Dshi_0140"
FT   CDS_pept        139098..139919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0140"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein KEGG: rsp:RSP_0891
FT                   putative lipoprotein, middle swissprot to Lipoprotein vacJ
FT                   precursor from Shigella flexneri"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91889"
FT                   /db_xref="GOA:A8LKP6"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP6"
FT                   /protein_id="ABV91889.1"
FT                   /translation="MFQSLTRALVCLAVITTLGACASPNRPDEVIDPFEPANRGVHNFN
FT                   KALDKAILREASEAYVTLVPDPLVQGISNATGNLEQPARILNNVLQGRAENALHNMFRF
FT                   LVNTTMGLGGLLDPATAMGLQELDTDFGETMYVWGVGEGPFVSVPLLGPHTSRHLSGRA
FT                   VDIVIDPIGELVTFTRPLTVRAGLFTVEQLKDRAEFGSVVDDLLYNSIDSYASTRILYL
FT                   QNRRFRLGSGTGNDYLDPYDDFGGDPSVALIEGGAPADDLYFDPYEDPYVE"
FT   gene            139909..140529
FT                   /gene="ttg2D"
FT                   /locus_tag="Dshi_0141"
FT   CDS_pept        139909..140529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttg2D"
FT                   /locus_tag="Dshi_0141"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein KEGG:
FT                   rde:RD1_0939 toluene tolerance family protein, putative;
FT                   swissprot hit to Protein yrbC precursor from Escherichia
FT                   coli K12 (ABC transporter related)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91890"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP7"
FT                   /protein_id="ABV91890.1"
FT                   /translation="MSSNLSRRRVLRTLGAFALSLPFAGLLGPRPVQALNTNEAKDLVG
FT                   RLVGEIDAAINSGKTGSALYREFERIFERYADVDIIAQSVLGVEWRSASNAQRRAYTDA
FT                   FKTYISRKYGRRFQEFVGGRIEVNSARPVRSFFEVKSTAFLRGEAPFEVIFLVSDRSGR
FT                   DLFFNIVIEGVNLAITERTEIGALLDRNGGNLDAMIQALRNTT"
FT   gene            complement(140693..142882)
FT                   /gene="mrcB"
FT                   /locus_tag="Dshi_0142"
FT   CDS_pept        complement(140693..142882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="Dshi_0142"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rde:RD1_0938 penicillin-binding protein, 1A
FT                   family TIGRFAM: penicillin-binding protein, 1A family PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91891"
FT                   /db_xref="GOA:A8LKP8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP8"
FT                   /protein_id="ABV91891.1"
FT                   /translation="MLRADARSAGHPAKARTAAAKAPAKPKPKPRRKTAAKRRSSARSG
FT                   PPRGLFGRLFWAIRRLIGWILGLIFAITWRGIAVLLLILAGSVAYHYSTLPPALQLTDG
FT                   RVRGSVTLLDRDGDVYAWRGDQFGGVIDANTVSPHLKNAIIATEDRRFYQHFGISPRGI
FT                   ASAVRINLREGRGPLSGHGGSTITQQVAKLLCLGTPYKPESGMTEAEYEADCRRGGIWR
FT                   KVKEVPYSLALEAAYTKDEILTIYLNRAYLGAGARGFEAASQRYFGKSAAEVDPAEAAM
FT                   LAGLLVAPSRFAPTNDLERSQRRAATILRLMEQEGYLSATDAAVARANPATLSEAAERR
FT                   AGGYFADWVMEEGPNFLTSETTEDVIIRTTFDQDIQAAAEEALKYVFETKVSPGSKAQA
FT                   AIVVMSADGAVRAMVGGRKLQVSGAFNRATQALRQTGSAFKPFVYAAALDLGYRPNDMI
FT                   LDAPLTIDIPGSGPWSPRNYTNNFYGEVTLTEALKNSLNTPAVRLSEQVGRENVRKVAS
FT                   DFGIAREMAPGPALALGASESTLLEMTAAYAGILNGGSSVAPYGLTELRLLGDSEPLMG
FT                   QAGGIGERVVSQRAAQELTFMMFQVIETGTGGRAKLPDGRQAAGKTGTTQAARDAWFVG
FT                   FTADYVAGIWMGYDDNTPLTGVTGGGLPAEIWRETMRRVHEGDPQRPLPMTLPPPRVEP
FT                   APQIARQERPQIEDQIRNAAERVLRDVLGGLLGRN"
FT   gene            143197..143535
FT                   /gene="glnK"
FT                   /locus_tag="Dshi_0143"
FT   CDS_pept        143197..143535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="Dshi_0143"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II KEGG:
FT                   jan:Jann_4056 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK), glnK-amtB-Operon (amtB: Dshi_1838); highly conserved
FT                   gene cluster (e.g. E. coli, R. capsulatus)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91892"
FT                   /db_xref="GOA:A8LKP9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKP9"
FT                   /protein_id="ABV91892.1"
FT                   /translation="MKLIIAAIKPFKLEEVREALTSIGVRGMMVTEIKGFGSQSGHTEI
FT                   YRGAEYAVNFVPKVKLEIVVGDTMADQVVETIQTTAKTDKIGDGKIFVLDVQQAVRVRT
FT                   GETNDDAL"
FT   gene            143570..144883
FT                   /gene="amtB"
FT                   /locus_tag="Dshi_0144"
FT   CDS_pept        143570..144883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="Dshi_0144"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter PFAM: Rh family
FT                   protein/ammonium transporter KEGG: sit:TM1040_2630 ammonium
FT                   transporter, high swissprot to Putative ammonium
FT                   transporter sll0108 from Synechocystis sp. PCC 6803;
FT                   sequence homolgies; gene arrangement (-> glnK, Dshi_0143)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91893"
FT                   /db_xref="GOA:A8LKQ0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ0"
FT                   /protein_id="ABV91893.1"
FT                   /translation="MKLTKLLPLAAAAIVLPSLGLAQDAAPSFDEIGPYIMTTLLFCMA
FT                   GFLVFFMACGFAMLEGGLVRSKNVTMQMTKNIALYSIAAVMYWLIGFNLMYPGDFNGYV
FT                   GSFFVPTVLDPVGVAAADAALDYASIGSDFFFQLVFVAATASIVSGALAERIKLWPFLA
FT                   FVVVLTGIMYPISGSWQWGGGWLSEMGFSDFAGSTVVHSVGGWAALAGAIILGPRLGKY
FT                   KDGRVNPMPGSNLALATLGTFILWLGWFGFNGGSQLAMGTVGDVSDVSRIFANTNMAAA
FT                   AGALTALILTQVLYKKPDLTMVLNGALAGLVSITASPLDPTLFGALWIGAVGGVIVVFT
FT                   VPLLDKFKIDDVVGAIPVHLFAGIWGTIAVVFYQEGASLVTQLVGIAAYGVFTFGVGLI
FT                   VWYLLKLTMGIRVSEEDEINGLDTSELGMEAYPDFTKG"
FT   gene            complement(145044..146222)
FT                   /locus_tag="Dshi_0145"
FT   CDS_pept        complement(145044..146222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0145"
FT                   /product="amino-acid aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91894"
FT                   /db_xref="GOA:A8LKQ1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ1"
FT                   /protein_id="ABV91894.1"
FT                   /translation="MFAHLRPQADDPILVLMRAFQADPRPGKVDLGIGVWRDAEGRTPV
FT                   FGAVKTAEERLWRTQDTKSYVSFAGDPAFHAAVGDLLLGSVTRPRAVTATTGGTSAVQT
FT                   LLALSQVARPAAQVWIPAETWPNHRVLAEHLGLATRAFTYLAPEGTGIDREVLLRDLAQ
FT                   AQAGDVVILHACCHNPTGIDPDPELQAEIVDSLARTGAVPLVDCAYLGFGAVPEADAAF
FT                   LRRLASLPEAMLAFSGSKSFGLYRERVGLALVLLEQPGVVEAVQSQLTRLNRVNYSFPP
FT                   DHGARVVTEILADPALRTAWEAELAAIRTALSANRQALAKALRARLQSDRFDGLAAQSG
FT                   MFAMLPLGKERVMRMREDFAVYAVGTGRVNLAGVTPRTTDRVAEAIAAVLRD"
FT   gene            complement(146231..147106)
FT                   /gene="sseA"
FT                   /locus_tag="Dshi_0146"
FT   CDS_pept        complement(146231..147106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="Dshi_0146"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="PFAM: Rhodanese domain protein KEGG:
FT                   rsh:Rsph17029_2544 3-mercaptopyruvate sulfurtransferase;
FT                   both, high swissprot and Ref YP hits to 3-mercaptopyruvate
FT                   sulfurtransferase (sseA)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91895"
FT                   /db_xref="GOA:A8LKQ2"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ2"
FT                   /protein_id="ABV91895.1"
FT                   /translation="MLNKAAGPVSQDDPKTLVSTDWLEAHLSNPDLRVLDASSYLPGSG
FT                   RDPKAEYDAAHIPGARFVAIDDVSDARSDLPHMAPPVEKFMSRMRALGVGDGHQVVVYD
FT                   GAGLFSAARMWWLFRLMGKTDIAVLDGGFPKWQAEGRPVEDLPPVVRDRHMTVQRQAHL
FT                   VKDVTQVAAAAKLGEPQVVDARSAGRFRGEEPEPRAGLRAGHIPGSKNLHYATLLAEDG
FT                   TMKPLDELRAAFVAAGVDLDKPVITTCGSGVTAAILSLALERLGHRDHSLYDGSWSEWG
FT                   MYGDLKVATG"
FT   gene            complement(147392..147874)
FT                   /gene="smpB"
FT                   /locus_tag="Dshi_0147"
FT   CDS_pept        complement(147392..147874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="Dshi_0147"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein PFAM: SmpB protein
FT                   KEGG: jan:Jann_0031 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91896"
FT                   /db_xref="GOA:A8LKQ3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKQ3"
FT                   /protein_id="ABV91896.1"
FT                   /translation="MAKPKTPEEKNYKVIAENRRARREYAIEEDLEVGIVLEGSEVKSL
FT                   REGGSNIAESYATVDDGELWLVNSYIAPYAQAKTWKHEERRRRKLLVSRRELSRLWNAT
FT                   QRQGMTLVPLVMYFNHRGLVKLKIGVAKGKKLADKRQTDAKRDWNRQKQRLLKQNL"
FT   gene            complement(147905..148354)
FT                   /locus_tag="Dshi_0148"
FT   CDS_pept        complement(147905..148354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0148"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase KEGG:
FT                   bur:Bcep18194_B2857 GCN5-related N-acetyltransferase, bad
FT                   BLAST hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91897"
FT                   /db_xref="GOA:A8LKQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ4"
FT                   /protein_id="ABV91897.1"
FT                   /translation="MTGSDLSLRPRLAADLEALCVIWEAATRSTHPFLPEKVIATERAA
FT                   LAETYFPATRTLVAVRGGRVVGFGSMRGAELAGLFVAPEAQRSGVGRALVAELCAGMAV
FT                   TLEVYTLNMHGRAAYHRLGFVETGRRVDTATGLERVQMVRPAESA"
FT   gene            complement(148351..149226)
FT                   /gene="dapA"
FT                   /locus_tag="Dshi_0149"
FT   CDS_pept        complement(148351..149226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="Dshi_0149"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: sil:SPO3556 dihydrodipicolinate synthase
FT                   TIGRFAM: dihydrodipicolinate synthase PFAM:
FT                   dihydrodipicolinate synthetase; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91898"
FT                   /db_xref="GOA:A8LKQ5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LKQ5"
FT                   /protein_id="ABV91898.1"
FT                   /translation="MFKGSMPALVTPMKDGAVDFATLEALVEWQIAEGSHGLVPVGTTG
FT                   ESPTLSHEEHEAVVAKVIEVAAGRVPVIAGAGSNNTVEAVRFVRHAKDAGADGALVVTP
FT                   YYNKPTQGGMIAHYTALAEAADIPIVIYNIPGRSVVDMTPATMAALAALPTIVGVKDAT
FT                   GDLARVSQTRMACGPEFIQLSGEDATALGFNAHGGVGCISVTANVAPALCAQFQEATLA
FT                   GDFATALALQDKLMPLHEAIFVEPGLVGAKYALSLLGKCSEDVRLPLLGLSDGTKVLIK
FT                   DAMIHAGILG"
FT   gene            149400..151349
FT                   /locus_tag="Dshi_0150"
FT   CDS_pept        149400..151349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0150"
FT                   /product="putative lytic transglycosylase catalytic"
FT                   /EC_number="3.2.1.-"
FT                   /note="PFAM: Lytic transglycosylase catalytic KEGG:
FT                   rsh:Rsph17029_2541 lytic transglycosylase, catalytic;
FT                   swissprot to Putative soluble lytic murein transglycosylase
FT                   precursor from Haemophilus influenzae; IPR Scan: domain to
FT                   bacterial muramidases superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91899"
FT                   /db_xref="GOA:A8LKQ6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ6"
FT                   /protein_id="ABV91899.1"
FT                   /translation="MAGKAIRVFFMVMAAVGLVAQAAPVRADLAEALQATRSSDWDRAT
FT                   RAAAALEDQAARDVVIWTLLRARQGSWQDYRDFLARNSDWPGLPLLRARGEDAIPENAA
FT                   PADVLAYFAPQAPRTGTGARRLAAAQAATGDAEGAVETLATAWRHLNLDREEQAIFLRE
FT                   HFREITPQNIARLDRLLWEGRTGDARAMLDSVPPAWQRLAEARIALRIDQPGVDGLIAA
FT                   VPAALQDHPGLAYERFQWRLRKGRIDSARELLDAQSTSAAALGDPEAWANRRRSLARDL
FT                   MRDDRDREAYRLAANHFLTEGNHYADLEWLSGFIALRKLNDPETALGHFRRFEDAVASP
FT                   ISLGRAGYWQGRALEALGRPNEARAAYAMGAEHQTAFYGQLAAERAGIAPDPALAGRET
FT                   YPDWAASPYARTSVFRAARALQQAGQRSLAERFLVHLSERLTLEEMGALADVALAWDEP
FT                   HIALKIAKFAAEDGRVLHRAYHPVTNLVPGQGLAVNRALALAIARRESEFDPAVVSPAG
FT                   ARGLMQLMPGTGELMAGKLGEPFSAARLLSDPAQNVRFGAAYLDQLIEEFGENLTLIAI
FT                   GYNAGPGRSRSWTERFGSPKGLDEDAMVDWIEHVPFRETRNYIMRVTESRVIYEMRLTG
FT                   RAQPFRVIERLTAR"
FT   gene            complement(151387..152265)
FT                   /locus_tag="Dshi_0151"
FT   CDS_pept        complement(151387..152265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0151"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6 transmembrane
FT                   KEGG: jan:Jann_0141 protein of unknown function DUF6,
FT                   transmembrane, swissprot hit to S-adenosylmethionine uptake
FT                   transporter from Rickettsia typhi (DMT related)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91900"
FT                   /db_xref="GOA:A8LKQ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ7"
FT                   /protein_id="ABV91900.1"
FT                   /translation="MTAQNTRLGIWLMIVTTVVFALQDGISRHLAAEYNVLMVVMIRYW
FT                   FFAAFVVTLATRQAGGVRAAARTEQPVLQAFRAVLLVAEICIMVTAFVLLGLVESHAVF
FT                   TCYPLLIAALSGPVLGEKVGWRRWCAIGVGFVGVLIILQPSGGVFAVEALVPLAAAFGF
FT                   ALYGLLTRYAARKDSAQTSFFWTGTVGAVAITAVGVWGWEPMSAPDWGWMGALCVTGAL
FT                   GHYLLIKCYEVAEASAVQPFAYLQLVWGAMLGVSVFGEQIRWNVALGAALVVAAGIFTL
FT                   WRAQVAAARAR"
FT   gene            complement(152262..152954)
FT                   /locus_tag="Dshi_0152"
FT   CDS_pept        complement(152262..152954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0152"
FT                   /product="protein of unknown function DUF752"
FT                   /note="PFAM: protein of unknown function DUF752 KEGG:
FT                   sil:SPO3553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91901"
FT                   /db_xref="GOA:A8LKQ8"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ8"
FT                   /protein_id="ABV91901.1"
FT                   /translation="MQGQNLGQISGQRAEVTWTEGVPVSARFDDPYYSKADGLAETRHV
FT                   FVAGNELPARFVPGFAVAELGFGTGLTLAVMRAAWRGAGIAGPLRFTSFEAFPMAVPEM
FT                   RAALATFPGVAAELADVLAALEGGAVVVEAADLSFELVLGDARETVPGWHGCADAWCLD
FT                   GFSPAKNPELWEPTLLAAVAARTAPGGSFATYTAAGAVRRALAEAGFEVTRAPGFGRKR
FT                   HMSRGRLP"
FT   gene            153035..154093
FT                   /gene="dao"
FT                   /locus_tag="Dshi_0153"
FT   CDS_pept        153035..154093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dao"
FT                   /locus_tag="Dshi_0153"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase KEGG: sil:SPO3552
FT                   oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91902"
FT                   /db_xref="GOA:A8LKQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKQ9"
FT                   /protein_id="ABV91902.1"
FT                   /translation="MAIPDVTVLGAGILGLSAAYACARRGARVRVIETHHVGAGSSGGV
FT                   VGALAPHTPEKWNPKKQVQFDSLIRAEAWWTEIAGATGCDPGYARLGRLQPIADDRALA
FT                   LARDRAQQAETLWQGRAAWHIRPATEFANWAPVTSTGLVTHDTLTARLHPAKACAAMAA
FT                   ALQGLGAEILIGDHAPTGKVIEATGAAGLAELSGHFGVQVGNGVKGQAAVLGYDARTLP
FT                   QLFVDGLHIVPHTDGTTAVGSTSERDYTDPTGTDALLDAVIARARAAVPVLRDAPVRAR
FT                   WAGLRPRAKSHAPMLGAHPLRPDRVILNGGFKIGFGMAPELAEMAADLILDGRARIPPE
FT                   FDPAASLPKPTP"
FT   gene            complement(154275..154820)
FT                   /locus_tag="Dshi_0154"
FT   CDS_pept        complement(154275..154820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0154"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase KEGG: sit:TM1040_2447
FT                   NADPH-dependent FMN reductase; predicted flavoprotein
FT                   COG0431"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91903"
FT                   /db_xref="GOA:A8LKR0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR0"
FT                   /protein_id="ABV91903.1"
FT                   /translation="MTQPRLLGLSGSLRAGSFNTQLMREAAARFGPAEFSEGNLRLPLY
FT                   DGDLESAEGIPAEVQMLADQIAAADAVIIASPEYNQSLTGVLKNALDWVSRLEGKPWAG
FT                   KPVAIVAAAAGRAGGARGTYALRLAMMPFGAHVLPGPEVLVAGAFREFDSEGKLITESY
FT                   QKILDALMAELRKAAMAG"
FT   gene            155531..155887
FT                   /gene="lrgA"
FT                   /locus_tag="Dshi_0155"
FT   CDS_pept        155531..155887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="Dshi_0155"
FT                   /product="putative LrgA family protein"
FT                   /note="PFAM: LrgA family protein; bad Ref ZP hit to
FT                   hypothetical protein RAZWK3B_06232 from Roseobacter sp.
FT                   AzwK-3b no significant swissprot hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91904"
FT                   /db_xref="GOA:A8LKR1"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR1"
FT                   /protein_id="ABV91904.1"
FT                   /translation="MILHLLVLLVFQLIGEVLARSLGLLVPGPVLGLVLLLGFFLVLPQ
FT                   VAEAVRPTANALLAHLSLLFVPAGVGVVAHLDVLGENGVPLLIALVISTLVAISVGALV
FT                   FVGVARLIGDAGDD"
FT   gene            155880..156596
FT                   /gene="lrgB"
FT                   /locus_tag="Dshi_0156"
FT   CDS_pept        155880..156596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="Dshi_0156"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein KEGG: pde:Pden_2740 LrgB
FT                   family protein; gene arrangement wtih Dshi_0155 putative
FT                   LrgA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91905"
FT                   /db_xref="GOA:A8LKR2"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR2"
FT                   /protein_id="ABV91905.1"
FT                   /translation="MTELSAIWVYLSSEPLLWLTATLAAYVAGDALSKLSGRAPLVNPV
FT                   LVAVALLALVLWASGTAYDTYFEGAQFVHFMLGPATVALAAPLHANLAKVRRAALPMIA
FT                   ALFAGSLAAMATAVGVGYALGLRGEVLMSLAPKSATAPVALGIAENIGGLPTLTAVLVI
FT                   LTGIIGAVAATPLLNLLRIRDWRARGFAVGVAAHGIGTARAFQVNETAGAFAGIGMGVN
FT                   AVLTAVLAPLLLGLIF"
FT   gene            156608..157222
FT                   /gene="cobA2"
FT                   /locus_tag="Dshi_0157"
FT   CDS_pept        156608..157222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA2"
FT                   /locus_tag="Dshi_0157"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: ret:RHE_CH02488 cob(I)alamin
FT                   adenosyltransferase protein TIGRFAM: cob(I)alamin
FT                   adenosyltransferase PFAM: ATP:corrinoid adenosyltransferase
FT                   BtuR/CobO/CobP, good swissprot hits, good RBS site AGGAT,
FT                   the following genes are also involved in the vit. B12
FT                   biosynthese; alternative gene name: cobO/btuR"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91906"
FT                   /db_xref="GOA:A8LKR3"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR3"
FT                   /protein_id="ABV91906.1"
FT                   /translation="MTDADDTARHNAKMAKKKAARDKIMATKTDEKGLIIVHTGKGKGK
FT                   SSAAFGMIFRCIAHGMPCAVVQFIKGGMSTGERDLILSTFSDKCAFHTMGEGFTWETQD
FT                   KDRDIEMAQAAWEKAKELIRDPANKMVLLDEINIALRYDYLNLEDVLTFLADEKPEMTH
FT                   VVLTGRNAKEPLIEAADLVTEMELVKHPFRAGIKAQIGVEY"
FT   gene            complement(157466..161173)
FT                   /gene="cobN"
FT                   /locus_tag="Dshi_0158"
FT   CDS_pept        complement(157466..161173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobN"
FT                   /locus_tag="Dshi_0158"
FT                   /product="cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: bov:BOV_1269 cobaltochelatase, CobN subunit
FT                   TIGRFAM: cobaltochelatase, CobN subunit PFAM:
FT                   CobN/magnesium chelatase; swissprot: high similarity to
FT                   aerobic cobaltochelatase subunit cobN from Pseudomonas
FT                   denitrificans; gene arangement from Dshi_0157 to Dshi_0166
FT                   Vit B12 synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91907"
FT                   /db_xref="GOA:A8LKR4"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR4"
FT                   /protein_id="ABV91907.1"
FT                   /translation="MHLLAATPGSIDDGQEPVDLGQTPADLVVISAADTELAGLSAARA
FT                   EMDAPPRMRLANMMHLRHPMSVDLHIDDCASKARLVVARVLGGMGYWRYGAEQYATRVA
FT                   AAGGHVVLLPGDDKPDPELRALSTLRGAEYDALWSYLVEGGPENAVHFLAYARHLLDPA
FT                   QPAPPAASPLLRAGVYWPGAGLSNLDTVRAQWTEGAPVVPLIFYRALVQGAGLHPINRM
FT                   VKALRARGLNPLPVFVASLKDPVSAATLEHLFEAAPPDVILNCTSFAVGLPGTERLSQG
FT                   ASNPLAQPAARGAPVFQVVLAGSSLEAWEGGTAGLSARDIAMNVALPEVDGRVLTRAVS
FT                   FKGEAFFDDATECAIATYQAQGDRIGFVADLAANWARLRRTPPGERRTALILANYPNKD
FT                   GRLANGVGLDTPEATARMLQLLRDAGYGVDAPPADGAALMDRILAGPTNWLTDRAERTG
FT                   GVRLPLDTYRAHYAALPLALRSQIEDRWGAPEDDPFCADGAFALSVIPFGNVVVGIQPA
FT                   RGYNIDPTETYHAPDLVPPHNYLAFYIWLRHVQGAHALVHMGKHGNLEWLPGKSVALSE
FT                   TCFPEAVFGPLPHVYPFIVNDPGEGTQAKRRAQAVIIDHLTPPLTRAETYGPLRDLEGL
FT                   VDEYYEAAGVDPRRIAELRREILSLTSVTGLDKDAGFTGEEDNDLAKLDAYLCELKEAQ
FT                   IRGGLHIFGTAPTGRLARDLAIALTRLPRGDGTGGDASLLRALAGDLDLGFDPLDCDMA
FT                   AAWEGPRPDMLAAIAKDSWRSTGDTVERLELLAAACVEGAPAPGPQSATVLAEIAADVL
FT                   PTIAACGPAEGAGLLTALDGQFVAPAPSGAPTRGRLDVLPTGRNFYSVDSRAIPTPTAW
FT                   KLGWKSANLLIERHLQDQGDWPRTLLLTAWGTANMRTGGDDIAQCLALMGVKPRWDAAN
FT                   RRVTGFEVLPLSVLGRPRVDVTLRVSGFFRDAFPQQIALVDSAARAVMALDEPEADNPA
FT                   AARARAEGHTARVYGSKPGAYGAGLQAMIDERLWADKADLAEAYIGWSSYAYGAEAEGT
FT                   PDRDGFTARLSQADAIVQNQDNREHDLLDSDDYYQFEGGAAAAIATLQGAERPIYHNDH
FT                   SRPERPVIRTLDEEIGRVVRSRVVNPKWIAGVKRHGYKGAFEIAATVDYMFAFAATTGA
FT                   VKSHHFDLVHAAMLEDDDTREFIAEANPAALREIAERLSEAIDRGLWQPRSNSAKARLA
FT                   QLGADTQAAE"
FT   gene            complement(161242..161751)
FT                   /locus_tag="Dshi_0159"
FT   CDS_pept        complement(161242..161751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0159"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no IPR Scan result;
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91908"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR5"
FT                   /protein_id="ABV91908.1"
FT                   /translation="MMPSEIRIFRSSPFDPNAQELLVPPKARTRPDLTDLTGPNAFFYL
FT                   AVLREAPQGCIALRNMGSFGLVSAFRFLSDRARTSLPDILIEQVETQARSLRLPVLRAW
FT                   VERMYPVQGQALRRNGYFPVDPKTEEEDMTLYERPLRRAATSPERRQSEPSQPEPPDLR
FT                   TRTKGS"
FT   gene            complement(162047..163126)
FT                   /gene="cobW"
FT                   /locus_tag="Dshi_0160"
FT   CDS_pept        complement(162047..163126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="Dshi_0160"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobW PFAM:
FT                   cobalamin synthesis protein P47K; cobalamin synthesis CobW
FT                   domain protein KEGG: bov:BOV_1270 cobalamin biosynthesis
FT                   protein CobW, high swissprot hit to Protein cobW from
FT                   Pseudomonas denitrificans"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91909"
FT                   /db_xref="GOA:A8LKR6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR6"
FT                   /protein_id="ABV91909.1"
FT                   /translation="MPAKIPATVVTGFLGAGKTTLIRHMLANANGKRIALIINEFGDLG
FT                   VDGDILKGCGDETCSEDDIMELSNGCICCTVADDFIPTMEKLLARETPPDHIVIETSGL
FT                   ALPQPLVRAFNWPGISTKVTVDGVVTVVDGKAVTEGRFAHSVAAVDAQRKLDENLDHET
FT                   PLSELFEDQVACADMLVVNKTDLLTPAEAEALTERLKSEARGGVQVVRATHGALPVDVL
FT                   LGQGIGAEHDLEARSEVHHHHHHDHDDHDDDHHDDHPHHDHDHDAFTSFVVTLPEITEP
FT                   DAFAAHVARVIADHDILRLKGFAAVAGKPMRLTLQAVGPRIETYFDRPLGADETRETRL
FT                   VVIGQAGLDSVAIAAALAA"
FT   gene            complement(163128..163817)
FT                   /gene="cbtA"
FT                   /locus_tag="Dshi_0161"
FT   CDS_pept        complement(163128..163817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbtA"
FT                   /locus_tag="Dshi_0161"
FT                   /product="possible cobalt transporter, subunit CbtA"
FT                   /note="TIGRFAM: cobalt transporter, subunit CbtA PFAM:
FT                   Cobalt transporter subunit CbtA putative KEGG:
FT                   sit:TM1040_2222 cobalt transporter subunit CbtA, putative,
FT                   no swissprot, middle Ref hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91910"
FT                   /db_xref="GOA:A8LKR7"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR7"
FT                   /protein_id="ABV91910.1"
FT                   /translation="MSMKLLTSAVFAGLAAGLIAALLQFSFVTSSLLEGELYEAGEKVH
FT                   FAVDGTPQSPRGGAEVDLAAEPVRYGLTVAFNIVTYTGFGLLLVALMALAETKKLTKIT
FT                   PRQGLIWGLAGFVAIQLAPAMGQPPVLPGSVGAEIGPRQAWWLATLLSAGLAMWLLAFG
FT                   RGLWPWLAIPLLLVPQIIGAPVLDTYFGVTPAELAASFAAMSLGYSAAGWAALGFFAAY
FT                   FYSRQEA"
FT   gene            complement(163833..164030)
FT                   /gene="cbtB"
FT                   /locus_tag="Dshi_0162"
FT   CDS_pept        complement(163833..164030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbtB"
FT                   /locus_tag="Dshi_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_2524 hypothetical protein, no
FT                   swissprot, bad EDO hit to cobalt transporter, subunit CbtB
FT                   from Methylobacterium populi BJ001, a single transmembrane
FT                   domain and four times His at C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91911"
FT                   /db_xref="GOA:A8LKR8"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR8"
FT                   /protein_id="ABV91911.1"
FT                   /translation="MERDDMTTQTTTQTAAIARAATSTTGIVAAMAAGLLLLFLSGYAQ
FT                   ATILHDAAHDQRHAMAFPCH"
FT   gene            164463..167915
FT                   /gene="smc"
FT                   /locus_tag="Dshi_0163"
FT   CDS_pept        164463..167915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="Dshi_0163"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein
FT                   KEGG: rde:RD1_1327 chromosome segregation protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91912"
FT                   /db_xref="GOA:A8LKR9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKR9"
FT                   /protein_id="ABV91912.1"
FT                   /translation="MRFTRLRLNGFKSFVDPTDLIIGDGLTGVVGPNGCGKSNLLEALR
FT                   WVMGENRPTAMRGGGMEDVIFAGAASRPARNFAEVALILDNSDRRAPAGFNDTDQLEII
FT                   RRITRDVGSAYKTNGKDVRARDVQMLFADASTGAHSPALVRQGQISELINAKPKARRRI
FT                   LEEAAGISGLYQRRHEAELKLRGAETNLDRVDDVLEALAAQLATLARQAKQAARYREIG
FT                   AQLRRAEGLLLYRRWREADETRLVAVGELTARTTEAAAAETAARQAAKARVAADEALPP
FT                   LREEEAIAGAVVQRLHVQRDTLADQETRAREAIETLTGRIATLEADIAREEELNRDAGE
FT                   TIAKLDWEQAQIAKASVGHDEKLAAAAEAAQAASEVLTDRETTQSEMTEDVARLAARHQ
FT                   STQRLLQEAGRAETRAQEQVGRAEAALSEAQAGLCDAETRFVAAERDQQAAQGETEAAE
FT                   AALAAAEAERSEVQGAEAEARAARSEAEGEATALRAEVGALEKLVDRARAEGGQVLDAV
FT                   TAAPGYEAALGAALADDLKAPEVEGDRSGWHLLPGYDAAQKLPDGAAPLSAHVEVPAVL
FT                   ARRMAQVGLVDRAEGARLQPALKPGQRLVSREGDLWRWDGLAARAEDAPSAAAARLQQI
FT                   NRLAALKADLEAAEAKAATARATHEGLQAAMRAATEADRAAREARKGAERALGEASRAL
FT                   SRAEADRNIMAGKLETLGSAVSRYRDEVLEARKAVAEAQAAQADLGDLEAARAQVEAVR
FT                   VTVDAARMTMLAKRSAHDELRREGEARTRRSQEITTQISGWRHRLETAEAHKGELEGRL
FT                   EASRAELKSATAAPEEIAAKRDALAHEIARAEARKAAAADALSTAEGAARSAEQAERDA
FT                   ERAASEAREARARAEARAEAAAETVTLAAERIQEALEVTPQQLLDTLKVGPDAMPASDA
FT                   IEAEVNRLKRQREAMGAVNLRAEEDAKAVEEEYDGLVAEKGDLEGAIGKLRTGISSLNK
FT                   EGRERLLTAFEQVNDNFAMLFTHLFGGGEAKLVLVESDDPLEAGLEIMCQPPGKRLSTL
FT                   SLLSGGEQTLTALALIFAVFLANPAPICVLDEVDAPLDDANVTRFCDLLDEMTRRTETR
FT                   FLIITHHAVTMARMDRLFGVTMGEQGVSQLVSVDLRKAESLVA"
FT   gene            complement(168135..169304)
FT                   /gene="mltB1"
FT                   /locus_tag="Dshi_0164"
FT   CDS_pept        complement(168135..169304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltB1"
FT                   /locus_tag="Dshi_0164"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase PFAM:
FT                   Peptidoglycan-binding domain 1 protein KEGG: sil:SPO3226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91913"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS0"
FT                   /protein_id="ABV91913.1"
FT                   /translation="MLRFSLLLLLSFGLAGPVAAQCGGSFSDFVAGLKTEAQAKGHAKA
FT                   TVDAFFRTAAQDPRTLRADRAQGVFKMPFTEFARRVISQNRMDNGRRNADRFDAVFDAA
FT                   ETRFGVPRGVLLALWALETDYGAVQGDFNTLNSLVTLAHDCRRPELFRPQIFAALELYE
FT                   AGDFDPARTTGAWAGEIGMVQMLPEDILTKGIDGDGDGHVYLKTSAPDALLSGANMLSG
FT                   LGWRKGEPWLQEVSVPADLDWAETGLNSRKSGRDWARLGVTPRWGEIAGGLEAALILPQ
FT                   GRKGPAFLAYPNFDVFFEWNQSFVYVTTAAYFATRLSGAPVFDAGNPEPGLNDAQMKQL
FT                   QQKLAARGYDVGAVDGILGARTRAAVRAEQQRLGLPADAWPTPALLGRL"
FT   gene            complement(169365..170276)
FT                   /gene="cobD"
FT                   /locus_tag="Dshi_0165"
FT   CDS_pept        complement(169365..170276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="Dshi_0165"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /EC_number="6.3.1.10"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD PFAM:
FT                   cobalamin biosynthesis protein CbiB KEGG: sit:TM1040_2585
FT                   cobalamin biosynthesis protein CobD; high Ref hits and
FT                   middle swissprot hits to Cobalamin biosynthesis protein
FT                   cobD; in Salmonella this protein is called Cbib"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91914"
FT                   /db_xref="GOA:A8LKS1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS1"
FT                   /protein_id="ABV91914.1"
FT                   /translation="MTEHAALLLLALLLDAVFGEPDWLWTRLPHPAVLMGRLVAGADKR
FT                   LNKHRDLRFRGILVMIALGLGALVLGAGLAALGPVVEVLLAAILLAQRSLVDHVRAVAT
FT                   GLSDSLAAGRAKVAMIVGRDTEPLDAAGVARAAIESGAENFSDGVLAPAFWFLIGGLPG
FT                   LLLYKITNTADSMIGYRTPRYAEFGWAAARFDDLLNWVPARISALVILVAAGRPGGWPV
FT                   ILRDAPLHRSPNAGWPEAAMAVSLDVALSGPRSYEGAIRDFPFVHPDGTRTPGPAEIEA
FT                   ACTALWRSWGAMLALTALIAVL"
FT   gene            complement(170273..171229)
FT                   /gene="cobC"
FT                   /locus_tag="Dshi_0166"
FT   CDS_pept        complement(170273..171229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="Dshi_0166"
FT                   /product="threonine-phosphate decarboxylase"
FT                   /EC_number="6.3.1.10"
FT                   /EC_number="4.1.1.81"
FT                   /note="PFAM: aminotransferase class I and II KEGG:
FT                   sil:SPO3224 cobalamin biosynthetic protein CobC; gene
FT                   arrangement with several genes upstream (Dshi_0157) to
FT                   downstream (Dshi_0175); L-threonine-O-3-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91915"
FT                   /db_xref="GOA:A8LKS2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS2"
FT                   /protein_id="ABV91915.1"
FT                   /translation="MTASAPRDHGGGLDAAAARWGGTRDAWLDLSTGINPVSYPIPDIP
FT                   GPDWTALPDESAFSDLVAAARDFWAVPDGLDILPAPGASALIAALPGLVPASRVEIPGP
FT                   TYNEHAAAFAAHGWAQGTGPGAAFVAVHPNNPNGRLWQAEEIPTDRALTVLDESFCDIA
FT                   PEASLMPLAARPRTVILKSFGKFWGLAGLRLGFAIGQAETLAPLRDRIGPWAVSGPALR
FT                   VGALALRDAGWAAKTRARLDRDAARLDALAKGFGWSVTGGTGLFRLYDTPDASAAQDRL
FT                   ARRQIWTRRFPYSDRWLRLGLPGTEADWGRVARALTP"
FT   gene            complement(171226..171609)
FT                   /locus_tag="Dshi_0167"
FT   CDS_pept        complement(171226..171609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0167"
FT                   /product="protein of unknown function DUF1636"
FT                   /EC_number="6.6.1.-"
FT                   /note="PFAM: protein of unknown function DUF1636 KEGG:
FT                   hne:HNE_2170 hypothetical protein; conserved domain
FT                   COG5469: predicted metal-binding protein; middle Ref ZP hit
FT                   to hypothetical protein ROS217_22062 from Roseovarius sp.
FT                   217 (same COG domain); bad Swissprot hit to
FT                   Magnesium-chelatase subunit H (Mg-protoporphyrin IX
FT                   chelatase subunit H) from Rhodobacter sphaeroides 2.4.1:
FT                   This family contains a domain common to the cobN protein
FT                   and to magn"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91916"
FT                   /db_xref="GOA:A8LKS3"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS3"
FT                   /protein_id="ABV91916.1"
FT                   /translation="MTTWITICDTCKRTDWDARAPGRTDGEALAELIETAAAAQPEVRT
FT                   RRHSCLMGCTSGCNVTVQAAGKITYTLGDFEASGEAAEAIVGYAALHAVSDSGQVPYKT
FT                   WPQGVKGHFVTRHPPLPPEDDTP"
FT   gene            171888..172247
FT                   /locus_tag="Dshi_0168"
FT   CDS_pept        171888..172247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0168"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rde:RD1_1333 response regulator, putative;
FT                   COG2204 Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91917"
FT                   /db_xref="GOA:A8LKS4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS4"
FT                   /protein_id="ABV91917.1"
FT                   /translation="MRVLIVHGEAGLAGIWAAHLRRGGAVVDCVGAQEDAVRHLSTHPV
FT                   DVVLLSLTLSQGSALAIADYASYRRPDTRVIFVNNTQFFSDGSIFNHVSNARAMMPEDT
FT                   PPEDLTAMVEHYATH"
FT   gene            complement(172349..173338)
FT                   /locus_tag="Dshi_0169"
FT   CDS_pept        complement(172349..173338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0169"
FT                   /product="putative glutathione S-transferase"
FT                   /note="KEGG: jan:Jann_0368 putative glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91918"
FT                   /db_xref="GOA:A8LKS5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS5"
FT                   /protein_id="ABV91918.1"
FT                   /translation="MGQLIDGIWHDTWYDTESTGGKFVRSTAGFRNWITPDGAPGPTGS
FT                   GGFAAESGRYHLYVSMACPWAHRTLIFRKLKGLEPHIDISVVHPDMLGDGWTFETDDHG
FT                   ATGDRLYGLPFARDLYIKADPKVSGRVTVPILWDKAGKTIVSNESSEIIRMFNNAFDGI
FT                   TGDTQDFYPEALRTEIDAVNARVYSDINNGVYKSGFATTQEAYDEAVTTLFAALDWVED
FT                   RLGTRRYLAGDRITEADWRLFTTLVRFDLVYHLHFKCNRRRIVDYPNLWAYTRELFQWP
FT                   GVAETVNFDHIVRHYHYSHETINPHRIIPINPQIDWIAPHGRDRQIAA"
FT   gene            173674..173919
FT                   /locus_tag="Dshi_0170"
FT   CDS_pept        173674..173919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0170"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, bad GC frame plot, no
FT                   conserved domains detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91919"
FT                   /db_xref="GOA:A8LKS6"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS6"
FT                   /protein_id="ABV91919.1"
FT                   /translation="MPLLPLYCLAVLAGMSAAPALAHPGHLAGLAGHDHWVAGAAIGAA
FT                   IAIGLFGALKGRKSRADHQPEEAADAAEADSAEART"
FT   gene            173916..175166
FT                   /gene="cbiX2"
FT                   /locus_tag="Dshi_0171"
FT   CDS_pept        173916..175166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX2"
FT                   /locus_tag="Dshi_0171"
FT                   /product="sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein KEGG: sye:Syncc9902_0843 hypothetical protein;
FT                   swissprot to Sirohydrochlorin cobaltochelatase (CbiXL) from
FT                   Bacillus megaterium"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91920"
FT                   /db_xref="GOA:A8LKS7"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS7"
FT                   /protein_id="ABV91920.1"
FT                   /translation="MSAPATPKIGVMICGHGSRSQAAVDEFAILAEKLPVHLPSGWEME
FT                   YGYLEFANPVIRDGLDRLREKGCDRVLAVPGMLFAAMHSKNDIPTVLSTYAARHGMQIS
FT                   YGRELGVDPKMVAAAGDRAMQAVARANAELGEVALHETCLVVIGRGASDPDANGNVAKI
FT                   ARLVQEGLGFGWCEVGYSGVTFPLVEPCLRHVVKLGYKRVLVLPYFLFTGILIDRIYGF
FT                   TDQVAADHPEIQFVKAGYLRDHPEVLRTFAERVIEQMSDTPPPNCGDCGYRAQVLSLDA
FT                   GETRLITAEERTHPAFGAVPPSTCVMCKYRTAVLGFEGEVGAVQESHHHHVEGQGASAP
FT                   GSNVADCTLCDTFCTGMCRLEAQARHDHHHHHHGHDHGHSHGHDHDHEHHHHHAPYPHA
FT                   KHPHGPESARKTVRTAE"
FT   gene            175166..176704
FT                   /gene="cobH"
FT                   /locus_tag="Dshi_0172"
FT   CDS_pept        175166..176704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="Dshi_0172"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH KEGG:
FT                   bvi:Bcep1808_1609 precorrin-8X methylmutase; alternative
FT                   gene name: cbiC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91921"
FT                   /db_xref="GOA:A8LKS8"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A8LKS8"
FT                   /protein_id="ABV91921.1"
FT                   /translation="MRRAFCSYLVADWSANGTPKTGKDSIWVALVQPDARPVVENPSTR
FT                   KAAMALIEELIAAEQEAGRRVLAGFDFPFGYPAGFAKALGDGAGWQEVWARIAAEVSDG
FT                   PDNANDRFDAAARLNTLFPGAGPFWGNGLKRDIPGLPRKLPEGYGTTLPARLRHAEAQA
FT                   RGAQEVWKLSGAGSVGGQALMGIAALEGLRHRIGAAVWPFQPWRGEGPVLAEVFPSLTD
FT                   IPHLAGRVRDAVQVESLARGLVLLDAEGRLAPLLDAAERQPEDVRSHEASILGLGYEAL
FT                   LGRAVKSGLGAMRAASGAGMRPYERDPKAIYAQSFKTVRAEARLDRFPRGLDQVAVRLI
FT                   HACGMVDVADRLAFSDGAFEAGRAALEAGAPVLCDCEMVGAGIIRRYLPAGNEVIVTLN
FT                   RAEVPARAQAIGNTRSAAAVELWEPLLGGAVVAIGNAPTALFHLLELIDAGAPKPALIL
FT                   GFPVGFVGAAESKAELAANPRGCDFVALRGRRGGSAMASAAVNALAAGLPEVET"
FT   gene            176787..177989
FT                   /gene="cobL"
FT                   /locus_tag="Dshi_0173"
FT   CDS_pept        176787..177989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="Dshi_0173"
FT                   /product="decarboxylating precorrin-6Y
FT                   C(5,15)-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: ava:Ava_3558 uroporphyrin-III C/tetrapyrrole
FT                   (corrin/porphyrin) methyltransferase TIGRFAM: precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit;
FT                   precorrin-6Y C5,15-methyltransferase (decarboxylating),
FT                   CbiT subunit PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91922"
FT                   /db_xref="GOA:A8LLB2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB2"
FT                   /protein_id="ABV91922.1"
FT                   /translation="MTAPWLHIVGIGEDGMAGLLPATRAVVEAAEVIVGGERHHQLSAS
FT                   VTAERIAWPHPFDALIDTLTGLAGRRVVVLATGDPLWFSVGARIGRAIPPGEITYHPQL
FT                   SAFQLAAARMGWSLADVETLTVHGRPVEQMIAFIQPDQRLLILTTGAETPAQIAQFLTE
FT                   RGFGQSRMTVLAAMGGGDEARFDGVAETWDHVVPPFNTLAVECIAAPDCALLPRVPGLA
FT                   DDLFTHDGTMTKREVRAVTLAKLMPMRGALLWDVGTGCGSVAVEWMRGARYARAIGIEP
FT                   RADRRAMAAANALALGVPKLQVIEGTAPGAFAGLEAPDAIFLGGGLSAEVFDAAWAALR
FT                   PLGRLVANAVTIESEQVLVALHKTHGGELSKLSVQRADAVGPRLGWRPFMPVTQWSLIK
FT                   R"
FT   gene            177986..178687
FT                   /gene="cobI"
FT                   /locus_tag="Dshi_0174"
FT   CDS_pept        177986..178687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="Dshi_0174"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.15"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase KEGG: mag:amb0297 precorrin-2 methylase;
FT                   alternative gene name: cbiL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91923"
FT                   /db_xref="GOA:A8LLB3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB3"
FT                   /protein_id="ABV91923.1"
FT                   /translation="MSGTLYGVGLGPGDPELLTLKADRLIRGARVVAYPALVAGDSLAR
FT                   GIAAAAIPEDAREIRIEVPMTPARAPAQAAYDAAAAEIAAALAAGEDVVCLCEGDPFFY
FT                   GSFMYLHARLADRFAVEVVPGVTSMTACAARAARPLVARNEMLTVIPGPLPEAALAEAL
FT                   RAADTAVIMKVGRHLAKIRRVLEAEGLAAQAVYLERATLPAERALPLAEAPDPAPYFSM
FT                   VLVTKGADPWL"
FT   gene            178678..180483
FT                   /gene="cbiG"
FT                   /locus_tag="Dshi_0175"
FT   CDS_pept        178678..180483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="Dshi_0175"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="1.14.13.83"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; cobalamin (vitamin B12) biosynthesis
FT                   CbiG protein KEGG: mag:amb0298 precorrin-3B methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91924"
FT                   /db_xref="GOA:A8LLB4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB4"
FT                   /protein_id="ABV91924.1"
FT                   /translation="MAVTLVVVAISRAGEDTAHRIAAARGWAVHGRAGRVDRADAHFDN
FT                   ALTHVRDLFAAGVPVVGVCAAGILIRAVAPLLADKTAEPPVVAVAEDGSVVVPLLGGHR
FT                   GANRIAADLSDLLGGVSAVTTAGDVALGVALDAPPSGYRLANPGDAKSVMAGLLSGGGA
FT                   RLTGEALFDLPAGEGAEIAVTEAPLAGGPDRLVYHPQRFALGAGCARDADPQVLRAQVF
FT                   EMLAEAGVAPGAVASLNTLGLKADEPAMHALAAELGVPLRVFTAAELEAEAARLATPSE
FT                   VVFAEVGCHGVAEGAALAAAGPDAVLVQPKRKTATTTCALARAPAPITALRGRARGRVS
FT                   VVGIGPGQSAWRTPEASRLVAEAEELVGYGLYIDLLGPLAAGKARADFPLGGEEDRCRY
FT                   ALERAGEGRNVALVCSGDAGIYAMGALVFELLDRGPEAQGVSDAARRVEVICAPGVSAL
FT                   QAAAARAGAPLGHDFCAISLSDLLTPRADILRRLRAAAEGDFVIAFYNPVSKTRRTLLA
FT                   EAREILLAHRPADTPVLLASSLGRPEEEIRYRRLDGLEVDEVDMLTVVLVGSSNSKLAQ
FT                   LGAGPRMYTPRGYARKIDGDLSDAG"
FT   gene            180607..181383
FT                   /gene="cobM"
FT                   /locus_tag="Dshi_0176"
FT   CDS_pept        180607..181383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="Dshi_0176"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase KEGG: mag:amb0514 precorrin-4 methylase,
FT                   anaerobic equivalent cbiF"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91925"
FT                   /db_xref="GOA:A8LLB5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB5"
FT                   /protein_id="ABV91925.1"
FT                   /translation="MTVYFIGAGPGDPELLTLKAQRVIGACPVCLYAGSLVPAEVVAGA
FT                   PAGARVLDTAPMTLDDTHAEIVAAHGRGQDVARVHSGDPSLYGAIAEQIRRLRADGIPY
FT                   EIIPGVPAYAAAAAALGQELTIPEVAQSIILTRVSMKSTSMPEHETLENFARTRATLAI
FT                   HLGVRNLREIERVLTPHYGAGCPVVVAYRVGWPDQMFLRGTLADIHAKVRAEKITRTAL
FT                   ILVGPALGEVTDFKDSALYDPEMPHVLRPRARKTGS"
FT   gene            181444..181797
FT                   /locus_tag="Dshi_0177"
FT   CDS_pept        181444..181797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0367 hypothetical protein, no
FT                   significant swissprot, no IPR Scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91926"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB6"
FT                   /protein_id="ABV91926.1"
FT                   /translation="MSEFLPKEVRDGLNQARVRAARRDKRRLRVQVGPEAYTIQSFGAE
FT                   AFTLRADGAPHLRGLVDIYKGSEHLYQALIVTAALDGPEMRYEFKRMTRTRENVPLDYD
FT                   PGPNVPAGLIARQ"
FT   gene            complement(181801..182973)
FT                   /locus_tag="Dshi_0178"
FT   CDS_pept        complement(181801..182973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0178"
FT                   /product="aminotransferase class I and II"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class I and II KEGG:
FT                   sit:TM1040_2581 aminotransferase, class I and II; middle
FT                   swissprot to Putative aminotransferase B from Bacillus
FT                   subtilis (patB)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91927"
FT                   /db_xref="GOA:A8LLB7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB7"
FT                   /protein_id="ABV91927.1"
FT                   /translation="MTFDTEIDRRNTDCIKWDKMESAFGVSPEDGLAMWIADMDFPPGP
FT                   FLQEAMQGLLARADYGYFCGLESYEDAIIGWMRDRHGWTVEREWMFTTYGLGNGIAITL
FT                   NALTAPGDEVIIFSPVYHEFAAKITKTGRVVKELPLAIVDGVYTMDFDAYAGMLSGRET
FT                   MVIACSPHNPAGRVWTQEELTALADFCQRHDLLLISDEIHADLTFAGHTHIPMHVAAPQ
FT                   IADRLVMTTSASKTFNIAGGRTGCVTIPDPDLRARFHRFFNTLDMQPNLLGVALTRAAY
FT                   SPAGAAWCDALCTYLEGNAAVFNDGVNAIPGLSAMPMQGTYLAWVDFAGTGMERPEFSE
FT                   RVYGTARIAATPGHTLGKGGESCLRFNVGMPRARVQEAVDRLADAFADLQ"
FT   gene            183047..183610
FT                   /gene="def1"
FT                   /locus_tag="Dshi_0179"
FT   CDS_pept        183047..183610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="Dshi_0179"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rsh:Rsph17029_2532 peptide deformylase
FT                   TIGRFAM: peptide deformylase PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91928"
FT                   /db_xref="GOA:A8LLB8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB8"
FT                   /protein_id="ABV91928.1"
FT                   /translation="MLRPGGAWITSTGMTIRPILIHPDPRLKKTVDPVAEITDEIRQLA
FT                   DDMLATMYDAPGIGLAGPQVAAMTRIITMDCAPKDGEPDPMVLINPEIVWSSEEMNTYE
FT                   EGCLSIPEMYADVERPAEVEVRWTTLEGGDASARWGGLHATCVQHEIDHLNGKLFIDYL
FT                   KPLKRQMITRKMVKLKRERARAEG"
FT   gene            183683..184189
FT                   /gene="def2"
FT                   /locus_tag="Dshi_0180"
FT   CDS_pept        183683..184189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def2"
FT                   /locus_tag="Dshi_0180"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase PFAM: formylmethionine
FT                   deformylase KEGG: sit:TM1040_2578 formylmethionine
FT                   deformylase, worse BLAST hits than Dshi_0179, but same
FT                   product result"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91929"
FT                   /db_xref="GOA:A8LLB9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLB9"
FT                   /protein_id="ABV91929.1"
FT                   /translation="MIRPFLSWPDARLRTPAAPVAEITDEIRTVWDDMIDTMEAMPGMG
FT                   PGAGLAAPQIGVMQALAVVDASEERGRAIRMANPQVLHASAQLRSHEEASPNLPGVFAK
FT                   IDRPRAVTVRFLDANGAVKEQDFVGLWATSVQHQIDHLAGRMYFDRLSKTKRDMLLRKA
FT                   RKLAR"
FT   gene            184186..185085
FT                   /gene="fmt"
FT                   /locus_tag="Dshi_0181"
FT   CDS_pept        184186..185085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="Dshi_0181"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase PFAM:
FT                   formyl transferase domain protein KEGG: sil:SPO3216
FT                   methionyl-tRNA formyltransferase; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91930"
FT                   /db_xref="GOA:A8LLC0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLC0"
FT                   /protein_id="ABV91930.1"
FT                   /translation="MRLVFMGTPAFSVPVLDALVAAGHEVAAVYCQPPRPAGRGKKPRP
FT                   SPVQARAEVLGLAVRHPVSLKGAEAQADFAALGAEIAVVVAYGLILPQAVLDAPEHGCW
FT                   NIHASLLPRWRGAAPIHRAILAGDAETGVCIMQMEAGLDTGPVLLREAVAIGAEETTGG
FT                   LHDRLSALGARLIVEALARRAELVPEPQPEVGVTYAAKIDKAEARVDWSRPAVEVDRLI
FT                   RGLSPVPGAWCEIAGERVKLLGSRLAEGSGAAGQVLEGFTLACGVGAVEITRAQRAGRK
FT                   AADAAEILRGMTLPARLD"
FT   gene            complement(185190..185663)
FT                   /gene="rnhA"
FT                   /locus_tag="Dshi_0182"
FT   CDS_pept        complement(185190..185663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="Dshi_0182"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease H KEGG: sit:TM1040_2573
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91931"
FT                   /db_xref="GOA:A8LLC1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLC1"
FT                   /protein_id="ABV91931.1"
FT                   /translation="MPELFAYTDGACSGNPGPGGWGALLIARDGDTVVKERALKGGEAE
FT                   TTNNRMELLAAIHALEALERPARLTVVTDSAYVKGGVTGWIHGWKRNGWKTSTKKPVKN
FT                   EDLWRRLDAAQARHEVQWEWVKGHAGHPENERADALAREGMAPFKPGKSKAGR"
FT   gene            complement(185656..186255)
FT                   /locus_tag="Dshi_0183"
FT   CDS_pept        complement(185656..186255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0183"
FT                   /product="methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12 KEGG: sil:SPO3211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91932"
FT                   /db_xref="GOA:A8LLC2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC2"
FT                   /protein_id="ABV91932.1"
FT                   /translation="MSDPQTLAVYAREAERYRARFADKGADGHLQAFLDALPAGADVLD
FT                   LGCGPGRAAALMQAAGHRVVAMDATPEFVAQARALGVDARLARFDDLDAAAAFDGIWAN
FT                   FSLLHAPRAEMPGHLAAIARALRPSGLFHLGLKLGTGEERDALGRFYTYYTDAELQQLL
FT                   TDAGLTVSHTDFGTGEGLSGRTDPFIIVTSRRVPDA"
FT   gene            complement(186252..186704)
FT                   /locus_tag="Dshi_0184"
FT   CDS_pept        complement(186252..186704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91933"
FT                   /db_xref="GOA:A8LLC3"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC3"
FT                   /protein_id="ABV91933.1"
FT                   /translation="MNDIPRSALILGLAGLIPFLFGAGTLVLPGLAAFGMEVFGPRFIG
FT                   PYVQIFYGTIILAFMSGVLWGFATKATGTVATTGYGLSVIPALWAFFTVGGGSANALTN
FT                   LIAGFIGLLALDYLFWRQGLAPRWWMHLRVLLTAIVVACLAVGVVV"
FT   gene            complement(186744..187694)
FT                   /gene="cdsA2"
FT                   /locus_tag="Dshi_0185"
FT   CDS_pept        complement(186744..187694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA2"
FT                   /locus_tag="Dshi_0185"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="PFAM: phosphatidate cytidylyltransferase KEGG:
FT                   reu:Reut_B4016 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91934"
FT                   /db_xref="GOA:A8LLC4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC4"
FT                   /protein_id="ABV91934.1"
FT                   /translation="MTEPTLPFAWEITAIGGLLVLATVIARLLRQRLSPSGENATIENL
FT                   NARIMAWWAISALVALFSLGGDAGVVTLFGICAFAALREFMTLTAKRTADHWAIAASFF
FT                   VVLPVQFLLVGLGWYGLYTVFIPVYAFLLLPILSALQGDRTDFLERVAETQWALMICVF
FT                   CMSHVPALLTLNIPGGEDRMILLLAFLVIVVQSTDVLQYSWSKLIGRRKIAPTLSRTKT
FT                   WQGMIGGIASATLLGAALYWITPFAPWQAALLACLAATVGFFGTLVMTAIKRDRGVKDW
FT                   GPMFAGQGGFIDRLDSVLFAAPVFFHVVRFFFHTP"
FT   gene            complement(187691..188344)
FT                   /gene="plsC"
FT                   /locus_tag="Dshi_0186"
FT   CDS_pept        complement(187691..188344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="Dshi_0186"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase KEGG:
FT                   reh:H16_A2089 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91935"
FT                   /db_xref="GOA:A8LLC5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC5"
FT                   /protein_id="ABV91935.1"
FT                   /translation="MRLLTGVAAWLLGGGLILLARLLTAPRAIWQGIEPVPRQRVYYAN
FT                   HTSNADLILIWSVLPPRLRRATRPVAGSDYWLKSRLRAFVGHEVVRAVMVERRPEHRGD
FT                   EDPIALILDALDEGSSLIIFPEGKRNMTDAPALPFKSGIYNISRARPAVDLVPVWIENL
FT                   NRVMPKGHVIPVPLLCTVSFGAPIRVEEGEEIGPFLARAADAMVALRPNGGSKP"
FT   gene            complement(188367..188981)
FT                   /locus_tag="Dshi_0187"
FT   CDS_pept        complement(188367..188981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0187"
FT                   /product="amino-acid exporter protein"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA) KEGG:
FT                   jan:Jann_0505 lysine exporter protein (LysE/YggA); COG1280
FT                   putative threonine efflux protein; Ref hit to Lysine
FT                   exporter protein (LYSE/YGGA) from Jannaschia sp. CCS1, also
FT                   swissprot to Homoserine/homoserine lactone efflux protein
FT                   from Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91936"
FT                   /db_xref="GOA:A8LLC6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC6"
FT                   /protein_id="ABV91936.1"
FT                   /translation="MITASFLLTAFVVVLAPGTGVVYTLALGLGRGRRAAGWAALGCTL
FT                   GIVPHLLAVTLGLAAVLHSSALLFNLVKFAGVAYLLWLAWGALRDGGALQVRAETTAEP
FT                   GWRIARRGALINILNPKLSIFFLALLPPFLSGNPATATAEMVLLGAVFMALTFAVFLVY
FT                   GAFAAQARDWVLGSARAMAWLNRSFAAVFALLAGRLALERA"
FT   gene            complement(189644..190600)
FT                   /gene="lytB"
FT                   /locus_tag="Dshi_0188"
FT   CDS_pept        complement(189644..190600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="Dshi_0188"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: sil:SPO3207 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase PFAM: LytB protein, high swissprot
FT                   hit; alternative gene name: ispH"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91937"
FT                   /db_xref="GOA:A8LLC7"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLC7"
FT                   /protein_id="ABV91937.1"
FT                   /translation="MSLPPLTLYLAAPRGFCAGVDRAIKIVEMALEKWGAPVYVRHEIV
FT                   HNKYVVDGLRAKGAVFVKELDDCPDDRPVIFSAHGVPKAVPAEATRREMVYVDATCPLV
FT                   SKVHIEAERHHAGGLQMVMIGHAGHPETVGTMGQLPDGEVILVETVADVATITPRDPDK
FT                   LAFITQTTLSVDDTADIVAALQARFPAIVGPHKEDICYATTNRQGAVKAMAPKADAMLV
FT                   IGAPNSSNSKRLVEVGRSAGCAYAQLVQRAEDIDWRALEGISSIGITAGASAPEVLVNE
FT                   VIEAFRTRFDLTVEQVETAQENVEFKVPRVLREPAGA"
FT   gene            190754..191188
FT                   /locus_tag="Dshi_0189"
FT   CDS_pept        190754..191188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0189"
FT                   /product="putative cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I KEGG: rsh:Rsph17029_3996
FT                   cytochrome c, class I; COG2863 Cytochrome c553; just middle
FT                   Ref hits to probable c-type cytochrome from Roseovarius sp.
FT                   HTCC2601; good RBS site AGGAGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91938"
FT                   /db_xref="GOA:A8LLC8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC8"
FT                   /protein_id="ABV91938.1"
FT                   /translation="MRVISGLMAGLCLAMPVRAEGFLPWQDAEMVALGATVYADHCAAC
FT                   HGAQLEGQVPDWRSPGPDGRLPAPPHDETGHTWHHADMLLFQITKYGTEALIGGEYRSN
FT                   MMGFGDLLSDAEIVAVLAYIKSTWPPQVIAAHDRVNAAAQ"
FT   gene            complement(191192..191707)
FT                   /locus_tag="Dshi_0190"
FT   CDS_pept        complement(191192..191707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0190"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /note="KEGG: pmy:Pmen_0684 membrane protein-like protein,
FT                   middle Ref hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91939"
FT                   /db_xref="GOA:A8LLC9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLC9"
FT                   /protein_id="ABV91939.1"
FT                   /translation="MVKLTQDPLRRVLSREAGGMTLFETMAGILAVMFGTAFGAATILP
FT                   LQSEIVFTAFQVQAAVPLWALLLVASVGNTLGSVLNYALGWQIPRFKDKRWFPVTEAQL
FT                   DKAQRWFAKYGKWSLLLSWAPLGDAITVVAGMMRTRLFVFIALVGFAKTARYIALAALV
FT                   EGGVRVFA"
FT   gene            complement(191718..192290)
FT                   /locus_tag="Dshi_0191"
FT   CDS_pept        complement(191718..192290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0191"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88 KEGG:
FT                   rsq:Rsph17025_2579 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91940"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD0"
FT                   /protein_id="ABV91940.1"
FT                   /translation="MFYKDDRLALFIDGSNLYAAAKALGFDIDYKLLRQEFMRRGKLLR
FT                   AFYYTALLENDEYSPIRPLVDWLHYNGFSMVTKPAKEYTDSQGRRKVKGNMDIELAVDA
FT                   MELAPHMDHAVLFSGDGDFRPLIESLQRRGVRVSVVSTIRSHPPMISDELRRQADNFIE
FT                   LDELKEIIGRPPREPREPRETAVETAD"
FT   gene            192409..192978
FT                   /gene="hppk"
FT                   /locus_tag="Dshi_0192"
FT   CDS_pept        192409..192978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppk"
FT                   /locus_tag="Dshi_0192"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK
FT                   KEGG: sil:SPO3205
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91941"
FT                   /db_xref="GOA:A8LLD1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD1"
FT                   /protein_id="ABV91941.1"
FT                   /translation="MKIQSFGIIALGANQPLGGRTPKVTLRQACEALADAPLEIVARSR
FT                   FFATPAFPDPSQPEYVNGCVTVETGLGAKALLKVLHDVEDRLGRARGQRWGARTLDLDL
FT                   LALGAQVLPDMETYAQWRDLPRSAQVARTPNELILPHPRIADRPFVLVPLMDVAPLWRH
FT                   PVTGKTASEMLRNLPKSEIDAIRPLE"
FT   gene            193056..193412
FT                   /gene="rpoZ"
FT                   /locus_tag="Dshi_0193"
FT   CDS_pept        193056..193412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="Dshi_0193"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit
FT                   PFAM: RNA polymerase Rpb6 KEGG: sit:TM1040_2566
FT                   DNA-directed RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91942"
FT                   /db_xref="GOA:A8LLD2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLD2"
FT                   /protein_id="ABV91942.1"
FT                   /translation="MARVTVEDCVDKVPNRFELVMLAAHRAREISAGSELTIDRDNDKN
FT                   PVVSLREIAEETQSADALRERLIESNQTQIEVDEPEEDSMAMLMGGGQPDKPAEDDMSE
FT                   EKLLRALMEAQGQP"
FT   gene            193417..195561
FT                   /gene="relA"
FT                   /locus_tag="Dshi_0194"
FT   CDS_pept        193417..195561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="Dshi_0194"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: rsq:Rsph17025_2576 (p)ppGpp synthetase I,
FT                   SpoT/RelA TIGRFAM: RelA/SpoT family protein PFAM: TGS
FT                   domain protein; metal-dependent phosphohydrolase HD sub
FT                   domain; RelA/SpoT domain protein SMART: metal-dependent
FT                   phosphohydrolase HD region; ppGpp synthetase I; ATP:GTP
FT                   3-pyrophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91943"
FT                   /db_xref="GOA:A8LLD3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD3"
FT                   /protein_id="ABV91943.1"
FT                   /translation="MPRDSSDSLIEARDLIALVQTYNPRTNAALIEAAYDYGREMHRGQ
FT                   LRHSGEEYFTHPVAVAAILAEQRLDDSTIITALLHDTVEDTRSTFAELESQFGREIAEL
FT                   VNGVTNLTNLQLSSRETKQAENFRKLFMAMSKDLRVILVKLADRLHNMRTIKHMPVEKQ
FT                   VKKARETMDIYAPLAGRMGMQWMRDELEDLSFRVLNPDGRQSIMRRFIKLQNETGDVVQ
FT                   KITSDIRKELDAHGIEADVYGRAKKPYSIWRKMEAKQLGFSRLSDIYGFRVITHSEDDC
FT                   YGVLGAIHQRWRAVPGRFKDYISQPKSNGYRSIHTTVSGRDGKRVEVQIRTRQMHEVAE
FT                   AGVAAHWSYRDGVQVENPFAVDPAEWIASLSERFESSEDHGEFLEHVKLEMYSDQVFCF
FT                   TPKGEVVKLPKGATPLDYAYGIHTRIGDSCVGAKVDGIRVPLWTRLKNGQSVEIITADG
FT                   QRPQATWIDIVVTGRAKQAIRRSLREEDRARFVKLGQELARVAFDHVGKRVTDKALKTA
FT                   AHQLGYGGRLELLSALGSADISARDVVEVLYPELQGQGGDEVAADRAVVGLHSDQSFER
FT                   ARCCQPVPGERIVGIAYRGHGVRVHAIDCPALEEFEDEMRRWIDLQWHSGRHAAVHAVR
FT                   LDVTIGNDQGVLGRICTLIGEQRANISDLHFVDRKPDFYRLLLEVEVRDLEHLHRVMTA
FT                   VQADTDVAGLERHRDLSRKP"
FT   gene            195599..196255
FT                   /locus_tag="Dshi_0195"
FT   CDS_pept        195599..196255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91944"
FT                   /db_xref="GOA:A8LLD4"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD4"
FT                   /protein_id="ABV91944.1"
FT                   /translation="MVFKRRDKRPFWKVVAESLWPRGGWGRAFHYIKRRLQRLPDTPET
FT                   IARGIAAGVFTTFTPLYGVHFVIAAILAKILRGNILASLLATFFGNPLTYIPIGIVSLK
FT                   TGHFILGTEFDPEDKTSFLRKFTEAGADLWNNVVAIFTDREPQWDHLARFFDEVFWPYL
FT                   VGGIIPGIIAGAVMYHLSLPVLRAYQKRRKGRLKKKIEALRVKAKSRADEAHRAP"
FT   gene            196281..197045
FT                   /gene="pdxJ"
FT                   /locus_tag="Dshi_0196"
FT   CDS_pept        196281..197045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="Dshi_0196"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ PFAM: Pyridoxal phosphate biosynthetic protein PdxJ
FT                   KEGG: sil:SPO3201 pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PNP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91945"
FT                   /db_xref="GOA:A8LLD5"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD5"
FT                   /protein_id="ABV91945.1"
FT                   /translation="MTDKTTAAPGELRLGVNIDHVATVRNARGGAVPDPVRAAVLAQQA
FT                   GADGITAHLREDRRHIGDADIEALMAALTVPLNFEMAATDEMQAIALRHVPHAVCIVPE
FT                   KREERTTEGGLEVARDENRLAHFIAPLREAGCRVSIFIAADRAQIEAAHRIGAPVIELH
FT                   TGAYCDAAAEGDIAARDAELARLTEMAAFAYDLGLEVHAGHGLSYDTVAPIAALPQVRE
FT                   LNIGHFLIGEAIFRGLPDAMAEMRRRMDAARA"
FT   gene            197042..197704
FT                   /locus_tag="Dshi_0197"
FT   CDS_pept        197042..197704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1321 hypothetical protein, no
FT                   swissprot, no conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91946"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD6"
FT                   /protein_id="ABV91946.1"
FT                   /translation="MSWLRVIAGLFSRTVLALLLVASMSLTVLSLTVSGVQVALSGALS
FT                   AAGMTTIAAREAAAAQTRRTAAKRVAQQTSERVTRRVTRAAARNSSSVVAEAVPFLGVA
FT                   VIAGALAYDIKDTCDTARDMAGLEAAASTDGDPQAAFDAAVAAFDCADLIPEVETLPDR
FT                   ATIWNAMSEAPQQAWESATGYYEGLPDWDPSVPLGWMQGKLGDLYGWISGGAPAGAE"
FT   gene            197844..198263
FT                   /gene="acpS"
FT                   /locus_tag="Dshi_0198"
FT   CDS_pept        197844..198263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="Dshi_0198"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="KEGG: sil:SPO3200 4-phosphopantetheinyl transferase
FT                   TIGRFAM: holo-acyl-carrier-protein synthase PFAM:
FT                   4-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91947"
FT                   /db_xref="GOA:A8LLD7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLD7"
FT                   /protein_id="ABV91947.1"
FT                   /translation="MIIGIGTDLANIERIERTLERFGDRFRHRVFTEREQRKADSRQQT
FT                   AATYAKRWAAKEACSKALGTGLRMGISWRDMAVQNLETGQPTMYVTGWAAERLKQLTPE
FT                   GHEAVIHVSLTDDHPWAQAYVVISAIPLEAAARSA"
FT   gene            198319..199104
FT                   /gene="lepB"
FT                   /locus_tag="Dshi_0199"
FT   CDS_pept        198319..199104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="Dshi_0199"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: rsq:Rsph17025_2572 signal peptidase I TIGRFAM:
FT                   signal peptidase I PFAM: peptidase S24 and S26 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91948"
FT                   /db_xref="GOA:A8LLD8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLD8"
FT                   /protein_id="ABV91948.1"
FT                   /translation="MASTEKAEGGIMETVKTVVYALVIAGVFRTLFFQPFWIPSGSMKD
FT                   TLLVGDFLFVNKMAYGYSQVSCPFSMCPIPGRIFASDPERGDIVVFRHPVNGSDFIKRL
FT                   IGLPGDTVQFRDGRLILNGEAVPTEPDGTFDEIFERQGPIGSFPRCANAPVGQGGVCEK
FT                   EKFVETLPGGVSHSILNIDQSFGDNTPEFTVPEGHFFFVGDNRDNSQDSRYAQSVGGVG
FT                   FVPFENLIGRADRVIFSSAGSRMLYFWTWRGDRFFKALE"
FT   gene            199101..199790
FT                   /gene="rnc"
FT                   /locus_tag="Dshi_0200"
FT   CDS_pept        199101..199790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="Dshi_0200"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein KEGG: rde:RD1_1366 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91949"
FT                   /db_xref="GOA:A8LLD9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLD9"
FT                   /protein_id="ABV91949.1"
FT                   /translation="MKLSKEISAFCDRIGHRFDRPELLVRALTHASRSTAGRSDNQRLE
FT                   FLGDRVLGLVMAEALLEADPQAREGQLAPRYNALVRKETCAEVAREIGLGDVLRLGRSE
FT                   MLTGGRRKDALLGDGMEAVIAAVYRDAGFEAAKALILRLWGKRIGAVEADARDPKTALQ
FT                   EWAQARGLPPPAYIESARSGPDHAPVFTISARLETGACAEAQAGSKRQAEQAAAKALLA
FT                   QVESNHD"
FT   gene            199783..200709
FT                   /gene="era"
FT                   /locus_tag="Dshi_0201"
FT   CDS_pept        199783..200709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="Dshi_0201"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era PFAM: GTP-binding protein HSR1-related; KH type
FT                   2 domain protein KEGG: sit:TM1040_2558 GTP-binding protein
FT                   Era"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91950"
FT                   /db_xref="GOA:A8LLE0"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLE0"
FT                   /protein_id="ABV91950.1"
FT                   /translation="MTENAAPTRAGFVALIGEPNAGKSTLTNAMVGAKVSIVTHKVQTT
FT                   RARIRGVALEGAAQIVFVDTPGLFRPRRRLDRAMVAAAWGGAADADIVVLMVEAHRGMT
FT                   DGVRAILETLNERRDPKQIVALAINKIDRVKSEVLLKLTQDLNAAYPFAETFMISAEKG
FT                   YGVADLRAWLGASLPEGPWMYPEDQIADVPLRMIAAEITREKLTLRLHQELPYQLTVET
FT                   ENWEERKDGSVRIDQVVYVMRDGHKGILLGHKGETAKAVSKAAREELVEFLGRKVHLFL
FT                   QVKVRPNWLEEKERFDEMGLDFRDGNA"
FT   gene            200713..201045
FT                   /locus_tag="Dshi_0202"
FT   CDS_pept        200713..201045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0202"
FT                   /product="protein of unknown function DUF1491"
FT                   /note="PFAM: protein of unknown function DUF1491 KEGG:
FT                   sil:SPO0690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91951"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE1"
FT                   /protein_id="ABV91951.1"
FT                   /translation="MARLAAGLWVQAYMMRCQIEGIPVYVEARGDGTAGAVIVKLCTLD
FT                   GKARAYERRYDLMRDTRSWEVLVEGDEAEVDAALARARSRDPDLWIVAVEDRAGRHLLD
FT                   QPGLEG"
FT   gene            201114..201839
FT                   /gene="recO"
FT                   /locus_tag="Dshi_0203"
FT   CDS_pept        201114..201839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="Dshi_0203"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO PFAM: Recombination
FT                   protein O RecO KEGG: rsh:Rsph17029_0311 DNA repair protein
FT                   RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91952"
FT                   /db_xref="GOA:A8LLE2"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLE2"
FT                   /protein_id="ABV91952.1"
FT                   /translation="MIEWREEGVLLSVRPHGETSVIVEAFTRAHGRHLGVVRGGVSRKL
FT                   APVLQPGAQLDLRWKARLEDHMGAFTVEPVRGRAAAVLGDRLALSAMSSALALARFSLA
FT                   ERAAYPGFYDQTVALLDALAEGTGWLPAYLDWEMALLDQMGFGLDLSGCAVRGVNEDLA
FT                   FVSPRTGRAVSRQAAGAWVDRLLPLPEVMLGGPAHLHGVLEGLTTTGHFLEHKLAPALG
FT                   NRPPPEARARFIDVLSRAR"
FT   gene            complement(201901..203595)
FT                   /gene="mmgC"
FT                   /locus_tag="Dshi_0204"
FT   CDS_pept        complement(201901..203595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC"
FT                   /locus_tag="Dshi_0204"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain KEGG: rde:RD1_1372
FT                   isobutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91953"
FT                   /db_xref="GOA:A8LLE3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE3"
FT                   /protein_id="ABV91953.1"
FT                   /translation="MPHDGQDLSLNDAQTVVLPDLLNLTAAAVPPVEAVLEKAVAILKT
FT                   QLAVDGRISGALVEEHQTASHGLAWLATYAQSLRQMQKWAETLQADGKFGEVEQLIHQI
FT                   AFGEYLWQLYGGIPMSQGEILRLQDIGLSQDDQRGLMTPEIQTLTRSGNTQAARTRLVE
FT                   LMQERAAEITVGATGLDDELEMIREQFRRFSVDKVEPHAHEWHLKDELIPMEIIEELAE
FT                   MGVFGLTIPEEYGGFGLSKASMCVVSEELSRGYIGVGSLGTRSEIAAELIICGGTEEQK
FT                   QKWLPRLASAETLPTAVFTEPNTGSDLGALRTRAVQDENGDWKVTGNKTWITHAARTHV
FT                   MTLLARTKPDTTDHRGLSMFLAEKTPGTDEAPFPTEGMTGGEIEVLGYRGMKEYELAFD
FT                   NFHVKGENLLGGEEGKGFKQLMETFESARIQTAARAIGVAQSALDVSMQYAIDRKQFGK
FT                   SLINFPRVSGKLAMMAVEIMVARQLTYFSAFEKDEGRRCDVEAGMAKLLGARVAWAAAD
FT                   NGLQIHGGNGFALEYGISRILCDARILNIFEGAAEIQAQVIARRLLG"
FT   gene            203871..204635
FT                   /locus_tag="Dshi_0205"
FT   CDS_pept        203871..204635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0205"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81 KEGG:
FT                   sit:TM1040_2445 protein of unknown function DUF81; no
FT                   significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91954"
FT                   /db_xref="GOA:A8LLE4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE4"
FT                   /protein_id="ABV91954.1"
FT                   /translation="MDLFLSLSELTLAFLVLCAVFAGVVKGAVGFAMPLILMSGLSAVV
FT                   PVPVALAGLMVPSLVMNLWQALRGGVGALSLTARTHWRLVALVLVFIALSGQLVLAVPE
FT                   RILSLMIGVPIALYATSQLLGWRLRIAPAYRRRAELGTGVIAGFFGGFSGIWGPPIVAY
FT                   LVALDTPKAEQVRTQGLLYGLASCALVLTHLRTGVANVETLTFSAMLLVPAAAGMAMGL
FT                   WLQDRMDQDRFRQATLVFLLLAGLNLVRRGIM"
FT   gene            complement(204628..205515)
FT                   /locus_tag="Dshi_0206"
FT   CDS_pept        complement(204628..205515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1384 hypothetical protein, no
FT                   significant swissprot, but conserved domains and good RBS
FT                   site AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91955"
FT                   /db_xref="GOA:A8LLE5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE5"
FT                   /protein_id="ABV91955.1"
FT                   /translation="MTDSSGPSSPLAAPSTDQMPDRIEQPYDGRNLSYAKTFTNPWASA
FT                   LIRTMEWGTGKIRLLRLIRKFEKQGVPSGQGFWRPALDTMGIALTTPAEQIARIPRTGP
FT                   VIIVANHPHGLVDGMILADLIGRVRTDYKILTRSLLTDVEEIQQFMIPVPFPHEDDALQ
FT                   KNLDMRKQAMAHLAAGGVIVIFPSGVVASSETMFGPAIEAEWNPFTAKMILRSGAKVVP
FT                   IRFTGQNSRWYQIANQISPVLRQGLLLHEVVHSLNKPQAPIVGEPLTADEIAARKDNPR
FT                   GFMEWLREKTLSLT"
FT   gene            complement(205596..205865)
FT                   /gene="ptsH"
FT                   /locus_tag="Dshi_0207"
FT   CDS_pept        complement(205596..205865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="Dshi_0207"
FT                   /product="phosphotransferase system"
FT                   /note="TIGRFAM: phosphocarrier, HPr family PFAM:
FT                   phosphocarrier HPr protein KEGG: sit:TM1040_2436
FT                   phosphotransferase system, HPr; phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91956"
FT                   /db_xref="GOA:A8LLE6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE6"
FT                   /protein_id="ABV91956.1"
FT                   /translation="MIRQELKIINEKGLHARASAKFVECVEAHDASAEVEKDGLSASGD
FT                   SIMGLLMLAASKGTSIQVETKGPAAEELAKALEQLVANRFGENY"
FT   gene            complement(205876..206265)
FT                   /gene="ptsL"
FT                   /locus_tag="Dshi_0208"
FT   CDS_pept        complement(205876..206265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsL"
FT                   /locus_tag="Dshi_0208"
FT                   /product="PTS system IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="PFAM: PTS system fructose subfamily IIA component
FT                   KEGG: sil:SPO0714 PTS system IIA component, Man family; Man
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91957"
FT                   /db_xref="GOA:A8LLE7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE7"
FT                   /protein_id="ABV91957.1"
FT                   /translation="MIGIVIVAHGGLAKEYLLAVEHVVGKQDGMRAISIAADCDRPAKQ
FT                   AEICAAADAVDTGGGVVIVTDMFGGSPSNLALNASAREDRRIVYGANLPMLIKLAKSRN
FT                   APVQDAVRLSLEAGRKYINSFDGKV"
FT   gene            complement(206303..207205)
FT                   /locus_tag="Dshi_0209"
FT   CDS_pept        complement(206303..207205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0209"
FT                   /product="uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: conserved hypothetical protein KEGG:
FT                   rsh:Rsph17029_0317 uncharacterised P-loop ATPase protein
FT                   UPF0042; high swissprot, part of the PTS system in gene
FT                   neighborhood?"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91958"
FT                   /db_xref="GOA:A8LLE8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLE8"
FT                   /protein_id="ABV91958.1"
FT                   /translation="MTDTAPTPEKMPQKIVLVTGPSGAGRTTAIRALEDLGFEAIDNMP
FT                   ISLVPRLLDGPPLARPLALGLDARTRDFSVTAVADLLHLLAEDPRADAQLLFLDASPRV
FT                   LTRRFSETRRRHPLAPLESPMDGIARETDLLAPIRARADVVIDTSELSPHDLRAEMLRW
FT                   FGDRDSLRLAITVQSFSYKRGVPQGTDMVFDVRFLRNPYWEDTLRRLDGRDARVQDYVS
FT                   ADPRFDSFFDNIASLVRLLLPAYREEGKSHLSIGFGCTGGQHRSVTVAEKLSAALVAEG
FT                   WQVSNRHLELSRRSIGAQS"
FT   gene            complement(207218..207655)
FT                   /gene="hprK"
FT                   /locus_tag="Dshi_0210"
FT   CDS_pept        complement(207218..207655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="Dshi_0210"
FT                   /product="HPr kinase/phosphorylase"
FT                   /EC_number="2.7.-.-"
FT                   /note="KEGG: sil:SPO0712 HPr serine kinase/phosphatase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91959"
FT                   /db_xref="GOA:A8LLE9"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLE9"
FT                   /protein_id="ABV91959.1"
FT                   /translation="MHDAEMLHATSVAASGRALLIAGAAGAGKSSLALQLIAFGARLIS
FT                   DDRTELRAVDGTLVAHPAPNIAGKIEARGLGILSVPAAPPTPVAALVDLDQIETARLPP
FT                   FRIRRMLDVDLPLLHKVDSPSFAAALWLYLHHERWAPHPPD"
FT   gene            complement(207658..209376)
FT                   /locus_tag="Dshi_0211"
FT   CDS_pept        complement(207658..209376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0211"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein KEGG: rsh:Rsph17029_0315 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91960"
FT                   /db_xref="GOA:A8LLF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF0"
FT                   /protein_id="ABV91960.1"
FT                   /translation="MTLAADPDPSQSGPSGSLHPADGGGVDAKRADRKAARSGRERLQR
FT                   GLAINSSPLARKIISFNLLALLVLVVGVLYLNPFRDSLVFQREQGLVFEAHLIADVFEA
FT                   VADTQEADADLRSIDITRLVASLDLAPSLELFVFDPAGNILARAEGAKRSEWVALSEQN
FT                   APKPTIITDFLNGIWELIAKLVGQERLPLLPPGADQARSLLPGALSGRTTIENSVDPSG
FT                   NQIFAVGTPILLGGEVKGIVALTTASGEIDALVQNEREQFLQMFMVALLVSIGLSLVLA
FT                   GTIANPLSDLAAAAELGRDRNARKMNPGRVRIPDLTARPDEIGRLSGALRGMVAALYDR
FT                   IDANEQFAADVAHEIKNPLASLRSATGTLRVAKREDQRQRLLEVIEHDVRRLDRLVSDI
FT                   SNASRLDSELVKEEEETFDLIRMLRALTDFHAEEAQTQGIDFITDLPPGPMTIQGLEPR
FT                   LAQVFVNLLSNAISFCESGDAVRLWVRRRDNRALIVVEDTGPGIPEEALTKIFTRFYSE
FT                   RPERQFGNHSGLGLAISKQIIDAHGGVIWAENIRPTEDDITSAPLGARFVVGLPL"
FT   gene            complement(209373..210074)
FT                   /locus_tag="Dshi_0212"
FT   CDS_pept        complement(209373..210074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0212"
FT                   /product="two component transcriptional regulator"
FT                   /EC_number="2.7.-.-"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein KEGG: sit:TM1040_2441 two
FT                   component transcriptional regulator, winged helix family;
FT                   winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91961"
FT                   /db_xref="GOA:A8LLF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF1"
FT                   /protein_id="ABV91961.1"
FT                   /translation="MSRIALVDDDRNILTSVSITLEAEGFEVETYNDGQSALDAFTRRM
FT                   PELGVFDIKMPRMDGMDLLQRVRQKSRMPVIFLTSKDDEIDEVLGLRMGADDYVKKPFS
FT                   QRLLVERIRALLRRQQAVANHEAGDIDESKVMVRGNLTMDPLRHAVSWKGEDVALTVTE
FT                   FLLLQALAQRPGFVKSRDQLMDVAYDDQVYVDDRTIDSHIKRLRKKMRSVDENFTAIET
FT                   LYGIGYKYNEE"
FT   gene            210410..212008
FT                   /gene="pckA"
FT                   /locus_tag="Dshi_0213"
FT   CDS_pept        210410..212008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="Dshi_0213"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP) KEGG:
FT                   sit:TM1040_2442 phosphoenolpyruvate carboxykinase (ATP),
FT                   high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91962"
FT                   /db_xref="GOA:A8LLF2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLF2"
FT                   /protein_id="ABV91962.1"
FT                   /translation="MANGRVNPTFTLEDQGINGLGAVHYNLIEPALIQEALKREEGTLG
FT                   KGGAFLVETGKYTGRSPKDKHVVKTPSVADTIWWDNNAEMSSEGFDALYADMLAHMKGK
FT                   EYFVQDLFGGADPAHRLDVRVITELAWHGLFIRHMLRRPERGELDSFTADFTIINCPSF
FT                   KADPAKHDCRSDTVIALNFDRKLILIGGTEYAGENKKSVFTLLNYMLPEKGIMPMHCSA
FT                   NHAVGNPVDTAVFFGLSGTGKTTLSADPERVLIGDDEHGWSERGTFNFEGGCYAKTINL
FT                   SAEAEPEIYATTEMFGTVIENMVFDPETLDLDFEDDSLTANMRCAYPLNYISNASETAL
FT                   GGHPKNIIMLTCDAFGVLPPISRLTPAQAMYHFLSGFTSKVAGTERGVTEPEPTFSTCF
FT                   GAPFMPRRPEVYGKLLQEKIAKHGATCWLVNTGWTGGAYGTGSRMPIKATRALLTAALD
FT                   GSLADATFRKDANFGFDVPVTVHGVDATLLDPRGTWEDSAAYDAQAQKLVEMFAENFAQ
FT                   YVPYIDEDVKAVAIG"
FT   gene            complement(212131..213006)
FT                   /gene="hbdA"
FT                   /locus_tag="Dshi_0214"
FT   CDS_pept        complement(212131..213006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbdA"
FT                   /locus_tag="Dshi_0214"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding KEGG:
FT                   sil:SPO0717 3-hydroxybutyryl-CoA dehydrogenase; high
FT                   swissprot, good RBS site AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91963"
FT                   /db_xref="GOA:A8LLF3"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF3"
FT                   /protein_id="ABV91963.1"
FT                   /translation="MDIKSVGVIGAGQMGNGIAHVFAVAGFDVMMTDISQDALDQAMAL
FT                   IRRNLERQVSREKISREDMETAMARITTTLKLPELGQTDLVIEAATERETVKSAIFEDL
FT                   QPHLKPETILTSNTSSISITRLASRTDRPERFMGFHFMNPVPVMQLVELIRGIATDEAT
FT                   YKTLLGVVEKLGKTAASAEDFPAFIVNRILMPMINEAVYTLYEGVGSVRSIDESMKLGA
FT                   NHPMGPLELADFIGLDTCLAIMNVLHDGLADTKYRPCPLLTKYVEAGWLGRKTQRGFYD
FT                   YRGEVPVPTR"
FT   gene            213167..214024
FT                   /locus_tag="Dshi_0215"
FT   CDS_pept        213167..214024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1386 hypothetical protein; no
FT                   significant swissprot; no IPR Scan results"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91964"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF4"
FT                   /protein_id="ABV91964.1"
FT                   /translation="MTYERHGVAPPESAPCFYPGLDMAFRGPERSLEGPYVTFLGGTSF
FT                   YGKYAETAIPDRVEAVTGHACVNLGVMNAGLDLMRSDPMLSVAEKGAATVIELVAAQNM
FT                   SNRFYRVHPRRNDRFVAPTRLLRKAFPELDLSEIHFTRHLLRLMQMTSPARFETVVEEL
FT                   RASWVEGMCALLRALEGPRILLWLVPKPAEGTDRMAQEPFLVDRAAVHAVSELADSVVE
FT                   VRETAALRARGFAGMQVPDTHARILSALPRAALLDEAALSLLDPLHRIGIGPGRAGVQE
FT                   TLAG"
FT   gene            complement(214091..215017)
FT                   /gene="eftA"
FT                   /locus_tag="Dshi_0216"
FT   CDS_pept        complement(214091..215017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eftA"
FT                   /locus_tag="Dshi_0216"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit KEGG: rde:RD1_1387 electron transfer flavoprotein,
FT                   alpha subunit, high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91965"
FT                   /db_xref="GOA:A8LLF5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF5"
FT                   /protein_id="ABV91965.1"
FT                   /translation="MAVLCLAEVTDGTLAMDATAKAVTAAGALGDVTLLCVGASAKAAA
FT                   AEAATISGVAKVLVAEDPLYGHRLAEPVATLIASLAGDYSHVVAPATTDAKNIMPRVAA
FT                   LLDVMVLSDVTAVVDADTFERPIYAGNAIQTVKSADPTKVITFRTSTFDVAPLGGSAPV
FT                   EEIAAADNPGLSEWVEDKVAESDRPELTSAGVVVSGGRGVGSEDDFALIEKLADKLGAA
FT                   VGASRAAVDSGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKVIVAINKDE
FT                   EAPIFQVADYGLVADLFSAVPELTEKL"
FT   gene            complement(215017..215775)
FT                   /gene="eftB"
FT                   /locus_tag="Dshi_0217"
FT   CDS_pept        complement(215017..215775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eftB"
FT                   /locus_tag="Dshi_0217"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit KEGG: sil:SPO0720 electron transfer
FT                   flavoprotein, beta subunit; high swissprot to Electron
FT                   transfer flavoprotein subunit beta from Paracoccus
FT                   denitrificans"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91966"
FT                   /db_xref="GOA:A8LLF6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF6"
FT                   /protein_id="ABV91966.1"
FT                   /translation="MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEE
FT                   AIRLKEAGVATEIVAVSIGVKQSQETLRTALAMGADRAILIVATDDVHTDIEPLAVAKL
FT                   LAAVVREEEPGLVLCGKQAIDNDMNATGQMLSALLGWSQATFASEVKIDGAHAHVTREV
FT                   DGGLQTIKVKLPAIVSVDLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDITPRLSVL
FT                   KTAEPAERAAGIKVGSVDELVAKLKEAGAV"
FT   gene            complement(216003..216575)
FT                   /locus_tag="Dshi_0218"
FT   CDS_pept        complement(216003..216575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0218"
FT                   /product="putative ATP--cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase PFAM:
FT                   cobalamin adenosyltransferase KEGG: rde:RD1_1389
FT                   cob(I)alamin adenosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91967"
FT                   /db_xref="GOA:A8LLF7"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF7"
FT                   /protein_id="ABV91967.1"
FT                   /translation="MVVLNKIYTKTGDAGETALGNGARVAKHAMRVAAYGTVDETNATV
FT                   GLARQHATGEMDAQLAMIQNDLFDLGADLCRPDMEKDAEAEYPPLRMADSQVARLEAEI
FT                   DAMNKDLEPLRSFILPGGSALAAQLHLCRTVSRRAERLSVELATIETVNPAAVKYLNRL
FT                   SDWFFVAGRVANSNGADDVLWVPGANR"
FT   gene            complement(216579..216794)
FT                   /locus_tag="Dshi_0219"
FT   CDS_pept        complement(216579..216794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2554 hypothetical protein; no
FT                   significant swissprot; no conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91968"
FT                   /db_xref="GOA:A8LLF8"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF8"
FT                   /protein_id="ABV91968.1"
FT                   /translation="MAQDPLFIVMAIAMLAVVGILLFGIGSFAKGGDFNKKYANKAMRW
FT                   RIAAQFIAVLLILLFVFVRRQTTGEG"
FT   gene            complement(216879..217712)
FT                   /locus_tag="Dshi_0220"
FT   CDS_pept        complement(216879..217712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0220"
FT                   /product="putative oxidoreductase NAD-/NADP-dependent"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR KEGG:
FT                   rde:RD1_1391 oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91969"
FT                   /db_xref="GOA:A8LLF9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLF9"
FT                   /protein_id="ABV91969.1"
FT                   /translation="MTQRSLLITGCSSGIGLDAARGLRARGWQVFAACKKPRDCARLEA
FT                   EGFVSPRIDYTDTASIEAGLAQVLEATGGKLDALFNNGAHAIPGAVEDLPTDALRANFE
FT                   ANFFGWHELTRRVIPVMRAQGHGRIVQNSSVLGFVTLPWRASYVSTKFALEGLTDTLRI
FT                   EMADTPIHVILIEPGPITSRIRENSIPHFVKWIDWRASPRAAQYESRLLKRLYNDSGPD
FT                   KFELPAQAVTDKLIHALESPRPRPRYYVTTPTYIMGAARRLLPTRWLDRLIRKAG"
FT   gene            217806..220139
FT                   /gene="parC"
FT                   /locus_tag="Dshi_0221"
FT   CDS_pept        217806..220139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="Dshi_0221"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sil:SPO0726 DNA topoisomerase IV, A subunit
FT                   TIGRFAM: DNA topoisomerase IV, A subunit PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller, high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91970"
FT                   /db_xref="GOA:A8LLG0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG0"
FT                   /protein_id="ABV91970.1"
FT                   /translation="MSDTTDDPNMDDPDAEEPGAAQTSEPLRRAIGARYLQYALSTIMH
FT                   RALPDARDGLKPVHRRILYAMRELRLSATGGFRKSAKISGDVMGNYHPHGDAAIYDAMA
FT                   RLAQDFNVRYPLVDGQGNFGNIDGDNPAASRYTEARLTAAAEALMEGLAENAVDFRDNY
FT                   DGTLTEPEVLPAAFPNLLANGSSGIAVGMATNIPPHNLHELIDGCLHLIRAPNARDETL
FT                   LEMIPGPDFPTGGVIVEPKESIAQAYATGRGAFRLRARWAREDLGRGQWQIVITEIPYQ
FT                   VQKSKLIEKIADLIQTKKVPILADIRDESADDVRIILEPRSKNVDPEVLMGTLFRLSEL
FT                   ETRFSLNMNVLIDGRTPKVCSLREVLRAFLDHRRDVLGRRSRHRLAKIDHRLEVLEGFL
FT                   VAFLNLDRVIDIIRYDEDPKAALMREDWSLKHVRATDEADYKTPAPGEGELTEVQAEAI
FT                   LNMRLRSLRRLEEMELISERDALMAERAELEDLLADEALQWARIADELREVRKQFGKGT
FT                   ALGKRRTDFAVATEMAEVSLEDMIEREPITVVCSKMGWIRAMKGHVALDQALKFKDGDE
FT                   GRFIFHAETTDKLLAFGANGRFYTLSCAALPGGRGMGEPIRLMVDLPNEAELVDLFLHV
FT                   PGRRLIVASDAGDGFIVPETEVLAQTRTGKQVLNVKSPHRALLARPVAGDAIAAVGENR
FT                   KLLVFAADELPEMGRGKGVRLQKYKDGGLSDLRSFDRAQGLQWLDAGGRTRTVADPELA
FT                   EWSGKRAGTGRMAPRGFPRDNKFT"
FT   gene            220158..220832
FT                   /locus_tag="Dshi_0222"
FT   CDS_pept        220158..220832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_0330 hypothetical protein, no
FT                   significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91971"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG1"
FT                   /protein_id="ABV91971.1"
FT                   /translation="MQVWVRSSAALALAALLAACGNHAELREQRNLGAFELGFNVVIAD
FT                   NAQTVPGGRVATEEQIEAAITSEIDRRFRRYDGGRLYHLGIIVEGYLLAPPGVPVIAAP
FT                   KSVMVLTVNVFDDALGENLVPGGKQFTVLESLTGDAVVGSGFTMTAEEQLLNLAQNAAG
FT                   QIETWLEDNPKWFDYEVVRNPFEEGMTFEVDVTEITPEAAAGTASISRPPARPAAPDRP
FT                   GI"
FT   gene            220923..222098
FT                   /gene="tufA2"
FT                   /locus_tag="Dshi_0223"
FT   CDS_pept        220923..222098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA2"
FT                   /locus_tag="Dshi_0223"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein KEGG: sit:TM1040_2434
FT                   translation elongation factor Tu; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91972"
FT                   /db_xref="GOA:A8LLG2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLG2"
FT                   /protein_id="ABV91972.1"
FT                   /translation="MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKQFGDFKAYDEI
FT                   DGAPEEKARGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVFMNKVDQVDDEELLELVEMEIRELLSSYEYPGDDI
FT                   PIIAGSALAALEGRDPEIGEQKIAELMKAVDDYIPTPARAVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVINVGDEIEIVGIRDTKKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDR
FT                   EGVERGQVLCKPGSVTPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVT
FT                   LPEGTEMVMPGDNLKFGVELIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE"
FT   gene            complement(222170..223045)
FT                   /locus_tag="Dshi_0224"
FT   CDS_pept        complement(222170..223045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0224"
FT                   /product="hypothetical protein"
FT                   /note="bad Ref ZP hit to methyltransferase FkbM from
FT                   Lyngbya sp. PCC 8106, no significant swissprot hit,
FT                   conserved domain related to
FT                   S-adenosyl-L-methionine-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91973"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG3"
FT                   /protein_id="ABV91973.1"
FT                   /translation="MTTPATGPRLSVPAPFRDAPWQADALRAAEAEIAVPTMLAPEERQ
FT                   FYYWAARDWARGEGALVDLGAFAGGSTARLAAGAAAAGHGAVIHAYDRFTAKEQTKANV
FT                   LYAAGVPPFEGRDILPLAQEFLAPWAAQTRFHVGHIPDLGWPGGRIELLAVDAAKIATT
FT                   TDLIAAAFLPHLIPGRSLVIQQDFLHWSQPWLPAQMWRLRDHLRPVAFARRDTVAFLCT
FT                   APITPEALEGARIAEATDMELIEDIRAIRETLPEDWDLTRRLRRTIAALRANPGERIAW
FT                   KMRPAPPPGS"
FT   gene            223158..223233
FT                   /locus_tag="Dshi_6002"
FT   tRNA            223158..223233
FT                   /locus_tag="Dshi_6002"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            223884..224186
FT                   /locus_tag="Dshi_0225"
FT   CDS_pept        223884..224186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3026 hypothetical protein, no
FT                   swissprot, bad Ref hits, no conserved domains detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91974"
FT                   /db_xref="InterPro:IPR021111"
FT                   /db_xref="InterPro:IPR038125"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG4"
FT                   /protein_id="ABV91974.1"
FT                   /translation="MKNRILVSALLALALLAPPSLAQDSGDSWLPSLLTETPAQGFDLA
FT                   VTMARKGVTTTQGDKEVLFAVRPNYARDPQSLIDVSGVIAMYFATIAEANDHWEN"
FT   gene            complement(224310..224642)
FT                   /locus_tag="Dshi_0226"
FT   CDS_pept        complement(224310..224642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0226"
FT                   /product="protein of unknown function DUF1244"
FT                   /note="PFAM: protein of unknown function DUF1244 KEGG:
FT                   sil:SPO3602 hypothetical protein; no significant swissprot
FT                   hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91975"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG5"
FT                   /protein_id="ABV91975.1"
FT                   /translation="MTAPQIDPQTQVELEAAAFRALRKHLMEDRTDVQNIDMMNLAGFC
FT                   RNCLSRWYQEAAAEKGIELGKEDAREIFYGMPMAEWKANYQTDASPEKQAEFETAFKEN
FT                   VTDKQG"
FT   gene            complement(224639..225388)
FT                   /locus_tag="Dshi_0227"
FT   CDS_pept        complement(224639..225388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0227"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase KEGG:
FT                   jan:Jann_0446 N-formylglutamate amidohydrolase; high Ref
FT                   hit, but no significant swissprot hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91976"
FT                   /db_xref="GOA:A8LLG6"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG6"
FT                   /protein_id="ABV91976.1"
FT                   /translation="MDACPFLEIDGPAPSDWVLLCDHARNWVPPDVAGGDLGLPPEDMA
FT                   RHIAYDPGAEGVTRVLAAELNAPAVMATFSRLVIDPNRAEDDPTLLMRLYDGSIIPGNR
FT                   HADATERQRRIEAWHRPYHDAVTAMLAARPEAMLVSIHSFTRQLRGRAPRPWHIGVLYS
FT                   DDTRLARPLLDVLNGEPDLCIGDNLPYSGHLPGDTMDRHGVQPGRPHVLIELRNDLIST
FT                   PETQAAWGVRLAHLLRAAHQQMEETRL"
FT   gene            225543..226991
FT                   /gene="pykA"
FT                   /locus_tag="Dshi_0228"
FT   CDS_pept        225543..226991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="Dshi_0228"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: rsp:RSP_1766 pyruvate kinase TIGRFAM: pyruvate
FT                   kinase PFAM: Pyruvate kinase barrel; Pyruvate kinase
FT                   alpha/beta; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91977"
FT                   /db_xref="GOA:A8LLG7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG7"
FT                   /protein_id="ABV91977.1"
FT                   /translation="MRRHRNLKIVATLGPSSSDYDTIRALFEAGADVFRLNMSHGSHDD
FT                   VAARHEIIRQVEKDTGRPIAILADLQGPKLRVGAFANGPHQLEVGQAFRLDLDPAPGDA
FT                   TRVCLPHKEIFDALEPGARLLVNDGKVVLKVTRCAGDFAETEVLVAGEISDRKGVNVPD
FT                   VVLPLAALSDKDRADLEFVCTLGVEWLALSFVQRAADVHEARELAGNRAAIMSKIEKPA
FT                   AVQAYEEILAASDGIMVARGDLGVELPVQKVPPIQKRLVRGARREAKPVIVATQMLESM
FT                   ISSPMPTRAEVSDVAAAIYEGADAVMLSAESAAGDFPVEAVTTMNNVAIEVESDPTYRQ
FT                   IIEASRPGARSTVADGIVSAAREIAETTTGIKAICCFSESGTTVSKVSREKPRVPIIAL
FT                   TSRLGTARKLCLTWGAHCVMATEISRFKMAVVAAARAARTEGFATEADQILVVAGVPFN
FT                   QAGSTNILRVAPCEEKLIFSTEPG"
FT   gene            226996..227220
FT                   /locus_tag="Dshi_0229"
FT   CDS_pept        226996..227220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0229"
FT                   /product="hypothetical protein"
FT                   /note="bad BLAST hits, best swissprot to Prolyl-tRNA
FT                   synthetase from Haemophilus ducreyi, but very unsure; no
FT                   conserved domains detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91978"
FT                   /db_xref="GOA:A8LLG8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLG8"
FT                   /protein_id="ABV91978.1"
FT                   /translation="MEGALPLIGGLICLALAVTRSLVAAIEQRAIWPTLLLAPVGLGLL
FT                   AVAWQAQPDGLQLEDIPVAVVKIYRTVMD"
FT   gene            227567..227767
FT                   /gene="rpmI"
FT                   /locus_tag="Dshi_0230"
FT   CDS_pept        227567..227767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="Dshi_0230"
FT                   /product="50S ribosomal protein L35"
FT                   /note="PFAM: ribosomal protein L35 KEGG: sil:SPO3599
FT                   ribosomal protein L35; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91979"
FT                   /db_xref="GOA:A8LLG9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLG9"
FT                   /protein_id="ABV91979.1"
FT                   /translation="MPKMKTKSSAKKRFKMTATGKVRAGQAGKRHGMIKRTTKFIRTAR
FT                   GTTILSAPDAKIVKSYMPYSR"
FT   gene            227780..228145
FT                   /gene="rplT"
FT                   /locus_tag="Dshi_0231"
FT   CDS_pept        227780..228145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Dshi_0231"
FT                   /product="50S ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20 KEGG: rde:RD1_1010
FT                   ribosomal protein L20, high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91980"
FT                   /db_xref="GOA:A8LLH0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLH0"
FT                   /protein_id="ABV91980.1"
FT                   /translation="MSRTKGGTVTHARHKKVTDAAKGYYGRRKNTFKVARQAVDKANQY
FT                   ATRDRKNRKRQFRALWIQRINAAVRAHDEALTYSRFINGLSLAGIEVDRKVLADLAVHE
FT                   PEAFSAIVDQAKAALPA"
FT   gene            228403..229473
FT                   /locus_tag="Dshi_0232"
FT   CDS_pept        228403..229473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2161 hypothetical protein; no
FT                   significant swissprot, best Ref ZP hit to type I secretion
FT                   target repeat protein from Roseovarius sp. 217; Hedgehog
FT                   hintN domain detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91981"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH1"
FT                   /protein_id="ABV91981.1"
FT                   /translation="MARISELHYSNAYARRSGEPEFLEVALDPSENPADFVVSFYQTSG
FT                   QLALEVRLDDPGVTVTRDPETGEDVYVISETVFIVRLTDPDSIGPRNTEAFALTNTATD
FT                   TVINFYDIGGGRTDIVADGGAADGAVSTNIPVPTGPVAATYSIQFNKPDPDTPVYIPVT
FT                   PGDSGVCFTPGTLIDTPDGPRMVQDLRPGDLVWTRDAGAQPLRWVGARTVPAAGPLAPV
FT                   AIPAGMYGATAPLLVSPQHRMLLTGWQAELLTGTDEVLVAALHLVDGDRVVRRPGGMVT
FT                   YIHILFDRHHLVRANGAWSESFHPGAQGLETMDGAARDELLGLFPELRESPAAYGPSAR
FT                   RSLRAHEAQLLRLPSR"
FT   gene            229629..231512
FT                   /locus_tag="Dshi_0233"
FT   CDS_pept        229629..231512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0233"
FT                   /product="putative citrate transporter"
FT                   /note="PFAM: Citrate transporter KEGG: mgm:Mmc1_1728
FT                   citrate transporter; best Ref ZP hit to sulfur deprivation
FT                   response regulator from Rhodobacterales bacterium HTCC2150,
FT                   best swissprot toUncharacterized transporter sll0640 from
FT                   Synechocystis sp. PCC 6803; CitMHS domain detected (citrate
FT                   transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91982"
FT                   /db_xref="GOA:A8LLH2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH2"
FT                   /protein_id="ABV91982.1"
FT                   /translation="MEALTLTYPMMVVLGLLGFTVALFVSEVVRIDFAAILVMVLLGLL
FT                   SQLPGLHSLADVSTLFDGLASNAVVSIIAVMIIGAGLDKTGLMSKVAALILKRGGSSEA
FT                   RVVPIVSGTVGVISSFMQNVGAAALFLPVVSRISVRTGLPLSRLLMPMGFCAILGGTLT
FT                   MVGSSPLILLNDLLLAANPSLPPDARMAPYGLFSVTPVGIALVATGILYFMLFGRWVLP
FT                   SGQKGGDATSGQSTKDYLKQIYGLKTDIFEITIPEGHRVAGQTYDDLTKRYHVYIIGSA
FT                   YQGKTWFAPVIQTEITPPCRLAVLGRAREVRHMAEDMGFTLHDRLDVFAEDYAPTKSGI
FT                   AEVVIPPGSSLIGKCAHDVVFRKTYGASMLAIHRGEETLSIVETEDHTHTQIGEVPFRA
FT                   GDTLVILTTWEALTRLSRNRDFVVVTSDYPQEEPRPKKVGWALLFFAIALGLILLTDLR
FT                   LSLCLLTGAAGMILTRVLDIDEAYNAVSWSTVFLLASLIPLGQAVQSSGTAAWIAQQIL
FT                   ILLDGWPLWALQAGLAVLSTVFTLIMSNVGATVLLVPLAISIAMAAGGDPALFALTVAI
FT                   STSNSFLIPTHQVNALIMGPAGYKVTDFIKSGGIMTLLFLVVSLSVMNLVF"
FT   gene            231585..232649
FT                   /locus_tag="Dshi_0234"
FT   CDS_pept        231585..232649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2161 hypothetical protein; no
FT                   significant swissprot hit, Hedgehog/intein (Hint) domain,
FT                   Ref ZP hit to type I secretion target repeat protein
FT                   fromRoseovarius sp. 217; same like Dshi_232"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91983"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH3"
FT                   /protein_id="ABV91983.1"
FT                   /translation="MARISEMHYSDVYSNASGVSEFLELALDPSEDPADFTASFYNHDG
FT                   TALIEIPLDHPDVRVSFDADSGENVYVISQDDFVIRLTDPDGGGTLNAEAAALTDHTSG
FT                   TVHSFFDIGGETQNITALDGAAQGAVSVNVWPPTGAGMATYSIQWNQPDPTTPVFEPVD
FT                   PGDTGMCFTPGTRIDTPDGPRPVEHLRPGDLVLTRDAGAQPLVWTGARRVPAAGVLAPV
FT                   AIPVGVHGATAPLLVSPQHRILVTGWQAELLTGAAEVLVAALHLVDGDRVVRRPGGMVT
FT                   YVHILFDRHQIVRANGAWSESFHPGAQGLDTMAQASRDELLALFPELAADPAAYGPSAR
FT                   PTLRAHEARLLCKL"
FT   gene            232709..233782
FT                   /gene="pheS"
FT                   /locus_tag="Dshi_0235"
FT   CDS_pept        232709..233782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Dshi_0235"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha subunit
FT                   PFAM: phenylalanyl-tRNA synthetase class IIc; aminoacyl
FT                   tRNA synthetase class II domain protein KEGG: sil:SPO3594
FT                   phenylalanyl-tRNA synthetase, alpha subunit, high
FT                   swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91984"
FT                   /db_xref="GOA:A8LLH4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLH4"
FT                   /protein_id="ABV91984.1"
FT                   /translation="MDDLKSKYLAAIAEAADESALETLRVAAVGKKGEISLKMRELGKM
FT                   TPEERKTAGPALNALKDEINSALAAKKAALADAALDERLRSEWLDVTLPGRQRPAGTLH
FT                   PISQVSEEVAAIFADMGFAVAEGPRVESDWYNFDALNIPGHHPARAEMDTFYMKRAEGD
FT                   DRPPHVLRTHTSPVQIRAMQEHGAPIRVICPGGVYRCDYDQTHTPMFHQVEGLAIDRDI
FT                   SMANLKWVLEEFVRSYFEVDDVELRFRASHFPFTEPSAEVDIRCSWEGGQLKVGEGDDW
FT                   LEILGSGMVHPKVLEAGGIDPTQWQGFAFGMGIDRIAMLKYGIPDLRAFFDSDLRWLRN
FT                   YGFSALDVPTVHAGLSR"
FT   gene            233956..234210
FT                   /locus_tag="Dshi_0236"
FT   CDS_pept        233956..234210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0236"
FT                   /product="hypothetical protein"
FT                   /note="no swissprot, bad Ref ZP hit to phenylalanyl-tRNA
FT                   synthetase beta subunit from Loktanella vestfoldensis
FT                   SKA53, no conserved domains, just short signalpeptide and
FT                   two transmembrane regions, bad GC frame plot, maybe
FT                   Dshi_0236 is part of Dshi_0237?"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91985"
FT                   /db_xref="GOA:A8LLH5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH5"
FT                   /protein_id="ABV91985.1"
FT                   /translation="MQGGFPASPVPYLSPMKIRIALAALLTLIVVAHIGLWMSDRMPTE
FT                   MKLRFTIINVLGWSVVLLPAYGVSRWLAAREAERDPSDR"
FT   gene            234571..236967
FT                   /gene="pheT"
FT                   /locus_tag="Dshi_0237"
FT   CDS_pept        234571..236967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="Dshi_0237"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: rde:RD1_1013 phenylalanyl-tRNA synthetase,
FT                   beta subunit TIGRFAM: phenylalanyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91986"
FT                   /db_xref="GOA:A8LLH6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH6"
FT                   /protein_id="ABV91986.1"
FT                   /translation="MKFTLSWLKDHLETDATLDEILYALTDLGLEVEGVENPAAKLSDF
FT                   VVGKVLRAEKHPEADRLKVCQVEYGDGPVQIICGAPNAREGITVVVARPGVYVPGIDTT
FT                   IGVGKIRGIESHGMMASERELEMSDEHTGIIELPEGEIGQSFPDWLAVYDPARVDPVIE
FT                   IAITPNRPDALGVRGIARDLAARGLGTMKARDVAPVPGAFPCPITVTIDDDTRDAAPVF
FT                   YGRLIRGVKNGPSPDWLQTALRAIGLRPISTLVDITNFFTYDRNRPLHVFDADKVAGCL
FT                   RVHAAKGGETFTGLDEKEYVLAPGMTAISDDNGVESLAGIMGGLHSGCTEETVNVFVEA
FT                   AYFDPVRTAYTGRALKINSDARYRFERGIDPAWTPEGMEHATRMILDLCGGEASDVVVA
FT                   GALPDVARAYKLDTDRVQSLVGMDIAPETQRATLEALGFTLEGDMAHVPSWRPDVMGEA
FT                   DLVEEVARIASLTKLQGRPLPRASTGVPKPVVTQGQRRQALARRTAAALGYNECVTYSF
FT                   IDQPTAALFGGGTEATELENPISSEMSHMRPALLPGLMQAASRNQARGIMDLALFEVGP
FT                   AFHGGEPGEQHTLISGLLVGRTGPKDVRGESRPVDVFDVKADAEAILAAIGAPAKVQIL
FT                   RGAQGWWHPGRHGKICLGPKKVLGVFGELHPRVVAAMDLKGPVMGFTLWPDEVPMPRKT
FT                   SATRPALEARDLQAVERDFAFVVDAQVEALALTNAAAGADKTLIEEVRVFDEFIGGALG
FT                   EGKKSLAITVRLQPTDATLTEKEIEAVAARIVAKVEKATGGVLRG"
FT   gene            237254..237724
FT                   /locus_tag="Dshi_0238"
FT   CDS_pept        237254..237724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO3492 hypothetical protein; no
FT                   swissprot; best Ref hit to succinate dehydrogenase
FT                   iron-sulfur subunit from Roseobacter sp. AzwK-3b; no
FT                   conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91987"
FT                   /db_xref="InterPro:IPR019884"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH7"
FT                   /protein_id="ABV91987.1"
FT                   /translation="MGLNIYLSGEIHTDWREQIVEGAAGLDVTFNAPVTDHAASDDCGV
FT                   AILGAEPNKYWHDHKGAMVNAIRIRKGIADADVVVVRFGEKYKQWNAAFDAGYAAALGK
FT                   SIIVLNPPEHQHALKEVHAAALAVAETPAQVVEVLRYVLTGALPAGQSAAAE"
FT   gene            complement(237729..238490)
FT                   /gene="nadX"
FT                   /locus_tag="Dshi_0239"
FT   CDS_pept        complement(237729..238490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadX"
FT                   /locus_tag="Dshi_0239"
FT                   /product="aspartate dehydrogenase"
FT                   /EC_number="1.4.1.21"
FT                   /note="PFAM: aspartate dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding KEGG: mes:Meso_0824 aspartate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91988"
FT                   /db_xref="GOA:A8LLH8"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH8"
FT                   /protein_id="ABV91988.1"
FT                   /translation="MRLALIGLGAINRAVAAGMAGQAEMVALTRSGAEAPGVMAVSDLS
FT                   ALRVFAPDLVVEAAGHGAARAYLPGLLAAGIDVLMASVGVLADPETEAAFRAAPAHGAQ
FT                   LTIPAGAIGGLDLLAALPKDSLRAVRYTGVKPPAAWAGSPAADGRDLSALDGPVTLFEG
FT                   TARQAALRFPNNANVAATLALAGAGFDRTEARLVADPDAAGNGHAYDVISDTAEMTFSV
FT                   RARPSDTPGTSATTAMSLLRAIRNRDAAWVV"
FT   gene            complement(238487..239185)
FT                   /gene="gst3"
FT                   /locus_tag="Dshi_0240"
FT   CDS_pept        complement(238487..239185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst3"
FT                   /locus_tag="Dshi_0240"
FT                   /product="glutathione S-transferase domain protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="PFAM: Glutathione S-transferase domain KEGG:
FT                   sil:SPO3494 glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91989"
FT                   /db_xref="GOA:A8LLH9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLH9"
FT                   /protein_id="ABV91989.1"
FT                   /translation="MSDLSRFPITARWPAENPGVIQLYSFPTPNGVKVSIALEELGLAY
FT                   EPHLVTLSDTDVKSPAFLSLNPNNKIPAIIDPDGPEGPLGLFESGAILLYLAEKTGKLA
FT                   GRNAAEKAVVTQWLMFQMGGLGPMLGQLGFFVKFAGAAIEDPRPRDRYVSEARRLLAVL
FT                   EGALEGRDWIAGEYSIADIAIAPWLRALDFYGARELVGWADHPNLVAYLDRFLARPAVQ
FT                   KGLNIPARPA"
FT   gene            239334..239729
FT                   /gene="mscL"
FT                   /locus_tag="Dshi_0241"
FT   CDS_pept        239334..239729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="Dshi_0241"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein PFAM: large-conductance mechanosensitive channel
FT                   KEGG: jan:Jann_0457 large conductance mechanosensitive
FT                   channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91990"
FT                   /db_xref="GOA:A8LLI0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLI0"
FT                   /protein_id="ABV91990.1"
FT                   /translation="MLNEFKQFIAKGNVMDMAVGIIIGAAFTAIVTSLVEDLINPIISL
FT                   FTGGLDFSGLGLALTEGEEAAVFAYGNFIMAVINFLIIAWVVFLLVKMVNRIKEMAENE
FT                   PEEAPAEDPGPTEKELLMQIRDSLAKS"
FT   gene            239815..240792
FT                   /locus_tag="Dshi_0242"
FT   CDS_pept        239815..240792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: fatty acid hydroxylase KEGG: hne:HNE_0606
FT                   hypothetical protein; no significant swissprot hit, middle
FT                   Ref YP hit to hypothetical protein HNE_0606 from Hyphomonas
FT                   neptunium ATCC 15444, Erg3 domain: sterol desaturase and
FT                   fatty acid hydroxylase superfamily domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91991"
FT                   /db_xref="GOA:A8LLI1"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI1"
FT                   /protein_id="ABV91991.1"
FT                   /translation="MDLLSNYLRDLGAVPFNMNLRISLVYLLCTVVLAGAIWIWRGRPT
FT                   GFLSWLLPASVYRHRSNLLDIKLFLTNRLVDASGLAGAVFFPPLVAIGLIGLWADVAGY
FT                   NPPPETWGRTLLATIIIVMASDFCKYWAHRWHHEWKVLWPFHAVHHSADVLTPLTVMRA
FT                   HPVETLLRNLLITVVVGVVQAVVLILVLGQIDFVTIGGANALYVLFNALGANLRHSHIW
FT                   LSYGAVLEHVFISPAQHQVHHSVAVEHHDKNYGSIFALWDWAFGTLYIPPRQEALTFGI
FT                   SDAAGKRIAQPHETLGAALLTPFAESIAAARTGEDAAAPELRKP"
FT   gene            240789..241940
FT                   /locus_tag="Dshi_0243"
FT   CDS_pept        240789..241940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0243"
FT                   /product="acyltransferase family protein"
FT                   /note="PFAM: acyltransferase 3 KEGG: hne:HNE_0605
FT                   acyltransferase family protein; bad swissprot to
FT                   transferases, middle Ref YP hit to acyltransferase family
FT                   protein from Hyphomonas neptunium ATCC 15444"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91992"
FT                   /db_xref="GOA:A8LLI2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI2"
FT                   /protein_id="ABV91992.1"
FT                   /translation="MSGARPMSPGFSLWLDVLRAGAALTVLFGHMAHTRFTRGDYEVLR
FT                   DWNLASDAVVVFFVLSGVVIAYAAERDGTLGRFAFHRLTRVLSVVAPALVLTLLFDAIG
FT                   QRLDLRAYQPPFFEALPVAEMLWRGLSFSNEWQGLSDRVRLGSNGPLWSLSYEVAFYAL
FT                   FAIAFYLRGFLRWVLLALGALLAGLPILALMPCWLLGVALWHHIQRALALPRSRAWALA
FT                   LGGPVTLVALKAAGLAPFLSALTAAAVAPASHHALLGYSDEVLWNTLLALCVAAHLRGV
FT                   HALCVGRTAPHRGRPARAVRWIAQGSFSLYVLHYPVLHLLDAGLPEALPGYDLWLLALT
FT                   LLACFAFAALFERRLPQQRARLRQLWCRLHKPRSDRPERALSG"
FT   gene            complement(241950..243065)
FT                   /gene="adh"
FT                   /locus_tag="Dshi_0244"
FT   CDS_pept        complement(241950..243065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="Dshi_0244"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; alanine
FT                   dehydrogenase/PNT domain protein KEGG: sit:TM1040_3628
FT                   alanine dehydrogenase; high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91993"
FT                   /db_xref="GOA:A8LLI3"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI3"
FT                   /protein_id="ABV91993.1"
FT                   /translation="MRIGCPTEIKPQEFRVGLTPAAAAEAVAHGHAVLVQAGAGVGSGF
FT                   EDADYIAAGARIVDTAEEVFAKADMVVKVKEPQAVERAMLREDQVLFTYLHLAPDPAQT
FT                   RELLASGVTAIAYETVTAPDGTLPLLAPMSEVAGRLAPQMGAWTLQKANGGRGVLLGGV
FT                   PGVGAAEVVVIGGGVVGTHAARVAAGMGAKVTVLDRSLSRLRYLDDVFGGRFANRYASR
FT                   AATAELVAQADMVIGAVLIPGAAAPKLVSRAQLADMKPGAAIVDVAIDQGGCFETSRAT
FT                   THRDPIYEVDGILHYCVANMPGAVARTSTIALGNATLPYMLQIADQGWRAAVRADPHLR
FT                   AGLNVHAGKLTYRAVGEALGLPVTEADLLAA"
FT   gene            243155..243664
FT                   /gene="asnC"
FT                   /locus_tag="Dshi_0245"
FT   CDS_pept        243155..243664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="Dshi_0245"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family KEGG:
FT                   jan:Jann_0459 transcriptional regulator, AsnC family; AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91994"
FT                   /db_xref="GOA:A8LLI4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI4"
FT                   /protein_id="ABV91994.1"
FT                   /translation="MLKSCINDFKTGKSCVMIALDDTDHRLLSALQRAGRLSNAELSER
FT                   VHLSPSACHRRVARMEAAGVIKDYVALVDPRAVDRKTTVFVEVTLSGQADEVLVAFEAA
FT                   VAQVPEVLECHLMAGSADYLLKVVAQDTEAFAALHRRHLATLPGVAQIQSSFALRTVFK
FT                   TTALPL"
FT   gene            complement(243756..243962)
FT                   /locus_tag="Dshi_0246"
FT   CDS_pept        complement(243756..243962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0246"
FT                   /product="putative ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21 KEGG: sil:SPO0229
FT                   ribosomal protein S21, bad Ref and swissprot hits to S21,
FT                   bad GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91995"
FT                   /db_xref="GOA:A8LLI5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLI5"
FT                   /protein_id="ABV91995.1"
FT                   /translation="MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHYEKPSEKKAR
FT                   EKAEAIRRARKLARKKAQREGGL"
FT   gene            244084..244782
FT                   /locus_tag="Dshi_0247"
FT   CDS_pept        244084..244782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: rpsU-divergently transcribed protein PFAM:
FT                   COQ9 domain protein KEGG: rde:RD1_1038 hypothetical
FT                   protein, best Ref hits to hypothetical proteins, middel
FT                   swissprot hit to Ubiquinone biosynthesis protein COQ9 from
FT                   Drosophila melanogaster (fruit fly), gene arrangement with
FT                   following gene (Dshi_0248 quinone oxidoreductase)?"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91996"
FT                   /db_xref="GOA:A8LLI6"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI6"
FT                   /protein_id="ABV91996.1"
FT                   /translation="MEDTRSTPELRAALLDAALIHVAFDGWSQATFAAACTDADIDPAL
FT                   AKSLFPRGAVDLALAFHARGDAEMVARIKREPLDGLRFRDRIAAAVRYRLEAVEDKEAV
FT                   RRATTLFALPVYAGDGAKAVWGTCDLIWETLGDRSDDFNWYSKRATLSGVYSATVLYWL
FT                   GDTSEDHAATWAFLDRRIDDVMKIEEVKGAVNKNPLLRGLMTGPNWVLSQIKPPSKLPR
FT                   ADLPGSYRPK"
FT   gene            244793..245779
FT                   /locus_tag="Dshi_0248"
FT   CDS_pept        244793..245779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0248"
FT                   /product="quinone oxidoreductase putative PIG3"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative PIG3 PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein KEGG: rsq:Rsph17025_2435
FT                   alcohol dehydrogenase, zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91997"
FT                   /db_xref="GOA:A8LLI7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI7"
FT                   /protein_id="ABV91997.1"
FT                   /translation="MTLPETMRAVEITEPGGPEVLRPCTRPMPVPGAGQILIKVAYAGV
FT                   NRPDALQRAGSYAPPPTASDLPGLEVAGEVVATGPDVARWAVGDQVCALTPGGGYAEYV
FT                   VCPAAHALPVPDGMPLDQAAALCENHYTVWSNVVTRGGLTGGERFLVHGGSSGIGTVAI
FT                   QLAHALGARVFATAGSAAKCAACMDLGAERAINYREEDFVPVLQDEGGANLILDMVGGD
FT                   YIPRNLKSLAEDGRLVQIAFLQGPKVAVNFAPLMMRRLTITGSTLRPQSDLAKARIAAE
FT                   LEREVWPLLSAGRIKVVMDSEFALDDAAKAHARMESSAHIGKIVLKV"
FT   gene            complement(246115..246699)
FT                   /locus_tag="Dshi_0249"
FT   CDS_pept        complement(246115..246699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0249"
FT                   /product="efflux transporter"
FT                   /note="located downstream of an ORF representing the
FT                   N-terminal part of RND subunit, putative sequencing error
FT                   colocated with MFP subunit; pfam00873,; RND family,
FT                   C-terminal part of RND subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91998"
FT                   /db_xref="GOA:A8LLI8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI8"
FT                   /protein_id="ABV91998.1"
FT                   /translation="MALGGDADARNDTVNRLLAPLGLIVTLSLATIVLTFGSFRLAAVT
FT                   LVVAVLSAGLSLLSLAVFQYPFGITAIIGVIGSIGVSINAAIIILTGLQQDEAAAAGDR
FT                   DAMAQVVMNGSRHILSTTLTTFGGFLPLILAGGGFWPPFAMAVAGGVLLSTVVSFYFTP
FT                   PLFALVRPRRTKAANQVEGHTCLAELKIAAE"
FT   gene            complement(246745..249237)
FT                   /locus_tag="Dshi_0250"
FT   CDS_pept        complement(246745..249237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0250"
FT                   /product="efflux transporter"
FT                   /note="located upstream of an ORF representing the
FT                   C-terminal part of RND subunit, putative sequencing error
FT                   colocated with MFP subunit; pfam00873,; RND family,
FT                   N-terminal part of RND subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV91999"
FT                   /db_xref="GOA:A8LLI9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLI9"
FT                   /protein_id="ABV91999.1"
FT                   /translation="MRTLPFRNPRLVALALLVIIAAGLSAFLSLGRQEDPTITNLNATI
FT                   TTLYPGAEPSRIEALISQPLEDEMRTLADMDEIKSTSATGISIISLQLDEATDPAIIEE
FT                   IWSKARDGVADVARTFPEGVQPPEFDSEGIAAVGAIFAVKPSGAAANPAVLARTAEELA
FT                   ERLRNVPGTKSVESWGTPTEEVRVTLDPAATAALGLTPDAVSAAVRAADAKVQSGRLVS
FT                   GSSDILLDVQGDIEALDRLRQIVLATGPQGQVTRLGDVAEISRSPRDPAPAIALVDGQD
FT                   AILLGVQANEGLQIDVWMGWIRDEVAAFAPLLPASLTVEQIFDQAVYTADRLSEVALNM
FT                   AIGVGLVVLVLLVTLGVRAALIVAAVLPLVSLATLASMNFIGLPIHQMSVTGLIVALGL
FT                   LVDAAIVMTDDIRQRLRAGASRMDAVDTAVKRLFAPLLASTVTTALSFVPMILLPGGAG
FT                   DFVGAIAIAVVLMLIWSLIIALTITPALAGWLLPEGGRGAGLPSGLAGRAFHASLRWSV
FT                   RNPVRSVALALVLPAMGFASFPTLTAQFFPGVDRDQFHIEVDLAPGAALSRTHALVEEM
FT                   DALLRATPGITRVAWTLGESAPAFYYNIVGSRQGAPGFAQELITTAAPEATADLLDPLQ
FT                   TTLTARFPEARILVRGLVQGPPVDAPVEFRLEGPTLEVLRAEGERLRAILLGVEGITTV
FT                   RASYEGGAPKVQVEIDEAAAQLAGLSLADVARQLQSGLDGVTGGSLIEASEQLPVRVQL
FT                   GAGTRDDLERISQMLIVPPPGNGRSSQTLPAFPLSAMAEISLVPSDSPIARQNGTRVNT
FT                   VQAFIAPDLLPQEALVRA"
FT   gene            complement(249241..250392)
FT                   /locus_tag="Dshi_0251"
FT   CDS_pept        complement(249241..250392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0251"
FT                   /product="efflux transporter"
FT                   /note="colocated with RND subunit; TIGRFAM: efflux
FT                   transporter, RND family, MFP subunit PFAM: secretion
FT                   protein HlyD family protein KEGG: jan:Jann_1310 secretion
FT                   protein HlyD; RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92000"
FT                   /db_xref="GOA:A8LLJ0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ0"
FT                   /protein_id="ABV92000.1"
FT                   /translation="MPKDPASPLSPSRTRRGLRRLGILTGTGLTLALAAGLVMGGSGLI
FT                   AARAQQDGPARPETVLPVQTAPLVIEDSYAVTARFTGQVEPARSADLGFEAGGTLAEVL
FT                   VDEGDRVAAGDVLARLDIRAQQADRAAQVAARDAARARRDLAELTSARQERLAASDFAS
FT                   AQRADEARFRLAEAEAQIAQADAAILALDVALSKSQITAPFDGTIAARLRDEGARLGGG
FT                   TPVLRIEETEAPQLRVGLPDALAQTLGPDATFPVTLPGGTATATLDRLRPDLDPVTRTR
FT                   AAVFTLDRPAPSGTLATLEMTREVPGRGAWVPLSALSEGIQGLWTLYLLDDGDILRRES
FT                   VEVLHATGTRAFVTGTFPQAARYVPAGAHRIAPGQRVAPTPAG"
FT   gene            250470..251144
FT                   /locus_tag="Dshi_0252"
FT   CDS_pept        250470..251144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0252"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein TetR KEGG: jan:Jann_1309
FT                   transcriptional regulator, TetR family; TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92001"
FT                   /db_xref="GOA:A8LLJ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ1"
FT                   /protein_id="ABV92001.1"
FT                   /translation="MSNIKSRLIGFSPKAPCRKGDMRVKQATRVTGKAGYHHGDLRQQL
FT                   VKATRELIEEKGAEAFSVSEACRRAGVSTAAPYRHFGDKTDMVAAVILEGMAEMTARLH
FT                   AAAALFPHGSIEGIAASGAEYVAYAETHPTLFRLMFAENSGRADVEEAGHTCYSGLLMQ
FT                   VAAYLGKDAVDEEVLTVSFPLWTFVHGLSFLRIDGKAEFARMHMPVADLVSDATRRLLT
FT                   GR"
FT   gene            251200..252759
FT                   /locus_tag="Dshi_0253"
FT   CDS_pept        251200..252759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0253"
FT                   /product="putative Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II"
FT                   /EC_number="6.2.1.12"
FT                   /note="PFAM: AMP-dependent synthetase and ligase KEGG:
FT                   sil:SPO0801 4-coumarate:CoA ligase; high swissprot to
FT                   4-coumarate--CoA ligase 1 from Nicotiana tabacum"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92002"
FT                   /db_xref="GOA:A8LLJ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ2"
FT                   /protein_id="ABV92002.1"
FT                   /translation="MKIYRSPFADVTVRDLSITEALFEGLARRGDAPILIDGPSGAAMT
FT                   GAQLEGRIRACAGGLRARGIGPGDVVAIMAPNMPDYATAFHGAAFAGATVTTLNPTYTT
FT                   EEAAHQLRDSGAQMLVTVPAFADLAAEAVQGTGVTETVMMGTTGPGSLEALFGPPLAAQ
FT                   VAVDLARDIVVLPYSSGTTGLPKGVMLSHRNLVVNVDQTAEIIGITVQDVTVGFLPFFH
FT                   IYGMTVLMNCYLSRGAAVVTMPRFDLEQFLSLCQTHRPRQLYIAPPVALALAKHPMVDD
FT                   YDLSGVEFILSGAAPLGGDVAEAVGRRLGVEMVQGYGMTEMSPVSHFTPPGQNVPGSVG
FT                   PTAPSAESRIVDPETGEDAAEGEVWVRGPQIMQGYLNRPDATAETVTRDGWLKTGDLGR
FT                   FDEAGNLFITDRVKELIKVSGFQVAPAELEAVLLTHPAITDAAVIGVPDDSAGERPMAF
FT                   VVRSDPDLSEGAVIAHAAEHLAHYKRIARVAFVEAVPKSASGKILRRLLRAKVGEDMAT
FT                   GA"
FT   gene            complement(252790..253431)
FT                   /locus_tag="Dshi_0254"
FT   CDS_pept        complement(252790..253431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0254"
FT                   /product="ribonuclease T2"
FT                   /EC_number="3.1.27.-"
FT                   /note="PFAM: ribonuclease T2 KEGG: jan:Jann_3879
FT                   ribonuclease T2, unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92003"
FT                   /db_xref="GOA:A8LLJ3"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ3"
FT                   /protein_id="ABV92003.1"
FT                   /translation="MLRCVLCLCLLLAAPATARADGDQAGEFDYYVLALSWSPNWCLRE
FT                   GDDRDAPECAPGAGRGWTLHGLWPQYETGWPSDCRTTASDPSRAMTRAMTDIMGSAGLA
FT                   WHQWKKHGRCSGLSAADYFAASRRAYESVTRPEILRQLDRDVTLPAAVVEEAFLRENPD
FT                   WDADMLTITCRDRQIQEARLCLTRDLEPRRCGADVLRDCTLQDALLTPLR"
FT   gene            253588..254340
FT                   /locus_tag="Dshi_0255"
FT   CDS_pept        253588..254340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0255"
FT                   /product="protein of unknown function DUF1013"
FT                   /note="PFAM: protein of unknown function DUF1013 KEGG:
FT                   rde:RD1_1043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92004"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ4"
FT                   /protein_id="ABV92004.1"
FT                   /translation="MAKPLMAKATAVWLVDNTTLSFKQIADFCGLHELEVQGIADGDVA
FT                   AGVKGFDPIANNQLEQSEIDRAENNPGYTLKLKYNPAATGEEKRRGPRYTPLSKRQDRP
FT                   ASILWLVKFHPELSDGQISKLVGTTKPTIQAIRERTHWNIQNIQPIDPVALGLCKQTEL
FT                   DAAVQKAAAKKAREGELMSDDERRKLVSTEQSLEMEPEPRMPTAISGLESFTLLGNDDD
FT                   EDEDKSTLVDADSLFNLPDSKDDEDEQP"
FT   gene            complement(254419..254667)
FT                   /locus_tag="Dshi_0256"
FT   CDS_pept        complement(254419..254667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0256"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92005"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ5"
FT                   /protein_id="ABV92005.1"
FT                   /translation="MDTTLKVHIGLKPQAAQTLKALPSEARDAWVEKHIHAHPVTFETF
FT                   ETYGFLSCTLDRADMLSTVKAAPEVDWVEIDRKMSAI"
FT   gene            complement(254727..256076)
FT                   /locus_tag="Dshi_0257"
FT   CDS_pept        complement(254727..256076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0257"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin KEGG: sma:SAV5709 protease; good swissprot to
FT                   Subtilisin E precursor from Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92006"
FT                   /db_xref="GOA:A8LLJ6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ6"
FT                   /protein_id="ABV92006.1"
FT                   /translation="MPGSGQVLNRDGHPTHIVVFEKPSENNAAMLSSMLGDRSPKGANG
FT                   ALRFQARGARKTSALLYERLAVAEMDMTEAEARDMRDQSGIAAVERNEVMSIPRPVRLD
FT                   PAEAQEAEEGLRPPSRAMGAERDAYLRGVRDLANMLLGEGPRPTGPAGAQGFWRPRNWT
FT                   TWGLDAIGSDRRPELTGEGVKVAVLDTGLDLTHPDFTDVLGARTASFVGTETAQDGHGH
FT                   GTHCCGTVAGPLQPALGPRYGVAPGAELLVGKVLADDGFGMMSQIIDGITWALNEGAQV
FT                   ISMSLGSARAEGAGFSRVYEMVFRRLLSEGVLPICAAGNESDRPGLIAPVGNPAACPGA
FT                   MAVAAVDRRMDPGDFSCGQVDRIGLLDIAGPGVGVHSAWTGGGYRRISGTSMATPHVAG
FT                   VAALHLQADPSTTGDDLRALMKMQATALGPVRDFGAGLVQVPANPGVPVG"
FT   gene            256271..256471
FT                   /gene="secE"
FT                   /locus_tag="Dshi_0258"
FT   CDS_pept        256271..256471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Dshi_0258"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="part of the sec system translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92007"
FT                   /db_xref="GOA:A8LLJ7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ7"
FT                   /protein_id="ABV92007.1"
FT                   /translation="MAITNPFQFLQQVRAEVSKVTWPTRKEVMVTSLMVFAMAILTAIF
FT                   FFFVDWMIRTGLQFVLNFFGG"
FT   gene            256673..257206
FT                   /gene="nusG"
FT                   /locus_tag="Dshi_0259"
FT   CDS_pept        256673..257206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="Dshi_0259"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG PFAM: KOW domain protein; NGN domain protein
FT                   KEGG: rsq:Rsph17025_2547 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92008"
FT                   /db_xref="GOA:A8LLJ8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLJ8"
FT                   /protein_id="ABV92008.1"
FT                   /translation="MAKRWYSVSVLSNFEKKIAEQIKHAVAEAGLEDDIEEVLVPTEEV
FT                   IEVRRGKKVTAERRFMPGYVLVRMEMTDQGYHLINSINRVTGFLGPQGRPMAMRDDEVN
FT                   QILNRVEEGQEAPRSLITFDIGEQVNVTDGPFEGFSGSVEEVDDDNNRLKVTVSIFGRA
FT                   TPVELEFTQVTKTS"
FT   gene            257310..257735
FT                   /gene="rplK"
FT                   /locus_tag="Dshi_0260"
FT   CDS_pept        257310..257735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="Dshi_0260"
FT                   /product="50S ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11 KEGG: sit:TM1040_0229
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92009"
FT                   /db_xref="GOA:A8LLJ9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLJ9"
FT                   /protein_id="ABV92009.1"
FT                   /translation="MAKKLAGTMKLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAK
FT                   TQDMEPGAPCPTVITYYQDKSFTMEIKTPPAAYYLKKAAKVKSGASTPSRQTVGTVTVA
FT                   QVREIAEAKMRDLNANDIEGAMKIVLGSARSMGIEVK"
FT   gene            257737..258435
FT                   /gene="rplA"
FT                   /locus_tag="Dshi_0261"
FT   CDS_pept        257737..258435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="Dshi_0261"
FT                   /product="50S ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1 KEGG: sil:SPO3513
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92010"
FT                   /db_xref="GOA:A8LLK0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLK0"
FT                   /protein_id="ABV92010.1"
FT                   /translation="MAKLGKRTRAAREAVAGKSDLTVEEAVALIKANATSKFDETVEIA
FT                   MCLGVDPRHADQMVRGVVSLPNGTGKTVRVAVFARGPKAEEAQAAGADIVGAEDLMETI
FT                   QSGKIEFDRCIATPDMMPIVGRLGKILGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQF
FT                   KAEKAGVVHAGVGKASFDEAKLVENVRAFVDAVSKAKPSGAKGSYMKKIALSSTMGPGV
FT                   TVAVDSATGN"
FT   gene            258788..259516
FT                   /locus_tag="Dshi_0262"
FT   CDS_pept        258788..259516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_2686 hypothetical protein; PEP-CTERM
FT                   putative exosortase interaction domain; no significant
FT                   swissprot, bad Ref hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92011"
FT                   /db_xref="GOA:A8LLK1"
FT                   /db_xref="InterPro:IPR022472"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLK1"
FT                   /protein_id="ABV92011.1"
FT                   /translation="MRVFGKAGIAAASTLAFAAFMATGAAAAPVTLFKQNNGDTFNGGG
FT                   NLHVNVASPTANAMAGGFRLKDGDDNAFVAWCLDIMNDLAIPAGGQQYNTTTAPFTNTT
FT                   GALDPVTLANVEGLFETAYSSVDITDNAQSAGFQLALWEVLYETDASFDLTAGTFSQSK
FT                   SGSAQDDAEAAANSYLALLAGGVVTQGYNFTYYESGTTGTGDQLSQNLVSVAPVPLPAA
FT                   AWMLGLGLAGLYGARRRRKA"
FT   gene            259644..260429
FT                   /gene="fkbM"
FT                   /locus_tag="Dshi_0263"
FT   CDS_pept        259644..260429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkbM"
FT                   /locus_tag="Dshi_0263"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family KEGG:
FT                   jan:Jann_0310 methyltransferase FkbM; no significant
FT                   swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92012"
FT                   /db_xref="GOA:A8LLK2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLK2"
FT                   /protein_id="ABV92012.1"
FT                   /translation="MRTPFPDRARPARAGLRRSFDIYYRDRARTLRMDRLNAECVAPGG
FT                   LVFDIGAHVGDRTGSFLRLGAQVVALEPQPMAFRAVQRLYGRCPRATLYAVAAGARAGE
FT                   VDLLLNSANPTVATIAPAFPAAASGAPGWEGQVWDDRVRVPVTTLDALIAAHGVPDFVK
FT                   IDVEGHEAEVLNGLSVALPCVSFEVTMIQRDVALACLARLGRLGRYVFNLSLGERHALH
FT                   LPEWVDAATMAAQILDLPDAANSGDVYARLWSDPDPGCD"
FT   gene            260484..261542
FT                   /locus_tag="Dshi_0264"
FT   CDS_pept        260484..261542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_2490 hemolysin-type calcium-binding
FT                   protein, middle Ref hits to hypothetical proteins, no
FT                   swissprot, C-terminal beginning of unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92013"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLK3"
FT                   /protein_id="ABV92013.1"
FT                   /translation="MSVFEDKINDYSNGAQGTLTTPSGQSVGYTVSSSANTMDWGVIDD
FT                   GAQVAQSGGFVEVTFDVAVQNAAIHISSSNVGEDYVVEVDGQPTDLNAMIAAGQATFHN
FT                   FGGNQIINPDGGLTATGSYTTMDAAVLQFHVPITSVKVSGDGSGGGWDVYDIGFAGASL
FT                   PCFRAGTRIVTPKGAVPVESLRPGDEVLTLDHEVQTVLWAGARQVSLAEQIANARLRPV
FT                   RIAAGALGPGCPARPLWLSRQHRVLLTRADGAECLVPVAKLLGCAGVEVAGPTRHISYH
FT                   HLLFAQHEVLQAEGLACESLFWGARSLLLFPAAARAVPAGARAELAKMTPARPFIERRS
FT                   ALRAWLEPSPVG"
FT   gene            261837..262355
FT                   /gene="rplJ"
FT                   /locus_tag="Dshi_0265"
FT   CDS_pept        261837..262355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="Dshi_0265"
FT                   /product="50S ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10 KEGG: sil:SPO3510
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92014"
FT                   /db_xref="GOA:A8LLK4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLK4"
FT                   /protein_id="ABV92014.1"
FT                   /translation="MDRAQKEKLVDELGQIFESSGVVVVAHYAGLTVAEMQDFRARMRE
FT                   AGGSVRVAKNRLAKIALQGKPNEKIGELLTGMTVLAYSEDPVAAAKVADAYAKDNSKYQ
FT                   ILGGAMGEDYLDQAGVKAVASMPSREELIAQIASCIGAPASNIAGAIGAPASNIASILS
FT                   TIEEKAEAA"
FT   gene            262428..262808
FT                   /gene="rplL"
FT                   /locus_tag="Dshi_0266"
FT   CDS_pept        262428..262808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="Dshi_0266"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12 PFAM: Ribosomal
FT                   protein L7/L12 KEGG: jan:Jann_0567 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92015"
FT                   /db_xref="GOA:A8LLK5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLK5"
FT                   /protein_id="ABV92015.1"
FT                   /translation="MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGP
FT                   AGGDAGAAAEEQTEFDVILKAAGAQKINVIKEVRALTGLGLKEAKELVEAGGKAVKEGV
FT                   DKAEAEEIKGKLEAAGAEVELK"
FT   gene            262945..264294
FT                   /locus_tag="Dshi_0267"
FT   CDS_pept        262945..264294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_2598 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; bad BLAST hits, unsure GC frame plot,
FT                   RBS site AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92016"
FT                   /db_xref="GOA:A8LLK6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A8LLK6"
FT                   /protein_id="ABV92016.1"
FT                   /translation="MPITGPDMFRRIIAPLLCWLAVLAAAPALSRDVLATVNRVEITEG
FT                   HFEMFLRGLPRDYIRAELRPALLAHLIDQQVLAERMAPRFDPDGYYIRLRQAKVAEAYL
FT                   GARFDAISVSEDDLVDMYLKTYGRLAWFDLTVATLPKRDAAQAFAQRVALGKSFAEAAR
FT                   EAGAEASLFEADWLRRKELDPAILRAAAVLHSGGVSDPVRSRSGWHVVRADMIWHAPPF
FT                   FGVRDELTKLARFEQVLEALRTQSDAPQDLIYLLENETRRFLAEAALAGGVGHGPFVWR
FT                   SSKRYLEEHGDRVEYLVRLSAFPTRDAALDAVDYVRNRHRATEGFEPQPDWRPVDDQTA
FT                   WVRPSTLPASLMPPVLGTSFGLWQGPYEVTGRYYLIMVNDVRGGPSYTYDERRLYSEDP
FT                   QMRSPDMSDIWPDLRENVDVIPRSELARVADSAKRLPFRTLLEAYNLPGD"
FT   gene            264787..268923
FT                   /gene="rpoB"
FT                   /locus_tag="Dshi_0268"
FT   CDS_pept        264787..268923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="Dshi_0268"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3 KEGG: sil:SPO3508
FT                   DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92017"
FT                   /db_xref="GOA:A8LM40"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM40"
FT                   /protein_id="ABV92017.1"
FT                   /translation="MAQTVLGQKRFRKYYGKIREVLEMPNLIEVQKSSYDLFLKSGDQP
FT                   QPMDGEGIMGVFQSVFPIKDFNETAVLEFVKYELEKPKYDVEECQQRDMTYSAPLKVTL
FT                   RLIVFDVDEDTGAKSVKDIKEQDVFMGDMPLMTPNGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFACRIIPYRGSWLDFEFDAKDLVFARIDRRRKLPVTTLLYSLGMD
FT                   QQDIMDAYYDTVTYTHRKGEGWVTKFFPERIRGTRPTQDVVDAATGEVIAEAGKKVTPR
FT                   AVKQLIDEGNVSEILVPFDGIIGKFAAKDIINEENGAIYVEAGDELTWEVDKDGAVTGG
FT                   TLKELLDAGIEEIPVLDIDNITVGAYMRNTLAADKNMNRDTALMDIYRVMRPGEPPTVE
FT                   AASALFDTLFFDSERYDLSAVGRVKMNMRLALDAEDTVRTLRKEDIVSCIKALVDLRDG
FT                   RGDIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTVMPQDLINAKP
FT                   AAAAVREFFGSSQLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYG
FT                   RMCPIETPEGPNIGLINSLATFARVNKYGFIETPYRRVEDGKVTDEVNYMSATEEMRHT
FT                   VAQANANLDESGSFVNEMVNTRQSGEYTLAPRESVDLIDVSPKQLVSVAASLIPFLEND
FT                   DANRALMGSNMQRQAVPLLQADAPFVGTGIEGVVARDSGAAIMARRGGFIDQVDATRIV
FT                   IRATEDLEPGDPGVDIYRLRKFQRSNQNTCINQRPLVKVGDKVGKDDVIADGPSTDLGE
FT                   LALGKNVVVAFMPWNGYNYEDSILISERVARDDVFTSIHIEEFEVAARDTKLGPEEITR
FT                   DIPNVGEEALRNLDEAGIVYIGADVGPGDILVGKITPKGESPMTPEEKLLRAIFGEKAS
FT                   DVRDTSMRLPPGDFGTVVEVRVFNRHGVEKDERALQIEREEVESLARDRDDEMAILERN
FT                   IYARLKDMILGKTAVKGPKGVKPGSEITEDLLGTLSRGQWWQLALEDEAEAQMVEALNQ
FT                   QYEAQKRALTARFEDKVEKVRRGDDLPPGVMKMVKVFIAVKRKLQPGDKMAGRHGNKGV
FT                   ISKVVPMEDMPFLADGTPVDFVLNPLGVPSRMNVGQILETHMGWAARGMGLKIDEALGE
FT                   YRRSGDMTPVREAMRLAYGDEAYEEAISGLDQDDLLERAGNVTRGVPIATPVFDGAKEA
FT                   DVNDALTRAGFDTSGQSDLYDGRTGEKFARQVTVGVKYLLKLHHLVDDKIHARSTGPYS
FT                   LVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYESIVKG
FT                   EDNFEAGVPESFNVLVKEVRGLGLNMELLDAEGEE"
FT   gene            269021..273268
FT                   /gene="rpoC"
FT                   /locus_tag="Dshi_0269"
FT   CDS_pept        269021..273268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="Dshi_0269"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsq:Rsph17025_2541 DNA-directed RNA
FT                   polymerase, beta subunit TIGRFAM: DNA-directed RNA
FT                   polymerase, beta subunit PFAM: RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 1; RNA polymerase Rpb1 domain 5; RNA polymerase Rpb1
FT                   domain 4 SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92018"
FT                   /db_xref="GOA:A8LM41"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM41"
FT                   /protein_id="ABV92018.1"
FT                   /translation="MNQELTTNPFNPVAPVKTFDEIKVSLASPERILSWSFGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVICEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGTMLDMTLRDLERILYFENYVVIEPGLTDLTYGQLMT
FT                   EEEFLDAQDAYGMDAFTANIGAEAIREMLAAIDLETEAEQLRADLAEATGELKPKKIIK
FT                   RLKLVENFLESGNRPEWMVLTVVPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIIRNEKRMLQESVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMILGLYYIT
FT                   LEREGLPGQGMIFGSPEEVEHALTAGTVHLHSKIQARVKQIDDEGNEIYKRYETTPGRV
FT                   RLGALLPLNAKAPFELVNRLLRKKEVQQVIDTVYRYCGQKESVIFCDQIMTLGFREAFK
FT                   AGISFGKDDMLIPDTKWDIVEGVRDQVKEFEQQYMDGLITQGEKYNKVVDAWSKCSDEV
FT                   ASEMMDEISRDRFDPDTKEQMEPNSVYMMAHSGARGSPAQMKQLGGMRGLMAKPSGEII
FT                   ETPIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVRLNDC
FT                   GTENAITAEAAVNDGEVVASLGERVLGRVAAEDVVDPASGEVIVAKGELIDERKADLIE
FT                   QSSIQSMRMRSPLTCEADEGVCAQCYGRDLARGTKVNVGEAVGIIAAQSIGEPGTQLTM
FT                   RTFHIGGIAQGGQQSFQEAGQEGKIAFRNANLLENTSGEKIVMGRNMQLLIVDGEGAER
FT                   ASFKLGYGTKVHVAEGDKVGRGDKLFEWDPYTLPIIAEKSGVVRFADLVSGISVREETD
FT                   DATGMTQKIVSDWRAAPKGSDLKPEVLIADPETGEPVRNDAGNPVTYPMSVDAILSIED
FT                   GMPISAGDVVARIPREGAKTKDITGGLPRVAELFEARRPKDHAIIAEIDGYVRFGRDYK
FT                   NKRRISIEPSDETMEPVEYMVPKGKHIPVAEGDFVQKGDYIMDGNPAPHDILRIMGIEA
FT                   LADYLINEVQDVYRLQGVKINDKHIEVIVRQMLQKWEILDSGETTLLKGEHVDKLQFEA
FT                   VNEKAIAEGRRPAQGEPILLGITKASLQTRSFISAASFQETTKVLTEASTMGKRDKLIG
FT                   LKENVIVGRLIPAGTGGATQQMRRIAQERDQKVIEQRQAEAEEAAALAAPMAEDVFEDG
FT                   GDMADISMPESRD"
FT   gene            273419..274324
FT                   /locus_tag="Dshi_0270"
FT   CDS_pept        273419..274324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0270"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6 transmembrane
FT                   KEGG: sil:SPO3504 hypothetical protein; best Ref ZP hit to
FT                   membrane protein, putative and bad swissprot to
FT                   S-adenosylmethionine uptake transporter from Rickettsia
FT                   typhi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92019"
FT                   /db_xref="GOA:A8LM42"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM42"
FT                   /protein_id="ABV92019.1"
FT                   /translation="MPLTAVPDRAAGNLRGAAYMLVVTASFTTGDALIRLATEEMPLFQ
FT                   VIFLRSWIAVAFLGLLVWRAGAHRMRVGPRDRRLIGLRSAAEVCAMVPFFIALANMPFA
FT                   NVSALLQALPLSLTLAGAVFLGEPVGWRRLAAIVVGFCGVLLIVQPGGSGFTAYALLVL
FT                   LTVVFVTFRDLSTRRISPEIPAVLLGLVMAVFVLVSSGVLSLLTPWQPVTVRGALLLFG
FT                   AGVFIASGYIFAALAMRHGEIGFVTPFRYMALVWAVLLGFFVFGEWPDALTWAGALLVV
FT                   ATGLYTLYREQVVRRAARRA"
FT   gene            274606..274977
FT                   /gene="rpsL"
FT                   /locus_tag="Dshi_0271"
FT   CDS_pept        274606..274977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Dshi_0271"
FT                   /product="30S ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12 PFAM: ribosomal
FT                   protein S12/S23 KEGG: sil:SPO3501 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92020"
FT                   /db_xref="GOA:A8LM43"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM43"
FT                   /protein_id="ABV92020.1"
FT                   /translation="MPTIQQLIRKPRQPKVKRSKSQHLESCPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKDRKQRRSKYGAKRPK"
FT   gene            274990..275460
FT                   /gene="rpsG"
FT                   /locus_tag="Dshi_0272"
FT   CDS_pept        274990..275460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="Dshi_0272"
FT                   /product="30S ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7 KEGG: sit:TM1040_0240
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92021"
FT                   /db_xref="GOA:A8LM44"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM44"
FT                   /protein_id="ABV92021.1"
FT                   /translation="MSRRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSAAEKIVYN
FT                   AFDRVESKLKRSPLEVFHECLDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWL
FT                   INASRARNENTMEERLAGELVDAVNSRGSAVKKREDTHKMAEANKAFSHYRW"
FT   gene            275486..277603
FT                   /gene="fusA"
FT                   /locus_tag="Dshi_0273"
FT   CDS_pept        275486..277603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="Dshi_0273"
FT                   /product="translation elongation factor G"
FT                   /EC_number="3.6.5.3"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV
FT                   KEGG: rde:RD1_4013 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92022"
FT                   /db_xref="GOA:A8LM45"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM45"
FT                   /protein_id="ABV92022.1"
FT                   /translation="MARDYPLDRYRNFGIMAHIDAGKTTCSERILYYTGKSHNIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTEDGETADTPKHRLNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCVLDANAGVEPQTETVWRQADRYKVPRIVFVNKMDKIGADFFNCVHMIE
FT                   DRTGARAVPVAIPIGSENELEGLVDLVTMQEWVYKGDDLGASWVKGEIRDSLKDVCEEW
FT                   RGKMIEAAVEEDDDAMMEYLEGNEPDVPTLRALLRKGTLALHFVPVLGGSAFKNKGVQP
FT                   LLNAVIDYLPSPLDVVDYMGFAPGDENEERNIPRRADDDMPFSGLAFKIMNDPFVGSLT
FT                   FTRIYSGTMNKGDTVLNSTKGKKERIGRMMMMHSNNREEIEEAFAGDIIALAGLKDTTT
FT                   GDTLCDVKEPVVLETMTFPDPVIEIAVEPKTKNDQEKMSQGLARLAAEDPSFRVETDIE
FT                   SGQTIMKGMGELHLDILVDRLKREFKVEANIGAPQVAYRETIGHEVEHTYTHKKQSGGS
FT                   GQFAEVKLVISPTEPGEGYSFESKIVGGAVPKEYIPGVEKGIKSVMDSGPLAGFPVIDF
FT                   KVALVDGKFHDVDSSVLAFEIAARMGMREGMKKAGAKLLEPVMKVEVVTPEEYTGGIIG
FT                   DLTSRRGQVTGQEPRGNAVAINAFVPLANMFGYINTLRSMSSGRAQFTMQFDHYDPVPA
FT                   NISQEIQEKFA"
FT   gene            277686..278861
FT                   /gene="tufA1"
FT                   /locus_tag="Dshi_0274"
FT   CDS_pept        277686..278861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA1"
FT                   /locus_tag="Dshi_0274"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein KEGG: sit:TM1040_2434
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92023"
FT                   /db_xref="GOA:A8LLG2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LLG2"
FT                   /protein_id="ABV92023.1"
FT                   /translation="MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKQFGDFKAYDEI
FT                   DGAPEEKARGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVFMNKVDQVDDEELLELVEMEIRELLSSYEYPGDDI
FT                   PIIAGSALAALEGRDPEIGEQKIAELMKAVDDYIPTPARAVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVINVGDEIEIVGIRDTKKTTCTGVEMFRKLLDRGEAGDNIGALLRGVDR
FT                   EGVERGQVLCKPGSVTPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVT
FT                   LPEGTEMVMPGDNLKFGVELIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE"
FT   gene            278960..279280
FT                   /gene="rpsJ"
FT                   /locus_tag="Dshi_0275"
FT   CDS_pept        278960..279280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="Dshi_0275"
FT                   /product="30S ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10 KEGG: sit:TM1040_0245
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92024"
FT                   /db_xref="GOA:A8LM47"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM47"
FT                   /protein_id="ABV92024.1"
FT                   /translation="MTMAIQSQNIRIRLKAFDYRVLDASTQEIVNTAKRTGAQVRGPIP
FT                   LPNKIEKFTVLRGPHVDKKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQI
FT                   SV"
FT   gene            279295..280134
FT                   /gene="rplC"
FT                   /locus_tag="Dshi_0276"
FT   CDS_pept        279295..280134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="Dshi_0276"
FT                   /product="50S ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3 KEGG: rde:RD1_1399
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92025"
FT                   /db_xref="GOA:A8LM48"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM48"
FT                   /protein_id="ABV92025.1"
FT                   /translation="MRSGVIAKKVGMTRLFMEDGKQVPVTVLQLDKLQVVAQRTAEKDG
FT                   YSAVQLGAGTAKAKRTTKAMRGHFAAASVEPKRKVAEFRVAPENLINVGEEITADHYFE
FT                   GQYVDVSGTSIGKGFAGAMKRHNFGGLRASHGVSISHRSHGSTGQCQDPGKVFKGKKMA
FT                   GHMGAARVTTQNLQVVRTDADRGLIMIKGAVPGSKGGWVTIKDAVKKPVPENVILPAAL
FT                   KSAAEEAKRLAEEAAAAAEAEAKAAEEAAAAEAAAAEEAALKQAEAQIEAEKKEGDE"
FT   gene            280131..280748
FT                   /gene="rplD"
FT                   /locus_tag="Dshi_0277"
FT   CDS_pept        280131..280748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="Dshi_0277"
FT                   /product="50S ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e KEGG: sit:TM1040_0247
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92026"
FT                   /db_xref="GOA:A8LM49"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM49"
FT                   /protein_id="ABV92026.1"
FT                   /translation="MKLDVIKLDGEAAGSVELDEALFGLEPRADILHRVVRWQRNKAQA
FT                   GTHKVKTRSEVSYSTKKIYRQKGTGGARHGARSAPIFRKGGIYKGPTPRSHAHDLPKKF
FT                   RKLGLKHALSAKAKAGELVVIDMATSEGKTATLAKQIKNLGWKRALVIDGAQVDAGFAK
FT                   AAANIDTLDVLPSMGANVYDILKRDTLVLTKAGVEALEARLK"
FT   gene            280745..281041
FT                   /gene="rplW"
FT                   /locus_tag="Dshi_0278"
FT   CDS_pept        280745..281041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="Dshi_0278"
FT                   /product="50S Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23 KEGG:
FT                   sit:TM1040_0248 ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92027"
FT                   /db_xref="GOA:A8LM50"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM50"
FT                   /protein_id="ABV92027.1"
FT                   /translation="MTAKAQHYDVIRKPIITEKATLASENGAVVFEVAIDSNKPQIKEA
FT                   VEALFGVKVKAVNTTITKGKTKRFRGTPGKRKDVKKAYVTLEEGNTIDVSTGL"
FT   gene            complement(281137..281487)
FT                   /locus_tag="Dshi_0279"
FT   CDS_pept        complement(281137..281487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0279"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92028"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM51"
FT                   /protein_id="ABV92028.1"
FT                   /translation="MRFVMGLAALALAGCTAQDLGLAPPEDGPITRALAGKTLTLDGAP
FT                   EFQVTFAKDGTISGFAEGRWSVTDGAYCRTLTGPPGMAGTECPVTELSGETVTFTSSTG
FT                   RSTWRISPAPDA"
FT   gene            complement(281779..282159)
FT                   /locus_tag="Dshi_0280"
FT   CDS_pept        complement(281779..282159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_1404 hypothetical protein, no
FT                   significant swissprot hit, unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92029"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM52"
FT                   /protein_id="ABV92029.1"
FT                   /translation="MRIPSLTALTLACLAMGTGLAAAACDGSTGRGWASGKGTGSYEMT
FT                   GSGPCLIPFVGFFSNGGQDFTEATEVSLRKAPKSGTVGLTRRGITYTPNAGFKGRDEFC
FT                   TINRSSAVPGETLGGCYTITVR"
FT   gene            complement(282323..282814)
FT                   /locus_tag="Dshi_0281"
FT   CDS_pept        complement(282323..282814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0281"
FT                   /product="YHS domain protein"
FT                   /note="KEGG: rde:RD1_3741 YHS domain protein, no swissprot;
FT                   is located in the midst of a unsure GC frame plot region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92030"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM53"
FT                   /protein_id="ABV92030.1"
FT                   /translation="MPKTLSLKSLRTGFVVATLATTLSLGTAFAADEVFITDADMNIAI
FT                   NGYDPVAYHTAGAPTKGVAEFKAEYDGAVYKFSSAENKAAFEADPAAFAPAFGGWCTVG
FT                   ASKGKKIATQPEFFDIVDGQLYLNSSEGAHDLYLRQTTQTIDTATTNWPEIVSTPASEL
FT                   "
FT   gene            283471..283737
FT                   /locus_tag="Dshi_0282"
FT   CDS_pept        283471..283737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0282"
FT                   /product="hypothetical protein"
FT                   /note="no swissprot, bad Ref hits, no conserved domains,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92031"
FT                   /db_xref="GOA:A8LM54"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM54"
FT                   /protein_id="ABV92031.1"
FT                   /translation="MAISLAETLDELDAGLKEFLKRDDACIGQVAQKRRVMHNRRVVAG
FT                   TRVPVSAIRAFREAGFTVTEILDEYPTLTQDDVEAALADDEAA"
FT   gene            283818..284120
FT                   /locus_tag="Dshi_0283"
FT   CDS_pept        283818..284120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0283"
FT                   /product="hypothetical protein"
FT                   /note="no swissprot, bad Ref hits, no conserved domains,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92032"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM55"
FT                   /protein_id="ABV92032.1"
FT                   /translation="MQDVMARGSPDTLVAEIAQRNEAILVAVDKDMRQIAKQNGVGKLR
FT                   FRSLHLLQFRCSEPQAVHRVREAIELIESEWEIACSRVARRFWVEIGGNYIRTHR"
FT   gene            284463..285113
FT                   /locus_tag="Dshi_0284"
FT   CDS_pept        284463..285113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0284"
FT                   /product="putative outer membrane protein"
FT                   /note="KEGG: rsq:Rsph17025_2139 hypothetical protein; bad
FT                   swissprot to 31 kDa outer-membrane immunogenic protein
FT                   precursor from Brucella melitensis; middle Ref ZP hit to
FT                   possible outer membrane protein from Roseovarius sp. 217;
FT                   Autotransporter beta-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92033"
FT                   /db_xref="GOA:A8LM56"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM56"
FT                   /protein_id="ABV92033.1"
FT                   /translation="MTSSYFHTKGKEMFRTATAFGLVLAASTGSLYAGNPEPAPVAPVM
FT                   VAPVPAPAPFWAGGYIGAQLGYAYGDFDIDAAIDGDDNDDGFIGGLTAGYLFDVGSGWY
FT                   VGPEVQYDWADLEITEDGGDTASFDEIARLKLIVGREIGNGLLYGTAGIAYGSLDSAGD
FT                   VFDGIDGSDTNWLLGLGYDYRVGDNWTVGGEYMYHSFDDVDLNTLHIKAAYRF"
FT   gene            285409..286251
FT                   /gene="rplB"
FT                   /locus_tag="Dshi_0285"
FT   CDS_pept        285409..286251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="Dshi_0285"
FT                   /product="50S ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2 KEGG: rde:RD1_1405
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92034"
FT                   /db_xref="GOA:A8LM57"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM57"
FT                   /protein_id="ABV92034.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLSKKGGRNN
FT                   TGRITMRRRGGGAKRLYRIVDFKRRKFDVEGVITRIEYDPNRTAFIALVTYTDGEQAYI
FT                   LAPQRTAVGDKVVASQKADIKPGNAMPFSGMPIGTIVHNIELKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNLGKAGRNRHKGIRPSVRG
FT                   VVMNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRNKNKASSKLIIRSRHAKKKGR"
FT   gene            286255..286533
FT                   /gene="rpsS"
FT                   /locus_tag="Dshi_0286"
FT   CDS_pept        286255..286533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="Dshi_0286"
FT                   /product="30S ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19 PFAM: ribosomal
FT                   protein S19/S15 KEGG: jan:Jann_0589 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92035"
FT                   /db_xref="GOA:A8LM58"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM58"
FT                   /protein_id="ABV92035.1"
FT                   /translation="MTRSVWKGPFVDAYVLKKAEKTRESGRNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGRKHIPVNVTEDMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            286537..286917
FT                   /gene="rplV"
FT                   /locus_tag="Dshi_0287"
FT   CDS_pept        286537..286917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="Dshi_0287"
FT                   /product="50S ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22 PFAM: ribosomal
FT                   protein L22/L17 KEGG: sit:TM1040_0254 ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92036"
FT                   /db_xref="GOA:A8LM59"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM59"
FT                   /protein_id="ABV92036.1"
FT                   /translation="MGKDKNPRRVAENEAMAKTRMLRTSPQKLNLVAQMIRGKKVDKAL
FT                   ADLTFSHKRIAVDVKKCLQSAIANAENNHGLDVDELIVAEAWVGKNLTMKRGRPRARGR
FT                   FGKIIKPFAEITIKVRQVEEQA"
FT   gene            286917..287639
FT                   /gene="rpsC"
FT                   /locus_tag="Dshi_0288"
FT   CDS_pept        286917..287639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="Dshi_0288"
FT                   /product="ribosomal protein S3 RpsC"
FT                   /note="KEGG: sit:TM1040_0255 ribosomal protein S3 TIGRFAM:
FT                   ribosomal protein S3 PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92037"
FT                   /db_xref="GOA:A8LM60"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM60"
FT                   /protein_id="ABV92037.1"
FT                   /translation="MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLKIREFIKE
FT                   ECKQAGISRVIIERPHKKCRVTIHTARPGVIIGKKGADIEGLRRKIAAMTDSELHLNIV
FT                   EVRKPELDAALVGESIAQQLERRVSFRRAMKRAVQNAVRMGAQGIRVNLAGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDFANVEATTAYGIIGIKVWIFKGEIMEHDPQARDRRHAEL
FT                   QEGGGPRPQGGGRPRRDR"
FT   gene            287653..288066
FT                   /gene="rplP"
FT                   /locus_tag="Dshi_0289"
FT   CDS_pept        287653..288066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="Dshi_0289"
FT                   /product="50S ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16 KEGG: jan:Jann_0592
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92038"
FT                   /db_xref="GOA:A8LM61"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM61"
FT                   /protein_id="ABV92038.1"
FT                   /translation="MLQPKRTKFRKQFKGRIRGEAKGGSDLNFGTYGLKALQPERITAR
FT                   QIEAARRAMTRHMKRQGRVWIRIFPDLPVTSKPVEVRMGKGKGSVDFWACKVKPGRIMF
FT                   EIDGVSEPVAREALRLAAMKLPIKTRTVVREDW"
FT   gene            288217..288447
FT                   /locus_tag="Dshi_0290"
FT   CDS_pept        288217..288447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_3827 hypothetical protein; short
FT                   signalpeptide and three transmembrane region; no swissprot,
FT                   bad Ref hits to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92039"
FT                   /db_xref="GOA:A8LM62"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM62"
FT                   /protein_id="ABV92039.1"
FT                   /translation="MTADTLKPVDIVKWIATIIQLIGYGLTGLNLVPWNIWFFFAGIFL
FT                   WFAVGVMWKDRAIMVVHVGAFISLLAGYLNA"
FT   gene            complement(289020..289409)
FT                   /locus_tag="Dshi_0291"
FT   CDS_pept        complement(289020..289409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_0735 hypothetical protein; bad Ref
FT                   hits to hypothetical proteins; short signalpeptide and four
FT                   transmembrane regions; no significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92040"
FT                   /db_xref="GOA:A8LM63"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM63"
FT                   /protein_id="ABV92040.1"
FT                   /translation="MTDLVLLMSATLLGGMVFYSFGFAPVLFAQLPMERVRPLLRGTFP
FT                   YYYLAVIGLSAVTAVAAWFVSPLAAGLFAAIALSTVYARQILMAQINAATDRGDKKAFG
FT                   MLHGLSVVIQLIQIGLAGWAVVLVG"
FT   gene            complement(289461..290186)
FT                   /locus_tag="Dshi_0292"
FT   CDS_pept        complement(289461..290186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0491 hypothetical protein; no
FT                   swissprot; TIGR02466 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92041"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM64"
FT                   /protein_id="ABV92041.1"
FT                   /translation="MRGPYRPPRDPWQARISLFSKGCVGLPTQTRKGRPMPAITSLFVT
FT                   RLYRAQLAEFGPALDPGELEKSCLVIAEDDDAGQDWCEQNGYPGYTSYASLTDLPWRFP
FT                   IFADLVKALDAHVAAFAEDLAFDLDGRALKLEDIWINILPQGGMHASHIHPHSVISGTT
FT                   YVAMPEGTSALKLEDPRSARMMAAPARLKDAPEDLQTFVYAKPAVGDVLLWESWLRHEV
FT                   PMNMAEEERISVSFNYAWA"
FT   gene            290274..290480
FT                   /gene="rpmC"
FT                   /locus_tag="Dshi_0293"
FT   CDS_pept        290274..290480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="Dshi_0293"
FT                   /product="50S ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29 KEGG: jan:Jann_0599
FT                   ribosomal protein L29, low BLAST hits"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92042"
FT                   /db_xref="GOA:A8LM65"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM65"
FT                   /protein_id="ABV92042.1"
FT                   /translation="MNAQELRDKTPDELRDQLAALKKEAFNLRFQQATGQLENTARMRS
FT                   VRRDVARVATILTEKAAAAAATE"
FT   gene            290493..290723
FT                   /gene="rpsQ"
FT                   /locus_tag="Dshi_0294"
FT   CDS_pept        290493..290723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="Dshi_0294"
FT                   /product="30S ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17 KEGG: sit:TM1040_0263
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92043"
FT                   /db_xref="GOA:A8LM66"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM66"
FT                   /protein_id="ABV92043.1"
FT                   /translation="MPKRILNGVVTSDANAQTVTVSVERRFTHPVLKKTIRKSKKYRAH
FT                   DAENAFKVGDKVRIQECAPMSKTKRWEVIAN"
FT   gene            290797..291165
FT                   /gene="rplN"
FT                   /locus_tag="Dshi_0295"
FT   CDS_pept        290797..291165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="Dshi_0295"
FT                   /product="50S ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14 PFAM: ribosomal
FT                   protein L14b/L23e KEGG: rde:RD1_1420 ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92044"
FT                   /db_xref="GOA:A8LM67"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM67"
FT                   /protein_id="ABV92044.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTAIRFDRNAAVILNNNNEPIGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            291165..291470
FT                   /gene="rplX"
FT                   /locus_tag="Dshi_0296"
FT   CDS_pept        291165..291470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="Dshi_0296"
FT                   /product="50S ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24 PFAM: KOW domain
FT                   protein KEGG: sit:TM1040_0265 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92045"
FT                   /db_xref="GOA:A8LM68"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM68"
FT                   /protein_id="ABV92045.1"
FT                   /translation="MAAKLKKGDKVVVLAGKDKGKEGEITSVSPKTGKAVVDGLNIAIR
FT                   HTRQSQNSQGGRIPQAMPIDLSNLALVDSNGKPTRVGFRMEDGKKVRFAKTTGEVV"
FT   gene            291470..292033
FT                   /gene="rplE"
FT                   /locus_tag="Dshi_0297"
FT   CDS_pept        291470..292033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="Dshi_0297"
FT                   /product="50S ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5 KEGG: sil:SPO0497
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92046"
FT                   /db_xref="GOA:A8LM69"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM69"
FT                   /protein_id="ABV92046.1"
FT                   /translation="MLDAATYTPRLKAAYAETIRAAMKEEFGYKNDMMIPRLDKIVLNI
FT                   GAGAEAVKDSKKAKSAQDDLSAIAGQRAVITKAKKSIAGFRVREDMPLGAKVTLRGDRM
FT                   YEFLDRLITIAMPRIRDFRGVKGSAFDGRGNYALGLKEHIVFPEINFDKVDEVWGMDII
FT                   ICTTAASDAEAKALLKHFNMPFNS"
FT   gene            292052..292357
FT                   /gene="rpsN"
FT                   /locus_tag="Dshi_0298"
FT   CDS_pept        292052..292357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="Dshi_0298"
FT                   /product="30S ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14 KEGG: sit:TM1040_0267
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92047"
FT                   /db_xref="GOA:A8LM70"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM70"
FT                   /protein_id="ABV92047.1"
FT                   /translation="MAKKAMIEREKKRQKLVAKYAAKRAALKEIANDDSKPMEERFKAR
FT                   LKLAELPRNSSATRLHNRCQLTGRPHAYYRKLKISRIALRDLGSAGQIPGLVKSSW"
FT   gene            292371..292763
FT                   /gene="rpsH"
FT                   /locus_tag="Dshi_0299"
FT   CDS_pept        292371..292763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="Dshi_0299"
FT                   /product="30S ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8 KEGG: sit:TM1040_0268
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92048"
FT                   /db_xref="GOA:A8LM71"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM71"
FT                   /protein_id="ABV92048.1"
FT                   /translation="MMNDPLGDMLTRIRNAQMRGKSTVRTPASKLRAWVLDVLTDEGYI
FT                   RGYEKVADSKHPELEISLKYYEGVPVIRELKRVSKPGRRVYMGSKDIPSVRQGLGVSIV
FT                   STPRGVMSDANARTANVGGEVLCTVF"
FT   gene            292776..293309
FT                   /gene="rplF"
FT                   /locus_tag="Dshi_0300"
FT   CDS_pept        292776..293309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="Dshi_0300"
FT                   /product="50S ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6 KEGG: rde:RD1_1425
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92049"
FT                   /db_xref="GOA:A8LM72"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM72"
FT                   /protein_id="ABV92049.1"
FT                   /translation="MSRIGKKPVELPTGVTASVSGQTIEVKGPKATRSFTATDDVTLKV
FT                   EDNVITIEPRGKSKRARQQWGMSRTMVGNLVTGVTNGFKKELEIQGVGYRAQMQGNTLK
FT                   LNLGLSHEVNYEVPAGVTVTCPKVTEIVIEGTDEQLVGQVAANIRDWRKPEPYKGKGIR
FT                   YKGEFIFRKEGKKK"
FT   gene            293321..293680
FT                   /gene="rplR"
FT                   /locus_tag="Dshi_0301"
FT   CDS_pept        293321..293680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="Dshi_0301"
FT                   /product="50S ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18 PFAM: ribosomal
FT                   protein L18P/L5E KEGG: pde:Pden_0775 ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92050"
FT                   /db_xref="GOA:A8LM73"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM73"
FT                   /protein_id="ABV92050.1"
FT                   /translation="MANSKRDLFLKRRLRVRNKLKKMADGRPRLSVHRSGKNISVQLID
FT                   DVQGRTLAAASSLEKDLGIVGKNNVEASAKVGAAIAERAKKAGIEECYFDRGGFLFHGK
FT                   VKALADAAREGGLKF"
FT   gene            293839..294414
FT                   /gene="rpsE"
FT                   /locus_tag="Dshi_0302"
FT   CDS_pept        293839..294414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="Dshi_0302"
FT                   /product="30S ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5 PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5 KEGG:
FT                   sit:TM1040_0271 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92051"
FT                   /db_xref="GOA:A8LM74"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM74"
FT                   /protein_id="ABV92051.1"
FT                   /translation="MAERDNRRGRRDDRDETPEFADRLVAINRVSKTVKGGKRFGFAAL
FT                   VVVGDQRGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVPLREGRTLHHDIEGRHGAGKV
FT                   MMRTAPQGTGIIAGGPMRAVFEMLGVQDVVAKSIGSQNPYNMIRATLDGLRKETSPRMV
FT                   AQRRGKKVSDILKKDGEPAEAAAEPAEA"
FT   gene            294427..294615
FT                   /gene="rpmD"
FT                   /locus_tag="Dshi_0303"
FT   CDS_pept        294427..294615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="Dshi_0303"
FT                   /product="50S ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30 KEGG: rde:RD1_1429
FT                   ribosomal protein L30; middle swissprot hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92052"
FT                   /db_xref="GOA:A8LM75"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM75"
FT                   /protein_id="ABV92052.1"
FT                   /translation="MAKTIVIKQIGSPIRRPEKQRQTLIGLGLNKMHKTRELEDTPAVR
FT                   GMINKIPHMVQIIEEKG"
FT   gene            294758..295231
FT                   /gene="rplO"
FT                   /locus_tag="Dshi_0304"
FT   CDS_pept        294758..295231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="Dshi_0304"
FT                   /product="50S ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15 KEGG: sil:SPO0505
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92053"
FT                   /db_xref="GOA:A8LM76"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM76"
FT                   /protein_id="ABV92053.1"
FT                   /translation="MKLNELRDNPGATKPRKRVGRGPGSGMGKTGGRGIKGQKSRSGVA
FT                   IKGFEGGQMPLYQRLPKRGFNMRNRKKFAVVNLGLIQKFIEAGKLDAGQPITEDALLAS
FT                   GLIRRKLDGVRVLAKGEITTKIDLTVTGASKSAIDAVEKAGGSVAVTSAQAAA"
FT   gene            295343..296704
FT                   /locus_tag="Dshi_0305"
FT   CDS_pept        295343..296704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0305"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92054"
FT                   /db_xref="GOA:A8LM77"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM77"
FT                   /protein_id="ABV92054.1"
FT                   /translation="MASAAEQMAANMSWSALGKATELRQRIFFTLGLLIVYRLGTYIPV
FT                   PGIDGAQLREFMDQAAAGLGGVLNMFTGGAISRMGIFALGIMPYISASIIVQLLTAMVP
FT                   KLEQLKKEGEQGRKKINQYTRYGTVFLATFQAYGLAISLESGGLVTDPGWFFRAACVIT
FT                   LVGGTMFLMWLGEQITQRGIGNGISLIIFVGIIAELPAALAQFFESGRSGALSTPVILG
FT                   VILMLLATLVFVVFMERALRKIHIQYPRRQVGMKMYDGGSSHLPVKINPAGVIPAIFAS
FT                   SLLLLPTTISTFSGGNSGPIMSTILAYFGPGQPLYLLFFAGMIIFFTYFYTANVSFKTE
FT                   DVADNLKNQNGFIPGIRPGKKTEEYLDYVVSRILVVGSGYLALVCLIPEMVRTELAITA
FT                   YFGGTSILIIVSVGMDTVQQIQSHLLAHQYEGLIEKSQLRGKKRGKGKRSPARR"
FT   gene            296701..297342
FT                   /gene="adk2"
FT                   /locus_tag="Dshi_0306"
FT   CDS_pept        296701..297342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk2"
FT                   /locus_tag="Dshi_0306"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein KEGG: rde:RD1_1433 adenylate kinase; high
FT                   swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92055"
FT                   /db_xref="GOA:A8LM78"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM78"
FT                   /protein_id="ABV92055.1"
FT                   /translation="MNIILLGPPGAGKGTQARKLVEERGMTQLSTGDMLREARTSGTEM
FT                   GQRVAEVMDRGELVTDEIVIGLIEEKLAGEAGGGFIFDGFPRTLAQADALGALLDKLGQ
FT                   SLDAVIEMRVDDAALVARIAGRATCGGCGEVYNDTLRPIPADGKCGNCGASDFKRRADD
FT                   NEESLKQRLMEYYKKTSPLIGYYHAKGTLRPVDGMGAMDAVASEIAAALD"
FT   gene            297504..297947
FT                   /gene="rpsM"
FT                   /locus_tag="Dshi_0307"
FT   CDS_pept        297504..297947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Dshi_0307"
FT                   /product="30S ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13 KEGG: sil:SPO0509
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92056"
FT                   /db_xref="GOA:A8LM79"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM79"
FT                   /protein_id="ABV92056.1"
FT                   /translation="METPRDFGCEKRFWHDGTAPKRTYDLARIAGVNLPTGKRTPIALT
FT                   YITGIGLSSAQAICEAVGIEESRRLNELSDAEILAIREHIDANYTVEGDLRRETQMNIK
FT                   RLMDLGCYRGLRHRRNLPVRGQRTHTNARTRKGPAKAIAGKKK"
FT   gene            297963..298352
FT                   /gene="rpsK"
FT                   /locus_tag="Dshi_0308"
FT   CDS_pept        297963..298352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="Dshi_0308"
FT                   /product="30S ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11 KEGG: pde:Pden_0783
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92057"
FT                   /db_xref="GOA:A8LM80"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM80"
FT                   /protein_id="ABV92057.1"
FT                   /translation="MARDKQRTKKKERKNIAAGVAHVNSSFNNTKILISDVQGNAIAWS
FT                   SAGTMGFKGSRKSTPYAAQMAAEDAGKKAQEHGVKTLEVQVQGPGSGRESALRALAAVG
FT                   FNITAIRDVTPIAHNGCRPPKRRRV"
FT   gene            298455..299486
FT                   /gene="rpoA"
FT                   /locus_tag="Dshi_0309"
FT   CDS_pept        298455..299486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="Dshi_0309"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: sil:SPO0511 DNA-directed RNA polymerase, alpha
FT                   subunit TIGRFAM: DNA-directed RNA polymerase, alpha subunit
FT                   PFAM: RNA polymerase alpha subunit domain protein; RNA
FT                   polymerase dimerisation; RNA polymerase insert SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92058"
FT                   /db_xref="GOA:A8LM81"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM81"
FT                   /protein_id="ABV92058.1"
FT                   /translation="MEATPMIHKNWQELIKPTQLEVKPGNEPARQATVVAEPLERGFGL
FT                   TLGNALRRVLMSSLQGAAITSVQIDNVLHEFSSVAGVREDVTDIVLNLKQVAIRMEVEG
FT                   PKRVSISAKGPRVVTAGDISESAGIEVLNRDHVICHLDEGADLFMELIVNTGKGYVSAD
FT                   KNRPEDAPIGLIPIDAIFSPVKKVSYDVQPTREGQVLDYDKLTLKLETDGSVTPDDAVA
FT                   YAARILQDQLSVFVNFDEPEAARSQSEEDDLEFNPLLLKKVDELELSVRSANCLKNDNI
FT                   VYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDILDWPPENIEDLAKKFE
FT                   DQF"
FT   gene            299605..300021
FT                   /gene="rplQ"
FT                   /locus_tag="Dshi_0310"
FT   CDS_pept        299605..300021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="Dshi_0310"
FT                   /product="50S ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17 KEGG: rde:RD1_1438
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92059"
FT                   /db_xref="GOA:A8LM82"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM82"
FT                   /protein_id="ABV92059.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIVEKLITLAKRGDLHARRQAASQLKQHAYVAKLFDVLGPRYAERQGGYVRIMKAGFRY
FT                   GDMAPMAIIEFVDRDVDAKGAADKAREAADEDAL"
FT   gene            300364..300975
FT                   /gene="luxR1"
FT                   /locus_tag="Dshi_0311"
FT   CDS_pept        300364..300975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR1"
FT                   /locus_tag="Dshi_0311"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein KEGG: pde:Pden_0786 response regulator
FT                   receiver protein, Autoinducer binding domain pfam03472,
FT                   HTH-LuxR domain pfam00196; LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92060"
FT                   /db_xref="GOA:A8LM83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM83"
FT                   /protein_id="ABV92060.1"
FT                   /translation="MSIKLGIELDLHELGLLSPTGYYIGLHIRFAAPLLDYQTYPQEWK
FT                   DRYTEQAYALRDPLLAWGFGMTGATRWSEIGIPDPFGILDDAARFGLNYGVAVSCGEIS
FT                   SRTIAGAARSDREFTDDEISAIQTIVLRLHDTTTPPDSLTKAQIEALGHIAAGDRHTAA
FT                   AAKLGISESALKARLTAARQKLMARTTAEAIQRAKDYRLL"
FT   gene            301032..301619
FT                   /gene="luxI"
FT                   /locus_tag="Dshi_0312"
FT   CDS_pept        301032..301619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxI"
FT                   /locus_tag="Dshi_0312"
FT                   /product="N-acyl-L-homoserine lactone synthetase-like
FT                   protein"
FT                   /note="KEGG: pde:Pden_0787 N-acyl-L-homoserine lactone
FT                   synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92061"
FT                   /db_xref="GOA:A8LM84"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM84"
FT                   /protein_id="ABV92061.1"
FT                   /translation="MQTTTLSFENLHNHGELFANLFRARRQSFIVQNKWDLPEAMGMEY
FT                   DQYDTPASRWVAVHEFGEVYAGIRLTPTTARCGIYTYMIRDAQMGLLDTIPQDLLYGPA
FT                   PVDESVWESSRVFVSHTTPQKLRRRVHACLISEMTKAAREHGASRVLGLVPAVWTRFAD
FT                   RLGLDIEPAGRVMELDGIDNQCVSIDLTRKLH"
FT   gene            301799..303109
FT                   /locus_tag="Dshi_0313"
FT   CDS_pept        301799..303109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0313"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5 SMART: AAA ATPase KEGG:
FT                   sil:SPO0515 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92062"
FT                   /db_xref="GOA:A8LM85"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM85"
FT                   /protein_id="ABV92062.1"
FT                   /translation="MADLFDRDGAAPPDDGPRPLADRLRPAHLSEVIGQDHLLGPDGPL
FT                   GAMLANRALSSVIFWGPPGVGKTTIARLLAAETDLAFVQISAIFTGVPDLRKVFEAARL
FT                   RRQGGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTIVLVGATTENPSFELNAAVLSRAQV
FT                   LVLHRLDAAALEALLARAEALLGVSLPLEPGARAALIEMADGDGRALLNLIEQVASWTP
FT                   EAPLDAKALGQRLSQRAAQYDKSGDGHYNLISALHKSVRGSDPDAALYWLARMLTAGED
FT                   PRYLMRRITRMSVEDIGLADPQAQRLCLDAWQTYERLGSPEGELAIAQAVVYLALAPKS
FT                   NAAYVAYKAAMKQAKSSGSAPPPKHILNAPTALMKDQGYGADYAYDHEAEDGFSGQNYF
FT                   PDDMARPRYYAPVERGFERELAKRLAYFAKLRAKRQS"
FT   gene            303192..303521
FT                   /locus_tag="Dshi_0314"
FT   CDS_pept        303192..303521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0314"
FT                   /product="integral membrane protein"
FT                   /note="PFAM: Camphor resistance CrcB protein KEGG:
FT                   rde:RD1_1440 CrcB-like protein; COG0239 Integral membrane
FT                   protein possibly involved in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92063"
FT                   /db_xref="GOA:A8LM86"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM86"
FT                   /protein_id="ABV92063.1"
FT                   /translation="MRWLLGVGVLRLTGPTAFPVAVLGANVLGSFLMGVFVVMAAHRGL
FT                   THLSPLVMTGLLGGFTTFSAFSLETVTLIERGQLGLAAGYVLASVVLSVGGLWTGMHMA
FT                   RMVVA"
FT   gene            303518..304564
FT                   /gene="rluC"
FT                   /locus_tag="Dshi_0315"
FT   CDS_pept        303518..304564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="Dshi_0315"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /note="high Ref YP hit to Pseudouridine synthase, RluD from
FT                   Jannaschia sp. CCS1 and middle swissprot hit to Ribosomal
FT                   large subunit pseudouridine synthase C from Pasteurella
FT                   multocida; RNA binding and rluC domain (PF00849)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92064"
FT                   /db_xref="GOA:A8LM87"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM87"
FT                   /protein_id="ABV92064.1"
FT                   /translation="MSGVQTLTVGVDEGDQRLDRWLRRRFPHLGQGRIEKMCRKGELRV
FT                   DGGRVKPATRLQTGQAVRVPPLPAPGEITARPARARISDADREMLQGTVIYRDADILAL
FT                   NKPAGLPVQGGSGQERHIDGMAEALQFELDEPPRLVHRLDKDTSGVLLMARTRRSAAAL
FT                   TAAFRARQTRKIYWAAVAGVPQPQLGTVRYALMKAPGHGKRGEGEKMLCIDPRQMDAHP
FT                   DAKRATTDYAVLSALGRRVAWCVLVPITGRTHQLRAHMAELGHPIIGDGKYGGSGQENL
FT                   GDGWGAQLGGEMSKKLHLHARHLSLTHPVTGAQLSLTAPLPPHMARTWEALGWDARDVP
FT                   VDPFEALE"
FT   gene            304561..305241
FT                   /gene="gph"
FT                   /locus_tag="Dshi_0316"
FT   CDS_pept        304561..305241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="Dshi_0316"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   KEGG: rde:RD1_1442 hydrolase, putative; PGPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92065"
FT                   /db_xref="GOA:A8LM88"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM88"
FT                   /protein_id="ABV92065.1"
FT                   /translation="MTLRLVVFDVDGTLVDSQQQILAAMIQAFEGIGLVPPKPAAMRAI
FT                   IGLSLPVAMAQLAPEAGARDHDRLAEGYRQAFVAQRAAGGAEADAPLYPGALAALRALA
FT                   ARDDTLLGVATGKSRRGLEHLLDCHDLRPFFITSQVADDHPSKPHPSMLWQAMAETGVD
FT                   AAQAVMLGDTGFDMEMARAAGVTPLGVGWGYHAPARLRDHGAVEVLADFAELPTALETI
FT                   WRQG"
FT   gene            305238..305942
FT                   /locus_tag="Dshi_0317"
FT   CDS_pept        305238..305942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0317"
FT                   /product="ATP12 chaperone protein"
FT                   /note="PFAM: ATP12 ATPase KEGG: rsp:RSP_1746 hypothetical
FT                   protein; good Ref hits to ATP12 proteins, also middle
FT                   swissprot hit toATP synthase mitochondrial F1 complex
FT                   assembly factor 2, mitochondrial precursor (ATP12 homolog)
FT                   from Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92066"
FT                   /db_xref="GOA:A8LM89"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM89"
FT                   /protein_id="ABV92066.1"
FT                   /translation="MSGWAAKRFWKETDIVEAGTGFEVRLDGRSVRTPLKTLLVVPSRG
FT                   FAERIAAEWDAQDETVNPQSMPFTRAANAALDKVTPQHAEVAEMLSAYGGTDLLCYRAT
FT                   GPDTLCARQAESWDPLLDWAAERYGARLRVTAGVLPVDQDPDSLARLSQAVAAFTPFQL
FT                   TGFHDLVAISGSLVLGLAVAEGRMSAEAGFAASRIDEEWQISQWGEDEEEAERIAVKRA
FT                   DYLRAKEIFDLS"
FT   gene            306292..307308
FT                   /gene="bztA"
FT                   /locus_tag="Dshi_0318"
FT   CDS_pept        306292..307308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bztA"
FT                   /locus_tag="Dshi_0318"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein SMART: extracellular
FT                   solute-binding protein family 3 KEGG: sil:SPO0519
FT                   glutamate/glutamine/aspartate/asparagine ABC transporter,
FT                   periplasmic substrate-binding protein; high swissprot hit
FT                   to Glutamate/glutamine/aspartate/asparagine-binding protein
FT                   bztA from Rhodobacter capsulatus; RBS site AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92067"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM90"
FT                   /protein_id="ABV92067.1"
FT                   /translation="MKKSVLFGALAAAGLAATGAAADTLEEVQARGAVNCGISTGLVGF
FT                   ASQDANGEWQGFDVAVCRAVAAAVFGDPTAVNFNPVTNQVRFEVLNSGEIDMLARNTTW
FT                   TFSRDVDLKLEFTGINYYDGQGFMVPKALGVSSATELDGATVCIQKGTTTELNLADFFR
FT                   ANNISFEPVPISTASEAQQQYLAGACDVYTTDASGLAATRASFESPDEHVVLPEIISKE
FT                   PLGPLVRHGDNEWGDIVRWTLNALIAAEELGVTSANVAELAAGTDNPEINRLLGTEGNL
FT                   GEQLGLSADWAVNVIKAGGNYGEIFETHIGENTPIGLARGLNAQWTEGGLLYAPPFR"
FT   gene            307429..308664
FT                   /gene="bztB"
FT                   /locus_tag="Dshi_0319"
FT   CDS_pept        307429..308664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bztB"
FT                   /locus_tag="Dshi_0319"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transport system permease"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit PFAM: binding-protein-dependent transport
FT                   systems inner membrane component KEGG: rde:RD1_1445
FT                   glutamate/glutamine/aspartate/asparagine transport system
FT                   permease protein, high swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92068"
FT                   /db_xref="GOA:A8LM91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM91"
FT                   /protein_id="ABV92068.1"
FT                   /translation="MTTFSDPPPASGPPNQPFNLGMLINDTRYRGYTFQFIALIALIFF
FT                   FGWLVSNAIYNLAALGQDINFSFLGQPASYEIDQTLIPYTSTDTHMRAAFVGLLNTLLV
FT                   AFLGCITATIFGVLAGVLRLSKNWLVAKVMSVYVEIFRNIPVLIWIVIISAVMSQALPQ
FT                   PRAFRGEDATATMVLWDSVAFTNRGVYIPAPVWNPGSGIVVAVFVLSIIGIFVFRRYAK
FT                   NLLFNTGKLLPVGRISLAIFFVPTLLAFFVMGRPIGLDYPELGGFNFRGGINIRGTLIA
FT                   LWFALALYTGAFIAENVRAGILAVSKGQTEAAAALGMRPNRIMSLIILPQALRVIIPPV
FT                   ISQYLNLTKNSSLAAAIGYMDLTGTLGGVTLNQTGRSFECVLLLMLFYLLISLSISALM
FT                   NLYNNAVKLKER"
FT   gene            308666..309964
FT                   /gene="bztC"
FT                   /locus_tag="Dshi_0320"
FT   CDS_pept        308666..309964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bztC"
FT                   /locus_tag="Dshi_0320"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transport system permease"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit PFAM: binding-protein-dependent transport
FT                   systems inner membrane component KEGG: rde:RD1_1446 amino
FT                   acid ABC transporter, permease protein, high swissprot to
FT                   Glutamate/glutamine/aspartate/asparagine transport system
FT                   permease from Rhodobacter capsulatus"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92069"
FT                   /db_xref="GOA:A8LM92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM92"
FT                   /protein_id="ABV92069.1"
FT                   /translation="MSDTHASAAFVRTEEIPPSPPPVSEVGIVNWLRSNLFYSIPSSIL
FT                   TLLTAAFIYWLSSILMPWMFNGVWDANSIRDCREILDGAIGGCFAVIAERWPQLIFGNY
FT                   PNEEYWRAVLAFVGLFVALAPVLFFKLPRKMLWFTGLFPFIAYWLIWGGSAWVSVMALV
FT                   GVVVGYVAFKALEERSFFGAIVAALFATLLFWIFISPLAVNALSSVVALSLPQVESRFI
FT                   GGFMINFILGTSGIALSLPLGIALALGRQSNLPIIKGVCVVFIEFIRGVPLITLLFVAS
FT                   VMLAYFLPPGTSFDLVLRVIIMITLFASAYIAEAIRGGLAALPRGQYEAGDSLGLDYWQ
FT                   SMRLIILPQALKISIPSIVNIAIGLFKDTTLVSIISMFDMLGMIQGPILSSTEWFGVYW
FT                   ELLGFAGVLFFVFCYGISQYSQWLERQLATEHR"
FT   gene            309980..310756
FT                   /gene="bztD"
FT                   /locus_tag="Dshi_0321"
FT   CDS_pept        309980..310756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bztD"
FT                   /locus_tag="Dshi_0321"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transport ATP-binding"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase
FT                   KEGG: jan:Jann_0630 ABC transporter related, high swissprot
FT                   hit to Glutamate/glutamine/aspartate/asparagine transport
FT                   ATP-binding from Rhodobacter capsulatus"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92070"
FT                   /db_xref="GOA:A8LM93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM93"
FT                   /protein_id="ABV92070.1"
FT                   /translation="MAMTDQAPAMTVSDEVAIEIDKMNKWYGQFHVLRDINLTVYRGER
FT                   IVICGPSGSGKSTLIRCINALEEHQAGSITVDGTLLSSDLKNIDTIRSEVGMCFQHFNL
FT                   FPHLTILENCTLAPIWVRKTPKKEAEATAMHFLEKVKIPDQANKYPGQLSGGQQQRVAI
FT                   ARSLCMRPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMICVTHEMGFARQVANRV
FT                   IFMDAGQIVEQNEPEEFFGNPQSDRTKLFLSQILGH"
FT   gene            complement(310800..311300)
FT                   /locus_tag="Dshi_0322"
FT   CDS_pept        complement(310800..311300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0322"
FT                   /product="putative phosphatase"
FT                   /note="PFAM: Phosphoglycerate mutase KEGG: sil:SPO0523
FT                   phosphoglycerate mutase family protein; COG2062
FT                   Phosphohistidine phosphatase SixA; best Ref hits to
FT                   hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92071"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM94"
FT                   /protein_id="ABV92071.1"
FT                   /translation="MKTLLLMRHAKSSWAEPGRDDHSRPLNGRGRRGAEALGRWIRDND
FT                   LVPDEVLCSDAARTRETWRRLDLPGEVTLDRALYHAEGAALMARLQQATGDRVLMIAHN
FT                   PGIAEFASRLTPDRPEHPRFAQYPTGATTVLHFPIAEWAALEWDTGRLASFVIPADLGV
FT                   TRT"
FT   gene            complement(311297..311920)
FT                   /locus_tag="Dshi_0323"
FT   CDS_pept        complement(311297..311920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1449 hypothetical protein, no
FT                   significant swissprot; no conserved domains detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92072"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM95"
FT                   /protein_id="ABV92072.1"
FT                   /translation="MFGAWHPESDPDVPAGTQTMILLGPREPGFWTAFRASPEAQEARA
FT                   DPLDRWSRRVIGQWACDLGAKALFPFGGPPWRPFIRWARESGRAHVSPVGLLVHDTAGL
FT                   MISYRGALALKQRLALPPPPPAPCAECSSQPCRIACPVSALSPEAYDVPLCKSFLDTPA
FT                   GLDCHGRGCAVRRACPVSRSYGRAEAQSAFHMQSFHKRGQRGPE"
FT   gene            complement(311973..312836)
FT                   /gene="argB"
FT                   /locus_tag="Dshi_0324"
FT   CDS_pept        complement(311973..312836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="Dshi_0324"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase PFAM:
FT                   aspartate/glutamate/uridylate kinase KEGG: sit:TM1040_0301
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92073"
FT                   /db_xref="GOA:A8LM96"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LM96"
FT                   /protein_id="ABV92073.1"
FT                   /translation="MKTRPMKSDWIATARTLSEAVPFLRRYDDAIVVIKFGGHAMGDAE
FT                   AMASFARDIVLMRQVGVNPVIVHGGGPMINAMLAKLDINSDFVNGKRVTDAATIEVVEM
FT                   VLSGLVNKRIVQAINREGGRAIGLSGKDANLIVCDPADPALGFVGEPVEVTPDTLLQLV
FT                   RSEIIPVIAPIGTGREGETFNINGDTAAGAIAAALKADRLLLLTDVSGVKDAQGKVVTE
FT                   LTVENIEEMTAAGVIAGGMIPKTETCVTAIRGGVRAAVILDGRAPNACLLELFTEHGAG
FT                   SIIRRG"
FT   gene            312924..313655
FT                   /gene="fabG3"
FT                   /locus_tag="Dshi_0325"
FT   CDS_pept        312924..313655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="Dshi_0325"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR , good
FT                   swissprot hit to Protein fixR from Bradyrhizobium
FT                   japonicum, fabG NCBI domain, good Ref ZP hit toShort-chain
FT                   alcohol dehydrogenase from Rhodobacterales bacterium
FT                   HTCC2150"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92074"
FT                   /db_xref="GOA:A8LM97"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM97"
FT                   /protein_id="ABV92074.1"
FT                   /translation="MSRQRTLVLTGASRGIGHATVKKFSAEGWRVLSCSRQPFDARCPW
FT                   PGGEDNHIQVDLADPHNTMEAISVIRDKVGGCLDALVNNAGISPKGAGGARLNTLDTDL
FT                   RTWGQVFHVNFFASVVLARGLKDELAAAGGAVVNVTSIAGTRVHPFAGAAYATSKAALK
FT                   ALTREMAHDFGPLGVRVNAIAPGEVETSILSPGTDKIVEKLPLRRLGQPSEVAEAIYFL
FT                   CSERSSYISGTEIEVNGGQHV"
FT   gene            complement(313718..314371)
FT                   /gene="engB"
FT                   /locus_tag="Dshi_0326"
FT   CDS_pept        complement(313718..314371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="Dshi_0326"
FT                   /product="GTP-binding protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related KEGG:
FT                   sil:SPO0530 GTP-binding protein, good swissprot toProbable
FT                   GTP-binding protein engB from Silicibacter pomeroyi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92075"
FT                   /db_xref="GOA:A8LM98"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM98"
FT                   /protein_id="ABV92075.1"
FT                   /translation="MTALPFPLSPEPDAQSLEAGRKLFAGEVTFLKGVVAMSGLPPADR
FT                   LEVCFAGRSNVGKSSLINALTGRKALARTSNTPGRTQEINYFCLGEDRYLVDVPGYGFA
FT                   EAPVAVVQKWQALLKAYLTGRPTLRRAFVLIDARHGIKAVDHEIMSLLDTAAVTFQVVL
FT                   TKADKIKTAEQDKTLAQVRKELARHPAAFPELLLTSSAKGDGIETLRATVAGLV"
FT   gene            complement(314368..315117)
FT                   /gene="mosc"
FT                   /locus_tag="Dshi_0327"
FT   CDS_pept        complement(314368..315117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mosc"
FT                   /locus_tag="Dshi_0327"
FT                   /product="MOSC domain protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein KEGG: sil:SPO0531 MOSC
FT                   domain protein, swissprot hit to Molybdenum cofactor
FT                   sulfurase from Mus musculus"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92076"
FT                   /db_xref="GOA:A8LM99"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8LM99"
FT                   /protein_id="ABV92076.1"
FT                   /translation="MNGTVAAIWRHPIKSHGAEALETATLSRGGTLPGDRLWAVLHDAA
FT                   KPNPEGWSPCANFARVAKAPALAAIRARLHPDGQTVTLTHPDRPDLDIAPDREADAFLA
FT                   WVKPLVPADRAQPVAVLRNDARGFTDTPEPTISLCNLASHRAVSQKLGRELSPLRWRGN
FT                   IWLDGPALWEEFEWVGRRIALGTAELEVTEPIARCTATMVNPETGRRDADTLASLETGW
FT                   GHRNFGVYAVVTRDGEVPLGAELRVLP"
FT   gene            complement(315114..316934)
FT                   /gene="yidC"
FT                   /locus_tag="Dshi_0328"
FT   CDS_pept        complement(315114..316934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="Dshi_0328"
FT                   /product="preprotein translocase subunit"
FT                   /note="SPRINT: YidC translocation/secretion protein
FT                   signature, PFAM: 60 kDa inner membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92077"
FT                   /db_xref="GOA:A8LMA0"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMA0"
FT                   /protein_id="ABV92077.1"
FT                   /translation="MDDQNKNLILATALSFLVILVWFLLFPPEEPVTDPNAPTQITQSG
FT                   ETADVALTPPAAVTEAAPGAAPQTAATPTENAPRVQIDTPALEGSISLLGGRIDDLSLR
FT                   NYNETLEPDSPIVRLLSPVDAPGAYYALYGWAPAGTLSFDDVPGANTLWTVESGDTLTV
FT                   DTPVVLRWENGNGLIFRRTLAVDDDFMFTVTQSVENTTETDKRMQPYGIIARHGEPDTI
FT                   NFFVLHEGVVAMADGSLIESDYDDMLDYDFVEREGARAEVEQIEQNGWIGFTDKNWMTT
FT                   LIPTPGQPFTSVAKYVGNADIYQTETRLPTQTVPGGQTVTVETRLFAGAKEWEAIRGYE
FT                   RELGIEGFIDSIDWGWFYFLTKPIFFVLHELNLLIGNMGVAIIVLTLLIKALLLPLAWK
FT                   SYVSMARMKELQPEMEKLKEKAGDDRQKLQVAMMELYKKEKVNPAAGCLPILLQIPIFF
FT                   SLYKVIFVTIELRHAPFFGPFQDLSAPDPTSIMNLFGLLPFASPEPGSILALIFIGILP
FT                   LLLGISMWLQQKLNPAPTDPTQAMIFAWLPWVFMFMLGTFASGLIVYWIANNVITFAQQ
FT                   YFIMRRHGYKPDLFGNIVASFKKKKPSEDK"
FT   gene            complement(317056..318645)
FT                   /gene="ydaM"
FT                   /locus_tag="Dshi_0329"
FT   CDS_pept        complement(317056..318645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /locus_tag="Dshi_0329"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase PFAM: GGDEF domain
FT                   containing protein; EAL domain protein KEGG: sil:SPO0533
FT                   diguanylate cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92078"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA1"
FT                   /protein_id="ABV92078.1"
FT                   /translation="MASARHAARAARGSGVLVSRFLDFFRSTGKQLFRDPALLAGFIPL
FT                   FVALSYSTRDIRWLIGASTLIPFLVLAIRAFDVVTSPKGGRDGLTGLPCRAALLEVLDK
FT                   YFATPGASTRTAACMVIDLDDFHSFNERWGREAADEVLRQTANRLRSAVRDNDLVVRLD
FT                   ADAFALYLAPSEGMTLDSTLSIADRIQRALSEPLVLHGLTAYVSASVGIALASKSPEPT
FT                   AASLLVAAERAMVEARSQGAGALRLFSAEMQTEIRASHELAEDLAKALENGEIVAWFQP
FT                   QVSTETGQVTGFEALARWDHPSRGIVSPAEFLPAIEASGRTERLSEVMLYQGLKALVAW
FT                   ERGGFVIPSIGVNFAGLELRNPHLIDKVKWELDRFGLTADRLSVEILETVITETDDDIV
FT                   LRNIKALGELGCGIDLDDFGTGHASISAIKRFKTSRIKIDRSFVTHIDKDGEQQRMVAA
FT                   ILTMAQQLQVESLAEGVETIGEHSILAQLGCQHVQGFGIARPMPFEDTFAWLAEHERKR
FT                   APTPRIERQRGA"
FT   gene            complement(318693..319556)
FT                   /gene="ydaO"
FT                   /locus_tag="Dshi_0330"
FT   CDS_pept        complement(318693..319556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="Dshi_0330"
FT                   /product="PP-loop ATPase"
FT                   /note="PFAM: PP-loop domain protein ; PIRSF:PP-loop ATPase,
FT                   YdaO type, good Ref ZP hit to ATPase of the PP superfamily
FT                   protein from Sagittula stellata E-37 and good swissprot hit
FT                   toUPF0021 protein ydaO fromEscherichia coli K12;
FT                   YdaO-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92079"
FT                   /db_xref="GOA:A8LMA2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMA2"
FT                   /protein_id="ABV92079.1"
FT                   /translation="MLDDADIHPLFHNAPGTTEFKKLRKRIIRNVREAIDLYGMVEREA
FT                   REGTKPRWLVCLSGGKDSYTLLAALTELQWRGLLPVEILACNLDQGQPGFPATVLPEFL
FT                   ERMGVPHRIEYQDTYSIVMDKVPAGRTYCALCSRLRRGNLYRIAREEGCSAVLLGHHRD
FT                   DILETFFMNLFHGGRLATMPPKLVNEEGDLFVLRPLAHVAEADCARFAKALDYPIIPCD
FT                   LCGSQDGLQRQQVKALLDGWEANSPGRRQVMFKALTNIRPSHMLDPNLFDFAGLGLADA
FT                   FSENPK"
FT   gene            319728..319803
FT                   /locus_tag="Dshi_6003"
FT   tRNA            319728..319803
FT                   /locus_tag="Dshi_6003"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   gene            complement(319810..320031)
FT                   /locus_tag="Dshi_0331"
FT   CDS_pept        complement(319810..320031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0331"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; middle
FT                   swissprot hit to UPF0161 protein RD1_1458 from Roseobacter
FT                   denitrificans OCh 114 and middle Ref ZP hit to hypothetical
FT                   protein SKA53_00415 from Loktanella vestfoldensis SKA53"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92080"
FT                   /db_xref="GOA:A8LMA3"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMA3"
FT                   /protein_id="ABV92080.1"
FT                   /translation="MSPLAWLLSLPVRAYRLIFSPWVGFNCRYDPTCSAYAMEALRKHG
FT                   GVKGGWLTLRRILRCHPWGGTGVDDVPD"
FT   gene            complement(320028..320417)
FT                   /gene="rnpA"
FT                   /locus_tag="Dshi_0332"
FT   CDS_pept        complement(320028..320417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="Dshi_0332"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="TIGRFAM: ribonuclease P protein component PFAM:
FT                   ribonuclease P protein , middle swissprot hit to
FT                   Ribonuclease P protein component from Silicibacter pomeroyi
FT                   and middle Ref ZP hit toribonuclease P protein component
FT                   from Roseobacter sp. CCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92081"
FT                   /db_xref="GOA:A8LMA4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA4"
FT                   /protein_id="ABV92081.1"
FT                   /translation="MAPSPPPASSQAALCVLTKRADFLRAARARRQSAPAFLLQARRRA
FT                   PDEPATGIRVGFTCSKKVGNAVARNRAKRRLREIARLELPTNGRDGWDYVLIGRKAATA
FT                   ERDFTLLRADLAAALARIHGKGRPS"
FT   gene            complement(320480..320614)
FT                   /gene="rpmH"
FT                   /locus_tag="Dshi_0333"
FT   CDS_pept        complement(320480..320614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="Dshi_0333"
FT                   /product="50S ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34, low swissprot and Ref
FT                   ZP hit to 50S ribbosomal protein L34 from Silicibacter
FT                   pomeroyi and Roseovarius nubinhibens ISM"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92082"
FT                   /db_xref="GOA:A8LMA5"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMA5"
FT                   /protein_id="ABV92082.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA"
FT   gene            complement(320770..320846)
FT                   /locus_tag="Dshi_6004"
FT   tRNA            complement(320770..320846)
FT                   /locus_tag="Dshi_6004"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            complement(320898..322301)
FT                   /locus_tag="Dshi_0334"
FT   CDS_pept        complement(320898..322301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0334"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; low swissprot hit to Sensor
FT                   protein zraS (a membrane-associated protein kinase that
FT                   phosphorylates zraR in response to high concentrations of
FT                   zinc or lead in the medium) from Salmonella typhimurium and
FT                   high Ref ZP hit to periplasmic sensor signal transduction
FT                   histidine kinase from R"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92083"
FT                   /db_xref="GOA:A8LMA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA6"
FT                   /protein_id="ABV92083.1"
FT                   /translation="MNSLSGRFLVLTIIFVMLAEVLIFVPSVARFREDYLLDRLERAQI
FT                   ASLALLATPDDMVAPELEAELLANAEVFNVVLRRDEVRQLILSRPMPPEIYGTYDLRDP
FT                   SAYELIRDALWNIVMTEDQVIRVIGNPVRGAGEVIEITMPTGPLRAALIDYGIRILILS
FT                   AVISIFTAALLFLAVRRFLVKPMRRVVDHMTAYAEAPEDARRIIIPDAGVRELRDAEAA
FT                   LQSLQTQLTTALKQKDRLAQLGSAVAKISHDLRNVLTVAQLLADRMERSEDPTVQKAAP
FT                   KLVRSISRAVNLCEGTLAFGKAEELPPTLSRFNLAPLIDDVLDSEALACDPSEIVLRAE
FT                   IPPGLMIRADSEQLYRVITNLVRNARQAIEATGQPGEICVLAREEDAEWVVCIRDSGPG
FT                   LPPKARENLFTAFQGGVRKGGTGLGLVIAAELVRGHGGALDLVRSDESGTEFALRLPRN
FT                   SAILDAAAE"
FT   gene            complement(322338..323750)
FT                   /gene="merA"
FT                   /locus_tag="Dshi_0335"
FT   CDS_pept        complement(322338..323750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="Dshi_0335"
FT                   /product="putative mercuric reductase MerA"
FT                   /EC_number="1.16.1.1"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; high swissprot to
FT                   Mercuric reductase from Bacillus cereus and high Ref ZP hit
FT                   to mercuric reductase, putative from Roseovarius sp.
FT                   TM1035"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92084"
FT                   /db_xref="GOA:A8LMA7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA7"
FT                   /protein_id="ABV92084.1"
FT                   /translation="MTNRIETDICVIGAGSGGLSVAAGAVQMGARVVLIEGHLMGGDCL
FT                   NFGCVPSKALIAAGKQAHIVRAGGFGVAPAEPVIDYAAAKDHVRRVIDTIAPVDSQERF
FT                   EGLGCTVIREYASFISETELQAGDTVITARRFVIATGSRPFVPPIPGVEDVPYYTNETI
FT                   FDLREKPEHLIIIGGGPIGMEMAQAHVRLGCKVTVLEGAQALGKDDPELAAIALERLRG
FT                   EGIEIIEGAQASNISGKGGAITVETANGQSVTGTHLLMAVGRTPNLDKLNLEAAGVDYD
FT                   RRGLKVDASLRTTNKRIYGAGDVAGPLQFTHVAGYHAGILIRQLVLGLPAKTRDDHVPW
FT                   ATYTDPEIAQVGLTEAQAREKYGAALEVARFEYDENDRAIASGKTTGLIKVMVVKGRPI
FT                   GASIVGAEAGELIGLWAYAIANKHKMSAVANMIAPYPTLGEINKRAAGAYFSPRLFESA
FT                   LVKRIVRIVQKF"
FT   gene            complement(323755..324486)
FT                   /locus_tag="Dshi_0336"
FT   CDS_pept        complement(323755..324486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0336"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein KEGG:
FT                   rde:RD1_1463 mercuric reductase; the mercuric reductase
FT                   MerA also comprises a SNARE associated Golgi protein motif,
FT                   low swissprot hit to UPF0043 membrane protein ydjX from
FT                   Escherichia coli K12 and good Ref ZP hit to hypothetical
FT                   protein RCCS2_07124 from Roseobacter sp. CCS2; also good
FT                   Ref YP hit to mercuric reductase from Roseobacter
FT                   denitrificans OCh 114; possible Gene arrangement with
FT                   Dshi_0335"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92085"
FT                   /db_xref="GOA:A8LMA8"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA8"
FT                   /protein_id="ABV92085.1"
FT                   /translation="MSIMDENRKAALPRWVPIAGIAAIAAIGAFTLRDTLSFEALAENR
FT                   EALIAFRDANFGLTIGVYLAVYIAVVAFSLPGATITTLTGGFLFGLGTGTLLTVFAATI
FT                   GATIIFLAARWGLGERLAAKMDASEGRVKQLKAGLAENEISVLFLMRLVPAIPFFVANL
FT                   LPALVGVKLRNFVFTTFFGIIPGTAVYTWVGAGLGEVFARGETPNLGIIFEPHILGPIL
FT                   GLSALALLPILLKYFRKTKGA"
FT   gene            complement(325428..326237)
FT                   /gene="parA2"
FT                   /locus_tag="Dshi_0337"
FT   CDS_pept        complement(325428..326237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA2"
FT                   /locus_tag="Dshi_0337"
FT                   /product="ATPases involved in chromosome partitioning-like
FT                   protein"
FT                   /note="PFAM: ATPase MipZ KEGG: jan:Jann_0738 ATPases
FT                   involved in chromosome partitioning-like;alternative gene
FT                   name: mipZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92086"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMA9"
FT                   /protein_id="ABV92086.1"
FT                   /translation="MAHIIVFGNEKGGSGKSSTCMHVATALARMGHRVGGLDLDLRQRS
FT                   FGRYLENRKASCEREGIALPTPELIELPQIDPASLPEGENLWDYRLSAAVSSLEEECDF
FT                   VVIDCPGSHTRLSQVAHSLADTLITPLNDSYVDFDMLARIDPTTNKVLGPSVYSEMVWD
FT                   ARQLRARAGLPPIEWVVLRNRLGTQYMHNKKKIGDALKDLSKRIGCRVIPGFSERVIFR
FT                   ELFPRGLTLLDLRDIGIDKLNMSNVAARQELRELVKALNLPGVEVDF"
FT   gene            326619..327452
FT                   /locus_tag="Dshi_0338"
FT   CDS_pept        326619..327452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0338"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="PFAM: beta-lactamase domain protein KEGG:
FT                   sil:SPO2170 metallo-beta-lactamase family protein; NCBI
FT                   conserved domains:GloB, Zn-dependent hydrolases, including
FT                   glyoxylases; no significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92087"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB0"
FT                   /protein_id="ABV92087.1"
FT                   /translation="MPLGAYRITALLDGMAPLGRPFFFGPDEGAIDAKLAEMGLGPDLL
FT                   PAPVTAYLLRSDDRTILIDAGMGEVDLLGPGFGRVAAALGAAGVAPGDVDTVILTHAHP
FT                   DHLGGLVADGAVVFANAELVMAEAEAGFWLDAGMMAQAPTEAQGLFQLAQTVVEAYSDR
FT                   VTRVADGAEVAPGVRLILSPGHTPGHAVLRIDGGDRQLLMLADTLHSADLHTAMPDVGF
FT                   GFDVDPAAAAHSRRRLFEEAASDGVLIAGSHVHFPGFGRIQRAGDAFRYAPASWL"
FT   gene            complement(327660..328538)
FT                   /locus_tag="Dshi_0339"
FT   CDS_pept        complement(327660..328538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0339"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849 KEGG:
FT                   bur:Bcep18194_B0612 protein of unknown function DUF849, no
FT                   significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92088"
FT                   /db_xref="GOA:A8LMB1"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB1"
FT                   /protein_id="ABV92088.1"
FT                   /translation="MPQICLEVALNGPWSRSLQPGMPITTDELIAQGIACARAGAAVVH
FT                   VHVYDPDTGRQREDYDAYAKVIEGIRAVEDVIVYPTLPLSGSRDAATAMTPEARFAVVE
FT                   ALARDGLLEWAVVDPGCAILSSLSEIRAGREGFVYHNSEAEVRHGLDLARTYGFHPSYA
FT                   IYEPGFARLGAALAAQVPGVPRPIYRFMFSEGFTFGYPPRGYALDSYLALMAELDPGAP
FT                   CMIAGLQVDILPLIGAAVPAGVHVRVGLEDAPFGTELSNIGWTEAAAQAIAQAGGTLAR
FT                   AAEIRRKIAGR"
FT   gene            complement(328656..328877)
FT                   /gene="rpmE"
FT                   /locus_tag="Dshi_0340"
FT   CDS_pept        complement(328656..328877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="Dshi_0340"
FT                   /product="50S ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31 KEGG: sit:TM1040_2617
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92089"
FT                   /db_xref="GOA:A8LMB2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMB2"
FT                   /protein_id="ABV92089.1"
FT                   /translation="MKKDIHPEYHIIDVKMTDGTVIQMRSTWGAEGDQLSLDIDPSVHP
FT                   AWTGGTSRLLDTGGRVSKFKKKYEGLGF"
FT   gene            complement(328889..329263)
FT                   /gene="rplS"
FT                   /locus_tag="Dshi_0341"
FT   CDS_pept        complement(328889..329263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="Dshi_0341"
FT                   /product="50S ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19 KEGG: sil:SPO3257
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92090"
FT                   /db_xref="GOA:A8LMB3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMB3"
FT                   /protein_id="ABV92090.1"
FT                   /translation="MNLIAQLEAEQIAELGKDIPDFKAGDTIRVGYKVTEGTRSRVQNY
FT                   EGVCIARKGGDGIAASFTVRKISFGEGVERVFPLHSTNIDSIEVVRRGKVRRAKLYYLR
FT                   ARRGKSARIAEQTNYKPKSN"
FT   gene            complement(329524..330321)
FT                   /gene="trmD"
FT                   /locus_tag="Dshi_0342"
FT   CDS_pept        complement(329524..330321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="Dshi_0342"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: rsq:Rsph17025_0184 tRNA
FT                   (guanine-N1)-methyltransferase TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92091"
FT                   /db_xref="GOA:A8LMB4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB4"
FT                   /protein_id="ABV92091.1"
FT                   /translation="MTTPPNRSHGRKSISATLTPQDLMAARPRLKGAWTAKVLTLFPKA
FT                   FPGVLGESLTGKALDEGLWALEAMDLRSFGVGKHRNVDDTPAGGGAGMVLRPDVLGRAI
FT                   DAARAGTPEAPEDWPIVYLSPRGAPFTQAWARAWSRARGVTLLCGRFEGVDQRVLDHYP
FT                   IEEVSLGDFVLTGGELAAQAMIDATVRLLPGVLGNAASTEEESFSRGLLEHPQYTRPAV
FT                   WKGRAIPEVLMSGHHGQIEAWRREQAEALTRARRPDLWAARKP"
FT   gene            330412..331401
FT                   /gene="aph"
FT                   /locus_tag="Dshi_0343"
FT   CDS_pept        330412..331401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aph"
FT                   /locus_tag="Dshi_0343"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /EC_number="2.7.1.95"
FT                   /note="PFAM: aminoglycoside phosphotransferase KEGG:
FT                   sit:TM1040_2610 hypothetical protein; no significant
FT                   swissprot hit"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92092"
FT                   /db_xref="GOA:A8LMB5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB5"
FT                   /protein_id="ABV92092.1"
FT                   /translation="MTPGDRMMASALGSWTRLAPFAGLDPAAFEAEELWRREDPGQVRI
FT                   VLRMRGGAGQDLVFKRVFQPQDRGRWAEALDGQRRAVRALMRDPVHVPPAILAEDAETL
FT                   STVQDFVPGRTLQDHMLLRFDKPGARAQVLQRAGRFLAAFHGATAEGDKPFNPATMLDY
FT                   IRALGRRALSGDLTLADPDLFAVLAEGLEAAAQTAAGQPVRVAAQHGDLHARNLIVSGK
FT                   RATLIDFAQDRSAPVQYDMARLIVDLGARFSGDAAPEATCGLPAADLAALSDGYGRDLS
FT                   QDACLAFLCRCRVLQDWAALPAVASQRSAFQQERLLQLQKTATRLAAA"
FT   gene            complement(331421..331921)
FT                   /gene="rimM"
FT                   /locus_tag="Dshi_0344"
FT   CDS_pept        complement(331421..331921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="Dshi_0344"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM PFAM: RimM
FT                   protein; PRC-barrel domain protein KEGG: rsq:Rsph17025_0182
FT                   16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92093"
FT                   /db_xref="GOA:A8LMB6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMB6"
FT                   /protein_id="ABV92093.1"
FT                   /translation="MSDRVCVGAVAGAFGVRGELRIKSFCAVPEDIASYNPLSFEDGRE
FT                   TTLRLTGQIKNGLSGRLTGVSNKEAADALRGARLYAPRDRLPRLPDDEFYHADLIGLAV
FT                   HDTGGTLLGKVAAVHNHGAGDLLELRGPGLKGSVLLPFTRAVVPTVDLDAGRIVADPPE
FT                   GLF"
FT   gene            complement(331918..332064)
FT                   /locus_tag="Dshi_0345"
FT   CDS_pept        complement(331918..332064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0345"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure prosite hit to
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92094"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB7"
FT                   /protein_id="ABV92094.1"
FT                   /translation="MGKTVILLVFGASVYIGMQLERRLAEERCLSAGGAPDARGVCTGV
FT                   AAP"
FT   gene            complement(332071..332535)
FT                   /locus_tag="Dshi_0346"
FT   CDS_pept        complement(332071..332535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0346"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55 KEGG:
FT                   mjl:Mjls_0045 protein of unknown function DUF55, bad
FT                   swissprot hit to UPF0310 protein in gntR 5region
FT                   fromBacillus licheniformis; bad Ref ZP hit to UPF0310
FT                   protein in gntR 5region fromBacillus licheniformis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92095"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB8"
FT                   /protein_id="ABV92095.1"
FT                   /translation="MARYWIGLAERDSVQAAVANGVCLFSGGKAAAVRKLAPGDWVLYY
FT                   SPHETADGAALECFTAVGEVIDDTPWTQNWTQLCAGGPSWTFGTGRGSGQTWVRKCAYD
FT                   AVGEVSVRPLLGALDFVARPRHWGRTFRRGQMEIGAADFFAIADRLRAVA"
FT   gene            complement(332537..333166)
FT                   /gene="bluB"
FT                   /locus_tag="Dshi_0347"
FT   CDS_pept        complement(332537..333166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bluB"
FT                   /locus_tag="Dshi_0347"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="KEGG: sil:SPO3254 cobalamin biosynthesis protein
FT                   BluB TIGRFAM: cob(II)yrinic acid a,c-diamide reductase
FT                   PFAM: nitroreductase; good swissprot hit toPutative
FT                   cob(II)yrinic acid a,c-diamide reductase from Rhodobacter
FT                   capsulatus"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92096"
FT                   /db_xref="GOA:A8LMB9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMB9"
FT                   /protein_id="ABV92096.1"
FT                   /translation="MRSFTPAFRAELTELMRWRRDVRRFRTDPVPDAVLARCLDSLRLA
FT                   PSVGLSEPWRVLRIDSPAARAAAAANFAETNADALAGQPGDKAADYARLKLSGMDAAPI
FT                   QLAIYCDTDPAKGSGLGAASMPQMRQYSVVSGVTMMWLTARAEGLGLGWVSILDPDRLA
FT                   RDLAVPATWDLIGYFCLGWPEDEADTPELKRLGWEARAEALELEVR"
FT   gene            complement(333195..333587)
FT                   /gene="rpsP"
FT                   /locus_tag="Dshi_0348"
FT   CDS_pept        complement(333195..333587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="Dshi_0348"
FT                   /product="30S ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16 KEGG: jan:Jann_0749
FT                   ribosomal protein S16; middle swissprot hit to 30S
FT                   ribosomal protein S16 from Silicibacter pomeroyi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92097"
FT                   /db_xref="GOA:A8LMC0"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMC0"
FT                   /protein_id="ABV92097.1"
FT                   /translation="MAMKIRLARGGSKKRPFYRIVAADSRMPRDGRFIEKLGTYNPLLP
FT                   KDSEDRVKMDLERVQYWLGEGAKPTDRVARMLEAAEVLPKTERNNPKKAVPGKKAQDRA
FT                   EEKAAKAAEASEAPADEAPAEEAAAE"
FT   gene            complement(333629..333925)
FT                   /gene="pheA1"
FT                   /locus_tag="Dshi_0349"
FT   CDS_pept        complement(333629..333925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA1"
FT                   /locus_tag="Dshi_0349"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="1.3.1.12"
FT                   /note="TIGRFAM: chorismate mutase PFAM: Chorismate mutase
FT                   KEGG: rde:RD1_1312 chorismate mutase, putative; bad
FT                   swissprot hit to T-protein [Includes: Chorismate mutase
FT                   from Pantoea agglomerans"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92098"
FT                   /db_xref="GOA:A8LMC1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC1"
FT                   /protein_id="ABV92098.1"
FT                   /translation="MTDAVSRAAQVLAEHRDSIDRLDAILVFTLAERFKHTQAVGRLKA
FT                   EHALPPSDPTREESQIKRLSELAEMADLDPDFAKKFLNFIIQEVIQHHKQHQS"
FT   gene            complement(334046..334651)
FT                   /locus_tag="Dshi_0350"
FT   CDS_pept        complement(334046..334651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2605 hypothetical protein, no
FT                   significant swissprot, good Ref YP hit to
FT                   acetyltransferase, GNAT family from Roseobacter
FT                   denitrificans OCh 114, NCBI conserved domains: rimL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92099"
FT                   /db_xref="GOA:A8LMC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC2"
FT                   /protein_id="ABV92099.1"
FT                   /translation="MGHRDIPVLETRRLALRGPVPEDYPNFKATFASYRSRFMGGPLNA
FT                   YETWMLYAAEIGHWEIRGFGMWMIHDKATDETYGMAGGWQPAKWPEREIAWIIWPEKSG
FT                   HGFALEAVHACRRYYYDQRGWDGAVSYLDPMDLDSIRLAERLGAAKDKAAATVTGDDVV
FT                   YRHPAPAALRGSQLAHGIEMEIGHYADPLFKPKGYALD"
FT   gene            complement(334651..335166)
FT                   /locus_tag="Dshi_0351"
FT   CDS_pept        complement(334651..335166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0351"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase KEGG:
FT                   jan:Jann_0752 GCN5-related N-acetyltransferase; middle Ref
FT                   YP hit to GCN5-related N-acetyltransferase from Jannaschia
FT                   sp. CCS1; NCBI conserved domains: rimL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92100"
FT                   /db_xref="GOA:A8LMC3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC3"
FT                   /protein_id="ABV92100.1"
FT                   /translation="MTLLTTDRLILRPPAARDFPGYRDFYMSDRSRHAHGPLSEDQAWY
FT                   AFCVEMAHWPMRGFGMFTLLTQADPETPIGLVGPWFPADWPEREVGWLLWPGAEGRGYA
FT                   DEAARACLTHAFGHLGWDTAVSYIAPENAPSAKLAEKLGAHPDPDAKAPKPGLDVWRHD
FT                   PALWHEAA"
FT   gene            complement(335163..335696)
FT                   /locus_tag="Dshi_0352"
FT   CDS_pept        complement(335163..335696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0352"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="middle Ref ZP hit to acetyltransferase, GNAT family
FT                   protein from Roseobacter sp. CCS2, no significant
FT                   swissprot, NCBI domains: rimL; prosite51186 GCN5-related
FT                   N-acetyltransferase ; GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92101"
FT                   /db_xref="GOA:A8LMC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC4"
FT                   /protein_id="ABV92101.1"
FT                   /translation="MTGTTVHIPTLTTERLTLRAPRPEDAVAYGAFLESPRSAGVGGPY
FT                   KAADAFDRMCNTVGHWHLRGYGRWIIADRDTDAALGICGPYYPVDWPAPEFAWTVFGDA
FT                   EGRGIAFEAVTEARRWAYDTLGWDTAISLIIEGNTRSFALAERLGCRRDGTYDSPYYGA
FT                   MQIWRHPSAQELAA"
FT   gene            complement(335696..337210)
FT                   /gene="ffh"
FT                   /locus_tag="Dshi_0353"
FT   CDS_pept        complement(335696..337210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="Dshi_0353"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: rde:RD1_1315 signal recognition particle
FT                   protein, putative TIGRFAM: signal recognition particle
FT                   protein PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54
FT                   helical bundle SMART: AAA ATPase; high swissprot to Signal
FT                   recognition particle protein from Rickettsia typhi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92102"
FT                   /db_xref="GOA:A8LMC5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC5"
FT                   /protein_id="ABV92102.1"
FT                   /translation="MFENLSDRLSGVFDRLTKQGALSEADVATALREVRVALLEADVSL
FT                   PVARDFIKAVQEKATGQAVTKSVTPGQQVVKIVHDELVHVLQGDEDPGALKIDNPPAPI
FT                   LMVGLQGGGKTTTTAKIAKRLKERDGKKILMASLDVNRPAAMEQLAILGAQIGVDTLPI
FT                   VKGEDPVAIARRAKTQASLGGYDVYMLDTAGRLSIDEELMAQVEAVRDVANPRETLLVV
FT                   DGLTGQDAVTTAENFDDRIGITGVVLTRMDGDGRGGAALSMRAVTGRPIRFVGLGEKMD
FT                   ALETFEPDRVAGRILGMGDIVALVEKAQETIEAEQAERMMKRFQKGQFNMNDLRGQLEQ
FT                   MEKMGGVEGLMGMMPGMSKMKGKLDEAGFDDKVIRRQIALIQSMTKKERANPQILQASR
FT                   KKRIAKGAGMEVSDLNKLLKMHRQMSDAMKKMGKMGKKGMMKSLGGMLGGGKGGMPPGM
FT                   PGDLAGMNPADLEKAAKAMGKMPGGGLPGLGGGALPPGLSGFGKKK"
FT   gene            complement(337582..338226)
FT                   /gene="azoR1"
FT                   /locus_tag="Dshi_0354"
FT   CDS_pept        complement(337582..338226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azoR1"
FT                   /locus_tag="Dshi_0354"
FT                   /product="FMN-dependent NADH-azoreductase 1"
FT                   /EC_number="1.7.-.-"
FT                   /note="Pfam02525 Flavodoxin-like fold, NCBI conserved
FT                   domains PRK00170 azoreductase, middle Ref ZP hit to
FT                   (Acyl-carrier protein) phosphodiesterase from Roseobacter
FT                   sp. SK209-2-6, middle swissprot hit toFMN-dependent
FT                   NADH-azoreductase 1 from Jannaschia sp. CCS1; at N-terminal
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92103"
FT                   /db_xref="GOA:A8LMC6"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC6"
FT                   /protein_id="ABV92103.1"
FT                   /translation="MLNSWCTHRIPGAVFALPPTHRQDRSHDLRSPHRQLPPQHQLGLP
FT                   PARRPHPRPARRGPGRLPRHHRRACGGGCRLDRRELQRTADQRAVLALSDSLVAELQAA
FT                   DTVLITLPIWNFGIPSTLKAWIDQVARAGVTFRYTPDGPVGLLEGKRAILAVASGGTEV
FT                   GSAIDFATDYLRHVLGFIGIHEVEIVAADRLMVDADASHAKADAAIDALAA"
FT   gene            338282..339163
FT                   /gene="lysR"
FT                   /locus_tag="Dshi_0355"
FT   CDS_pept        338282..339163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="Dshi_0355"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding KEGG: sit:TM1040_2599 transcriptional
FT                   regulator, LysR family; high Ref Yp hit to transcriptional
FT                   regulator, LysR family from Silicibacter sp. TM1040; LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92104"
FT                   /db_xref="GOA:A8LMC7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC7"
FT                   /protein_id="ABV92104.1"
FT                   /translation="MPIENWDEVRTAFQVARLGTVSGAAEVLGVHHATVIRHIDSLEGR
FT                   LGVKLFQRHARGYTATDAGKDLLQVAQVTADQLEQLSGRLHGHGAQVTGELVITSLEIL
FT                   SPLIAPVLAEFQREHRDVMVKLITDARVFRLEYGEAHVAIRAGRKPEDPDNIVQPLYIQ
FT                   KMAFFGTPEYLDTHGPIEIGGDYAGHRIVGSTLDEPRAPFNIWMQENMPAERVVYRASD
FT                   IRGAGDAVVAGVGAGLLPVWWADKYPGVVRLCDPIDAWSSRIWLITHVDLHRTAKVQSF
FT                   TGSLKAAAKAWP"
FT   gene            339214..340104
FT                   /locus_tag="Dshi_0356"
FT   CDS_pept        339214..340104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0356"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6 transmembrane
FT                   KEGG: rde:RD1_1318 integral membrane protein, putative; no
FT                   significant swissprot; high Ref Yp hit to integral membrane
FT                   protein, putative from Roseobacter denitrificans OCh 114,
FT                   no conserved domains by NCBI; ten transmembrane regions"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92105"
FT                   /db_xref="GOA:A8LMC8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC8"
FT                   /protein_id="ABV92105.1"
FT                   /translation="MSGPAQGHLAMLLFSALVAGSFALGGQIANEIAPAALTAVRFGIA
FT                   GGIVGLVAWATGGLSRDLLRAPWRFALLGGVFAVYFVLMFEGLKTADPVSTAAVFTLTP
FT                   VMAAGFGWILMRQVTTPRMALALSVGAAGALWVIFDASLAAFLAFDIGRGEAIFFVGCV
FT                   AHALYAPMARHLNRGESTAGFAFGILTAGCVLLFLYGWRDVQATDWASLRPLVWITLGY
FT                   LTLGASAATIVLLQTATLRLPSAKVMAYTYLVPSWVILWQIALGAAVPDPWVLVGVGLT
FT                   CLALVLLLKPETPGG"
FT   gene            complement(340107..340445)
FT                   /gene="arsR"
FT                   /locus_tag="Dshi_0357"
FT   CDS_pept        complement(340107..340445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="Dshi_0357"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein ArsR KEGG: sit:TM1040_2597
FT                   transcriptional regulator, ArsR family; middle Ref ZP hit
FT                   to transcriptional regulator, ArsR family protein from
FT                   Roseovarius sp. TM1035; bad swissprot hit to cadC: Cadmium
FT                   efflux system accessory protein from Listeria
FT                   monocytogenes; ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92106"
FT                   /db_xref="GOA:A8LMC9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMC9"
FT                   /protein_id="ABV92106.1"
FT                   /translation="MTSQLDTVFAALADPTRRAILTMLLEDDMAVTDVAEPFAMSLAAI
FT                   SKHLGILTRAGLISQEKRGRVKWCKLEPDALRDASIWMQSFGQFEAVHLDAFERFLEAE
FT                   LPAGPEPD"
FT   gene            340610..342199
FT                   /gene="purH"
FT                   /locus_tag="Dshi_0358"
FT   CDS_pept        340610..342199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="Dshi_0358"
FT                   /product="bifunctional purine biosynthesis protein purH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: rde:RD1_0655 bifunctional purine biosynthesis
FT                   protein PurH TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region; high
FT                   swissprot to Bifunctional purine biosynthesis protein purH
FT                   from Brucella suis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92107"
FT                   /db_xref="GOA:A8LMD0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMD0"
FT                   /protein_id="ABV92107.1"
FT                   /translation="MTDLVPLRRALLSVSDKTGLVPLGQALAARGVELLSTGGTAKALR
FT                   EAGLDVVDVSDVTGFPEMMDGRVKTLHPKVHGGLLALRDNAAHVSAMERHGIGAIDLLV
FT                   VNLYPFEATVAAGADYAACIENIDIGGPAMIRAAAKNHSFVTVLTDVEDYEALLGELEA
FT                   REGATGYPFRQKMALNAYARTAAYDAAVSGWMTDALAEVAPRRRAVAGTLAQTLRYGEN
FT                   PHQGAAFYVDGSDRPGVATAVQHQGKELSYNNINDTDAAFELVAEFAPEDGPACAIIKH
FT                   ANPCGVARGATLAEAYTKAFQCDQTSAFGGIIALNRPLDGPTAEAISGIFTEVVIAPGA
FT                   DETARAVFAAKKNLRLLTTEGLPDPKAPALTVRQVSGGYLVQDKDNGNIGWDDLKVVTK
FT                   RAPSEAEIADLLFAWKVAKHVKSNAIVYVKDGATVGVGAGQMSRVDSARIAARKSADMA
FT                   EALGLETPLIQGSVVASDAFFPFPDGLLTAAEAGATAVIQPGGSMRDVEVIAAADAAGL
FT                   AMVFTGMRHFRH"
FT   gene            342204..342680
FT                   /gene="lspA"
FT                   /locus_tag="Dshi_0359"
FT   CDS_pept        342204..342680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Dshi_0359"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="TIGRFAM: lipoprotein signal peptidase PFAM:
FT                   peptidase A8 signal peptidase II KEGG: rde:RD1_0656 signal
FT                   peptidase II, putative, swissprot hit to Lipoprotein signal
FT                   peptidase from Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92108"
FT                   /db_xref="GOA:A8LMD1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMD1"
FT                   /protein_id="ABV92108.1"
FT                   /translation="MRALALSAVVAFAIDQLSKLVVVHWLNLKEIRAIDVLPPVLNFRM
FT                   GWNHGVNFGLFGSDSEAMRWALIVLALAICAGVVIWVRREGGGTRVMVSAGLLVGGALA
FT                   NVLDRVIYGAVADFLNVSCCGIRNPFTFNLADVAIFAGALGLVLFTGKTDENPS"
FT   gene            342734..343279
FT                   /locus_tag="Dshi_0360"
FT   CDS_pept        342734..343279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2930 hypothetical protein; no
FT                   significant swissprot, no conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92109"
FT                   /db_xref="InterPro:IPR021395"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMD2"
FT                   /protein_id="ABV92109.1"
FT                   /translation="MDATAKRLGTVLLACIVLSACGSGDEAPVLMNVRSTTTGPDEFAI
FT                   LPNKPLEIPQNLSSLPAPTPGAANRTDPSPRADAIAALGGRPDRAAPGGDVPSSDRGLL
FT                   AYANRYGFGGDIRATLAAEDLEFRQRNNGRLLERWFSANVYFDAYEPQSLDQDAELERL
FT                   RRGGVRNVSAPPAPTPGG"
FT   gene            343363..344724
FT                   /gene="pqqL2"
FT                   /locus_tag="Dshi_0361"
FT   CDS_pept        343363..344724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqL2"
FT                   /locus_tag="Dshi_0361"
FT                   /product="peptidase M16 protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="PFAM: peptidase M16 domain protein; high swissprot
FT                   to Uncharacterized zinc protease y4wA fromRhizobium sp.
FT                   NGR234 and high Ref ZP hit to putative zinc protease from
FT                   Rhodobacterales bacterium HTCC2150; NCBI conserved domains:
FT                   pqqL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92110"
FT                   /db_xref="GOA:A8LMD3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMD3"
FT                   /protein_id="ABV92110.1"
FT                   /translation="MTRWFFPRLAAAGLAVSLSVAAPAQAAEDVTTYTLDNGLEIVVIE
FT                   DHRAAAVTNMVWYRTGAADEPPGKSGIAHYLEHLLFKGTDELAPGEFSATVQANGGSDN
FT                   AFTSWDYTGYFQRVAADRLELMIKMEADRMVDLELSEEIVLPERDVILEERSQRVDSSP
FT                   GSIFGEQRRAAQYLNHPYGVPIIGWRHEMEQLSRQDALDFYETYYAPNNAILIVAGDVQ
FT                   PEEVKRLAEQYFGPIPANPDLPARVRPVEPPQVAERRIAYADPRVAQPYVIRTYLAPER
FT                   DSGAQETAAALTLLAELLGGSSATSFLGEKLEFEESRAVYTSAFYSGVSLDDTTFGLIV
FT                   VPAEDVSLAEAEADLDRVLEQFMASEIDAEALDRIKMQVRAAEIYGRDSVDARAREYGT
FT                   ALTSGLTVADVQAWPKVLAAVTAEDIKAAAEMVFDKRKAVTGWLMRDGEEELMQ"
FT   gene            344721..346034
FT                   /gene="pqqL1"
FT                   /locus_tag="Dshi_0362"
FT   CDS_pept        344721..346034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqL1"
FT                   /locus_tag="Dshi_0362"
FT                   /product="peptidase M16 protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="PFAM: peptidase M16 domain protein; good swissprot
FT                   to Uncharacterized zinc protease-like protein y4wB from
FT                   Rhizobium sp. NGR234 and Ref YP hit to peptidase M16 domain
FT                   protein from Rhodobacter sphaeroides ATCC 17025, NCBI
FT                   conserved domains: pqqL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92111"
FT                   /db_xref="GOA:A8LMD4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMD4"
FT                   /protein_id="ABV92111.1"
FT                   /translation="MSRILGGFAALILWAVPAWAIVDIQEVTSPGGIEAWLVEDHSIPF
FT                   TALEIRFEGGAALDPEGKRGAAYFMSGLLEEGAGEYDARGYAARTEALAASFEFDISDD
FT                   SLAISARFLTENRDEALEHLRLAIQEPRFDDEAIERVRAQILSVIASDAQDPNAIVGAR
FT                   FDALAFPDHPYGTPYEGSAESVAGLTRDDLVASHRAILARDRIHVGAAGDITAEELGGV
FT                   LDALLGALPETGAPLPEDTEVALTGGVTVVPFASPQSVARFGHEGLARDDPDFFPAFIL
FT                   NQIVGGGGFSSRLMQEVRVERGLTYGIGSYLLPLDDAALYIGQFSSDNTRIAEAIAVIR
FT                   EQWADIAANGVTAEELDEAKVYLTGAYPLRFDGNGRIASILVGMQQDDLSIDYIPTRND
FT                   KVRAVTLEDIARVAARLLRPEDLRFVVVGMPEGLEASN"
FT   gene            346074..347939
FT                   /gene="mutL"
FT                   /locus_tag="Dshi_0363"
FT   CDS_pept        346074..347939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="Dshi_0363"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation, high
FT                   swissprot to DNA mismatch repair protein mutL from
FT                   Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92112"
FT                   /db_xref="GOA:A8LMW8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMW8"
FT                   /protein_id="ABV92112.1"
FT                   /translation="MSAPNPNIMPSHPDLAARPVIRQLDEAAINRIAAGEVIERPASAV
FT                   KELVENALDAQARQIEIAYADGGKTLLRVTDDGIGIAAGDLPLALARHATSKIDGADLL
FT                   NIHTFGFRGEALPSLGAVGRLTIASRAAGAEAAEVTVEGGRMGPVRPAALNRGTVVTLR
FT                   DLFSATPARLKFLRSDRAEVQAIGEVVRRLAMAEPSVGFTLRDVSGGGEGRVTFRVAPE
FT                   QGDLFDALHRRLGRVLGSEFAENALRIEGEREGLRLSGYAALPTYSRGAAVAQFLFVNG
FT                   RPVRDKLLVGALRGAYADFLSRDRHPAAVLFVDCPPERVDVNVHPAKSEVRFREPGVAR
FT                   GLIVTALRHALAEAGHRASSTVADATLGAFRAPDAVGSGARIYQMDRPSAAALGRSTAW
FT                   QAPETAAQGFGFAEAPSARVEPAETVEAIARPLGAARAQLHENYIVAQTETGMVLVDQH
FT                   AAHERLVYERLKALMAENGVPSQALLIPEIVEMSEADARTLLDRSEELAALGLRIEPFG
FT                   PGAVAVRETPALLGPVKAEALLRDILDELSDLGQTDALQARIEAILSRMACHGSVRSGR
FT                   RMSGEEMNALLRQMEATPHSGQCNHGRPTYVELKLADIERLFGRT"
FT   gene            347936..349168
FT                   /gene="rmuC"
FT                   /locus_tag="Dshi_0364"
FT   CDS_pept        347936..349168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmuC"
FT                   /locus_tag="Dshi_0364"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195 ; NCBI
FT                   conserved domains: rmuC; swissprot to DNA recombination
FT                   protein rmuC homolog from Xylella fastidiosa Temecula1 and
FT                   high Ref ZP hit to RmuC domain protein from Oceanicola
FT                   batsensis HTCC2597"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92113"
FT                   /db_xref="GOA:A8LMW9"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMW9"
FT                   /protein_id="ABV92113.1"
FT                   /translation="MIEIAGRVWSEQELVLAGAAALGIVLLSMLILLVVAVRAAGRSAR
FT                   ATEPLVVQVDTLGRAVEALGQGQHALSGGLKSVSDAQATAQMHMVQTMEARLAHVQQQM
FT                   TETLHANALKSANALSEMQTRMNETLSGSSEKTTKSLTQLQERLATIDKAQTNIEKLSG
FT                   DVLSLQDILSNKQTRGAFGEIQLHDIVSKALPADAYAMQATLSNGKRADCLIGLPNPPG
FT                   PIVIDSKFPLEAYEKLRAAGTPAEQTLALREMKAAVRTHIKAIAERYIIEGETADGALM
FT                   FLPSEAVYAELHASLPEVVREGFAARVWIVSPTTCMATLNTMRAVLKDARMREQAGAIR
FT                   KTLGMLHRDVEIVLERVAKLDTHFNQARQDLDGITTAAERAGKRAGRLESFDFDEQNDG
FT                   PQLISVADPSR"
FT   gene            complement(349194..349865)
FT                   /gene="chrR1"
FT                   /locus_tag="Dshi_0365"
FT   CDS_pept        complement(349194..349865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrR1"
FT                   /locus_tag="Dshi_0365"
FT                   /product="anti-ECFsigma factor"
FT                   /note="TIGRFAM: anti-sigma factor, putative, ChrR family
FT                   PFAM: Cupin 2 conserved barrel domain protein; good
FT                   swissprot to Transcriptional activator chrR from
FT                   Rhodobacter sphaeroides 2.4.1 and good Ref ZP hit to
FT                   Anti-sigma factor ChrR from Roseovarius sp. TM1035; NCBI
FT                   conserved domains: chrR; ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92114"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX0"
FT                   /protein_id="ABV92114.1"
FT                   /translation="MTGIKHHLNDALLMAYSAGTLPEAFSLVVATHISMCDDCRAALAA
FT                   HDAVGGALLEDTAEVELAPEALDKCLAAIQALPPKGPIKLPKSMTNGSAPRSSVFPSPL
FT                   AEYVKGDVEDVNWRSVGLGVRQAILPTSKEASVRLLYIPAGAEVPDHGHHGTELTLVLQ
FT                   GAFRDEFDRFGPGDIEVADPNVEHTPVAEAGEACICLAATDAPLKFRSILPKIAQPFLR
FT                   I"
FT   gene            complement(349872..350441)
FT                   /gene="rpoE2"
FT                   /locus_tag="Dshi_0366"
FT   CDS_pept        complement(349872..350441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE2"
FT                   /locus_tag="Dshi_0366"
FT                   /product="RNA polymerase sigma-E factor"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; bad swissprot to RNA polymerase
FT                   sigma factor sigW from Bacillus subtilis and good Ref YP
FT                   hit to RpoE from Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92115"
FT                   /db_xref="GOA:A8LMX1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX1"
FT                   /protein_id="ABV92115.1"
FT                   /translation="MALAHKTTMERPLDMEWVSVMLAIRDRQDTAAFARLFRHFAPRIK
FT                   AFLIKSGASDTLAEDCAQDVMTTVWQKAHMFDPSRASVATWIFTIARNRRIDMLRKERR
FT                   PEPEELPWGPEPEPDQADVLMLQQESEKLQAALIQLPEKQRILVERCYFGDMSHSEIAT
FT                   QTGLPLGTIKSRLRLALDKLRHELKQ"
FT   gene            350649..351953
FT                   /locus_tag="Dshi_0367"
FT   CDS_pept        350649..351953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0367"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase,
FT                   no significant swissprot, high ref ZP hit to Putative
FT                   cyclopropane/cyclopropene fatty acid synthesis protein,
FT                   flavin amine oxidase from Sulfitobacter sp. NAS-14.1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92116"
FT                   /db_xref="GOA:A8LMX2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX2"
FT                   /protein_id="ABV92116.1"
FT                   /translation="MPFETTRGASRRVAVIGGGISGLGAAHLLAKDHSVVVFEAESRFG
FT                   GHARTVTAGRFGDQPVDTGFIVFNYANYPNLTKLFDELDVPVKKSDMSFAASIDGGRLE
FT                   YGLRTLGTLFAQKRNLFRPAYLRMIKDIATFNRRAVEVADDPEITIGQFLDKLGTGPWF
FT                   RDYYITPLSGAIWSTPVSKILDFPARAMVQFFENHALLGATGQHQWYTVDGGSIEYVSR
FT                   LSRSLNEAGVEMRAPAKVTAVQRIEDGVLVKVEGGDWEPFDDVVFAAHSDQTLGMLADS
FT                   SEAERAALGAVKYQANEAILHGDASTMPQHRNIWAAWNYVEERGKTADRIDLTYWMNKL
FT                   QSIPNDDPLFVTLNTTRPIRDALIYDTVTFHHPVYDMPAQHAREALRSMQGMRNTYFCG
FT                   AWMRNGFHEDGFASAVDAVAVLNARNRAPNKVAAA"
FT   gene            351950..352708
FT                   /locus_tag="Dshi_0368"
FT   CDS_pept        351950..352708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0368"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; no
FT                   significant swissprot, high Ref YP hit to protein of
FT                   unknown function DUF1365 from Jannaschia sp. CCS1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92117"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX3"
FT                   /protein_id="ABV92117.1"
FT                   /translation="MSVLDHIEAQTFHGRRGGVENDFRYSIDYLLIDPEAEPKTPFFFS
FT                   RNRANLASLRDRDHGGAPGQGTGANWVRDLLHIQDLEVADGQILLLAQPRILGHVFNPV
FT                   SFWLCHDMDGALRVVIAEVSNTFGDRHCYLCHRDDLAPITRSDILSAQKIFHVSPFQPV
FT                   EGSYTFRFDMRPDRVGVWIDYTTGNEGLIATLTGMRKPMTSLGILKACLRRPLGSRRVL
FT                   GLIHWQALKLWWKGAIYRSRPEPPVEDISR"
FT   gene            352726..353964
FT                   /locus_tag="Dshi_0369"
FT   CDS_pept        352726..353964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0369"
FT                   /product="putative sodium:galactoside symporter family
FT                   protein"
FT                   /note="bad swissprot hit to Uncharacterized symporter ynaJ
FT                   from Bacillus subtilis and high Ref ZP hit to
FT                   sodium:galactoside symporter family protein, putative from
FT                   Roseobacter sp. CCS2; PF07690 MFS_1: transporter, major
FT                   facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92118"
FT                   /db_xref="GOA:A8LMX4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX4"
FT                   /protein_id="ABV92118.1"
FT                   /translation="MIAADKPRLPGFAVFAAMIAAAGLPIYIHAPKFYVDTYGVSLAAL
FT                   GGVLFVLRMLDFAQDPLLGWLSERTRKARAAMVTGAVALLALSMLGLFAVAPPIAPLWW
FT                   FALTLTGLFSAFSFLTISFYAQGVQAADSLGPKGHTRLASWRETGALLGVCVAAVAPTL
FT                   LMGTQAPFTAFALGFAILCGGALWAMRGQWSAVALPTSPESGFRIVLRDPTARWLLVLA
FT                   LVNATPVAVSSTLFLFFVESRLDAPGMEGPLLLLFFLAAAASAPLWGRAAARFGAKRSL
FT                   LSGMVLSIVAFAGAALLGAGDTALFALVCLGSGAALGADLTLLPAIFARRMARIAPTAA
FT                   EGFGLWSLVSKFTLAFAAVALLPLLETTGFTTGPDNDPQALRMLTILYAVVPCVLKLVA
FT                   ITLLTAIRLEEDD"
FT   gene            353964..354554
FT                   /locus_tag="Dshi_0370"
FT   CDS_pept        353964..354554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, good Ref ZP hit to
FT                   hypothetical protein RCCS2_10850 from Roseobacter sp. CCS2;
FT                   no NCBI conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92119"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX5"
FT                   /protein_id="ABV92119.1"
FT                   /translation="MEPILYTLLGVLLTLALFGLWRAKFSFAAQQPEDYADRGPDFDIR
FT                   EQLNGPILCEGVIYGPTGRVTSRFVADFEASWDGDTGVMREEFRYDSGTTQTREWRLTL
FT                   DGDGRIRAEADDLVGAGSGRQTGASVLLNYRIRLTEDAGGHVLDVTDWMYLMENGAIIN
FT                   RSQFRKFGLPVAELVATMRRKPDAKLARLEAAE"
FT   gene            354573..355304
FT                   /locus_tag="Dshi_0371"
FT   CDS_pept        354573..355304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0371"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; middle swissprot hit to Uncharacterized
FT                   oxidoreductase MXAN_5909 from Myxococcus xanthus DK 1622,
FT                   good Ref ZP hit to Short-chain dehydrogenase/reductase
FT                   family member from Loktanella vestfoldensis SKA53; NCBI
FT                   conserved domains: COG4221, Short-chain alcohol
FT                   dehydrogenase of unknown specificity"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92120"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX6"
FT                   /protein_id="ABV92120.1"
FT                   /translation="MRELTGKRYWLVGASEGLGRALAEHLSRMGVELVLSARSEDRLKE
FT                   LAESLPGKAHAVPVDISDTASVTAAAEAAGQIDGMVFLAGVYWPLKATEWDAEKVEAMC
FT                   DINFTGAARCVGAVLPGMVARDAGHIVLTGSLSGFRGLPGASGYGPSKAGVMAMAEAMH
FT                   CDLRKTGVDVQVANPGFIRTRLTEKNDFNMPFLMEPEDAAREMVELMLTDSFKRSFPTV
FT                   FASFFRLSQFLPDWAYYRIFA"
FT   gene            355405..355728
FT                   /locus_tag="Dshi_0372"
FT   CDS_pept        355405..355728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="no conserved domains detected, no significant
FT                   swissprot, middle Ref ZP hit to hypothetical protein
FT                   SKA53_12618 from Loktanella vestfoldensis SKA53"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92121"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX7"
FT                   /protein_id="ABV92121.1"
FT                   /translation="MLDISNAKIAQVIMLSREGKMAEGQLHGFIANLNEDEQASLVAVM
FT                   WIGREDFDPEDLAEAKRTALAEASAPTEEYLSNQPLLADYLESGLDALGVDVTEAEADV
FT                   MRR"
FT   gene            355873..357843
FT                   /gene="fadD3"
FT                   /locus_tag="Dshi_0373"
FT   CDS_pept        355873..357843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD3"
FT                   /locus_tag="Dshi_0373"
FT                   /product="acyl-CoA synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /note="PFAM: AMP-dependent synthetase and ligase, good
FT                   swissprot hit to Putative long-chain-fatty-acid--CoA ligase
FT                   from Haemophilus influenzae and high Ref ZP hit to
FT                   AMP-binding enzyme from Rhodobacterales bacterium HTCC2654;
FT                   NCBI conserved domains: COG0318, CaiC, Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92122"
FT                   /db_xref="GOA:A8LMX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX8"
FT                   /protein_id="ABV92122.1"
FT                   /translation="MVDAASVRRLETFPQLLARNAQKFGDKPAYREKEFGIWQSWTWAE
FT                   TQSEIEALAYGLLEMGLAEGDHVALLGPNRPHLYWTMVAVQMCGAVPVPLYHDSVGEEI
FT                   AYVLDHCGARFVVAQDQEQVDKVIEVKDRLPTLEEVIYLDPRGMRKYDHTHLRLFSDVQ
FT                   TIGRGAHAALEKEMAARLARQDGQTTCVMLYTSGTTGRPKGVVLSNDNIILTSKNSGEF
FT                   DHLRQDDDILAYLPLAWVGDFIFSVGQAYWTGFCVNCPESAETMMTDLREIGPTYYFAP
FT                   PRIFETQLTTVMIRMEDAGRIKKWLFDTFMAHARKVGPKILDGEPVGAMDKLTYALGNI
FT                   LVYGPLKNTLGLSRVRVGYTAGEAIGPEIFDFYRSLGINLKQLYGQTEASVFITQQKDH
FT                   EVRADTVGTPTPGVELKIAENGEVFYRSPGVFVRYYKNDESTASTKDAEGWVATGDAGF
FT                   IEPETGHLRIIDRAKDVGKLADGRLFAPKYVENKLKFFPNILEAVVFGADREMCCAFIN
FT                   IDLTAVGNWAERNNIAYASYQELAGHPQVLDTIQKHIAEVNESVAQDEMLSGCQVHRFL
FT                   VLHKELDADDGELTRTRKVRRRIIEEKYADLVTALYDGSPRVSTETEVTYEDGRKGSIK
FT                   ATLEIRDVRVVAAAPQAVAAE"
FT   gene            357902..358156
FT                   /locus_tag="Dshi_0374"
FT   CDS_pept        357902..358156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0374"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains
FT                   detected; normal GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92123"
FT                   /db_xref="GOA:A8LMX9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMX9"
FT                   /protein_id="ABV92123.1"
FT                   /translation="MTLIGVLFFGLGFAASYVIGRRIGKYGDIAQGLSIALCGVGGLLF
FT                   GMPAVLHDGLLLTLVVLGAYGMIGALLFRAGRRARKEQT"
FT   gene            358153..358974
FT                   /gene="livG"
FT                   /locus_tag="Dshi_0375"
FT   CDS_pept        358153..358974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="Dshi_0375"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding protein livG"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase,
FT                   good swissprot to High-affinity branched-chain amino acid
FT                   transport ATP-binding protein from Pseudomonas aeruginosa
FT                   and high Ref ZP hit tobranched-chain amino acid ABC
FT                   transporter, ATP-binding protein from Rhodobacterales
FT                   bacterium HTCC2654; NCBI conserved domains: livG; gene
FT                   arrangement (ABC transporter) with following genes to
FT                   Dshi_0381"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92124"
FT                   /db_xref="GOA:A8LMY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY0"
FT                   /protein_id="ABV92124.1"
FT                   /translation="MNDMSHEGYTTEDGRKIGGVLMEMRNITLKFGGVTAIKDISFDIR
FT                   EGEIRAIIGPNGAGKSSMLNVISGFYVPQEGQVMFRGAPRPKMKPYQVARQGIARTFQN
FT                   IALFEGMSVLDNIMTGRLTHMKSNMLDQAIWWGKAQKEETENREKVEKIIDFLEIQNIR
FT                   KTPVGRLPYGLKKRVELARALAAEPKLLLLDEPMAGMNVEEKEDMSRYILDTNDEFGTT
FT                   IALIEHDMGVVMDLSDRVVVMDYGKKIGDGTPDEVRNNQDVIDAYLGVAHD"
FT   gene            359118..360107
FT                   /gene="livH"
FT                   /locus_tag="Dshi_0376"
FT   CDS_pept        359118..360107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="Dshi_0376"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permease protein livH"
FT                   /note="PFAM: inner-membrane translocator KEGG: rde:RD1_0704
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein, putative, low swissprot hit to High-affinity
FT                   branched-chain amino acid transport system permease protein
FT                   livH from Escherichia coli K12 and high Ref ZP hit to ABC
FT                   branched amino acid transporter family, inner membrane
FT                   subunit from Rhodobacterales bacterium HTCC2654, NCBI
FT                   conserved doma"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92125"
FT                   /db_xref="GOA:A8LMY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY1"
FT                   /protein_id="ABV92125.1"
FT                   /translation="MPDQLLFAMEVTLNGLMAGVMYALVALGFVLIFKASGIFNYAQGV
FT                   MALFAAMTLVGIQNGQVPFAHLINAIFGTNIHYFGWQVPALLAILLTVFVMIGFAWAVN
FT                   RFVLRHLVNQEPIILFMATIGLAYFLEGTADLMWGAEIKKLDVGLPQGLNEAIDETTFN
FT                   LFGYGFFIDNLDISAAIIATVLVSGLVIFSQYTKQGRALRAVADDHQAALSVGISLNFI
FT                   WVLVWSIAGFVALVAGIMWGAKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIG
FT                   MGEQLFEFLIGQPYLGGATQNWFAYVLALVFLVFRPQGLFGEKIIERV"
FT   gene            complement(360124..360432)
FT                   /locus_tag="Dshi_0377"
FT   CDS_pept        complement(360124..360432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0377"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot, no
FT                   conserved domains detected, lies in the middle of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92126"
FT                   /db_xref="GOA:A8LMY2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY2"
FT                   /protein_id="ABV92126.1"
FT                   /translation="MTLARELEDIEARRAAGTLTEADAALAKDALLRGADPAPRRGRNP
FT                   VLLAGLFSNLMLTLVILCGLAAAVFMFVPLTLAMPIMIVLALCLPVIWFWDWFTDLF"
FT   gene            360675..360929
FT                   /locus_tag="Dshi_0378"
FT   CDS_pept        360675..360929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0378"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot, no
FT                   conserved domains detected, lies in the middle of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92127"
FT                   /db_xref="GOA:A8LMY3"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY3"
FT                   /protein_id="ABV92127.1"
FT                   /translation="MMKKFWAIACVIAFTAFWIFGFLALAAMLGERPFDWTSTIIAMVG
FT                   LGLGTYARMQINAMTHDIKKGLHVRPTQGEDPYAEQVHS"
FT   gene            361062..362138
FT                   /gene="livM"
FT                   /locus_tag="Dshi_0379"
FT   CDS_pept        361062..362138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="Dshi_0379"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permease protein livM"
FT                   /note="PFAM: inner-membrane translocator KEGG: sil:SPO3292
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein; middle swissprot hit to High-affinity
FT                   branched-chain amino acid transport system permease protein
FT                   livM from Salmonella typhimurium and high Ref YP hit to
FT                   inner-membrane translocator from Jannaschia sp. CCS1; NCBI
FT                   conserved domains:livM; gene arrangement with Dshi_0375 to
FT                   Dshi_0381"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92128"
FT                   /db_xref="GOA:A8LMY4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY4"
FT                   /protein_id="ABV92128.1"
FT                   /translation="MFYREAGDFKTSYVADSQTFPIAFDRMRYYLVLAVAVGIIPFVIN
FT                   DYWASAVMVPFLIWAIAAIGLNILTGYCGQVSLGTGGFMAVGAYACYKLMTAFPDLNIA
FT                   ICVLLGGVITAAVGVLFGLPSLRIKGFYLAVATLAAQFFLVWLFNKVPWFYNYSASGQI
FT                   NAPERTMFGYAITGPNADAAPKYLFCLAFLFVLAWLARNLTRGTIGRSWMAIRDMDIAA
FT                   EIIGVNPLKAKLTAFAVSSFFVGVAGALFFSVYLGAVEVGEAFGINQSFLVLFMIIIGG
FT                   LGSIFGSLAGAAFIVLLPVLLKNVMVGSLGWDTAIAAHFEFVVLGGLIIFFLIVEPHGL
FT                   ARLWQLAKEKLRLWPFPH"
FT   gene            362188..363468
FT                   /gene="livK"
FT                   /locus_tag="Dshi_0380"
FT   CDS_pept        362188..363468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="Dshi_0380"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system periplasmic binding protein livK"
FT                   /note="pfam01094 Receptor family ligand binding region; bad
FT                   swissprot hit to Leu/Ile/Val-binding protein homolog 3
FT                   precursor from Brucella suis and high Ref ZP hit to
FT                   branched-chain amino acid ABC transporter, periplasmic from
FT                   Roseobacter sp. MED193; gene arrangement with Dshi_0375 to
FT                   Dshi_0381"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92129"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY5"
FT                   /protein_id="ABV92129.1"
FT                   /translation="MKKTLTSMAVAATMVAAPVMADLVYPSLSYRTGPYAAGGIPFADG
FT                   YADYFTLLNERDGGIGGVMTRVLECETGYNTQKGVECYESTKGEGSLVYQPLSTGITYQ
FT                   LIPKATADGIPLHTMGYGRTSAANGTVFSHVFNYPANYWDAASVAVNHLLGEYESLEGK
FT                   TIALLYHNSAYGKEPIRTLEELSAKHGFELTTIAVDHPGQEQKSQWLQIRRERPDYVVM
FT                   WGWGVMNQVAVQEAANIRFPMENFIGNWWAGSENDVIPAGMAADGYKSLAMHSVGDDFP
FT                   IYEDLKTHVFDKGLAAGAGDQHGTVLYNRGLYAAMLAAEATRKAQEIHGVADITPAMMR
FT                   DGMEALEITEARMAELGMPDFGPAFSVSCEDHGGSGAAKIQQWDADTQTWTVISDWIAP
FT                   DAEVINALVTADSEAFAAENNIETRCN"
FT   gene            363531..364355
FT                   /gene="livF1"
FT                   /locus_tag="Dshi_0381"
FT   CDS_pept        363531..364355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF1"
FT                   /locus_tag="Dshi_0381"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding protein livF"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase
FT                   KEGG: jan:Jann_4003 ABC transporter related, good swissprot
FT                   hit to High-affinity branched-chain amino acid transport
FT                   ATP-binding protein livF from Salmonella typhimurium and
FT                   high Ref ZP hit to ABC transporter related protein from
FT                   Roseobacter sp. CCS2, NCBI conserved domains: livF; gene
FT                   cluster from Dshi_0375 to Dshi_0381"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92130"
FT                   /db_xref="GOA:A8LMY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY6"
FT                   /protein_id="ABV92130.1"
FT                   /translation="MLDTGRTEETLLEVNNIEVIYNHVILVLKGVSLTVPKGGITALLG
FT                   GNGAGKTTTLKSISNLLHSERGEVTKGTISYRGDRVQDLSPSDMVKRGVIQVMEGRHCF
FT                   EHLTVEENLLTGAYTRRDGRGAIADDLELVYTYFPRLKERRKSQAGYTSGGEQQMCAIG
FT                   RALMSRPETILLDEPSMGLAPQLVEEIFTIVKNLNEREGVSFLLAEQNTNVALRFAHHG
FT                   YILESGRVVMEGPAAELRENPDVKEFYLGMSDEGRKSFRDVRSYRRRKRWLS"
FT   gene            364512..365732
FT                   /gene="paaK"
FT                   /locus_tag="Dshi_0382"
FT   CDS_pept        364512..365732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="Dshi_0382"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="SSF56801 Acetyl-CoA sythase-like, low swissprot hit
FT                   to Phenylacetate-coenzyme A ligase from Escherichia coli
FT                   K12 and high Ref Yp hit to phenylacetate-CoA ligase,
FT                   putative from Silicibacter sp. TM1040; NCBI conserved
FT                   domains:paaK"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92131"
FT                   /db_xref="GOA:A8LMY7"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY7"
FT                   /protein_id="ABV92131.1"
FT                   /translation="MSPSPYDALETRDAAQRAADLARDLPVQIARAQALPGYADSLAGV
FT                   DPAAITSAAALTDLPVLRKSALTGAQTPDTPLGGFAGPVTGFSHVFQSPGPIYEPGGID
FT                   GDWFRLGRFLHAAGIGRGDLVQNCFGYHLTPAGIMFESGARAVGATVLPAGTGQTELQV
FT                   QAAAHLGATAYAGTPDYLKVILDKADEMGVTLGFAKAAVSGGALFPSLRQAYAERGITC
FT                   LQAYATADLGNIAYESPAMEGLIVDEGVIVEIARPGTGDPLPEGEVGEVVVTSLNPAYP
FT                   LIRFATGDMSAVLPGQSPCGRTNQRIKGWMGRADQTTKIKGMFVRPEQVAALVAAHGEV
FT                   TRARVVAGRDGEMDTMRVLIESPGGDAAAYAASVATHLKLKGAVEVVAPGSLPNDGLVI
FT                   EDTRSYD"
FT   gene            365857..366321
FT                   /locus_tag="Dshi_0383"
FT   CDS_pept        365857..366321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0383"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot, no
FT                   conserved domains"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92132"
FT                   /db_xref="GOA:A8LMY8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY8"
FT                   /protein_id="ABV92132.1"
FT                   /translation="MAESRPVVILATQTDLAALEEDLQRGRRRKLAGFSVQVPGLAPHD
FT                   TLAVQRALDGAYLSRAGAETMAAAVLGAGAALAWGLGPAGLGGSAAALALCLGGVLGAA
FT                   AGRRLGLWAARRRIAGAVARLRRHFTTAGIAPMAVAVPAPEVAGPRCALS"
FT   gene            complement(366443..366901)
FT                   /locus_tag="Dshi_0384"
FT   CDS_pept        complement(366443..366901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1502 NUDIX hydrolase; no
FT                   significant swissprot, bad Ref YP hit to NUDIX hydrolase
FT                   from Burkholderia sp. 383; no conserved domains by Interpro
FT                   Scan, NCBI conserved domains:NUDIX hydrolase 23"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92133"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMY9"
FT                   /protein_id="ABV92133.1"
FT                   /translation="MPQQNRNTDFQGVTLAALHADKVAVTCLPPKARPDAGGPVWTLPQ
FT                   LDRTDGESPADTALRLVRQTLGFPLPVTRLNWPILRLAETDAPDPRPDWFFAAWLSPME
FT                   WEVLSRDGGPRDALMLSIESYLKAPTAIAAQQDSLRHYLRQKKRAPGA"
FT   gene            366959..368212
FT                   /gene="dinB"
FT                   /locus_tag="Dshi_0385"
FT   CDS_pept        366959..368212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="Dshi_0385"
FT                   /product="DNA-directed DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein KEGG:
FT                   rde:RD1_0719 DNA polymerase IV, putative; high swissprot
FT                   hit to DNA polymerase IV from Brucella melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92134"
FT                   /db_xref="GOA:A8LMZ0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ0"
FT                   /protein_id="ABV92134.1"
FT                   /translation="MPSLCRDCQERALQGARCARCGSPRIVAHAELDTLTIAHMDCDAF
FT                   FASVEKRDNPALADRPVIIGGGRRGVVSTACYVARIKGVRSAMPMFKALALCPDAVVIK
FT                   PRFEAYVEASRAIRAMMDEMTPDVEPLSLDEAFMDLGGTARLHGAPPAVMLARLVKRME
FT                   DELGLTGSIGLSHNKFLAKIASDLDKPRGFAVIGKAETLDFLADKPVRMIWGVGAAGQA
FT                   ALEAAGIRTFTDLARWEQTDLVARFGSMGLRLWHLARGEDARAVSGRSPVKSISNETTF
FT                   SEDTADPDLLEGHVWRMAEKVAGRAKAQGLAGRVVVLKLKKSDHGLITRRHALRDATQI
FT                   ADRVFREAMALFRAVPDGQSYRLLGVGLSDLVPEDGGDLSGDLLDPGAVRRARAERATD
FT                   AIRARFGETAIVKGRALR"
FT   gene            complement(368291..369154)
FT                   /gene="hutG"
FT                   /locus_tag="Dshi_0386"
FT   CDS_pept        complement(368291..369154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="Dshi_0386"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /EC_number="3.5.3.8"
FT                   /note="PFAM: N-formylglutamate amidohydrolase KEGG:
FT                   rde:RD1_0718 N-formylglutamate amidohydrolase, putative; no
FT                   signifcant swissprot; good Ref ZP hit to N-formylglutamate
FT                   amidohydrolase family protein from Loktanella vestfoldensis
FT                   SKA53; NCBI conserved domains: hutG"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92135"
FT                   /db_xref="GOA:A8LMZ1"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ1"
FT                   /protein_id="ABV92135.1"
FT                   /translation="MMHTAYTLGLPQPCTTSVIFASPHSGRAYSKDFLRSTVLDTQTIR
FT                   SSEDAFVDELIACAPRYGAQTIAATAPRAYIDLNRNADELDPAVVSGLRRVTHNPRISS
FT                   GLGVVPRVVANGRAIYRGKMHLNEAKARLDAYWHPYHDQLRRMLDVTRNAFGQAILVDC
FT                   HSMPHEAIDALHQHSEARPDVVLGDRFGAASAAHIVDQVEAAFKNAGLRVARNAPFAGA
FT                   FIAQHYGRPSRNQHVVQIEIDRALYMDEETISRGPQFRAFQRLMEQVISEVADFGRASQ
FT                   MPLAAE"
FT   gene            369290..369364
FT                   /locus_tag="Dshi_6005"
FT   tRNA            369290..369364
FT                   /locus_tag="Dshi_6005"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUC"
FT   gene            369431..369556
FT                   /gene="rpmJ"
FT                   /locus_tag="Dshi_0387"
FT   CDS_pept        369431..369556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="Dshi_0387"
FT                   /product="50S ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36 KEGG: jan:Jann_3997
FT                   ribosomal protein L36; NCBI conserved domains:rpmJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92136"
FT                   /db_xref="GOA:A8LMZ2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LMZ2"
FT                   /protein_id="ABV92136.1"
FT                   /translation="MKVKNSLRSLKQRHRDCRVVRRKGRVYVINKTQRRFKARQG"
FT   gene            complement(369763..370548)
FT                   /gene="rbsA5"
FT                   /locus_tag="Dshi_0388"
FT   CDS_pept        complement(369763..370548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA5"
FT                   /locus_tag="Dshi_0388"
FT                   /product="ribose import ATP-binding protein rbsA"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase
FT                   KEGG: sit:TM1040_0370 ABC transporter related; good
FT                   swissprot hit to Ribose import ATP-binding protein rbsA
FT                   from Anabaena variabilis and high Ref ZP hit to sugar ABC
FT                   transporter, ATP-binding protein, putative from Roseobacter
FT                   sp. CCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92137"
FT                   /db_xref="GOA:A8LMZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ3"
FT                   /protein_id="ABV92137.1"
FT                   /translation="MTDTSQQPILAGRNLVKRYGRVTALDHCDFELYPGEILAVIGDNG
FT                   AGKSSLIKAVSGAVIPDEGEVFLEGKRVRFQSPLDARAAGIETVYQQLAMSPALSIADN
FT                   MFMGRELRKPGWRGKWLRQLDRAAMEKFARDKLSELGLMTIQNINQAVETLSGGQRQGV
FT                   AVARAAAFGSKVIILDEPTAALGVKESRRVLELILDVRARGIPIVLISHNMPHVFEVAD
FT                   RIHIHRLGKRLCVIDPKDHDMSDAVAFMTGAKEPESAAA"
FT   gene            complement(370545..371618)
FT                   /gene="rbsC2"
FT                   /locus_tag="Dshi_0389"
FT   CDS_pept        complement(370545..371618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC2"
FT                   /locus_tag="Dshi_0389"
FT                   /product="ribose transport system permease protein rbsC"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator KEGG:
FT                   sit:TM1040_0369 inner-membrane translocator; middle
FT                   swissprot hit to Ribose transport system permease protein
FT                   rbsC from Bacillus subtilis and high Ref YP hit to
FT                   inner-membrane translocator from Silicibacter sp. TM1040"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92138"
FT                   /db_xref="GOA:A8LMZ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ4"
FT                   /protein_id="ABV92138.1"
FT                   /translation="MTEPRPQGQDYESALKDSAAAVAEFDHGPQGFTRKFQHALHQTPA
FT                   LVPLIVLVAAIAVFGLLLGSKFFSPFALTLILQQVQIVGIVAAAQSLVILTAGIDLSVG
FT                   AIMVMSSVVMGQFTFRYGLPVEVAVACGLLCGTLLGFINGWLVAKVKLPPFIVTLGMWQ
FT                   IVLAANFLYSRNETIRSQDIRDQAPLLQFFGTTLEIGGARLTYGVIFMVLLVIVLAYAL
FT                   RHTAWGRHVYAVGDDPEAAELSGVQVSRTLISVYMLSGLICAFAGWALIGRIGSVSPTS
FT                   GQLANIESITAVVIGGISLFGGRGSILGAFFGALIVGVFTLGLRLLGADAQWTFLLIGL
FT                   LIIAAVAVDQWIRKVSV"
FT   gene            complement(371715..372728)
FT                   /gene="rbsB3"
FT                   /locus_tag="Dshi_0390"
FT   CDS_pept        complement(371715..372728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB3"
FT                   /locus_tag="Dshi_0390"
FT                   /product="D-ribose-binding periplasmic protein precursor"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator KEGG: sit:TM1040_0368 periplasmic
FT                   binding protein/LacI transcriptional regulator; low
FT                   swissprot hit to D-ribose-binding periplasmic protein
FT                   precursor from Salmonella typhimurium and high Ref YP hit
FT                   to periplasmic binding protein/LacI transcriptional
FT                   regulator from Silicibacter sp. TM1040; NCBI conserved
FT                   domains:rbsB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92139"
FT                   /db_xref="GOA:A8LMZ5"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ5"
FT                   /protein_id="ABV92139.1"
FT                   /translation="MKNLMLGTALACATMSGAALADTTSACLITKTDTNPFFVKMREGA
FT                   VAKAEELGVELKTFAGKFDGDHETQVQAIETCILDGAKGILITASDTSSITGAVQQARD
FT                   AGLVVIALDTPLTPADAADATFATDNYVAGLLIGQWARAQMGDAAADAKIAMLNIQVSQ
FT                   PTVGVLRNQGFLEGFGIDIGDPNRWGDETDPRIVGQDVTQGSEEGGRAAMENILAADPM
FT                   VNVVYTINEPAAAGAYEALKAIGRENDVLIVSVDGGCPGVQNVADGVIGATSQQYPLLM
FT                   ASLGIEAIKTWAETGEKPAPTPGKDFFDTGVALVTDTPADGVESISVEEGRNLCWG"
FT   gene            373482..374943
FT                   /locus_tag="Dshi_6006"
FT   rRNA            373482..374943
FT                   /locus_tag="Dshi_6006"
FT                   /product="16SrRNA"
FT   gene            375220..375296
FT                   /locus_tag="Dshi_6007"
FT   tRNA            375220..375296
FT                   /locus_tag="Dshi_6007"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            375472..375547
FT                   /locus_tag="Dshi_6008"
FT   tRNA            375472..375547
FT                   /locus_tag="Dshi_6008"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            376000..378915
FT                   /locus_tag="Dshi_6009"
FT   rRNA            376000..378915
FT                   /locus_tag="Dshi_6009"
FT                   /product="23SrRNA"
FT   gene            379112..379229
FT                   /locus_tag="Dshi_6010"
FT   rRNA            379112..379229
FT                   /locus_tag="Dshi_6010"
FT                   /product="5SrRNA"
FT   gene            379296..379372
FT                   /locus_tag="Dshi_6011"
FT   tRNA            379296..379372
FT                   /locus_tag="Dshi_6011"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            379683..382190
FT                   /locus_tag="Dshi_0391"
FT   CDS_pept        379683..382190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0391"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, high Ref ZP hit to
FT                   hypothetical protein MELB17_00320 from Marinobacter sp.
FT                   ELB17; pfam02810 SEC-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92140"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ6"
FT                   /protein_id="ABV92140.1"
FT                   /translation="MSVTRKNHYVPQWHQERFFAPGRTTHFLLDLKPPTFKRRDGTLAS
FT                   GRCLFDSPTSRAFVAQDLYSTFFGVEVNDEIEKMFFGDIDRRGADAVRAFCGDDQGAWH
FT                   QHFEDLFEFLDIQKLRTPKGLAWLRQQYPEIGRLGEMLPGVAQNQLMAEMQSIRMLNVT
FT                   TWTTGVREIVSAEQAGAKFILSDHPVTVYNHAIPPSDARNRYPEDPSSALKGSQTLFPL
FT                   GPDHLLILTNLEYAKTPETCPNAKRTFARNYQSTMVSTIEFIKDRYLTDEQVAEVNFVI
FT                   KARADRYVAGSSREDIFPEKVVSKSWADLRTTFLPPADKLYRYGGEMYARFESGDVYYQ
FT                   DKFGRTEKPREWLLKEEPKTPPRPRDYCPCGSGLSFGKCCRDKPVHLRTSWTEKSIRER
FT                   NMMFMDALTQLFELGTKDWDTIRREMTDEKIARMYRLYEALWPLETDLLALLPKPDGKM
FT                   RSVYTGSLHPKLIIEFALGAPLYFGEVIVQNPFLISRTLQKDKRPTEHPRQYRGEALKT
FT                   LMTFFQLMPLVEAGLVRLIPDPCDFDLHLRDQMMAMAQARSHDIKFVPSDDPRLEAVMQ
FT                   EDLRRTMLYWPKEALAERILKTAEVDEPIETDTLVGIIEQMKVKDELAILQNDPFAEGG
FT                   QFEIMKMAPNFEIAMYLAQATGAQILTDSPFRWRELDAALARRHLGTSPALIQLQREIS
FT                   STPVEFPVGHQAILQVFDDPSFRGTESLFHAAFAYTSARTADKLKPNFEAHLAARFRRQ
FT                   RDSMKSLITSTKIPAVAARLSTAFRFGGFQDNTINRLLLMSGSEHHLHSVPMATLIERW
FT                   DAAPQADTVKSRATLRPERNRGL"
FT   gene            complement(382289..383437)
FT                   /locus_tag="Dshi_0392"
FT   CDS_pept        complement(382289..383437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, high Ref hit to
FT                   hypothetical protein TM1040_3581 from Silicibacter sp.
FT                   TM1040; no conserved domains, unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92141"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ7"
FT                   /protein_id="ABV92141.1"
FT                   /translation="MGAEILHVGFDGLKVTVQADIPLALQNQFSQAKTQCRKTNSECIV
FT                   QIGDTAFSMTPKGARGFACHTGDLGAVWMFQDPLDRVPHNPGIIVDFRAFGLATGGLGQ
FT                   AEDHFRRVTEDLRIRYSDQLMRISRVDVAVDMLAPWFEPDRTALVVPPGTKVTEYTGID
FT                   ETATQATGARVTGLRAGAVSNRQLAIYDKRLEVMKTGKLGWLEIWNKTRNKQGNGPLNL
FT                   RERDKSLVWRFELRLGSKQLRNQFELHSWDDLRAGIGDAYRDAFSRIRYCSPTQDTNRS
FT                   RWPSHELWRKFSDTVQENLADHSCGLVPTDIIYANKLAKIRQLDAQLMGLFLTRAAISD
FT                   VQETDLPAFMERHVEALLEYAKDHPQTLAERLQKAGSKYRWN"
FT   gene            complement(383697..383918)
FT                   /locus_tag="Dshi_0393"
FT   CDS_pept        complement(383697..383918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0393"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, bad
FT                   Ref Yp hit to hypothetical protein TM1040_3583 from
FT                   Silicibacter sp. TM1040, bad GC frame plot, CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92142"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ8"
FT                   /protein_id="ABV92142.1"
FT                   /translation="MRDLLDPEQSGQAPAFLDEVAVADMLCQSVRTIQKWRVTGYGPAF
FT                   YKLGRSVRYRQDEVLGWADARRRAHTSE"
FT   gene            complement(383978..384751)
FT                   /locus_tag="Dshi_0394"
FT   CDS_pept        complement(383978..384751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0394"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, bad
FT                   GC frame plot; bad Ref Yp hit to hypothetical protein
FT                   TM1040_3584 from Silicibacter sp. TM1040; CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92143"
FT                   /db_xref="UniProtKB/TrEMBL:A8LMZ9"
FT                   /protein_id="ABV92143.1"
FT                   /translation="MNGLFANKEFLALLQLEEIRKRKYFSEALSSSIEREFGIPSDTSS
FT                   TVFLSLECGALLYWNLRKQDHANKKTVRKDLDRLTQKASELADMLSIMTGEAWRAIDSF
FT                   QLAHDLSPALYPDQRGSKSSDAEATPPRLTKGDVVDLAAKLSALAETTKIATRMVGKGR
FT                   VGRPEDDATLHLLHAAFQVWEAILRRPFKLDWTGDSEPITDAARFCVRIAQVVDPTISF
FT                   GRIANASRTVREKSMAVSDLGLTPEIMKHYRKQFG"
FT   gene            complement(384765..385958)
FT                   /locus_tag="Dshi_0395"
FT   CDS_pept        complement(384765..385958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0395"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: integrase family protein KEGG: sit:TM1040_3585
FT                   phage integrase; COG4974 - Site-specific recombinase XerD;
FT                   high Ref YP hit to phage integrase from Silicibacter sp.
FT                   TM1040 and bad swissprot hit to Putative prophage CPZ-55
FT                   integrase from Escherichia coli K12; bad GC frame plot,
FT                   CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92144"
FT                   /db_xref="GOA:A8LN00"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN00"
FT                   /protein_id="ABV92144.1"
FT                   /translation="MPKLTKRLVESLTVESRDYFVWDDEVKGFGVRVMRSGTRTYQVQY
FT                   RKGGRTRRASIGRHGTVTVQQARQRAKELLGDVASGGNPVEEISQHRRASTVAALCERF
FT                   FEAHVMERCKPSTQREYRRSIDFFINPAIGTFKVVDVERRDIAELHHKLRDKPYQANRT
FT                   LGVLSKMFNLAEVWGLRPDGSNPCRHVPKYRERKRERYLSQAELRRLGEVLADCERSGS
FT                   ESPYVVAAFKLLILTGCRLGEIQTLRWDYLTPNGMELPDSKTGARRIPLPSAARAVLDA
FT                   LPHDPGNPYVIAGRIEGQHITDLQHPWRRIRDLAGLNDVRIHDLRHTYASNAVSSGMPI
FT                   QMVGRLLGHTQLQTTMRYAHLADDPVRKAAEENAAALSEGLGLGLRARTTPLRVVKG"
FT   gene            complement(386137..387813)
FT                   /locus_tag="Dshi_0396"
FT   CDS_pept        complement(386137..387813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0396"
FT                   /product="recombinase"
FT                   /note="PFAM: Resolvase domain; Recombinase KEGG:
FT                   pde:Pden_3123 recombinase; COG1961 - Site-specific
FT                   recombinases, DNA invertase Pin homologs; bad swissprot hit
FT                   toPutative DNA recombinase from Bacillus subtilis and high
FT                   Ref ZP hit toResolvase, N-terminal:Recombinase from
FT                   Paracoccus denitrificans PD1222; bad GC frame plot, CRISPR
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92145"
FT                   /db_xref="GOA:A8LN01"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN01"
FT                   /protein_id="ABV92145.1"
FT                   /translation="MGPSSVPNRKARPMRAAIYARYSTDLQSDSSIEDQHRLCARLITS
FT                   NGWREAETYSDRGLSGASHLRPAYQRLLEDARGNAFDIVVAEGLDRISRDQEHIAAFFK
FT                   QMRFQGIPVFTVAEGEISELHIGLKGTMSSLFLKDLAQKTHRGLEGRVRKGKSAGGVTF
FT                   GYDVLRQMQADGTLATGERAINPDQAEVVRRILEDYKNGLSPRAIASTLNAEGVPGPRG
FT                   TWGASTIYGNHQRGTGILNNELYIGRLVWNRQRFIKDPATGKRQARPNPPDAWVIEDVP
FT                   HLRIVDEDLWDAVKARQLQTRNMAISDGIKKLGRARRARHLFSGMLKCGRCGGGFVQVG
FT                   SQFYGCASVRNKGTCDNRLTIRREDLEARILSGLKEQLLQPDLIAEYVRAYQEEFNRLA
FT                   GTVRKERAQNARKLAAVNRQIDQIVDAIAQGMFHISMKDKMTALEAEKLRLEQELRETE
FT                   EESPVLIHPGLADRYRAQVESLEGALADPQRSVEAADAIRSLLSEIRLVPEADGLTIEL
FT                   VGELAGLLGLGGIQNANDRPKAVCSTSMVAGVGFEPTTFRL"
FT   gene            complement(387910..388986)
FT                   /gene="xerDC2"
FT                   /locus_tag="Dshi_0397"
FT   CDS_pept        complement(387910..388986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerDC2"
FT                   /locus_tag="Dshi_0397"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein ; low swissprot hit
FT                   to Tyrosine recombinase xerD from Bacillus subtilis and
FT                   middle Ref EDP hit to phage integrase from alpha
FT                   proteobacterium BAL199; NCBI conserved domains: xerDC;
FT                   CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92146"
FT                   /db_xref="GOA:A8LN02"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN02"
FT                   /protein_id="ABV92146.1"
FT                   /translation="MSDAIPLVLRFSDWPQADRSAWEDLFAEGDIFDGTGPCASWSEGS
FT                   RIKRRQSYGQWLSWLARHRPALLEHPPADRVTRDAVRGFMDELEARVQIGTIKNLINDL
FT                   YVVTRALQPSTDWGWLNTVSRRLMHRADRKSLPAAPPLSAGEVLAKCLAALEEVETSRH
FT                   TSEMKRAIRFREALMVGFLISRPVRRRTLLSMTTDRHVRRVGTGFEVHFSAEDMKDKKD
FT                   RWFPLPKVLVGPMEVYLTTYRVRLLGGADTKALWINRYGGAITPDGLSRQFPKVTERLL
FT                   GHALRPHAFRTIAATSIAEQDPEHVNIIRDILGHATLDMAEKHYNRATGLSACSEYQDL
FT                   VQATLKRLSGKRPKVRQT"
FT   gene            complement(388979..390658)
FT                   /gene="xerDC1"
FT                   /locus_tag="Dshi_0398"
FT   CDS_pept        complement(388979..390658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerDC1"
FT                   /locus_tag="Dshi_0398"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; COG4974 -
FT                   Site-specific recombinase XerD; bad swissprot hit to
FT                   Tyrosine recombinase xerC from Pseudomonas aeruginosa and
FT                   good Ref ZP hit to phage integrase from Roseovarius sp.
FT                   HTCC2601; CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92147"
FT                   /db_xref="GOA:A8LN03"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN03"
FT                   /protein_id="ABV92147.1"
FT                   /translation="MTHHRSFKLPTSLADILEALEAHPDPDQKRQSARQSAISRVSKYL
FT                   HRPPSDIPTDIPQLRRLLETLHPVRCGVKPKSLSTLRTDLAAALRATGVLQDRETAQPL
FT                   TPPWDRFLASVHSSHQVWGLHRFARYCSARSIQPEDVNTEVVEAFRAELDATLLTRDPD
FT                   KHVKSMIDTWNHVIRRSGLDLPVLKRAPSTRYLARPLSDYPASLQKEIQDYLDRVSHRD
FT                   LFSDDGPDKPLRETSLRNIKAHLRQILDALISVGHEPSEFTQLAEVITADNLKTAFRKM
FT                   KARRGGDDIPSGLGNIAGTAIAIARHHLNAPEEQIKALKAIQKRVAGSAVGMSSKNRKR
FT                   LAQFNSWDNLEQLISLPSTLMSRAQERPLSRDSALAAMHAAALAILLGCPMRIKNLAGL
FT                   DLDRHLLPQRSGTHTLYTIRIEGVEVKNSEPIEVRLNAGSSKLLHRYIMQFRSQVSRAD
FT                   GRALFPRMSDGKPRCPSNFGGELTQRVQRETGLSVNPHLFRHVAAKMYLEECPGNFEVV
FT                   RRLLKHKRLQTTMDFYAELSNQWAHDHYDKVVLSKWRGKIDV"
FT   gene            complement(390817..391029)
FT                   /locus_tag="Dshi_0399"
FT   CDS_pept        complement(390817..391029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0399"
FT                   /product="DNA binding domain protein"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family
FT                   PFAM: regulatory protein MerR; NCBI conserved domains:
FT                   HTH_MerR-trunc; bad Ref YP hit to DNA binding domain,
FT                   excisionase family from Alkaliphilus oremlandii OhILAs and
FT                   bad swissprot hit to Gene 36 protein from Mycobacterium
FT                   phage D29; bad GC frame plot; Dshi_0400 to Dshi_0402
FT                   CRISPRs; excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92148"
FT                   /db_xref="GOA:A8LN04"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN04"
FT                   /protein_id="ABV92148.1"
FT                   /translation="MTDWPFPPNAPYLSVKEVAQVFRICPKTVRRWIASGQLPATRLGR
FT                   DWRIARSDLRALAAARGKTGLADVL"
FT   gene            391798..395037
FT                   /locus_tag="Dshi_0400"
FT   CDS_pept        391798..395037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0400"
FT                   /product="CRISPR-associated protein"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family ; no
FT                   significant swissprot, high Ref YP hit to CRISPR-associated
FT                   protein, Csn1 family from Verminephrobacter eiseniae
FT                   EF01-2; Csn1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92149"
FT                   /db_xref="GOA:A8LN05"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN05"
FT                   /protein_id="ABV92149.1"
FT                   /translation="MRLGLDIGTSSIGWWLYETDGAGSDARITGVVDGGVRIFSDGRDP
FT                   KSGASLAVDRRAARAMRRRRDRYLRRRATLMKVLAETGLMPADPAEAKALEALDPFALR
FT                   AAGLDEPLPLPHLGRALFHLNQRRGFKSNRKTDRGDNESGKIKDATARLDMEMMANGAR
FT                   TYGEFLHKRRQKATDPRHVPSVRTRLSIANRGGPDGKEEAGYDFYPDRRHLEEEFHKLW
FT                   AAQGAHHPELTETLRDLLFEKIFFQRPLKEPEVGLCLFSGHHGVPPKDPRLPKAHPLTQ
FT                   RRVLYETVNQLRVTADGREARPLTREERDQVIHALDNKKPTKSLSSMVLKLPALAKVLK
FT                   LRDGERFTLETGVRDAIACDPLRASPAHPDRFGPRWSILDADAQWEVISRIRRVQSDAE
FT                   HAALVDWLTEAHGLDRAHAEATAHAPLPDGYGRLGLTATTRILYQLTADVVTYADAVKA
FT                   CGWHHSDGRTGECFDRLPYYGEVLERHVIPGSYHPDDDDITRFGRITNPTVHIGLNQLR
FT                   RLVNRIIETHGKPHQIVVELARDLKKSEEQKRADIKRIRDTTEAAKKRSEKLEELEIED
FT                   NGRNRMLLRLWEDLNPDDAMRRFCPYTGTRISAAMIFDGSCDVDHILPYSRTLDDSFPN
FT                   RTLCLREANRQKRNQTPWQAWGDTPHWHAIAANLKNLPENKRWRFAPDAMTRFEGENGF
FT                   LDRALKDTQYLARISRSYLDTLFTKGGHVWVVPGRFTEMLRRHWGLNSLLSDAGRGAVK
FT                   AKNRTDHRHHAIDAAVIAATDPGLLNRISRAAGQGEAAGQSAELIARDTPPPWEGFRDD
FT                   LRVRLDRIIVSHRADHGRIDHAARKQGRDSTAGQLHQETAYSIVDDIHVASRTDLLSLK
FT                   PAQLLDEPGRSGQVRDPQLRKALRVATGGKTGKDFENALRYFASKPGPYQAIRRVRIIK
FT                   PLQAQARVPVPAQDPIKAYQGGSNHLFEIWRLPDGEIEAQVITSFEAHTLEGEKRPHPA
FT                   AKRLLRVHKGDMVALERDGRRVVGHVQKMDIANGLFIVPHNEANADTRNNDKSDPFKWI
FT                   QIGARPAIASGIRRVSVDEIGRLRDGGTRPI"
FT   gene            395098..396009
FT                   /locus_tag="Dshi_0401"
FT   CDS_pept        395098..396009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0401"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1 KEGG:
FT                   vei:Veis_1231 CRISPR-associated protein Cas1, no
FT                   significant swissprot, good Ref YP hit to CRISPR-associated
FT                   protein Cas1 from Verminephrobacter eiseniae EF01-2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92150"
FT                   /db_xref="GOA:A8LN06"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN06"
FT                   /protein_id="ABV92150.1"
FT                   /translation="MDQIVDIATDGRHLSRDRGFLKVSEGAREIGRIPLDQIAGVIVHA
FT                   HGTTWTTSLLTELADRGAPVVLCGANHAPRSVLMPLDGHHAQGARLRAQWQARAPLVKQ
FT                   AWKQTVIAKIAMQAAALEAMGEPHAPVGMLARKVTSGDATNVEAQAARLYWPRMMGTEF
FT                   RRDRTAPDLNALLNYGYTVLRAATARAVVAAGLHPTIGLHHSNRGNAFALADDLMEPFR
FT                   PLVDCCVRGLAARNGPQVDPAAKQSLARLIALDLPLGDSLTPVSVALGKLAISLGQSFE
FT                   SGTLDLALPAPPDALTLAGLGA"
FT   gene            396006..396350
FT                   /locus_tag="Dshi_0402"
FT   CDS_pept        396006..396350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0402"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2 KEGG:
FT                   vei:Veis_1232 CRISPR-associated protein Cas2; no
FT                   significant swissprot; low Ref YP hit to CRISPR-associated
FT                   protein Cas2 from Verminephrobacter eiseniae EF01-2"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92151"
FT                   /db_xref="GOA:A8LN07"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN07"
FT                   /protein_id="ABV92151.1"
FT                   /translation="MTDAPAFLSGYRIMWILVMFDLPTDTKSQRKAATAFRNFLLDEGF
FT                   ERSQFSVYARFVNGKEAFQTRVRRIERNLPEKGDIQVLNFTDRQYRDIVHFSDQGRRAA
FT                   RKNPEQLALF"
FT   gene            397989..398255
FT                   /locus_tag="Dshi_0403"
FT   CDS_pept        397989..398255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0403"
FT                   /product="insertion element ISR1 uncharacterized 10 kDa
FT                   protein A3"
FT                   /note="PFAM: transposase IS3/IS911 family protein; NCBI
FT                   conserved domains: transposase_8; middle Ref ZP hit to
FT                   Insertion element ISR1 hypothetical 10 kDa protein A3 from
FT                   Sagittula stellata E-37; middle swissprot to Insertion
FT                   element ISR1 uncharacterized 10 kDa protein A3 from
FT                   Rhizobium sp."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92152"
FT                   /db_xref="GOA:A8LN08"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN08"
FT                   /protein_id="ABV92152.1"
FT                   /translation="MKRSRFTEEQIIGMLKEQEAGMTTADVCRKHGVSTATFYKYKARF
FT                   GGLEVSDARRLRALEDENAKLKKLLAEAMLDNAILKDVTSRKW"
FT   gene            398279..399088
FT                   /locus_tag="Dshi_0404"
FT   CDS_pept        398279..399088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0404"
FT                   /product="integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region KEGG: bbt:BBta_7691
FT                   integrase, catalytic domain; good swissprot hit toInsertion
FT                   element IS476 uncharacterized 39.2 kDa protein from
FT                   Xanthomonas euvesicatoria; high Ref Yp hit to Integrase
FT                   catalytic region from Xanthobacter autotrophicus Py2;
FT                   downstream of CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92153"
FT                   /db_xref="GOA:A8LN09"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN09"
FT                   /protein_id="ABV92153.1"
FT                   /translation="MAHVVEVHGVSQRRAGKALAVDRSSVRYRSVRPDDAEARAAMKAV
FT                   AAERRRFGYRRIHVMLERQGIMMNLKKLRRLYREEKLQVRRRGGRKRALGTRWPMLVPD
FT                   APNQHWSLDFVSDALTDGRQFRVLAVVDDYSRECLALVADTSLSGLRVVRELDALMLRR
FT                   GQPAMVVSDNGTELTSVAVLSWCQRTGIEWHYIAPGKPMQNGFVESFNGRFRDELLNES
FT                   LFSSLADAREQIRAWQHDYNHHRPHSGLGNIPPVEFVAKKGLEMRAA"
FT   gene            complement(399227..400612)
FT                   /locus_tag="Dshi_0405"
FT   CDS_pept        complement(399227..400612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0405"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains,
FT                   unsure GC frame plot, downstream of CRISPR region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92154"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN10"
FT                   /protein_id="ABV92154.1"
FT                   /translation="MEEVLAGFAEAEAADPVRLRMELMAPSADGAASHASGIALAAWVW
FT                   PGFSGSDGIVFHSERQVRNLVQDECLHVGRDDQGRLCLEPGGGYSVARVVFEIEGVHVP
FT                   FDLPWPDVTVSRRRAEGSVAQLPHGTRLSVGEDDRFDTISIRCPDQKAQLIIRGRREER
FT                   PFYGGLTRSLAVRDLLAPASDERVLLQRGNGSEVLLFELVAALAPQAINLLPARNAIRL
FT                   QLKFGDPVDAVAVEVENETGAVVFAEAALRHRPVATRRPDWFHAELNDNDAHGLELTLD
FT                   ADWIDDGPCLARLLIRPEGRDGWRPLRNSRGDSFAVAIANPAAEGFVQDGELQRRFEAL
FT                   SRWLSDCYAAECWPTLERTLVPRWQELGCRLRELRGGDGAVMRAACLPPPDHAAPDWVP
FT                   ILHPLQFAPDLYAAAPQAFAALAASVDPDVAEMAALATLNTARLHPNSITDLHATAISM
FT                   TAL"
FT   gene            complement(400543..401841)
FT                   /locus_tag="Dshi_0406"
FT   CDS_pept        complement(400543..401841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0406"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92155"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN11"
FT                   /protein_id="ABV92155.1"
FT                   /translation="MGGRPDRLQALFRGFPSLAAWLVTHSLSEGYGDAGNAVYPHIADV
FT                   LQVPLDFQPHRKVLFRSFCAVCDRFGLPTRGLDRDVDVYLLHAGVSQAQLPHLIDAFLR
FT                   QEAAFGPPPVETTVLLNRWEDDALYFLPPAVNVLRRAILWDETAWHAALFARIRQDPEA
FT                   FVPAIEFERSFKEVFDQRLKETRPTLSRGGSEALAPRPRLHWQSGGLVLRLPRSEGRIR
FT                   LWLDGAQRPRRLRGGEDWTLPQPWPRELRWEVSGQTGELELLAQGGCAAFDRITGHYLR
FT                   EIPRGSVDIELDSTDIVLLARTPFSIAGEPALEPEADSFVGFAVLGPRPLVLELDGLQT
FT                   GLTARPRRRLCLAGDEIASGPRGALHGRSARLRIETGLGRSETRAVRFTLGLQSRLIGV
FT                   PISDDGFGDVGWKRCSLALRRLRQQTLCGSGWN"
FT   gene            402104..402430
FT                   /locus_tag="Dshi_0407"
FT   CDS_pept        402104..402430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0407"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: helix-turn-helix domain protein KEGG:
FT                   nmu:Nmul_D2824 transcriptional regulator, XRE family; no
FT                   significant swissprot, middle Ref YP hit to transcriptional
FT                   regulator, XRE family from Nitrosospira multiformis ATCC
FT                   25196; XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92156"
FT                   /db_xref="GOA:A8LN12"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN12"
FT                   /protein_id="ABV92156.1"
FT                   /translation="MSADGVTFGQAISKARKALGLSQKELAARVMKEEGGGSISPQYLN
FT                   DIEHDRRSPSSGHLIRQFSGILNIPEDYLYALAGRLPDDLRPDASTPDKVVEAFANFRK
FT                   TLKE"
FT   gene            402441..403163
FT                   /locus_tag="Dshi_0408"
FT   CDS_pept        402441..403163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0408"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955 KEGG:
FT                   nmu:Nmul_D2822 hypothetical protein; no significant
FT                   swissprot; middle Ref YP hit to hypothetical protein
FT                   Nmul_D2822 from Nitrosospira multiformis ATCC 25196"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92157"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN13"
FT                   /protein_id="ABV92157.1"
FT                   /translation="MVKMIRDNTGRFAERPFYRERDLDDECERLIRELLMKRHGKVDYP
FT                   VETDDLTVLIEMHDAGLDPYADLFAYGADVEGVTEFFPDRGPKVSISERIAADERRENR
FT                   FRTTLTHEFGHVKFHGPLWAQKFANGDLLERGVNAKKALSKRENILDAPQSDWMEWQAG
FT                   YISGALLMPATPVRRLMSDYCSPRELHSDIHVSTEHAARLIQMVMERFAVSEEAARIRL
FT                   LKLNLITSARGQPSLFGP"
FT   gene            403268..403912
FT                   /locus_tag="Dshi_0409"
FT   CDS_pept        403268..403912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1958 hypothetical protein; no
FT                   significant swissprot, middle Ref YP hit to hypothetical
FT                   protein Nwi_1958 from Nitrobacter winogradskyi Nb-255, no
FT                   conserved domains detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92158"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN14"
FT                   /protein_id="ABV92158.1"
FT                   /translation="MATALSAFLRKTPGEALREYFDRPEIGLPTEFDWPASDAELSGPL
FT                   LGAIEKMSRVQRDRISNDAERVHALSDEPGQAAIYSVAEDPALLGGLANPHARSLWIFL
FT                   NAQDRFSHAEEVRFTEDRRRGRMWAGYITEPGSVVQRNALARYAFVSANKEFSGAAHAH
FT                   VDNFDRVRTTHALQGQRAHVGADGRSVRGQGTVSRARGLRLARLQVPRLHH"
FT   gene            complement(404246..405190)
FT                   /locus_tag="Dshi_0410"
FT   CDS_pept        complement(404246..405190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0410"
FT                   /product="hypothetical protein"
FT                   /note="good Ref Yp hit to hypothetical protein RD1_0494
FT                   from Roseobacter denitrificans OCh 114; no significant
FT                   swissprot; short signalpeptide and two transmembrane
FT                   regions; unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92159"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN15"
FT                   /protein_id="ABV92159.1"
FT                   /translation="MVTRTRRHILGLFGATLCSASCAPAIVSRDPNDPFEGGIGGTGIV
FT                   GTLTGFGSLRINGLRVRRDGRTRYRTPYGITTGEILAPGHVLTIAAMRDASGILAREVS
FT                   VDFALVGVLREDAGRLSVNGVPLMDPVAARGDGAPGTRVAVSGLWTAQGLRPSRIDPAP
FT                   TGTQDLIAGTVGRSPDGTGTIGGLPISSAATPPASGAYATAFGRANTERFLAERVHSGR
FT                   FARLSNLRLLSVEGYLEPAPSAPGLRIAGLGHNFATDVRAAAIGDRRALYFGRYTGRFA
FT                   AARGYLLPEDATARARLLRNGIQAEFPGPVLDL"
FT   gene            complement(405174..406022)
FT                   /locus_tag="Dshi_0411"
FT   CDS_pept        complement(405174..406022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="good Ref YP hit to hypothetical protein RD1_0495
FT                   from Roseobacter denitrificans OCh 114; no significant
FT                   swissprot; no NCBI conserved domains; PS00092 N-6
FT                   Adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92160"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN16"
FT                   /protein_id="ABV92160.1"
FT                   /translation="MEQDSQRFLKVMRGLMRPIVRTLIARGVTAPAFYKLLKSVYVEIA
FT                   HDAFRIGSEPPTDSRITLLTGVHRRDVRAILSQGGERWESARAKSAMFATVLGQWMARA
FT                   DYRDDTGAPRPLPRTAESGPSFEALVRAINTDIRPRTVLDELLRQGLVTEDAEGRLRIS
FT                   DTARRGPASDADRLVFFAANVGDHIAAASENLMAEDPPFFERAVFYNRLPSEAVDRIED
FT                   RARTLSQDLLETLNAESLSQRAADTTPEDGTERYRLGIYFYREADTPAQEPTRDDGGDK
FT                   N"
FT   gene            406254..407786
FT                   /gene="fas"
FT                   /locus_tag="Dshi_0412"
FT   CDS_pept        406254..407786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fas"
FT                   /locus_tag="Dshi_0412"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; Hemolysin-type
FT                   calcium-binding region KEGG: pde:Pden_0560 hemolysin-type
FT                   calcium-binding region; NCBI conserved domains: Fasciclin;
FT                   middle Ref YP hit to Beta-Ig-H3/fasciclin from Ralstonia
FT                   eutropha JMP134; no significant swissprot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92161"
FT                   /db_xref="GOA:A8LN17"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN17"
FT                   /protein_id="ABV92161.1"
FT                   /translation="MTRFSTKLPNIVAIAAGSDDFNLLVKALTAADLVGTVQGLKDITV
FT                   FAPTDAAFTQLAVDLGFAGDTGDEDAVFASLVASLTELGGGDPIPLLTDVLLYHVSAGA
FT                   KTAAEIDALEVVGTFLPGATFGSEGTELVDNEPDVANPNIVIPDIAASNGTIQAIDRVL
FT                   LPIDIPGNEPPAPTETLAGIVAASGGVFDGDKSDFDLLLNAVQAAGLVGALDDPEADLT
FT                   VFAPNDAAFIGLAQTLGFDGEDEGAAFAHIVEALTLLSGGGDPIPLLQDILLYHVVPEA
FT                   LGSDAVLSAESIPTLLGAPLGVDGVSLVDADPDIGDPALIETDIAATNGIAHVLDGVLL
FT                   PADILNGDGGRGRVDFEIGDAGNERFFTGANTDFVSGLGGNDVIRLGAGDDVGLGGAGN
FT                   DTLQGGRGADTLDGGAGRDVLKGGLGDDLLTGGADADVFLFNGFSGADTITDFSLGEDL
FT                   LQIRARGIDDYGDLAHRISDSDAGAVIAFGGTEITLAGIGADALTASDFQFI"
FT   gene            407836..408195
FT                   /locus_tag="Dshi_0413"
FT   CDS_pept        407836..408195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame Plot, no
FT                   conserved domains detected by InterPro Scan; NCBI conserved
FT                   domains: COG1373 - Predicted ATPase (AAA+ superfamily);
FT                   middle Ref ZP hit tohypothetical protein RTM1035_00450 from
FT                   Roseovarius sp. TM1035"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92162"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN18"
FT                   /protein_id="ABV92162.1"
FT                   /translation="MHAEAGVALLGPRRVGETTLGLDLSEIRETFYSDMARTADRQILD
FT                   EPDVYLDELLGKLVVIDEVQSIPGRFCAPGAQIARPTAEHRTGQFLLLGSTSNTLLQQS
FT                   AELLMVRASHHDLTF"
FT   gene            complement(408427..408873)
FT                   /locus_tag="Dshi_0414"
FT   CDS_pept        complement(408427..408873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0414"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: pde:Pden_4724 GreA/GreB family elongation
FT                   factor; bad swissprot hit to Transcription elongation
FT                   factor greA from Brucella suis; middle Ref ZP hit to
FT                   putative nucleoside diphosphate kinase regulator from
FT                   Oceanicola batsensis HTCC2597; NCBI conserved domains:
FT                   PRK05753, nucleoside diphosphate kinase regulator and
FT                   GreA/B"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92163"
FT                   /db_xref="GOA:A8LN19"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN19"
FT                   /protein_id="ABV92163.1"
FT                   /translation="MPDTRSRPQAAPKPKGRRPRIVINADDLSHIEALAEGAMDRNPAL
FT                   ADRLLEEIARARIVPAAKMPLNVIGIGKSATFRDETTGQERTVTLVYPEDADISRARVS
FT                   VMTPIGVALLGLAEGAVFHWNTRGEERRMLTVIRVSDPAAPESA"
FT   gene            409020..409262
FT                   /locus_tag="Dshi_0415"
FT   CDS_pept        409020..409262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0415"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains;
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92164"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN20"
FT                   /protein_id="ABV92164.1"
FT                   /translation="MPVLSVGDVLQILDIGHALAPQRSDVAIVLRKIEDPRMGSEALAP
FT                   TPSGEAGGSEEELEVQLRHLRYCGGKYSSAIGQSA"
FT   gene            409608..409919
FT                   /locus_tag="Dshi_0416"
FT   CDS_pept        409608..409919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0416"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; bad Ref
FT                   ZP hit to hypothetical protein OB2597_05265 from Oceanicola
FT                   batsensis HTCC2597; no significant swissprot, unsure GC
FT                   frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92165"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN21"
FT                   /protein_id="ABV92165.1"
FT                   /translation="MEDVMSVFITREMIASNTPTAPRSAEPGVIGRFMQRAARQWRDRR
FT                   MIAQLQSMEDWVLRDIGIERGEIPAIVARLNDREVRMTPVSKPDQQSSVMQHAYQKAA"
FT   gene            410003..410209
FT                   /locus_tag="Dshi_0417"
FT   CDS_pept        410003..410209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0417"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92166"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN22"
FT                   /protein_id="ABV92166.1"
FT                   /translation="MMLSKVDFEDLFPHLFPPAARPAHPPVIGAKAEAGPDRAVSEVRA
FT                   DDAMIGAKPVAANLNGMRQKEIA"
FT   gene            410284..411177
FT                   /gene="uspA2"
FT                   /locus_tag="Dshi_0418"
FT   CDS_pept        410284..411177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA2"
FT                   /locus_tag="Dshi_0418"
FT                   /product="universal stress protein uspA"
FT                   /note="PFAM: UspA domain protein KEGG: hha:Hhal_1414 UspA
FT                   domain protein; COG0589 - Universal stress protein UspA and
FT                   related nucleotide-binding proteins, bad swissprot hit to
FT                   Stress response protein nhaX from Bacillus subtilis; low
FT                   Ref YP hit to UspA domain protein from Halorhodospira
FT                   halophila SL1, NCBI conserved domains:Usp/UspA like"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92167"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN23"
FT                   /protein_id="ABV92167.1"
FT                   /translation="MSVRCILAAVGGFPQDEAVLERAVDIAARHRAALVVVHIVDLPVM
FT                   GGLSADSDTLRDQAAQAARDRIEVCAARLGQQAPALDIRVASGAPALCLIAMSDEIDPD
FT                   LIVMRAHQRTSIADKILGSTTDRVIAGGSRPVLVVKRAVEGAYASVFVTTNGKDDAEGA
FT                   LRFTRRLLPAAELNLVQAVQVAPQLEEAMLRIGTGQSEVRAHLDELAQIATAELGALVA
FT                   QAEGGVAHRVLRGDPAAALVREARATSVDLIVAGAGRSGLLRRAFVGSVARRLLRDAEC
FT                   DVLILYPEASDEAHGA"
FT   gene            411331..412584
FT                   /locus_tag="Dshi_0419"
FT   CDS_pept        411331..412584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0419"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1 KEGG:
FT                   sal:Sala_2954 major facilitator superfamily MFS_1; middle
FT                   swissprot hit to Uncharacterized MFS-type transporter ycaD
FT                   from Salmonella typhi and good Ref ZP hit to major
FT                   facilitator family transporter from Sphingomonas sp. SKA58"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92168"
FT                   /db_xref="GOA:A8LN24"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN24"
FT                   /protein_id="ABV92168.1"
FT                   /translation="MRSLLTATVALMAGNGLLGVVLPLRMEAAEYPVALTGAIMAAYYL
FT                   GLALGGFRAKRVILRIGHIRAFAAFAALTSTVCLAYAFFFNPAAWVLLRVINGFCIAGM
FT                   TTTIESWLNERSSNATRGRVLGYYMLAFYLAIALGQTLVNVAPVNGDDHLMIAAALIGL
FT                   SLVPVAMTRLGEPDLREVRSLGVGDLYAASKVGVVGASVAGILVGSFYALAMVFARQIG
FT                   LGVTEAALFMSTVVIGGLAAQVPVGMLADRFDRRIVMACILLAVGLSWGLLSGAITNGG
FT                   VPLAVLVVMALAFGGAISSVYPLCVAQTFDRLDRRAYVAASGRLLMIYSIGATIGPLLA
FT                   SALMSVYGPRSFFLFESALAMAYACFVLLRVVTGAKPPAAGEREKYVPLPDTSAVASAL
FT                   DPRTEPEPEPVAQPDPKP"
FT   gene            412724..413434
FT                   /locus_tag="Dshi_0420"
FT   CDS_pept        412724..413434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0420"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase KEGG:
FT                   sil:SPO2482 endonuclease/exonuclease/phosphatase family
FT                   protein; no significant swissprot; good Ref EDP hit to
FT                   metal-dependent hydrolase from Oceanibulbus indolifex
FT                   HEL-45, NCBI conserved domains: elsH, Metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92169"
FT                   /db_xref="GOA:A8LN25"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN25"
FT                   /protein_id="ABV92169.1"
FT                   /translation="MEFTLASWNIRAGLGRDLRRRPLRTIEVITGLDADILVLQEADFR
FT                   MQPRPAALPAPRGRIGPFRVIDLTPDAVGLGWHGIAVLKHPAVKVDGIRRYDLPALEPR
FT                   GAVVVDIRVRQCPLRVVGVHLGLLRGNRRKQIAYIAEQLAALDQRPTIIAGDFNEWRER
FT                   KGLETLPDWLRTHSPGPTFPAGRPLLKLDKIAMSHDITLMDSVVVGDPAAKVASDHRPI
FT                   WARFRLAPEHEEAC"
FT   gene            413435..414979
FT                   /locus_tag="Dshi_0421"
FT   CDS_pept        413435..414979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0421"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase KEGG:
FT                   pmy:Pmen_2055 phospholipase D/transphosphatidylase; high
FT                   swissprot hit to Uncharacterized protein ymdC from
FT                   Escherichia coli K12 and high Ref EDP hit to phospholipase
FT                   D/Transphosphatidylase from Oceanibulbus indolifex HEL-45;
FT                   NCBI conserved domains: PLDc"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92170"
FT                   /db_xref="GOA:A8LN26"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN26"
FT                   /protein_id="ABV92170.1"
FT                   /translation="MVPIEIRVLLFAVGALVLAVLVARLVFPAPTPEPQKTGRALPPAA
FT                   EGVLTEAMSTRAAQHPGQSGIAALSDGMEAYVARMVLANAAASSIDAQYYIWRNDMTGH
FT                   LFLQALWRAAERGVRVRLLLDDNGIHDLDGMLATLDSHPNIEVRLFNPFVLRRFKRLSY
FT                   AFDLFRLNHRMHNKAFTVDGRVSILGGRNIGDEYFGTGEIPLQMDLDVLAVGAVVPEIS
FT                   ADFDRYWNADATHSAARILHSRADPEAMAAQFDRVENDPRHATYRAQLEQSDLVSRLAK
FT                   GGLALDWTNATLISDDPARVFDRVPRSKRFTARLLDAIGPIEHRFDGVTPYFVPGEAGV
FT                   AAFTAMVRNGVTVRMLTNSLEATNMLPVHAGYSKRRAPLLRVGVGLFELRAQAAGASER
FT                   DRLGPLGSSGSNLHAKTFAVDGARIFIGSFNFDPRSALLNTEMGLVIESERMAQVLHEA
FT                   FDRGLGGMAWQVKLERGKPVWIDAEKAIRTDDEPGTTLVRRIALRVIGSLPVEWLL"
FT   gene            415164..415685
FT                   /locus_tag="Dshi_0422"
FT   CDS_pept        415164..415685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0422"
FT                   /product="propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4 KEGG:
FT                   swi:Swit_4515 hypothetical protein; no significant
FT                   swissprot; bad gb hit to Propeptide, PepSY amd peptidase M4
FT                   from Oceanibulbus indolifex HEL-45"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92171"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN27"
FT                   /protein_id="ABV92171.1"
FT                   /translation="MARSILAVTLAVANAIAVPAAVAQTPQTTQTIGMARAVAIAQEAR
FT                   PGGILEAELDSDLGALVYEIEIVSDGTIHEAVIDARSGELIELEEHTIEATWLGWFDEE
FT                   RLAAAKQASGTVQDAIAQAEAMFGGQVVELSLEEDNDRLFWEFEIATGDRELEAYMNIQ
FT                   TGEIFAGEMD"
FT   gene            complement(415763..416488)
FT                   /gene="pap"
FT                   /locus_tag="Dshi_0423"
FT   CDS_pept        complement(415763..416488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pap"
FT                   /locus_tag="Dshi_0423"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /EC_number="3.1.3.-"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related KEGG:
FT                   rsh:Rsph17029_1755 phosphoesterase, PA-phosphatase related,
FT                   no significant swissprot; good Ref YP hit to PA-phosphatase
FT                   related phosphoesterase from Rhodobacter sphaeroides 2.4.1;
FT                   NCBI conserved domains: Pap2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92172"
FT                   /db_xref="GOA:A8LN28"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN28"
FT                   /protein_id="ABV92172.1"
FT                   /translation="MANKSHLHLLRDVRPNPQITGLLIVAALLWAFARITNAVVGGETR
FT                   AFDTSLLIALRNPADLTDPLGPIWIEELGRDLSALGGTFVLSFLTLSVAGLFWLQRRRI
FT                   TSAFLLLAVTTGVGLSQLLKAGFDRPRPDLVSQETAIYTASFPSGHSMMAAVVYLTLAV
FT                   LAARTLKRRREKGYVVSLAILIVLGVGISRVYLGVHWPTDVLAAWIIGAGWALFCGIFA
FT                   RFLDRAGPQDRSSRPGPDT"
FT   gene            417105..417566
FT                   /locus_tag="Dshi_0424"
FT   CDS_pept        417105..417566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0424"
FT                   /product="peptidase M41"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92173"
FT                   /db_xref="GOA:A8LN29"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN29"
FT                   /protein_id="ABV92173.1"
FT                   /translation="MATGTEERVYSWDITSVAANLHVDEAVLTGESVPVRKQTDPVAAE
FT                   AVVAECCNMAFKGSSVTQQSSFLEGQAPRYIARSYSEATAEAMDAAVRGVLREVSDEAL
FT                   EILTQNRDILETSARRLLEVETLDEAELRDLARGLSVDISTENKGAVNE"
FT   gene            418488..418850
FT                   /locus_tag="Dshi_0426"
FT   CDS_pept        418488..418850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0426"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; PD068243 REGULATORY
FT                   BACTERIAL FAMILY MERR CYTOPLASMIC; middle Ref ZP hit to
FT                   hypothetical protein ROS217_15345 from Roseovarius sp. 217"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92174"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN30"
FT                   /protein_id="ABV92174.1"
FT                   /translation="MLDERDVVARVARVELRELRLWVREGWVKPVETETGPVFDDLDVA
FT                   RIRLVCDLRQDLELPDDAVPVILSLLDQLHGMRRDLRALVRAVEAQTPETRRAIVAAAS
FT                   ELMASELMAGEPTERG"
FT   gene            418998..419249
FT                   /locus_tag="Dshi_0427"
FT   CDS_pept        418998..419249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0427"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains
FT                   (except for one signalpeptide/ two transmembr. region), bad
FT                   Ref YP hit to hypothetical protein AZC_2085 from
FT                   Azorhizobium caulinodans ORS 571"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92175"
FT                   /db_xref="GOA:A8LN31"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN31"
FT                   /protein_id="ABV92175.1"
FT                   /translation="MTANMGSLDRALRGIIGLLLIVLPLVTTLGIHAAAWGLWLSVILG
FT                   AILAVTAIYGVCPVYFLLGVKTCKTRGSIPGRITMRTS"
FT   gene            419269..421152
FT                   /gene="phaC"
FT                   /locus_tag="Dshi_0428"
FT   CDS_pept        419269..421152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="Dshi_0428"
FT                   /product="poly(3-hydroxyalkanoate) polymerase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein KEGG:
FT                   sil:SPO0112 poly(3-hydroxyalkanoate) polymerase family
FT                   protein; high Ref YP hit to poly(3-hydroxyalkanoate)
FT                   polymerase family protein from Silicibacter pomeroyi DSS-3
FT                   and high swissprot hit to Poly(3-hydroxyalkanoate)
FT                   polymerase (PHA polymerase) from Methylobacterium
FT                   extorquens; NCBI conserved domains: phaC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92176"
FT                   /db_xref="GOA:A8LN32"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN32"
FT                   /protein_id="ABV92176.1"
FT                   /translation="MTKRQTISAPTDDIDPRADHRGGPVAAPVPSTPPARAADGPEVAP
FT                   ELGPLCPAEKPDRHGLSMLDQATKAHLARLTQGISPFGLTSSFFDWGMHLAASPGKQMQ
FT                   LADKAQRKAAKLAMAASRMALGKSGAPCIDPLIYDKRFVAPEWQRWPHNLIYQSFLMTQ
FT                   QWWYNATNDIDGLSRCDEQVVSFVMRQLLDMMSPANGLWTNPEVLAETTRTFGANLVQG
FT                   TQNLIEDMERALAGKPPVGAEDYLPGREVAVTPGKVVHRSHLFELIQYAPQTETVAAEP
FT                   ILIVPAWIMKYYILDLSPHNSLVRYLVEQGFTVFMISWRNPDAGDRDLGMEDYLAALDT
FT                   ALDEIGAIVPETGVHGVGYCLGGTLLSVKAALMARDGDDRLKTLSLLATQTDFEDPGEL
FT                   QLFISESQLSYLDHMMWDQGYLDTKQMAGAFQLLRSRDLIWSRYVHEYLMGRRQPMFDL
FT                   MAWNADATRMPYRMHSEYLRSMFLDNQLAQGQYRVGGRPVALSDIRAPVFCVSTTGDHV
FT                   APWQSVYKLHLLADTDITFVLTSGGHNAGIVSEPGHKGRSYQIRTLPDAEHYIPPEDWR
FT                   AQTQVQDGSWWPEHVAWLRAHGAPEEGPPPPMGRKGAGDLRDAPGAYVLQP"
FT   gene            complement(421265..421552)
FT                   /locus_tag="Dshi_0429"
FT   CDS_pept        complement(421265..421552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0429"
FT                   /product="uncharacterized conserved coiled coil protein"
FT                   /note="no significant swissprot, no conserved domains, low
FT                   Ref Yp hit to uncharacterized conserved coiled coil protein
FT                   from Marinomonas sp. MWYL1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92177"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN33"
FT                   /protein_id="ABV92177.1"
FT                   /translation="MDEKKAYQDKFRAQLDEWEAQIDQLRAKFRGASADARLKYMEEME
FT                   ELKGRQERAEARLDALNEAGGEAWKDLRKGTEAAWDDLEAALKRARSRFS"
FT   gene            complement(421575..422009)
FT                   /locus_tag="Dshi_0430"
FT   CDS_pept        complement(421575..422009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, low
FT                   Ref YP hit to hypothetical protein SPO0412 from
FT                   Silicibacter pomeroyi DSS-3"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92178"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN34"
FT                   /protein_id="ABV92178.1"
FT                   /translation="MARTAKPPANDATETALNAAQVVFSLNPAFRPQSEHLAQAQQELM
FT                   KEAEKFSSAWFKRRHEALHSALEVTSHIASTGMMNPAGAMQAMAEWQTRSAARLAEDAR
FT                   DCTEFMSQCARTMIEHEIEATEEAAENTKHAMSKTRATPV"
FT   gene            422213..423661
FT                   /gene="dcuC"
FT                   /locus_tag="Dshi_0431"
FT   CDS_pept        422213..423661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuC"
FT                   /locus_tag="Dshi_0431"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier KEGG:
FT                   mes:Meso_2242 C4-dicarboxylate anaerobic carrier; good
FT                   swissprot hit to Uncharacterized protein HI0594 from
FT                   Haemophilus influenzae; high Ref Yp hit to C4-dicarboxylate
FT                   anaerobic carrier from Mesorhizobium sp. BNC1; NCBI
FT                   conserved domains: dcuC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92179"
FT                   /db_xref="GOA:A8LN35"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN35"
FT                   /protein_id="ABV92179.1"
FT                   /translation="MADGTQPPKDPEHDLSSRFPTAYTILFGLIILVAALTWFIPAGQY
FT                   ERVMNEEVGREVAVAGTYTEVAPNPQGFVEVMLAPIAGFYDPDSYAANAIDVALFVLLL
FT                   GGFLGVVNATGSIDTGIRTAMAGMKGREIWMIPIMMSLFAIGGTTYGMAEETLAFYAIL
FT                   IPVMIAAGYDAVTGVAIILIGAGIGVLGSTINPFATVIASDAAGIPFTDGIVLRLIILL
FT                   GGLAICAAYVMRYSKRVKQDPSRSVVAKQGAAHRRLFLADAETADVNDSLTGTQKIILV
FT                   LFAITFAVMIWGVASQGWWMARMGALFLFAAIVVGIVGRLGEKKLTGSFVDGARDLLGV
FT                   ALVVGLARGIVVIMEQGLIADTILYSAEQSLGGLGDLAFINLMFWIEIGMSFFVPSSSG
FT                   LAVLSMPILAPLADFAGVGRDLVVTAYQSANGLVNLINPTFAVVIGGLAIGRVGYDRWI
FT                   VFIWPLMLILLVFISAALSLAAIL"
FT   gene            423677..424906
FT                   /gene="arcA"
FT                   /locus_tag="Dshi_0432"
FT   CDS_pept        423677..424906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="Dshi_0432"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase KEGG: psa:PST_3978 arginine
FT                   deiminase; high swissprot hit to Arginine deiminase (ADI)
FT                   from Pseudomonas aeruginosa, NCBI conserved domains: arcA"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92180"
FT                   /db_xref="GOA:A8LN36"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LN36"
FT                   /protein_id="ABV92180.1"
FT                   /translation="MTAHKLGVHSETGTLRQVIICRPGLAHRRLTPENCEELLFDDVFW
FT                   VKQAKQDHEAFGAAMTQEGVEVLETGALLGETLEIPEARKWVLDHRISANDVGVGMRKD
FT                   LRDWMDELPGTELATWLIGGLTVGDVPFEATSMFGAYLGRHGFILPPLPNFLFTRDNSS
FT                   WVYGGVTLNPMYWQARRPETLLTAAIYRYHPKFAGKVHEIWADPLKNHGLATLEGGDVM
FT                   PVGNGLVLVGMGERTSPQGVGLMAQALFGEGRATRVIACQMPKSRAAMHLDTVFTFCGD
FT                   NIVTSFKEVADEMTCYDLHPGEGDKPLDMRHDTRPMFEVVAEAMGFKKLNVVPTGGSDP
FT                   FEQSREQWNDGNNVLALRPGVVMGYDRNDDTNAALRAEGIKVIELPGAELGRGRGGSRC
FT                   MSCPTIRDAV"
FT   gene            424920..425921
FT                   /gene="arcB"
FT                   /locus_tag="Dshi_0433"
FT   CDS_pept        424920..425921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="Dshi_0433"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain KEGG: mes:Meso_2240 ornithine
FT                   carbamoyltransferase; high swissprot hit to Ornithine
FT                   carbamoyltransferase, catabolic from Haemophilus
FT                   influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92181"
FT                   /db_xref="GOA:A8LN37"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN37"
FT                   /protein_id="ABV92181.1"
FT                   /translation="MAFNLKNRHFLTLRGFTPEEIGFLLKLSADLKSAKYAGTEVPTLR
FT                   GKEIALIFEKDSTRTRVGFEVAAHDQGATVTYLGPSGTHLGKKETVKDTARVLGRVYDA
FT                   IEYRGFGQEIVQELADWAGVPVYNGLTDEFHPTQILADFLTMQEHCEKPLREVAYCFMG
FT                   DAGNNMGDSLLIGGAKMGMDVRLCAPRSLWPVQSIQDEARAIAEHTGARVTLTEDVDKA
FT                   VKGVDFVYTDVWVSMGEPVEKWAERIDLLMPYQVNADVMARTGNPRVRFMHCLPAFHNA
FT                   ETEVGCDIQDKFGLEAMEVTEEVFESPASIVFDQAENRMHTIKAVLVATLGG"
FT   gene            425925..426863
FT                   /gene="arcC"
FT                   /locus_tag="Dshi_0434"
FT   CDS_pept        425925..426863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="Dshi_0434"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="KEGG: mes:Meso_2239 carbamate kinase TIGRFAM:
FT                   carbamate kinase PFAM: aspartate/glutamate/uridylate
FT                   kinase; similar to Carbamate kinase from Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92182"
FT                   /db_xref="GOA:A8LN38"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN38"
FT                   /protein_id="ABV92182.1"
FT                   /translation="MLVVAALGGNALLKRGEPLTAENQRRNVREAAVALARIVRAGHRL
FT                   VVTHGNGPQVGLLALQGAAYKPEEAYPLDVLGAETGGMIGYIIEQELENALDHDRAVAT
FT                   LLTQIVVDPDDLAFRDPAKFIGPVYSRDEAEARAKAVGWTIAQDGDKWRRVVPSPAPQE
FT                   IPDMRVIRMLLEQDVIVICGGGGGIPVLRRADGSLIGIEAVIDKDAASALLARELEADA
FT                   LLLLTDVDGVYRDFGTDRQARIDSLTPGEAFKLNLPAGSMGPKMLAAARFAAYGGLAGI
FT                   GRLDEATDILEGRAGTRVIPDATDEGGSGRG"
FT   gene            427117..428505
FT                   /gene="atpD1"
FT                   /locus_tag="Dshi_0435"
FT   CDS_pept        427117..428505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD1"
FT                   /locus_tag="Dshi_0435"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: net:Neut_2013 ATP synthase F1, beta subunit
FT                   TIGRFAM: ATP synthase F1, beta subunit PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92183"
FT                   /db_xref="GOA:A8LN39"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LN39"
FT                   /protein_id="ABV92183.1"
FT                   /translation="MPADPEVHFEGTIVAIRGGVVDVAFAEAVPRIHALIVAGGVAMEV
FT                   ASIVGEGVVRCIALGPTRGLGLGTRATGTRAGIEVPVGEGVLGRMLDMFGAPLDGAPPP
FT                   EATARRPIHRPPPVLSDRVLRAEVLETGIKAIDLLSPIERGGKTGLFGGAGVGKTVLLS
FT                   ELIHNTVEHHHGVSLFCGIGERSREAEELWREMGEAGVRERMVMLFGQMNEAPGVRFLV
FT                   GHSALTMAEYFRDDREQDVLLLIDNIFRFVQAGSEVSGLLGRMPSRVGYQPTLATELAA
FT                   LQERIASTRRGAITSIQAVYVPADDFTDPAAAHIFSHLSASVVLSRKRASEGLYPAVDP
FT                   LASTSVMLTPEVVGQRHYDIARGVRRTLAEYEDLRDIIAMLGIEELSAHDRAVVARARR
FT                   LERFLTQPFFTVGAAAGTLGKLVPIAETLDGCEEILSQTSFERPESAYYMIGALSDLRK
FT                   EAAA"
FT   gene            428502..428912
FT                   /gene="atpC2"
FT                   /locus_tag="Dshi_0436"
FT   CDS_pept        428502..428912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC2"
FT                   /locus_tag="Dshi_0436"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit
FT                   KEGG: net:Neut_2014 H+-transporting two-sector ATPase,
FT                   delta/epsilon subunit, low swissprot hit to ATP synthase
FT                   epsilon chain 2 from Burkholderia xenovorans LB400"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92184"
FT                   /db_xref="GOA:A8LN40"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN40"
FT                   /protein_id="ABV92184.1"
FT                   /translation="MTMATEMRVYLRLPSRIMFDGSAVRLRGEAPNGSFGILPNHVDLV
FT                   TPLVSSVLLIAQADGTERIFGIDEGLLVKKGHRVEVAVRRAVETDDLDQMRDIVRDSFA
FT                   GLEDEERAARAALSRLEADMVRRFASLRKAQG"
FT   gene            428909..429196
FT                   /locus_tag="Dshi_0437"
FT   CDS_pept        428909..429196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0437"
FT                   /product="ATP synthase F0F1, subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: F0F1-ATPase subunit, putative PFAM:
FT                   F0F1-ATPase subunit putative KEGG: net:Neut_2015
FT                   F0F1-ATPase subunit, putative; no significant swissprot;
FT                   low Ref ZP hit to H(+)-transporting ATP synthase, gene 1
FT                   from Marinobacter sp. ELB17"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92185"
FT                   /db_xref="GOA:A8LN41"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN41"
FT                   /protein_id="ABV92185.1"
FT                   /translation="MTQKPDRSAEDIGQRARRMKAARDDPGPSPLRGIGTFGMIGWSIA
FT                   VPTVGGVFLGLWLDRVAPQTFSWTIALLLGGVVLGALIAWNWIGKEGDGR"
FT   gene            429193..429498
FT                   /locus_tag="Dshi_0438"
FT   CDS_pept        429193..429498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0438"
FT                   /product="ATP synthase F0F1, subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="no significant swissprot and no conserved domains
FT                   (except from signalpep. and three transmembr. regions);
FT                   low, but best Ref ZP hit to F0F1 ATP synthase subunit A
FT                   from Marinobacter sp. ELB17, lies in the middle of F0F1
FT                   ATPase cluster"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92186"
FT                   /db_xref="GOA:A8LN42"
FT                   /db_xref="InterPro:IPR017581"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN42"
FT                   /protein_id="ABV92186.1"
FT                   /translation="MIGLDWTLTGLGAFLGVLAGAAFFAGLAWGMRIALRRARPAPVLL
FT                   LSAGLRIAALLAVGYWVAGEGGTSMLLGFAGGFLVARVCILMLARRPVPEEAARWN"
FT   gene            429489..430178
FT                   /gene="atpB2"
FT                   /locus_tag="Dshi_0439"
FT   CDS_pept        429489..430178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB2"
FT                   /locus_tag="Dshi_0439"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit PFAM:
FT                   H+transporting two-sector ATPase A subunit KEGG:
FT                   net:Neut_2017 ATP synthase F0, A subunit; middle swissprot
FT                   hit to Chloroplast ATP synthase a chain precursor from
FT                   chloroplast Marchantia polymorpha and good Ref ZP hit to
FT                   ATP synthase subunit A from Marinobacter sp. ELB17"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92187"
FT                   /db_xref="GOA:A8LN43"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN43"
FT                   /protein_id="ABV92187.1"
FT                   /translation="MELTPDTNIVFAPWGFGINATIVNTWIIMAVLTGTAALVTRNLRP
FT                   DVPPNRWRTTLEVIVGGIVGQIAEITERRDPRILYFSGTLFLFIVTANLLTVVPGFDTP
FT                   TASLSTTVALALSVLIAVPLFGIGSRGLGGYLRTYLEPSVIMLPFNIISEVSRGISLAI
FT                   RLYGNIMSGAVIAAILLGVAPFFFPVVMDMLGLLTGVIQAYIFAILATVYISSATAATP
FT                   KPPKEAP"
FT   gene            430175..430465
FT                   /gene="atpE1"
FT                   /locus_tag="Dshi_0440"
FT   CDS_pept        430175..430465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE1"
FT                   /locus_tag="Dshi_0440"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit PFAM:
FT                   H+transporting two-sector ATPase C subunit KEGG:
FT                   net:Neut_2018 ATP synthase F0, C subunit; low swissprot hit
FT                   to ATP synthase C chain from chloroplast Pavlova lutheri
FT                   and middle Ref ZP hit to H+-transporting two-sector ATPase,
FT                   C subunit from Planctomyces maris DSM 8797"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92188"
FT                   /db_xref="GOA:A8LN44"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR017708"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN44"
FT                   /protein_id="ABV92188.1"
FT                   /translation="MTDLAIIAAVSIFTAGLTIAIGAIGPALGEGRAASTALSAIAQQP
FT                   DAASTLSRTLFVSLAMIESTAIYCFVVAMILIFANPFWEAALEAATVGAGG"
FT   gene            430470..431237
FT                   /gene="atpF1"
FT                   /locus_tag="Dshi_0441"
FT   CDS_pept        430470..431237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF1"
FT                   /locus_tag="Dshi_0441"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B subunit
FT                   KEGG: net:Neut_2019 H+-transporting two-sector ATPase, B/B
FT                   subunit; low swissprot hit to ATP synthase B chain from
FT                   Vibrio vulnificus and good Ref ZP hit to H(+)-transporting
FT                   ATP synthase, subunit B from Marinobacter sp. ELB17"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92189"
FT                   /db_xref="GOA:A8LN45"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LN45"
FT                   /protein_id="ABV92189.1"
FT                   /translation="MSIDWITVAAQIVNFLLLIWLLKRFLYRPILDGIDAREAEIAARM
FT                   GEAAAVRQQAEARETEYEARIAQLSSSRAELLEEARRAAEAERDALLSKARARLEEEQA
FT                   ERAAHRAEEAARHRADLQRRGAEALLALTRKALRDLADEGLERRIVLQAAGRLADMGDD
FT                   LREAAGDARQAVALTRDPLPEEVQARLRSDLGDVLEGVSLRFEVDPGQSPGLNLRLGGA
FT                   QLGWTVDSYLNGLEATLAEAAGRPARRGGHDAA"
FT   gene            431227..432756
FT                   /gene="atpA2"
FT                   /locus_tag="Dshi_0442"
FT   CDS_pept        431227..432756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA2"
FT                   /locus_tag="Dshi_0442"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: net:Neut_2020 ATP synthase F1, alpha subunit
FT                   TIGRFAM: ATP synthase F1, alpha subunit PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; high swissprot hit to ATP synthase subunit
FT                   alpha 2 from Syntrophus aciditrophicus SB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92190"
FT                   /db_xref="GOA:A8LN46"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LN46"
FT                   /protein_id="ABV92190.1"
FT                   /translation="MRHDTDPRPSTADLIDAVLDAPPPRPEVSEVGRVAELGDGIAIVT
FT                   GLARALADEVLDFASGVSGIVFDLEPGRLGVVLLGPSQNVAMGEDVRRTGRVVSVPVGP
FT                   ATLGRVVDALGRPRDERDPVTDSPLAPVEAEAPDILSRTPVSRPLATGLKAVDAAVPVG
FT                   LGQRQLIIGDRQTGKTSIAVDTILNQKDTGVICIYCAIGQRGDAVAKVIGALQGGEMLG
FT                   QTVVIAAGDEDAPGLAYIAPYAAMSVAESFAAQGRDVLVVLDDLTHHARTYRELSLLLR
FT                   RPPGREAFPGDIFYVHARLLERAGQFGEGAGSITALPVVETQAENLSAYIPTNLISITD
FT                   GQIYLSPKLVRTNQFPAVDLGVSVSRVGGKAQARAFRAVGGNLRVTLSQFEELEEFARF
FT                   GTRLDEDTRARLARGGAVRNALRQAERDPMAAHEQLAVLVAAMEGLLDGMDEAAAGAAM
FT                   QAIRAAIRAADGGLPEIIAGDEKLTEDARGHILATARAALAQTGRGDGADA"
FT   gene            432740..433687
FT                   /gene="atpG1"
FT                   /locus_tag="Dshi_0443"
FT   CDS_pept        432740..433687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG1"
FT                   /locus_tag="Dshi_0443"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: H+transporting two-sector ATPase gamma subunit
FT                   KEGG: net:Neut_2021 H+-transporting two-sector ATPase,
FT                   gamma subunit; low swissprot hit to ATP synthase gamma
FT                   chain from Desulfovibrio vulgaris subsp. vulgaris str.
FT                   Hildenborough and good Ref ZP hit to H(+)-transporting ATP
FT                   synthase, subunit gamma fromMarinobacter sp. ELB17; NCBI
FT                   conserved domains: atpG"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92191"
FT                   /db_xref="GOA:A8LN47"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN47"
FT                   /protein_id="ABV92191.1"
FT                   /translation="MAQTLERLTGRTETMRGIRSIVRTMKTMSAINALPYEQAADAIEA
FT                   YRDTAILGFRAFVRSHGPLPRDAATAGQPVVIAFGSDHGLCGNYNELVAQQVDRTRRTD
FT                   VETTVICVGAQMEDALAGLGIVPATTLLPPANADGLGRLAGRLIALLDEIRAAQPDGQI
FT                   NVTLVFTQRAEHGQQSPVSRRLLPLDPELTDGFARQPWRSRSLPRFTLAPEQLLAALIR
FT                   SFLFAEIFRAAAEAMVTENAARLARMQQAERSVDERLEELTAEMRSVRQSEITTELLDV
FT                   IIGFEAIKGRHLRKPKGRGARQEGPDENASDQGR"
FT   gene            433725..434012
FT                   /locus_tag="Dshi_0444"
FT   CDS_pept        433725..434012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, low
FT                   Ref YP hit to hypothetical protein Nham_4077 from
FT                   Nitrobacter hamburgensis X14"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92192"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN48"
FT                   /protein_id="ABV92192.1"
FT                   /translation="MSSAPQLSVTERHKMLYVDLPSPAEIGHLDLRRLDGFVSVYLPTT
FT                   PLTEDIRQRRTRLKQLEDEAVSRQEASGLEKLRIWPLEEHFETVLEDDDF"
FT   gene            434046..434438
FT                   /locus_tag="Dshi_0445"
FT   CDS_pept        434046..434438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, low
FT                   Ref ZP hit to hypothetical protein NB311A_09431 from
FT                   Nitrobacter sp. Nb-311A"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92193"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN49"
FT                   /protein_id="ABV92193.1"
FT                   /translation="MPKHLRTYRLPSDLAVTEQATALVRSLGTIAVLHRGIETSPDRMS
FT                   DADLVRATSFGCVHTLMVDIDSMVASTVYETTGAVSCRPEGMVGDYGVRDEIAGLALRT
FT                   GARVLAVREKEIPSGKLIAAILRCSV"
FT   gene            434569..434979
FT                   /locus_tag="Dshi_0446"
FT   CDS_pept        434569..434979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0446"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; middle Ref YP
FT                   hit to CBS domain containing protein from Mesorhizobium sp.
FT                   BNC1 and bad swissprot to Uncharacterized protein yhcV from
FT                   Bacillus subtilis; NCBI conserved domains: cbs_pair_9"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92194"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN50"
FT                   /protein_id="ABV92194.1"
FT                   /translation="MLVSRIMRKPVMTVAPEASVQTAAALMANLDIGALAVVDDGRPVG
FT                   ILTDRDIVVRHAAKAGTDALVGTVMTPCVVTCRSDQTIERAAHLMADRQIRRLVVLDAD
FT                   NRVVGLLSLGDIANDASEELAGQTLGEIVETR"
FT   gene            complement(434981..435769)
FT                   /locus_tag="Dshi_0447"
FT   CDS_pept        complement(434981..435769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0447"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: cyclic nucleotide-binding SMART: regulatory
FT                   protein Crp; low swissprot hit to Transcriptional
FT                   activatory protein aadR from Rhodopseudomonas palustris and
FT                   middle Ref ZP hit to transcriptional regulator, Crp/Fnr
FT                   family protein from Roseobacter sp. AzwK-3b; Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92195"
FT                   /db_xref="GOA:A8LN51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN51"
FT                   /protein_id="ABV92195.1"
FT                   /translation="MTSRARSLLLHGSGSMAPEPRAGLLHGPVGRHVPTLIDLFLRVQP
FT                   HPQIHTARRGKAVIREDDFADHAMLLLEGWVAFSKMLPDGESQIIDILLPGDFALIGAA
FT                   NAPLAAFSVETLSDARFINIGPGRVNGPEPEMARLRELMAAEIVRMQSRTSELLLRVGK
FT                   GSAANRIAYALLEFFVRLEAVGMTSGTRFAFPMTQHKLGEFTGMSNVHVNRTLRRFERE
FT                   GIVAYPAPPEIDLCDIDALCALAGLDLASFRNEIIARRAP"
FT   gene            436086..437696
FT                   /locus_tag="Dshi_0448"
FT   CDS_pept        436086..437696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0448"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; middle swissprot hit to
FT                   Uncharacterized sensor-like histidine kinase yclK from
FT                   Bacillus subtilis and high Ref YP hit to Sensor protein
FT                   resE, putative from Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92196"
FT                   /db_xref="GOA:A8LN52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN52"
FT                   /protein_id="ABV92196.1"
FT                   /translation="MTSAPARPSMSLKLRLSLGAALLAAATVLTSSILYFGLNEVADRL
FT                   DTALASERRMARYATASTQAATFLVIASEAVQAGLPTEVRRERILQVVGQLQETFTLLH
FT                   ADVEEAVFSARALGIDGQSRYGTQSLGIARMEATLDQTVRGLLTDTQDTERLRGYIDSF
FT                   ATSFDPLLGQAINTERLFRSEILSGIEALRIQLAWMALGIALAAGLSVAAFYFGLVRPQ
FT                   FYRLDAVRSAADQIGRGDFSGVLPVSRLDEIGQLSQQTNRMAAALSDRQAKVDAEWTQL
FT                   NEIIATRTKELKQANARLEKTDEDRRRFFADVSHELRTPLTVILMEAQIGRQSIPAAAD
FT                   AFATIEARAERLNRKIDDLLRLARSETGQLALACVPVALDALVASAIEEVQAELDNAGM
FT                   TLDLVPFRETQVRADPDWLRQVLVSLVRNAIRHARSGEKLRIAPVVQRTQAGVSITDNG
FT                   PGIPASRQYQVFERFSQGAGATSAQGFGIGLALARWVIDAHGGEISLQSPLPRSDALGE
FT                   HPGLRITILLPAEDAIADA"
FT   gene            437751..438434
FT                   /locus_tag="Dshi_0449"
FT   CDS_pept        437751..438434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0449"
FT                   /product="two component transcriptional regulator"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; middle swissprot hit to
FT                   Transcriptional regulatory protein dltR from Streptococcus
FT                   agalactiae serogroup III (Phosphorylated by dltS kinase);
FT                   good Ref YP hit to transcriptional regulatory protein PrrA,
FT                   putative from Roseobacter denitrificans OCh 114; winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92197"
FT                   /db_xref="GOA:A8LN53"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN53"
FT                   /protein_id="ABV92197.1"
FT                   /translation="MTSRLLIVEDDPEITSALVRGLALHGYEAEAENRADRALSRLTAG
FT                   IYSGAIVDVMLGSDSGVELVRTARAHGATLPILMLSALSGVEDRATGLAAGADDYVVKP
FT                   FHFDELVARLRVQEHRALAQRVSPARLIRTSRRLEMGPDSVTLTEREFDLLALLIRSGE
FT                   DPQPRSQLHATLWAAEGASTENVVDVYVGYLRRKLETADFGFEIKTVRNRGFCISGRRP
FT                   ELLES"
FT   gene            438538..438636
FT                   /gene="pqqA"
FT                   /locus_tag="Dshi_0450"
FT   CDS_pept        438538..438636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqA"
FT                   /locus_tag="Dshi_0450"
FT                   /product="coenzyme PQQ biosynthesis protein A"
FT                   /note="PFAM: coenzyme PQQ biosynthesis protein A; bad
FT                   swissprot hit to Coenzyme PQQ synthesis protein A from
FT                   Silicibacter pomeroyi; bad Ref ZP hit to pyrroloquinoline
FT                   quinone biosynthesis protein PqqB from Sagittula stellata
FT                   E-37; NCBI conserved domains: pqqA"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92198"
FT                   /db_xref="GOA:A8LN54"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LN54"
FT                   /protein_id="ABV92198.1"
FT                   /translation="MAWTKPIIREIECGMEINMYGPDSDEEREVLF"
FT   gene            438663..439556
FT                   /gene="pqqB"
FT                   /locus_tag="Dshi_0451"
FT   CDS_pept        438663..439556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="Dshi_0451"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B; high
FT                   swissprot hit to Coenzyme PQQ synthesis protein B from
FT                   Silicibacter pomeroyi; NCBI conserved domains: pqqB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92199"
FT                   /db_xref="GOA:A8LN55"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LN55"
FT                   /protein_id="ABV92199.1"
FT                   /translation="MAFRAHILGAAAGGGLPQWNCGCDNCNLARSGTIPPQTQSSLAVT
FT                   ADGTSWAILNASPDIRGQLADTPALHPTGLRDLPLRAVLVTNGDIDHVAGLLTLREMQP
FT                   FRLFATAGIHEVLAENPIFNAVNATVVPRETIALDAPFELVPGLIATLFPVPGKVPLYL
FT                   EGETVETDLIGDQTVGVRLQALDSTAYYIPGCALLTDDLRARLDGADTLFFDGTLWADD
FT                   EMVRAGLGKKTGKRMGHMSMSGPDGSIAAFEGLSIRQKIYVHMNNTNPVLRPSSAEKAQ
FT                   AEAAGWIIGQDGMEVS"
FT   gene            439556..440308
FT                   /gene="pqqC"
FT                   /locus_tag="Dshi_0452"
FT   CDS_pept        439556..440308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="Dshi_0452"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein C PFAM:
FT                   TENA/THI-4 domain protein; high swissprot hit to
FT                   Pyrroloquinoline-quinone synthase (Coenzyme PQQ synthesis
FT                   protein C) from Sinorhizobium meliloti, NCBI conserved
FT                   domains: pqqC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92200"
FT                   /db_xref="GOA:A8LNP2"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP2"
FT                   /protein_id="ABV92200.1"
FT                   /translation="MAQTREQFEARLRQIGAERYHDLHPFHDRLHGGSCTPDQVRAWVI
FT                   NRYYYQHSIPMKDAAFMSRVESPDLRRAWRSRIEDHDGTAENEGGIRRWLRLAEAVGLE
FT                   PDYVASCEGVLPATRFAVDAYVRFVREKTLLEAVAASLTELFAPKIHANRIQGLLKNYA
FT                   FADDSSLSYFRNRLKEAPKDVAFGLSWVLDHADTQEKQDAAAKALVFKTDVLWAQLDAL
FT                   SAAYVEPARIPPGAWQPHEGLARQRKAS"
FT   gene            440305..440583
FT                   /gene="pqqD"
FT                   /locus_tag="Dshi_0453"
FT   CDS_pept        440305..440583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="Dshi_0453"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D; low swissprot hit to
FT                   Coenzyme PQQ synthesis protein D from Silicibacter
FT                   pomeroyi; middle Ref ZP hit to coenzyme PQQ synthesis
FT                   protein D from Roseovarius sp. HTCC2601; NCBI conserved
FT                   domains: pqqD"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92201"
FT                   /db_xref="GOA:A8LNP3"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP3"
FT                   /protein_id="ABV92201.1"
FT                   /translation="MMEAGDIPELPRGVRLHFDKVRETWVLLAPERAVTLDAIGHAILS
FT                   EIDGTRSFGEITQALSDAYNAPRDQIAADSAGFLTALRNRRFLDVRP"
FT   gene            440580..441686
FT                   /gene="pqqE"
FT                   /locus_tag="Dshi_0454"
FT   CDS_pept        440580..441686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="Dshi_0454"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein E PFAM:
FT                   Radical SAM domain protein KEGG: rde:RD1_1150 coenzyme PQQ
FT                   biosynthesis protein E; high swissprot hit to Coenzyme PQQ
FT                   synthesis protein E from Silicibacter pomeroyi"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92202"
FT                   /db_xref="GOA:A8LNP4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP4"
FT                   /protein_id="ABV92202.1"
FT                   /translation="MRPPPPIAMLAELTYRCPLSCPYCSNPIEMARKEAELDTGTWERV
FT                   FQEAAELGVLQLHLSGGEPVSRRDIVDLVAAARAAGLYTNLITSGIGLTERRLADLDAA
FT                   GLDHIQLSLQGTDPAMADEIGGYKGGFARKMQVAEWIGAIGFPLTLNAVLHRRNLHQLP
FT                   RALDMALEMGARRIEVATVQFHGWALKNRDALMPTRDQAREATAIVAEARARLKGRLVI
FT                   DYVPADYHEDYPKRCMGGWGTSGLNVTPDGTVLPCHAAHSIPHLTFETVLDRSLSDIWY
FT                   EGMAFNAYRGTDWMSEPCSSCERKTVDFGGCRCQAMAILGDANATDPVCVKSPHHGALQ
FT                   SQADAHAARDDTPLVYRVSPGTTPEPVQ"
FT   gene            442029..442946
FT                   /locus_tag="Dshi_0455"
FT   CDS_pept        442029..442946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0455"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; no conserved domains
FT                   except for short signalpeptide; high Ref YP hit to
FT                   hypothetical protein RD1_0870 from Roseobacter
FT                   denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92203"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP5"
FT                   /protein_id="ABV92203.1"
FT                   /translation="MRSLLLLLFCASLLATTASADRASFVDLAKRGWNYELRTTMVGRD
FT                   MSIPVHINGRDLAGASLCLVGEEPHPASLEIINSFRDLAHHVFGKPLPMRYAGRSATKC
FT                   GAGRTVVLRLYSGYPPNADLSNDLGWLNQVHQLGLPEGRRFAVSSPAMAQTFFGRRGQG
FT                   THIMVKQPALEQVGTLETLFYRSILIEELFQSFTFGMDILLFDRAAEFQSKLQELPINV
FT                   NRMNWESRAFMRNLLNSNPPGLCVFDVFMFHAVAQAPVDQTVDPAFIDFIDLQYDRLFS
FT                   EAQQTMKDPRFASIIAPGCRRPEI"
FT   gene            443039..443995
FT                   /gene="moxR"
FT                   /locus_tag="Dshi_0456"
FT   CDS_pept        443039..443995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="Dshi_0456"
FT                   /product="MoxR-like ATPase"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5 SMART: AAA ATPase KEGG: rde:RD1_0871
FT                   MoxR-like ATPase, middle swissprot hit to Protein moxR from
FT                   Methylobacterium extorquens and high Ref YP hit to
FT                   MoxR-like ATPase from Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92204"
FT                   /db_xref="GOA:A8LNP6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP6"
FT                   /protein_id="ABV92204.1"
FT                   /translation="MDTRPTPGDRGVAALSAHLAAGLVGHERLIESLLVALLADGHLLI
FT                   EGAPGLAKTRAVKWLADAVDGSFARIQCTPDLMPSDVTGTPVYKPQDGAFEFVRGPVFN
FT                   NLVLVDEINRAPPKVQSALLEAMAEHQVTAGVETYRLPEPFLVVATQNPIEHDGTFPLP
FT                   EAQLDRFLLHTVLELPGIETERRILELVEAETQAGVAPTLSLSLEALNAARAKVRAIHL
FT                   APELRDYIVRLVMATREGPLSEDVEHAVSPRGTLAMAAAARARAFLHGRDYALPEDVDE
FT                   LAGDALAHRMVLSWRAVADGRKPRDVVRDILTAVEPL"
FT   gene            443992..444900
FT                   /locus_tag="Dshi_0457"
FT   CDS_pept        443992..444900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0457"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; no
FT                   significant swissprot; high Ref YP hit to hypothetical
FT                   protein RD1_0873 from Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92205"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP7"
FT                   /protein_id="ABV92205.1"
FT                   /translation="MTDALSAPGVALRPDPLIALRRMVLAAKPPQVTAALPGGFATKRK
FT                   GHGLEVADLREYVAGDDIRHLDRGTTARTGRLHIRQFQEERDRVTLLVPDFRPAMLWGV
FT                   RRAFRSVAAAEALALIGWNVIESGGRVGLMTLGQGPPVIVPPAGRVRGMLKLIGGLVRA
FT                   HEAALAGMAAGQGQDQHLDLALSRADRLVPAGSEIVIASGFDAPGAALADRLNALGRRR
FT                   LPRLVMVTDGQGLPRGVYPIVTRDGQRLRVTLGGRAGNRGSVAALVQNVVGHPALVLDA
FT                   GADIEMTARSIAAAFPAERVA"
FT   gene            444897..445268
FT                   /locus_tag="Dshi_0458"
FT   CDS_pept        444897..445268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0458"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains;
FT                   middle Ref YP hit to hypothetical protein RD1_0874 from
FT                   Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92206"
FT                   /db_xref="GOA:A8LNP8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP8"
FT                   /protein_id="ABV92206.1"
FT                   /translation="MSDRALSEATMLASLRDIHLPASAPGGVWAELCVAVGLAALAALV
FT                   VAAVLRAFTVRRTGQGPVSLQDRVAALEALPDDARRVALLHVLRAYAPQRYADLRAALY
FT                   KPGPGVTLATLEAEVARLV"
FT   gene            445261..446223
FT                   /locus_tag="Dshi_0459"
FT   CDS_pept        445261..446223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0459"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A KEGG:
FT                   rde:RD1_0875 hypothetical protein; bad swissprot hit to
FT                   Uncharacterized protein BB_0173 from Borrelia burgdorferi,
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92207"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNP9"
FT                   /protein_id="ABV92207.1"
FT                   /translation="MFELAAPWILLLLPLPLVALRALRSAQVTGGALLVPDRVGAALIS
FT                   AGRPKGPAQMLTPRNAALWLIWALVLLAISGPRDLAPVSALKVSGRDLAIVLDLSGSMV
FT                   RDDFNLDDRAVTRLEAVKAVGADFARRRAGDRLALVVFGSEAYFASPFTFDTESVARRI
FT                   EEATIGISGRATSISDGLGLALKRLSTSTATSRVVILLSDGINNAGATNPRGVAELAAR
FT                   YGVRVHTIALGPKDLTTAEVGERGVVDAATLRAISQISGGESFRVRTTEDLVAVTEALD
FT                   RLEATDGDGLAAEVYREYWVWPASLALVIGVWFGWRELS"
FT   gene            446220..447119
FT                   /locus_tag="Dshi_0460"
FT   CDS_pept        446220..447119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot; NCBI
FT                   conserved domains: VWA domain (von Willebrand factor); high
FT                   Ref YP hit to hypothetical protein RD1_0876 from
FT                   Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92208"
FT                   /db_xref="GOA:A8LNQ0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ0"
FT                   /protein_id="ABV92208.1"
FT                   /translation="MIGFDVTLLRPNWLLALMPLAAFGWWVLSRRGGLGDWQRVVDPAL
FT                   LRAMAVLGRVDAQSSRAPLWALIGALAVILVALSGPALERRDTLSYRNLDGVLFVVDVS
FT                   ASVTEDARWPRMLTMGRFGLAALETRPGGLIVYGGDAYVATEMTGDHLQLGQTLSLLSS
FT                   DMVPDDGSRPERALALAAQLLADAEIIAGDVVLFTDGDGLGPASLQQAAQIAAQGARLS
FT                   LVSLKMPLSDFATHAAVGQGAVFTLDQTDAFADWIQEDARTRLEAQDYPLLFWKDLGRY
FT                   VLGIALIPLLLLFRKGTA"
FT   gene            447116..447790
FT                   /locus_tag="Dshi_0461"
FT   CDS_pept        447116..447790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="unsure GC frame plot, no conserved domains (except
FT                   for one signalpep. and one transmembr. region); good Ref YP
FT                   hit to hypothetical protein RD1_0877 from Roseobacter
FT                   denitrificans OCh 114; bad swissprot hit to Transposon
FT                   Ty2-GR1 Gag-Pol polyprotein from Saccharomyces cerevisiae;
FT                   Dshi_0463 transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92209"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ1"
FT                   /protein_id="ABV92209.1"
FT                   /translation="MKGLVLVAAAALAVAALLGGGAPLSRVLLAMGMPKLAAPLFTDAE
FT                   WQGVALYRAGEFDAAARAFSEARSFYNLGNAEAHRGQYAAALEAFDLADARRDPDARAN
FT                   FDVVAAYYAGLGIDPDALGLFPERKEGPQEDSFIARGDGRAAGTGSDVTNSNTMLGLAE
FT                   LDSRGQLGVRRVFDDQFMMADDRWLAQLSDVPGEYLAARISAEHKRRQKLGLSPPKAED
FT                   PR"
FT   gene            447787..448983
FT                   /locus_tag="Dshi_0462"
FT   CDS_pept        447787..448983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot; high
FT                   Ref YP hit to hypothetical protein RD1_0878 from
FT                   Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92210"
FT                   /db_xref="GOA:A8LNQ2"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ2"
FT                   /protein_id="ABV92210.1"
FT                   /translation="MKWLLACLLMLPGLALAQSSEVLPGELEISVEIEETEHTPMVREM
FT                   VLITLRGIYRRHITREEMVQPDLEGFSWTQLGTDTWREERLNGARVKTFTRRMAIYPDR
FT                   AGTLTIGSFTHKLTLTNEADEWFEHRIETAPVSLDVAPASAGQGPEWWFPVKKLEISDT
FT                   WSNAPDQLAPGEGVLRIVRVEALGATPEMLPPMPELTSPSAMIFPHPEKRFVELSPFGP
FT                   ISYAFWRWTIQPGNDTSTIVEPLTFRYFDTVTREDRKVTISAQRVAYGTVTPEASGNQQ
FT                   VPVSRVQAHLPGWPMGLLALLVFLGGSWLAVWGRQFAGLSGIHRFALFDPLSRELRRAA
FT                   RAGELAETRRCARKMLARDGVTPARAAMLRQFDEAAFDPEADSLDLQKFVRSFVAAKS"
FT   gene            449156..449422
FT                   /locus_tag="Dshi_0463"
FT   CDS_pept        449156..449422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0463"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein KEGG:
FT                   rde:RD1_3450 inverted repeat region; middle swissprot hit
FT                   to Insertion element ISR1 uncharacterized 10 kDa protein A3
FT                   from Rhizobium sp."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92211"
FT                   /db_xref="GOA:A8LNE3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNE3"
FT                   /protein_id="ABV92211.1"
FT                   /translation="MKRSRFSEEQIIGILKEHQAGLGAKELCRKYGISDATFYKWRSKY
FT                   GGMEVSDARRLKTLESENAKLKKMLAEQMMDVATLKEMLGKNF"
FT   gene            449446..450267
FT                   /locus_tag="Dshi_0464"
FT   CDS_pept        449446..450267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0464"
FT                   /product="integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region KEGG: rde:RD1_3449
FT                   integrase, catalytic domain, putative; good swissprot hit
FT                   to Insertion element IS476 uncharacterized 39.2 kDa protein
FT                   from Xanthomonas euvesicatoria and high Ref YP hit to
FT                   integrase, catalytic domain, putative from Roseobacter
FT                   denitrificans OCh 114; NCBI conserved domains: rve"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92212"
FT                   /db_xref="GOA:A8LNE2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNE2"
FT                   /protein_id="ABV92212.1"
FT                   /translation="MDWAMKTKGYNQRRACALAGIDPRVYRRRSKRLADTELRVRMKEL
FT                   ASERRRFGYRRLHMLLKREGWEVNWKKLYRLYRDEGLTVRKRGGRKRAVGTRTPMAIPQ
FT                   GPNQRWSLDFMSDALEDGRRFRVLNVIDDFSRECLAAVVDTSISGARVARELDRIAELR
FT                   GYPCLVVSDNGTELTSNAMLKWQEDRKVDWHYIAPGKPMQNGLVESFNGRMREECLNEH
FT                   LFPSLRHACRMIAAWRDDYNHHRPHSSLDGLTPREYHQRSREDQTLNRANL"
FT   gene            450313..451032
FT                   /gene="luxR2"
FT                   /locus_tag="Dshi_0465"
FT   CDS_pept        450313..451032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR2"
FT                   /locus_tag="Dshi_0465"
FT                   /product="two component transcriptional regulator"
FT                   /note="blast hits, no swissprot, Response regulator
FT                   containing a CheY-like receiver domain and an HTH
FT                   DNA-binding domain, PFAM: regulatory protein LuxR; response
FT                   regulator receiver; LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92213"
FT                   /db_xref="GOA:A8LNQ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ5"
FT                   /protein_id="ABV92213.1"
FT                   /translation="MQTSHPAIEARPVSSILIVDDHPLYSDALESALEMMFTGCDIRKA
FT                   QTLNAALETAQDGFDPDLVMFDLKLPDVTGVSGFKTLRNRLPDARFLVISSLASVELVQ
FT                   SLLNEGAAGFLPKDTSTARLRDALAKIAAGGTFVPKDFRKAETEGVEGPAAEFDHPKLA
FT                   ELTPQQQRIMRLICKGKPNKEIAYELSLAEATVKAHITALLRRLGARNRTEAVVVVEEA
FT                   MAAQRGDEPEARAFLRR"
FT   gene            451045..452202
FT                   /locus_tag="Dshi_0466"
FT   CDS_pept        451045..452202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0466"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745, no
FT                   significant swissprot, unsure GC frame plot; high Ref YP
FT                   hit to hypothetical protein RD1_0880 from Roseobacter
FT                   denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92214"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ6"
FT                   /protein_id="ABV92214.1"
FT                   /translation="MRDHLSDPSIIQVAVSRATAPQAAADDAASKINLPETRFVLAFVP
FT                   GEMPGDEVAAALDTALDGVPVFGCSTAGQITDKGYETEALLLLAFPKKHFRCSSLMLAP
FT                   LDPISPTALATTAQRHENEFQHTAGWNRLGLIFSDGVSQQEDVLVSTLEAVLSDLPIFG
FT                   GSAGDSLRFEKTFVLHKGASHSNSAVLLILETDLEFQGLGFDHFLPSGAPLVITGADPE
FT                   ARKVYEINGAPAAEEYARLVGCKLGDLSPKVFAENPMLVQYRDRHYVRAISDADDAGAL
FT                   SFMAAIDDGLIMTLGKGQEILQTLETGLRRRDRRGERPDFILGFDCVLRKLEIEQKQLA
FT                   RAVSNILCSSRVFGYNTYGEQYCGVHMNQTFVGVAFFKSDQGYII"
FT   gene            452199..454475
FT                   /locus_tag="Dshi_0467"
FT   CDS_pept        452199..454475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0467"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; middle swissprot to Sensor protein rcsC from
FT                   Salmonella typhimurium; high RefZP hit to putative sensor
FT                   histidine kinase protein from Sagittula stellata E-37;
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92215"
FT                   /db_xref="GOA:A8LNQ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ7"
FT                   /protein_id="ABV92215.1"
FT                   /translation="MSMVDPSDPPLVQIEKQARIIDALVRRANRQSDISPSAYRSFQSA
FT                   IDLQRQVAAQSLELETVRTERERTRKTLVEALSSMGEGVALFSDDRLNICNDLFRGLLP
FT                   DISHKFVPGLSLSRYLELVEVSERVVSTDRKLSVLRQTLKVRQSAGATTALMVELSDDR
FT                   WYQLSIQQTSVENTVVLMTEITALVRRNRREKEHLIDRQADYLAAVFQNMGSGVCSFSA
FT                   EGEVMMQNARFREILGVPLTLLQAGTPLSTLLDFLRTRALISEDAWLHVDAWRDELRRK
FT                   GALVRRVSHGSNRVLDVHANVLPDGGFLVELKDVTLETQTTELLENRVAARTAELTRAN
FT                   ARLTAEYEQKARVEEELRLSKERAEAAVSSKTRFLAAASHDLLQPINAAKLLISTLQEA
FT                   TRETSFQPMVKRLKGAFSSAENLLHSLLDISRLESADPEAVSLMAVDLGALMESVRDDQ
FT                   SPLAARKGVRLTVVPCSLFVRSDPVYLMRSIQNLVVNAVQYTEPGGRVLVGGRRKGGHV
FT                   VLEVWDTGVGIAKKDQARIFEEFTRGDDVQLGSGVGLGLSIVDRACRLLGHELSVRSKP
FT                   GCGSVFRMKIALVDGVPIRRKTQSAAADDGGQPIDHIVMVIENDEDVLYGTTQWLEQWG
FT                   ASVLAARSTEEALAHVNDMGIPPDIILADYQLDGPDTGISAISAIRSLTGSDVPAIMIT
FT                   ADRSDLVRRLGIENDLTVMTKPAALSRLRPLIDWTIQRHAASVEHGRSHLRTQLQTKVG
FT                   GDSGL"
FT   gene            454509..455171
FT                   /locus_tag="Dshi_0468"
FT   CDS_pept        454509..455171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot; high Ref YP hit to
FT                   hypothetical protein RD1_0882 from Roseobacter
FT                   denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92216"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ8"
FT                   /protein_id="ABV92216.1"
FT                   /translation="MRTILMSLTIGAWLCAAPALAAPLEGEKTYDLLFRQGTLDTISRS
FT                   SELVYRRTVKNSLKPEAAERDTGDIALSFRQGEAVMALLEFRQGGKYRTLGTFPASVGN
FT                   PMIMYFYETVVRDMAETAGGSPFYIRNRVKEALVEPSEIIAGEAIIDGKTVETSTIRML
FT                   PFEGDPNVDRMRGFGDLELQVTMSEAVPGWYMSMEAKASNGEVYSNTLDFERLDVAR"
FT   gene            455168..455518
FT                   /locus_tag="Dshi_0469"
FT   CDS_pept        455168..455518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, good ref YP hit to
FT                   hypothetical protein RD1_0883 from Roseobacter
FT                   denitrificans OCh 114; no conserved domains (except from
FT                   signalpep.)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92217"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNQ9"
FT                   /protein_id="ABV92217.1"
FT                   /translation="MKQLALLAALMAIPAVAHADTVAERLNDFPTAARADYVFACMVAN
FT                   GQTREMLDRCSCSIDEIAAILSYEDYLAAETVLSMRRVGGERMSFFQSAAMAENIVAEL
FT                   RRAQAEAEVICF"
FT   gene            complement(455582..456454)
FT                   /gene="soxZ"
FT                   /locus_tag="Dshi_0470"
FT   CDS_pept        complement(455582..456454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxZ"
FT                   /locus_tag="Dshi_0470"
FT                   /product="sulphur oxidation protein SoxZ"
FT                   /note="PFAM: Sulphur oxidation protein SoxZ ; no
FT                   significant swissprot; good Ref YP hit to Sulphur oxidation
FT                   protein SoxZ from Sinorhizobium medicae WSM419; NCBI
FT                   conserved domains: SoxZ and PRK07474, sulfur oxidation
FT                   protein SoxY"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92218"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030831"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR0"
FT                   /protein_id="ABV92218.1"
FT                   /translation="MSFCMFLWHVCQAWTREEEIMAQKLVCAVAVATLTAGWAWAGETV
FT                   QNPLTASATWEDLREDVLGDVALMSADGLLSMDAPYRAHDAATVPIQLKQTDPSTRIHA
FT                   ATVVVDENPAPVAGLFTFGEGMGTLDFELRVRVDQYSNVRVIAETADGFHMTGRYVKAS
FT                   GGCSAPATKDAAAALANMGQMKLKSFDSDVQMSMPRREAQIMIRHPNYSGLQRDQITQL
FT                   FIPAHFIDHLEVWQGDEMLFSMEGGISISENPVFRFGYDDNGAEDLTVKATDTDGNSFE
FT                   ARLPKKVTS"
FT   gene            456517..457557
FT                   /locus_tag="Dshi_0471"
FT   CDS_pept        456517..457557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0471"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rde:RD1_0885 hypothetical protein; no significant
FT                   swissprot, unsure GC frame plot; high Ref YP hit to
FT                   beta-lactamase domain protein from Sinorhizobium medicae
FT                   WSM419; NCBI conserved domains: GloB, Zn-dependent
FT                   hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92219"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR030829"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR1"
FT                   /protein_id="ABV92219.1"
FT                   /translation="MFEAIVTLCLSLESGPCRDHLLPGFEAASASACVARLGQSPPNLH
FT                   IAGLVAKGAPQCAPTGTTFEMAEVAEGVFVHRGAVAEPDMNNRGNVSNLGFVVGERSVA
FT                   VIDSGTARWMGEATWRAIRAVTDKPVSHVILTHMHPDHVFGASVLVEGGALAVGHRDLP
FT                   RALIDRQVNYLASLARLIGAETMLGTEVTLLDDFVETTAEIDLGGRVLELETWPTSHTG
FT                   TDLTVLDRESGILFAGDLVFDRHTPALDGSLLGWRAVIAELAQREITGVVPGHGGPLLE
FT                   WPVGAADMARYLGVLERDTRRALDAGERLGEAVARIAAEEQEYWELFEAYNPRNATVAF
FT                   TELEWE"
FT   gene            complement(457583..458197)
FT                   /locus_tag="Dshi_0472"
FT   CDS_pept        complement(457583..458197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, high
FT                   REf YP hit to hypothetical protein RD1_0886 from
FT                   Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92220"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR2"
FT                   /protein_id="ABV92220.1"
FT                   /translation="MLRPLAVALAILLPSLPALAADYSDPTWPCVQRKVENLSPGLMWA
FT                   FPLDPKTVTPDKARDADVAELAGYLGLRSVTLEELEPRVAAFAQAYNGDTETLGLVFHD
FT                   VFDNLSKRRSRIISGIEDFSLSQIALAEKIDGNRLAMDAEMAKDAPNFDVIDALEETID
FT                   WDQIIYTDRQRNITYLCETPTLLERRLFGIAQMLQRVAVVD"
FT   gene            458365..459477
FT                   /locus_tag="Dshi_0473"
FT   CDS_pept        458365..459477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0473"
FT                   /product="alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="TIGRFAM: Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; high swissprot hit to
FT                   Alcohol dehydrogenase class-3 from Rhodobacter sphaeroides
FT                   2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92221"
FT                   /db_xref="GOA:A8LNR3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR3"
FT                   /protein_id="ABV92221.1"
FT                   /translation="MRTRAAVAVAAGQPLEVMEVNLDGPKAGEVLVEVKATGLCHTDEF
FT                   TRSGDDPEGIFPAILGHEGAGIVIEVGEGVTSLEVGDHVIPLYTPECRECEYCLNPKTN
FT                   LCQKVRATQGQGLLPDATTRFSMLDGTPIYHYMGCSTFSNHTVVPEIALAKVRKDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGSRGIVFGLGGIGLNVIQGLRLAGADQIVGVDLND
FT                   GKIEMARHFGMTDFVNPSKVEGDLVAHLVDLTGGGADYTFDATGNVQVMRAALESAHKG
FT                   WGESIIIGVAPAGAEIATRPFQLVTGRVWRGTAFGGARGRTDVPKIVDWYMDGKIEIDP
FT                   MITHKLTLDEINHGFDLMHKGESIRAVVEF"
FT   gene            459481..460308
FT                   /locus_tag="Dshi_0474"
FT   CDS_pept        459481..460308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0474"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: rde:RD1_0888 S-formylglutathione hydrolase,
FT                   putative TIGRFAM: S-formylglutathione hydrolase PFAM:
FT                   putative esterase; good swissprot hit to
FT                   S-formylglutathione hydrolase from Mus musculus; high Ref
FT                   YP hit to S-formylglutathione hydrolase, putative from
FT                   Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92222"
FT                   /db_xref="GOA:A8LNR4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR4"
FT                   /protein_id="ABV92222.1"
FT                   /translation="MVDLVAENRSFGGTQKVFSHRSSTCNCDMTFAAYLPPQISEGPVP
FT                   VLWYLSGLTCTHENAMVKGGFQEHAAKNGIAVVFPDTSPRGDGVADDDAYDLGQGAGFY
FT                   VNATRDPWKPHFQMYDYVLQELRGIVLETLPVQDRHGITGHSMGGHGAITMALRNPDMF
FT                   TSLSAFAPISHPTQSDWGRKQLSAYLGDDEAAWSAHDSTILLKEHGWKGDLLVDQGASD
FT                   QFLDLLKPEALAEAMIARRQPGQVRMQAGYDHSYFFVSTFAQDHVEWHAARLN"
FT   gene            460328..460729
FT                   /gene="cytC"
FT                   /locus_tag="Dshi_0475"
FT   CDS_pept        460328..460729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytC"
FT                   /locus_tag="Dshi_0475"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; low swissprot hit to
FT                   Cytochrome c-552 from Paracoccus denitrificans; high Ref YP
FT                   hit to cytochrome c family protein from Roseobacter
FT                   denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92223"
FT                   /db_xref="GOA:A8LNR5"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR5"
FT                   /protein_id="ABV92223.1"
FT                   /translation="MNRILAAATCLVTLPVLAMAAGDITVDAAAGEKVFRTGKAYHQVS
FT                   VDAESRASPRLNGAVDRAVGSIEGFSYSDAFVVLNAEGTIRSTEKFAAFLAKPKNFEKG
FT                   TMIAFAGLRKKEDRKNMIAYLATCWVEGM"
FT   gene            460857..462659
FT                   /gene="gcd"
FT                   /locus_tag="Dshi_0476"
FT   CDS_pept        460857..462659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="Dshi_0476"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; high swissprot hit
FT                   to Putative dehydrogenase xoxF precursor from Paracoccus
FT                   denitrificans; high Ref YP hit to Pyrrolo-quinoline quinone
FT                   from Rhodobacter sphaeroides ATCC 17025; NCBI conserved
FT                   domains: pqqDH"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92224"
FT                   /db_xref="GOA:A8LNR6"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR6"
FT                   /protein_id="ABV92224.1"
FT                   /translation="MRRFSLLTSGIALCAATVAYANDDLITQMDDSKQWAIQTGDYKNH
FT                   RYSELDEINAENVGDLQVAWTFSTGVLRGHEGSPLVIGDTMYVHTPFPNIVYALDLSNE
FT                   GKIIWKYEPKQDPDVIPVMCCDTVNRGVAYADGKIFLHQADTKVVALDANTGDVLWEVQ
FT                   NGDPSIGETNTATVLPVKDKVIVGISGGEFGVRGHVTAYDINSGELVWRAYSLGPDDDM
FT                   LVDPENTTHLGKPIGENSSLNSWEGDQWMIGGGTTWGWYAADMEENLFYYGTGNPSTWN
FT                   PAQRPGDNRWTMTVMARDIDTGMAKWFYQMTPHDEWDYDGVNENILTEQEFDGEMRKLL
FT                   TRFDRNGLAYTMDRVTGELLVAEKFDPVVNWTTGVDMDPNSETYGRPQVVAQYSTAQNG
FT                   EDVNTTGICPAALGTKDQQPAAYSPKTQVFYVPTNHVCMDYEPFRVSYTAGQPYVGATL
FT                   SMYPAPDSHGGMGNFIAWDNINGEILWSIPEKFSVWSGALATAGDVVFYGTLEGHLKAV
FT                   HADTGEELYRFKTPSGIIGNVMTYEHDGRQYVGVLSGVGGWAGIGLAAGLTNPNDGLGA
FT                   VGGYAALSDYTALGGQLTVFALPN"
FT   gene            462744..463289
FT                   /gene="cccA"
FT                   /locus_tag="Dshi_0477"
FT   CDS_pept        462744..463289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cccA"
FT                   /locus_tag="Dshi_0477"
FT                   /product="cytochrome c protein"
FT                   /note="SSF46626 Cytochrome c, monohaem; NCBI conserved
FT                   domains: CccA, Cytochrome c, mono- and diheme variants,
FT                   good swissprot hit to Cytochrome c-553I precursor from
FT                   Paracoccus denitrificans; good Ref ZP hit to putative
FT                   cytochrome c protein from Sagittula stellata E-37"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92225"
FT                   /db_xref="GOA:A8LNR7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR022411"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR7"
FT                   /protein_id="ABV92225.1"
FT                   /translation="MMMRSAAPLAIVAAATAALTATVVFAANWSDQDVDPEGDYPEVPV
FT                   AYSEGGRYFTEDDIPTFNIAEDGTVDWLTFNGFRRYHAECHVCHGPDGEGSTYAPKIKN
FT                   SAIHMGYYDFYDVVVNGRAVGNSVMPHFGDNRNVMCYLDDIYVYLKARAVDAVPRGRPA
FT                   KKEAKSDMIREEEDGCMG"
FT   gene            463273..464121
FT                   /locus_tag="Dshi_0478"
FT   CDS_pept        463273..464121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0478"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family ;
FT                   NCBI conserved domains: PbPb; low swissprot hit to Protein
FT                   moxJ precursor from Methylobacterium extorquens (May be
FT                   involved in the assemblage of active methanoldehydrogenase
FT                   and/or its cofactor PQQ in the periplasm); high Ref YP hit
FT                   to putative methanol oxidation protein from Roseobacter
FT                   denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92226"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR8"
FT                   /protein_id="ABV92226.1"
FT                   /translation="MAAWADVLCRLTVTLSVGLAISSGGVAAQTSDLVSTNALRVCADP
FT                   ANLPMSAKTEDGFENRLAELVGSKLELPVQYTWYPMATGFVRNTLNAKKCDLVIGYAQG
FT                   HELVLNTNHYFTSVYSLIVPAEGDLAGVTSLDDPSLQGRRIGIVAGTPPSAHLARNGLV
FT                   GKAKAYNLVVDRRHESPAVDMLNDLEAGDIDAAILWGPIGGPLVKQHHPNLKLIPLVNE
FT                   TLPPRLFFRITMGVRQGEKVWQRRLNSLIRRHQDEINAVLFEAGVPLVTDLGKEVIEPP
FT                   Q"
FT   gene            464118..464666
FT                   /locus_tag="Dshi_0479"
FT   CDS_pept        464118..464666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot, good
FT                   gb hit to hypothetical protein RLO149_07849 from
FT                   Roseobacter litoralis Och 149; NCBI conserved domains:
FT                   RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92227"
FT                   /db_xref="InterPro:IPR022376"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNR9"
FT                   /protein_id="ABV92227.1"
FT                   /translation="MIRRLALLLWLPLAAAAQPVPEPEDYRMDHYRAPVPATLSGAAVV
FT                   GPEAAYALWLGGETVFIDVMPQAPRPANLPEGTLWRDKPRYSIPGSIWLPNVGYGALAE
FT                   ITEQYFRDGLARATGGEKTHPILLFCLEDCWMSWNAAKRALAWGYTAVHWLPEGSDGWM
FT                   LWDYPLERITPEEPQPQSN"
FT   gene            464801..465967
FT                   /locus_tag="Dshi_0480"
FT   CDS_pept        464801..465967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0480"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot;
FT                   middle gb hit to hypothetical protein RLO149_03449 from
FT                   Roseobacter litoralis Och 149; no conserved domains
FT                   detected (except for one signalpep. and transmemb. region)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92228"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS0"
FT                   /protein_id="ABV92228.1"
FT                   /translation="MEDKKIFAAFGAVIGILLVFAVGRGLSGGDDTAALLDARTAPLTE
FT                   AVADLESRLNAVQSRLDGELVKVQDAMDSRLADLQGAVDALVDQASGALAEEDLAALRI
FT                   RLEELAMQSGDLSEMVAALGAASPPEKTLAPANEQASAPANEPAEEEAPGAPGLMPGQT
FT                   ALFADGAVRVFVSRLDPGANSLRASINGDRKTLREGIWRTVASGDGHCRITLEGLSRNG
FT                   ASISALCGDELPAAEGISPGETTILNDGSLRVFASRVTEDAARLSVNGEKVVLAAGDRA
FT                   TVMAGAQSCRLTLAQVDRGHATVGAECTDAVWQSAELGAGEAAILGDGAARVFVSLVQP
FT                   DGTARIAVNGLALSTAQSGQTTAMADNCDLTVGDVSRRAAQFSFACYN"
FT   gene            complement(466019..466831)
FT                   /locus_tag="Dshi_0481"
FT   CDS_pept        complement(466019..466831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, high Ref YP hit to
FT                   hypothetical protein RD1_0894 from Roseobacter
FT                   denitrificans OCh 114; NCBI conserved domains: COG5501,
FT                   Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92229"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030831"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS1"
FT                   /protein_id="ABV92229.1"
FT                   /translation="MTRLTLTTALLCCTALPALAGAEAWDDIRAALYGDRLLLDGAKVI
FT                   AIDAPYRTPDDARTDLAAQIIPPLGTEVSKVWVVLDENPMPVSAVFELKDPQPSFFFDV
FT                   TMRVNGPTPLHVVAETSDGRLFVQESFVKTSGTGACAAPPGTDPIAALTSLGEIDVSLG
FT                   SALPGIAEGELISFASQLSRMDVDISHPSHSGMQRDQISLLFIPMRYVESIDIDLDESG
FT                   FVEMTGSISLSENPRVGLSIPSSSRSVDVTMTDTDGTVSKLHQKLAGY"
FT   gene            complement(467299..467784)
FT                   /locus_tag="Dshi_0482"
FT   CDS_pept        complement(467299..467784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot; no
FT                   conserved domains; good Ref YP hit to hypothetical protein
FT                   RD1_0897 from Roseobacter denitrificans OCh 114"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92230"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS2"
FT                   /protein_id="ABV92230.1"
FT                   /translation="MKEILLVTLLWTTCAAAQDKVAFFGLTMLDTSPQTAALGPDPAEA
FT                   ARLEALEKVVAERFQAEGYELVDLAPEKVAIDRVANLAKCYGCDTRIAQRLGAGFSLVG
FT                   EVQKVSNLILTMNLQLRDANSGDLVKGGVVDIRGNTDDSWSRGMRYILNNRIFKDEK"
FT   gene            467943..469130
FT                   /locus_tag="Dshi_0483"
FT   CDS_pept        467943..469130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot
FT                   (N-terminal); SSF53822 Periplasmic binding protein-like I;
FT                   high gb hit to hypothetical protein RLO149_07824
FT                   [Roseobacter litoralis Och 149]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92231"
FT                   /db_xref="InterPro:IPR022478"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS3"
FT                   /protein_id="ABV92231.1"
FT                   /translation="MRLLLAPLLAAFSLLTSAPVALAIDVRAAVLRVDYQTLLPISRYD
FT                   LRPEDLGFAGAALADEDNGTTGSFLGHTYETRAVATTAADAGEALEALLAEGVDIIVIL
FT                   ARFEDLLRLTDRAAEAGALVFNALAPDMALRDDQCRGNLLHTAPSRRMNTDAVAQFLVW
FT                   KQWKNWFLISGSNPADVALADSYRFSARKFGARITEERVLEYSGGSRRTDSGHVLVQRQ
FT                   LPNFTQGAAGHDVLVAADETDYFARYLSYHLWTPRPVAGSGGLVPTTFHGAHEAYGATQ
FT                   FQTRFEALAGRYAKPEDYNVWLALRVVGEAVTRANTANPMELRDYAISDAFELAAFKGQ
FT                   KVTFRDWNGQLRQPILLHDGSITVSVSPQDGFLHQHSALDTLGLDEPESACSAFK"
FT   gene            469158..470129
FT                   /locus_tag="Dshi_0484"
FT   CDS_pept        469158..470129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0484"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; SSF50969 Quinoprotein amine dehydrogenase,
FT                   beta chain-like, no significant swissprot, high Ref YP hit
FT                   to 40-residue YVTN family beta-propeller repeat protein
FT                   from Sinorhizobium medicae WSM419"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92232"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022456"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS4"
FT                   /protein_id="ABV92232.1"
FT                   /translation="MKTILLSVAILALGTAQGLAGRAFVSNERGNTITVVNTDTWEVET
FT                   EFFAGNRPRGITVSPDEKVIYVCASDDNLIRVFDATTYEELPSLPSGPDPELFILEPSG
FT                   KRLYIANEDDNLVTVTDTETRMVLAEVPVGVEPEGMGMSPDAKWVVNTSETTNMAHFIS
FT                   TEDYKIKHNILVDQRPRYAHYTSDGTRLFVTSEIGGTVSVMDIDEDGAPTVVGKISFEV
FT                   AGLQPEWLQPVGARVTKDGSRLFVALGPANRVAVVDARSLEVLDYILVGQRVWQLDFTP
FT                   DEKYLLTTNGNSNDITVIDVEKERAIRSIQVGQQPWGVVTVN"
FT   gene            470179..470616
FT                   /locus_tag="Dshi_0485"
FT   CDS_pept        470179..470616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains, high
FT                   Ref YP hit to hypothetical protein RD1_0900 [Roseobacter
FT                   denitrificans OCh 114]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92233"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS5"
FT                   /protein_id="ABV92233.1"
FT                   /translation="MRHLICAAALTCFGGPLAAAPLCDDLGFAGLLASCNRGETIQLTL
FT                   ASGKPLGEDVVLESGAYYKLEITADGSAELAIEGPSFFRAIWMNEIVINQIEIRPMAID
FT                   SIEFDKAGVAELSFIAIKPGRHVLRIPGSTGESQSVTLSIQ"
FT   gene            470635..470883
FT                   /locus_tag="Dshi_0486"
FT   CDS_pept        470635..470883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains,
FT                   middle gb hit to hypothetical protein RLO149_07809
FT                   [Roseobacter litoralis Och 149]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92234"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS6"
FT                   /protein_id="ABV92234.1"
FT                   /translation="MKPILAFTAAMVVASTGFASEVDEATEMKIMAMLAEMECQMDADD
FT                   IEVEDDGYDLDDVICKGGNQFDIKLDKEFNEVSRRAE"
FT   gene            complement(471449..472675)
FT                   /locus_tag="Dshi_0487"
FT   CDS_pept        complement(471449..472675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0487"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; bad Ref XP hit to TPR
FT                   repeat protein [Entamoeba histolytica HM-1:IMSS]; InterPro
FT                   Scan: G3DSA:1.25.40.10 Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92235"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS7"
FT                   /protein_id="ABV92235.1"
FT                   /translation="MQDETHFETGHSGRFPLPDRVHGRCATSGAAASLPAERVAVLIRL
FT                   VLLLALWAPATALAQACTSDPEVCNQILSAKQDNDAGAPKDALDHLRKAQDTAGIDTQW
FT                   VVYLLGQKATAYSQSGNSEQSLAAIASALEFRPNDVWLLLQSCRLHAASSFLAKAQRDC
FT                   ARVRTLMRRTKDKDLQAVQMAHLVHAEAQLALIMRYPDLALEKLESLDGSGIPPRFIDD
FT                   LRASALSMLGDHAAAKQALDRVLALATDEPEASRAALYQRRGFEQIALGTVDAGLVDLE
FT                   TAVATAREVDDTVPDRDSALAQYLYGLCAVHLQREAAEAALEWCGALSETETGQTSHVF
FT                   LDAYGLAQMRNGLYEAAAETFAKALDLVPRSTQSYRHLQQSVRLAQDSGLPLVLDDYVD
FT                   DRVRLLQPN"
FT   gene            complement(472665..473018)
FT                   /locus_tag="Dshi_0488"
FT   CDS_pept        complement(472665..473018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0488"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains
FT                   (except for two transmembr. regions); good RBS site :
FT                   AGGAT"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92236"
FT                   /db_xref="GOA:A8LNS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS8"
FT                   /protein_id="ABV92236.1"
FT                   /translation="MPEDTPPPQSTSKRPATPVEQSPIDPVPSPTADPPPGQEESEDRF
FT                   LRRFVVITATLVASTIAIGIIFITALLPFYSDQNAPEQLVNWGGIIIGFYFGTFASLLK
FT                   DWLSSNKSTGGAR"
FT   gene            complement(473039..474289)
FT                   /locus_tag="Dshi_0489"
FT   CDS_pept        complement(473039..474289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0489"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, unsure GC frame plot;
FT                   NCBI conserved domains: mncomplete BisC domain, Anaerobic
FT                   dehydrogenases, typically selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92237"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNS9"
FT                   /protein_id="ABV92237.1"
FT                   /translation="MRVFVVISALCISIVTSSFDAQAFNKSRIKGTIFVRNAAGETIPI
FT                   PWQDAEELRRIINFEGRHFDLDTRLYMVDLDHKKIEKVEEEFFDFSTMLLDDIYAPAKV
FT                   YLKVFHEGYFLETPIYDFHRHDGDWPVGTLYIERRYFNDGERRQEVLDFLDSNSFTESE
FT                   ASDTLNVLGSLLADRADPEDFQLLVQMVSKLIRDNGRLPPDLVGDLQRLAATRMVGGRG
FT                   FTRFAELETAAQFDVLFGLGFWLTRAPEPKQPVLPNLTYYQLAQQFFDATVELAFSHAA
FT                   ELDRFAVASAFQEYYKLECALGLPEDCFTVIGDFIALLEEFESQGMSFPNRRKKTFLAD
FT                   YRVKVEDLSEYGTGRDITDGAFVARMAANTEMRAYWQGFFDAARSGPMEPVVSASPGLS
FT                   RTVRLAEDILNQPVVTN"
FT   gene            475571..475996
FT                   /locus_tag="Dshi_0490"
FT   CDS_pept        475571..475996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0490"
FT                   /product="protein of unknown function DUF454"
FT                   /note="low swissprot hit to Inner membrane protein ybaN
FT                   from Escherichia coli K12; low Ref YP hit toprotein of
FT                   unknown function DUF454 from Rhodobacter sphaeroides ATCC
FT                   17029; PF04304 Protein of unknown function DUF454; NCBI
FT                   conserved domains: DUF454, Protein of unknown function
FT                   (DUF454). Predicted membrane protein; unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92238"
FT                   /db_xref="GOA:A8LNT0"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT0"
FT                   /protein_id="ABV92238.1"
FT                   /translation="MVGSVGAVLPVLPTTPFVILGAVCLGRGSPRLAQRLERHRVFGPA
FT                   IADWRAHGAIAPRGKAVAHLMMGAALIVSLLAGVPGLVLALQAICLLAASFYILSRPNG
FT                   GRDLREPGAFAAPARSPRPCGARQSGDSPWTTPSLWH"
FT   gene            476139..477122
FT                   /gene="ssuA1"
FT                   /locus_tag="Dshi_0491"
FT   CDS_pept        476139..477122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA1"
FT                   /locus_tag="Dshi_0491"
FT                   /product="putative sulfonate/nitrate transport system
FT                   substrate-binding protein"
FT                   /note="low swissprot hit to Putative aliphatic
FT                   sulfonates-binding protein precursor from Escherichia coli
FT                   K12; good Ref YP hit toTwin-arginine translocation pathway
FT                   signal [Paracoccus denitrificans PD1222]; COG0715 -
FT                   ABC-type nitrate/sulfonate/bicarbonate transport systems,
FT                   periplasmic components;TIGR01409 Twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92239"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT1"
FT                   /protein_id="ABV92239.1"
FT                   /translation="MTFLSRRSTLALLGTAAGALALPRSAAAQPIPRLALYGPPAGPSI
FT                   TLAHAVKTGMLSDIAEETLFTPWRSPDELRAGLTSGEILVSVVPIQAAANFYNRGFPIR
FT                   LENAMTNGLLYIIAEETGIATIPDLAGRHIAVPFRGDTPEIIFSQLLDHHGMRAEDLKI
FT                   TYAGTPTEAMQLMLAGQVDAALTAEPSTTAAVLRGREAGKQIRRAINLQAVWGEMTGAA
FT                   PVLPQAGLALTPTFLDTYGDAVPALLAALEQATADVLANPEAAAAHATEALGLPAPLLA
FT                   ASIPNSNLVARPANEARADIERLLAAMAGPDLARIGGAMPDDAFYL"
FT   gene            477181..478005
FT                   /gene="ssuC1"
FT                   /locus_tag="Dshi_0492"
FT   CDS_pept        477181..478005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC1"
FT                   /locus_tag="Dshi_0492"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   permease protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; COG0600, TauC, ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system, permease
FT                   component; low swissprot toNitrate transport permease
FT                   protein nrtB from Phormidium laminosum; high Ref ZP hit
FT                   toBinding-protein-dependent transport systems inner
FT                   membrane component [Paracoccus denitrificans PD1222]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92240"
FT                   /db_xref="GOA:A8LNT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT2"
FT                   /protein_id="ABV92240.1"
FT                   /translation="MSHLLLISLVTRVGRVGAFLWSGWAGLAALALLFAVWQAGHEAYG
FT                   PFILTSPLDTMQTVASLAGDPAAWKIAALTLQRAVSGFFLVAAVGTALGVAAGYFPAVL
FT                   RLVTPLVTVLLGVPPIAWIVLAMIWFGGSDATVRTVILISALPVVFMGAARGITTRDRL
FT                   LDRMASVFGAGPVRRFMTIGLRQTTTTLFPALALALGTAFKVAVMAELLANAGGIGGAL
FT                   ADARINLDIGLALAWVLIAVALLIVVEYTLVQPVKAEIDRWRHAAQPWGVKR"
FT   gene            478002..478751
FT                   /gene="ssuB1"
FT                   /locus_tag="Dshi_0493"
FT   CDS_pept        478002..478751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB1"
FT                   /locus_tag="Dshi_0493"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding"
FT                   /EC_number="3.6.3.-"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase;
FT                   COG1116 - ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component; NCBI conserved domains: ssuB;
FT                   middle swissprot hit to Aliphatic sulfonates import
FT                   ATP-binding protein ssuB 1 from Xanthomonas axonopodis pv.
FT                   citri; good Ref ZP hit to ABC transporter [Paracoccus
FT                   denitrificans PD1222]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92241"
FT                   /db_xref="GOA:A8LNT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT3"
FT                   /protein_id="ABV92241.1"
FT                   /translation="MTTLQLSGIGHAFLGRTVLDTIDLSVAQGEIVALVGPSGCGKSTL
FT                   AHIAAGLIEARAGRISHGYTRHAMIFQDPALIPWATAAGNIDYVLRMARVPRAARPTRI
FT                   AQAAAQVALLAEDLNKYPVELSGGMRQRVAIARALAIRPDFIYFDEPFTALDVALRRRM
FT                   QDLVIATCAGGHLSGLFITHDLSEAARIAHRIAVLDTHGRGILGHRPLIGNPCDRSDDA
FT                   VFDWVQTATHTDPIFRHIHDVDERQVA"
FT   gene            478748..480028
FT                   /gene="nnrS"
FT                   /locus_tag="Dshi_0494"
FT   CDS_pept        478748..480028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nnrS"
FT                   /locus_tag="Dshi_0494"
FT                   /product="NnrS family protein"
FT                   /note="PFAM: NnrS family protein KEGG: pde:Pden_4166 NnrS
FT                   family protein; no swissprot; good gb hit to NnrS
FT                   [Rhodobacter capsulatus]; NCBI conserved domains: NnrS"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92242"
FT                   /db_xref="GOA:A8LNT4"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT4"
FT                   /protein_id="ABV92242.1"
FT                   /translation="MSCGPATGRSRPLPRGPLATLGDEGFRLFFLLGALYAAQFPALWV
FT                   LAWGLDLPMAQDVPPALWHAHEMLIGAFGAALIGFVTTAAPEWTDTEPPRGRPLWALAG
FT                   LWAVGRTVGLFGWDAFGAVGALADLGWMCALTVWLGVLSIRRRTDRLVAFIAWLAILTV
FT                   CTAVGHFGFATGNLTLATQSIHLAGFALLGLLGLALSRITAPVTNLVLDPTERTSPFRP
FT                   HPGRLHLAPGLVLVVMAGDLLGVSPAVSAWLLVAAGAAFMDRVGEAFIGREIAMAEILL
FT                   LAGSSALAGLGLILAGAARLGAPWPEVTGLHIAFMGGLGLGVYAVYCIAGLLHTGRPLG
FT                   LSRAARLGAGMLVASVMLRVAPDLGLSLPLPAPALASGTWTAAFLLWAIAYWPALSRVA
FT                   LPEGPPDRAASKPHLPAAPVRFPEAAE"
FT   gene            480087..480497
FT                   /locus_tag="Dshi_0495"
FT   CDS_pept        480087..480497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0495"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; low Ref NP hit to
FT                   ferrienterobactin-like protein [Agrobacterium tumefaciens
FT                   str. C58]; Pfam07715 TonB-dependent Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92243"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT5"
FT                   /protein_id="ABV92243.1"
FT                   /translation="MLLLRPLTATVVEALMPTLALGQSATPGTTIELEPIVIDGTSGAL
FT                   ATAEERQRDTPGGTDLLRAETYRDKATVTLSDVLDGAPGVVVQDFFGGFDQPASRSAPR
FT                   PRDRILSRWRSVPAGWSAAERSCRFLGVGPID"
FT   gene            complement(480704..482722)
FT                   /locus_tag="Dshi_0496"
FT   CDS_pept        complement(480704..482722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0496"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; no significant swissprot, unsure GC frame plot;
FT                   high Ref ZP hit to putative ferredoxin [Loktanella
FT                   vestfoldensis SKA53]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92244"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT6"
FT                   /protein_id="ABV92244.1"
FT                   /translation="MIKANANRTILTCTCENTMSPDEGALAKAGCAAGGSVNQLCRANL
FT                   DNFRAALAKGLPVTVACTQEAPLFSEVAADEAPDLPLSFANIRETAGWTAQAATSGPKM
FT                   AAMIAAAAVAPAPFGVTTLDSTGVTLILGRDEVAIEAADALSEHLDITVLMQPGSQITP
FT                   PMQTRFPVLQGRIRTALGHLGAFTLTVDDYAAPSPSSREVLKFEAARDGAVSRADLVVD
FT                   LTGTQPLFAAHDLRPGYLRADPKNPRAVADLIAKAGQMVGTFDKPVYIDFLADLCAHSR
FT                   NGITGCTRCLSLCPTGAITPNGDSVQIDPAICAGCGQCAAACPTGAAAYALPDVATVAA
FT                   RLRAALKAWHDAGGTTAPVILLHDADHGEPLINASGRYGNGLPAHVIPLGLNEITQAGP
FT                   EVLAAAFAYGAGAVALLGRAKPLHDVDGLRAGIELVTGVAEAMGHGPVTLIETDDPDAL
FT                   EAALDVLPKSAVHAAPSSFLPPADKRGLLVMAFAEMNRAAPKPAQTLPLPQGAPFGSVT
FT                   VDPEACTLCQACTGVCPTGALLDNPETPMLRFTESACVQCGLCAATCPETAITLTPQLD
FT                   FAAWDTPRRILHEEPPFCCTVCGEAFATRSGIDRVKSRLVDHWMFQGETGAARLKVLSM
FT                   CEDCRVQEIVNQGFDPHGETIRKVRTQADYGDGYEDS"
FT   gene            482822..483556
FT                   /locus_tag="Dshi_0497"
FT   CDS_pept        482822..483556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot, no
FT                   conserved domains; good Ref ZP hit to hypothetical protein
FT                   SKA53_09144 [Loktanella vestfoldensis SKA53]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92245"
FT                   /db_xref="GOA:A8LNT7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT7"
FT                   /protein_id="ABV92245.1"
FT                   /translation="MLQGQAAVLDDHSAPRTLVLPPPYTAHWLAKGDALAHACHLAPEH
FT                   GAGTLVWHASSGGHMPGRFDFAVVLEPETPLTEARKAFVLGMVALGEALAAHCPPERAV
FT                   EFGWPGELRLDGGRLGGMRLSVAPDTAEEAVPNWMVLGVELIADRDHLTAPGSKPESLS
FT                   LKEEEFLDPPAVLESFAAYLMLNFDRLKHEGFDAVATRYVGRLTSEGTLTAEGDLQTAD
FT                   DLAALKDALAVAPWRDETGPKL"
FT   gene            483553..484110
FT                   /locus_tag="Dshi_0498"
FT   CDS_pept        483553..484110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot; unsure GC frame plot; no
FT                   conserved domains; good Ref ZP hit to hypothetical protein
FT                   SKA53_09139 [Loktanella vestfoldensis SKA53]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92246"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT8"
FT                   /protein_id="ABV92246.1"
FT                   /translation="MIRLPRTIQLDRSDTVIFAPAASPGEWAVTGTFLFAGRDPESLSR
FT                   KEQIAFRSGFLGVESFGWSTLVTVTLARQEDRDDMVATLARQFVEQLGAPSLAAATPAA
FT                   AEEVSLAEDLCRGHGEGTLIALHRSADERGIREQFRTLKPRETTAFSASYLGGHDKAFH
FT                   MVETDEDEAFDLAAFAEEKGIT"
FT   gene            484107..485120
FT                   /locus_tag="Dshi_0499"
FT   CDS_pept        484107..485120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, unsure GC frame plot; no
FT                   conserved domains; high Ref ZP hit to hypothetical protein
FT                   SKA53_09134 [Loktanella vestfoldensis SKA53]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92247"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNT9"
FT                   /protein_id="ABV92247.1"
FT                   /translation="MREFWVASGHHLTRLDAAGRMQVTDELILAWLARPEIVPPPEACA
FT                   AERALHARLLAHPQVTVSSVECANMQDADARENWGFLLTLRDTLLAAGSIEDGYLELVR
FT                   KRVRLPHLFYDQLVQLILRNALEGCEDVHTLRAAEMLFRPQRAYLQDGGLMLADDELVT
FT                   ELEGEIHSNPLFAMMDGGVDSLDVLNEANAWTYWSRSDAHTMALPFGADPKARAGLADA
FT                   IARFVSHLLGKAVSVVPLKTADDVDLQWFVGLDEAGTKVGNALWNGEAPVPTLVGLFAL
FT                   TFETPDRVLPQIGTRPVFLLMGLDGSNVIRFKPQNLVTGLPLIDDRDAFAAVMGTA"
FT   gene            485120..485656
FT                   /locus_tag="Dshi_0500"
FT   CDS_pept        485120..485656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0500"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; no conserved domains;
FT                   unsure GC frame plot; low Ref ZP hit to
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A
FT                   from Methylobacterium extorquens PA1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92248"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU0"
FT                   /protein_id="ABV92248.1"
FT                   /translation="MPREVIRVAVVGVSHPPANKWAKRVVRPSALMAELPALDMGALMS
FT                   EQGDVRAYYMGDHAVVLHSGETRHYIDNLRAMRPSLWVSCDGDEVRLVTADPYEGEAMA
FT                   SDPERVVEALAMPRAVVARIEAFIEAHHVHEEFHKRKRVPATSQHDPRAPRVLSDNEKW
FT                   VQTRGKAGLPPKGAG"
FT   gene            485653..486264
FT                   /locus_tag="Dshi_0501"
FT   CDS_pept        485653..486264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains; low
FT                   Ref ZP hit to hypothetical protein SKA53_09124 [Loktanella
FT                   vestfoldensis SKA53]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92249"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU1"
FT                   /protein_id="ABV92249.1"
FT                   /translation="MTDPEASRLSRWSRRKLEAKRQAEVADEVADTAAVDAVDAVEEDP
FT                   DLIAALPSLDEIEVGFDMTPFLAKGVPAHLKNAAFRKLWQASPAVRDYLDPAVDYAWDW
FT                   NAPGGVPGGGGALSEQSVAKMVKGLIGERSDDAEELIAEDTTGEEADPAPETDQPEASP
FT                   VAVRRDTPSEPEHKEKPDAPRAFDRVAQLPLRRHGGAMPE"
FT   gene            486380..487042
FT                   /gene="torD"
FT                   /locus_tag="Dshi_0502"
FT   CDS_pept        486380..487042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torD"
FT                   /locus_tag="Dshi_0502"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein; low
FT                   swissprot to Chaperone protein torD from Vibrio cholerae
FT                   and high Ref ZP hit toputative chaperone [Loktanella
FT                   vestfoldensis SKA53]; NCBI conserved domains: torD"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92250"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU2"
FT                   /protein_id="ABV92250.1"
FT                   /translation="MSTASTAQAKPAKSEYEMLRAQQWSLIASLLVAPPDSDALSALAG
FT                   LTGDDTALGQAYGVLADTAGAADAEDVAREFFELFVGVGRGELLPYASFYLTGFLNERP
FT                   LADLRRDLAMMGIERVEGRFEPEDHIASIAEVMAGLAAGDFDASVLGCGAAGEAGFFAR
FT                   HLEPWAAQFFDDLAVAPSARFYRSVAEVGRIFTDIETRAFALEAKAHRASGSGVAKS"
FT   gene            487101..487310
FT                   /locus_tag="Dshi_0503"
FT   CDS_pept        487101..487310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0503"
FT                   /product="hypothetical protein"
FT                   /note="no significant swissprot; bad Ref ZP hit to
FT                   hypothetical protein SKA53_09114 [Loktanella vestfoldensis
FT                   SKA53]; no conserved domains (except for one transmem.
FT                   region)"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92251"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU3"
FT                   /protein_id="ABV92251.1"
FT                   /translation="MSDNTKRERGIGRRGFFGAVAAAATTSVIAGGARPSFAEEVGDER
FT                   TKQRYQETEHVKAFYRTNRYYKGS"
FT   gene            487314..490274
FT                   /gene="fdnG"
FT                   /locus_tag="Dshi_0504"
FT   CDS_pept        487314..490274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnG"
FT                   /locus_tag="Dshi_0504"
FT                   /product="formate dehydrogenase alpha chain"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4; high swissprot hit to Formate dehydrogenase alpha
FT                   chain from Methanocaldococcus jannaschii; high Ref ZP hit
FT                   to formate dehydrogenase, alpha subunit, putative
FT                   [Loktanella vestfoldensis SKA53]; NCBI conserved domains:
FT                   mopB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92252"
FT                   /db_xref="GOA:A8LNU4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU4"
FT                   /protein_id="ABV92252.1"
FT                   /translation="MLVKRRSTDARRSGLAAFAQNVSAKPVDRRSFLRSSGLAVGGLAA
FT                   LGTVGATTVRRAEAGMTDFSQPVEIKTNICTHCSVGCTVLAEVQNGVWVGQEPAWKSPI
FT                   NRGTHCAKGASVRELVHGDRRLKYPMKKENGAWVRISWDQAIDEIGDKMLDIREKHGAD
FT                   SAYLLGSAKFSNEGAYLFRKFAAFWGTNNVDHQARICHSTTVAGVANTWGYGAMTNSYN
FT                   DIRNSKTIIFMGSNAAEAHPVSLQHILTGKETNRANVIVIDPRFTRTAAHATDYIRMRP
FT                   GTDIAVIWGIMWHIFENNWQDQEYIDQRVWGMDQIREAVKAYPPAEVERITGIGEAELR
FT                   RVAETFATQGPATFIWCMGGTQHTVGTANVRTYCNLLLATGNVGSNGSGANIFRGHCNV
FT                   QGATDFGLDIGSLPCYYGLSEGGWRHWSRVWEVDYDYLQARFDEVPAKGGRDARDRKAN
FT                   MEMAGIPSTRWFDATTLDAEDVDQRDNIKAMIVFGHGGNTVPRMGDSLKGMNALDLLVV
FT                   ADPHPTTFAALHDRPDNTYLLPISTQFECDGSRTASNRSVQWGEKVVEPIFESDNDYAV
FT                   IYRLAEKLGFADEMFKNYEMVQGKFSMEPTAESVLREINRGGWSTGYTGQSPERLKAHM
FT                   ANQDKFDLVTLRAPADAGDVAGDFYGLPWPCWGTPEFKHPGTHILYNPNVPVKEGGGGF
FT                   RPRFGLDRDGETLLAEGSYPVGSEIEDGYPQFTYGILQSLGWDSDLTAEELATIQRIGG
FT                   NDPEAMANVSWSLDLSGGIQRVAIEHGCVPFGNGKARAVAWNLPDPIPVHREPIYSPRP
FT                   DLVADYPTRDDGRQFRVPNIGHTMQASAVERNLSESFPIVLTSGRLVEYEGGGEETRSN
FT                   PWLAELQQDMFVEINPADAEARGISDGGWVWVYGPENESKTRVKALVTERVAEGVAFMP
FT                   FHFAGWFQGEDQRGNYPEGTDPIVLGESVNTVTSYGYDPVTGMHEGKVTLCQIAAA"
FT   gene            490289..490885
FT                   /gene="fdnH"
FT                   /locus_tag="Dshi_0505"
FT   CDS_pept        490289..490885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnH"
FT                   /locus_tag="Dshi_0505"
FT                   /product="formate dehydrogenase iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; good swissprot hit to Formate dehydrogenase
FT                   iron-sulfur subunit from Wolinella succinogenes; high Ref
FT                   ZP hit to formate dehydrogenase iron-sulfur subunit
FT                   [Loktanella vestfoldensis SKA53]; NCBI conserved domains:
FT                   HybA, Fe-S-cluster-containing hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92253"
FT                   /db_xref="GOA:A8LNU5"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU5"
FT                   /protein_id="ABV92253.1"
FT                   /translation="MARMKFLCDADRCIECNACVTACKNEHEVPWGINRRRVVTINDGL
FT                   PGERSVSMACMHCTDAPCAAVCPVDCFYTTDDAVVLHSKDTCIGCGYCFYACPFGAPQY
FT                   PKVGNFGTRGKMDKCTYCAGGPEADMTEAEYVKYGSNRLAEGKLPLCAEMCSTKSLLAG
FT                   DGDIIAEIYKERVVTRGYGSGAWGWRSAYGDTVTV"
FT   gene            490899..491927
FT                   /gene="fdnI"
FT                   /locus_tag="Dshi_0506"
FT   CDS_pept        490899..491927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnI"
FT                   /locus_tag="Dshi_0506"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit;
FT                   middle swissprot hit to Formate dehydrogenase,
FT                   nitrate-inducible, cytochrome b556(fdn) subunit (Formate
FT                   dehydrogenase-N subunit gamma) from Escherichia coli K12;
FT                   high Ref ZP hit to putative formate dehydrogenase
FT                   [Loktanella vestfoldensis SKA53]; NCBI conserved domains:
FT                   fdnI"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92254"
FT                   /db_xref="GOA:A8LNU6"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU6"
FT                   /protein_id="ABV92254.1"
FT                   /translation="MNMKTLTQRFVAVFGVLVVLGIMGGTLHAPAQAQQINPTAEAVTE
FT                   DSLFEALRDDQMVAGRVSIPDELSSGLIKPGNASWADTHTSTVRILSILGVVGALVVLT
FT                   GFYLIRGKIMVDSKLSGVRILRFTAVERFAHWLMAGSFIVLALTGLNLVLGRTMVLPWL
FT                   GETAFSTISVWGKIAHNYVGWAFMLGLIMSFAVWISHNIPDKVDAEWVAKGGGLLKKGV
FT                   HPPAKKFNAGQKVIFWSTTLGGAALSFTGFMMLFPALAGTQADWQFYQLIHGIVAAVLS
FT                   FIIIAHIYIGSIGMEGAFDAMGTGEVDLNWAKEHHSLWVEEVQKGEAAQDGGPAKTPHP
FT                   AE"
FT   gene            492087..493133
FT                   /locus_tag="Dshi_0507"
FT   CDS_pept        492087..493133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0507"
FT                   /product="MRP-like protein"
FT                   /note="high swissprot hit to Protein mrp homolog from
FT                   Haemophilus influenzae; high Ref ZP hit to probable
FT                   multidrug-resistance related protein [Loktanella Loktanella
FT                   vestfoldensis SKA53]; InterPro Scan: PS01215 Mrp; NCBI
FT                   conserved domains: mrp-like; ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92255"
FT                   /db_xref="GOA:A8LNU7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU7"
FT                   /protein_id="ABV92255.1"
FT                   /translation="MPDGTPFLGAPQVSGPVLSGGRISLSIMTTAAGAASLGETRSKAE
FT                   AALRAIPGAETAFVTLTNDAAAAPPVLKQPNAAKPAVLAEVAHVVAVASGKGGVGKSTT
FT                   AVNLALGLRANGLKVGILDADIHGPSIPTLLALHGQPRMGKDRRLLPMQSNGISAMSMG
FT                   MMVDAETAMVWRGPMVMSAITQMLAEVNWGALDVLIVDMPPGTGDAQLAIAQGTKLAGA
FT                   VIVSTPQDLALIDARRGIAMFKKVDVPILGLIENMAHFTCNDCGKQHALFGTGGAEAEA
FT                   KRLNVPFLGAVPLTMDLRAASDSGQPIVVRDPEGPLGKLYVEMAGALWANLVASSSKYQ
FT                   SPRKLQGA"
FT   gene            493317..494531
FT                   /locus_tag="Dshi_0508"
FT   CDS_pept        493317..494531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0508"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; SMART: WD-40 repeat
FT                   protein, unsure GC frame plot; low swissprot hit to
FT                   Cytochrome c from Cochliobolus lunatus; good Ref ZP hit to
FT                   cytochrome c, class I [Methylobacterium extorquens PA1];
FT                   NCBI conserved domains: WD40"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92256"
FT                   /db_xref="GOA:A8LNU8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU8"
FT                   /protein_id="ABV92256.1"
FT                   /translation="MRVASTLCAVALASAPVLAQDLRGHGGPVRALATDEAGRIYSGSF
FT                   DTRAIVWDGFTAMQITRHHEGAVTAVVPLEGGRFASGGQDGRVVIWGDSPEPLQSEIWH
FT                   PLPVGAMVALGDGLASAGWDGRIALWSGTGSPSYIEAHEGQITGLIGYRGGLASVGADL
FT                   RLRLWNPDGTDAGQISLPAAASALATDGAALFVASPDGILRKVTAITELDEATISSRGL
FT                   LSVAASEGLVAVGAMTGDVWLVDPDTLDVQVAIETGQGPIWALAISDGVLLTGGNDGLI
FT                   RRWSLDGIALGEGSGPPDPTLTNPRGAEVFRACAVCHTLTPDDGARAGPTLHGIFGRRI
FT                   ATAEGYQYSEALKDLDIVWTAQTISELFEYGPDAYTPGSRMPEQRVPSAADRQALVEFL
FT                   EMVTR"
FT   gene            complement(494625..495407)
FT                   /locus_tag="Dshi_0509"
FT   CDS_pept        complement(494625..495407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains
FT                   (except for one signalpep.); unsure GC frame plot; good Ref
FT                   YP hit to hypothetical protein Spro_3113 [Serratia
FT                   proteamaculans 568]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92257"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNU9"
FT                   /protein_id="ABV92257.1"
FT                   /translation="MKHARALSLTIITATMASAAFAQGEADAAAQANNPLADTTSLNLQ
FT                   NQYFGNLSSIDRDANAVLLRGAKPFRLGAANGIARATLPINTVPRTGGGDRSGLGDLNV
FT                   FAAFLFDTRNPAISFGIGPQFTAPTATDDALGSGNWSAGFANVLFNASSPTVQYGYLLT
FT                   WQASFAGEDTRDDVNAAAFQPFVFYQLGGGTYLRSTGVMTYDFKTDDYAIPIGLGIGQV
FT                   FQRENGVLNLFVEPQYTVASDGDGQPDWGIFAGVNFQF"
FT   gene            complement(495589..496662)
FT                   /locus_tag="Dshi_0510"
FT   CDS_pept        complement(495589..496662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0510"
FT                   /product="conserved hypothetical beta-lactamase"
FT                   /note="good swissprot hit to Alkyl/aryl-sulfatase BDS1
FT                   (Bacterially-derived sulfatase 1) from Saccharomyces
FT                   cerevisiae, high Ref ZP hit to beta-lactamase domain
FT                   protein [Methylobacterium sp. 4-46];InterPRo Scan:
FT                   Tetratricopeptide region TPR; NCBI conserved domains:
FT                   COG2015, Alkyl sulfatase and related hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT10196"
FT                   /db_xref="GOA:C5ZZD4"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:C5ZZD4"
FT                   /protein_id="ACT10196.1"
FT                   /translation="MFGTEAEVMFASHHWPRFGNERIQEVLRAQRDLYANLNSQVLHFA
FT                   NQGVTINEIHNVYEPPESIANNWFNRGYHGSVEHNVRAVINRYLGYWDANPATLIPLSP
FT                   ADSAPLYVEMMGGADAILAKGQQLFDTGQYFHAVEILNKLVYAEPDNAAAKDLLADNFE
FT                   QIGYQQENPGLRNSFLAGAYELRSPLPTGTATETATPDVIQAMPTGLFLDYIAIKMDSR
FT                   KAGDTEFTINIVHPDIEEEYILELSNATLTNIEGYQVETPDLTLTIDRAQLVPVMIGKA
FT                   TIDAQIDAGNAQAEGDRSVLTQLASLLTDFEMTFEVMPGTEGAAAVPGRYDPEAGPSGV
FT                   EGNPFQVKTVNAGELPN"
FT   gene            complement(496690..496893)
FT                   /locus_tag="Dshi_0511"
FT   CDS_pept        complement(496690..496893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="may be part of Gene Dshi_0510; low swissprot hit to
FT                   Alkyl/aryl-sulfatase BDS1 (Bacterially-derived sulfatase 1)
FT                   from Saccharomyces cerevisiae; middle Ref YP hit to
FT                   metallo-beta-lactamase superfamily protein [Azorhizobium
FT                   caulinodans ORS 571]; NCBI conserved domains: COG2015,
FT                   Alkyl sulfatase and related hydrolases; InterPro Scan: no
FT                   hits reported"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT10197"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5ZZD5"
FT                   /protein_id="ACT10197.1"
FT                   /translation="MEISEPLEEHTIDGVRMVFQLTPGTEAPSEMNTYLPDVKALWMAE
FT                   NVTGTMHNIYTLRGAQVRDALG"
FT   gene            complement(496905..497582)
FT                   /locus_tag="Dshi_0512"
FT   CDS_pept        complement(496905..497582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0512"
FT                   /product="beta-lactamase domain protein"
FT                   /note="pfam00753, Lactamase_B, Metallo-beta-lactamase
FT                   superfamily; COG2333, ComEC, Predicted hydrolase; low
FT                   swissprot hit to Alkyl/aryl-sulfatase BDS1
FT                   (Bacterially-derived sulfatase 1) from Saccharomyces
FT                   cerevisiae; good Ref YP hit to beta-lactamase domain
FT                   protein [Polynucleobacter sp. QLW-P1DMWA-1]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92258"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV0"
FT                   /protein_id="ABV92258.1"
FT                   /translation="MPSQFTIDILNEAREALPFDDTQDFDELARGLIAAPETLQIEAEA
FT                   GGFTWELERFNFLKEGENFDSIHPSLERQARLTTQFGLYEVMEGIYQVSGYDLSNPTLI
FT                   QTDSGWIAYDVLLSKETAEATMELVNQELGKRPIVAVIYSHSHADHFGGVRALVDDAAI
FT                   EAGEVEIIAPEGFIEHAVSENVYAGNAMTRRRFYQYASLLPASPFGYVTKASARLPPAA
FT                   PRA"
FT   gene            complement(498319..498786)
FT                   /locus_tag="Dshi_0513"
FT   CDS_pept        complement(498319..498786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0513"
FT                   /product="transcriptional regulator"
FT                   /note="pfam00196, GerE, Bacterial regulatory proteins, luxR
FT                   family; low swissprot hit to Transcriptional regulatory
FT                   protein fixJ from Sinorhizobium meliloti; middle Ref ZP hit
FT                   to putative two-component response regulator [Roseovarius
FT                   sp. HTCC2601], unsure GC frame plot; LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92259"
FT                   /db_xref="GOA:A8LNV1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV1"
FT                   /protein_id="ABV92259.1"
FT                   /translation="MRHRRYVTARDQRHCLSGPDRRDIQELSRGLSDRARRHRDGRARD
FT                   GVRSFRFSDQAHRIRTASDTVRNAIDHACDAQSALSVEARFERHLRRLTPRERQVHDAV
FT                   VAGEPNKNIAMDLGLAKKTVKVHRARVMQKMGMRNLADLVRAAVTRRIGAP"
FT   gene            complement(498765..498947)
FT                   /locus_tag="Dshi_0514"
FT   CDS_pept        complement(498765..498947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0514"
FT                   /product="response regulator receiver protein"
FT                   /note="bad swissprot to Transcriptional regulatory protein
FT                   fixJ from Azorhizobium caulinodans; low Ref ZP hit to
FT                   putative two-component response regulator [Roseovarius sp.
FT                   HTCC2601]; PFAM00072 response regulator receiver; COG4566,
FT                   TtrR, Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92260"
FT                   /db_xref="GOA:A8LNV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV2"
FT                   /protein_id="ABV92260.1"
FT                   /translation="MSAPESQECLVHIVEDDAAIRRALRRMIMRHGYEAIEHASGEAFM
FT                   DGFDPDRIGCVIVDM"
FT   gene            complement(498944..499843)
FT                   /locus_tag="Dshi_0515"
FT   CDS_pept        complement(498944..499843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0515"
FT                   /product="histidine kinase"
FT                   /note="unsure GC frame plot; - PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   NCBI conserved domains: HisKA; middle swissprot hit to
FT                   Sensor protein fixL; good Ref ZP hit to probable sensor
FT                   histidine kinase of two-component system from Roseovarius
FT                   sp. HTCC2601"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92261"
FT                   /db_xref="GOA:A8LNV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV3"
FT                   /protein_id="ABV92261.1"
FT                   /translation="MQRFDLDQDRLPPGAEILFYDPGVWEEYWAAILLAFPIILLQSST
FT                   IIGLGVLEKRRRRAAAELAQQRAEVARLSRVSQLGELSGAIAHELKQPLTSILMNAESG
FT                   RALLRQSPPDLREIAEILEDIANDDRRAAGVIDNLRKLLGEGAPDFQPVELNDVVRATL
FT                   RLIRSELIARSVRTDLKLCEAALIATGNAEQLQQVLLNLIFNATDGMADQPRKTRRISI
FT                   ETTLRTDGMREVSVTDTGPGLPEAVRDAAFQPFVTTKAHGMGLGLSISRTIAEAHGGQL
FT                   HVDGAASKTRAILALPAP"
FT   gene            complement(499850..500836)
FT                   /locus_tag="Dshi_0516"
FT   CDS_pept        complement(499850..500836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0516"
FT                   /product="putative two-component sensor kinase"
FT                   /note="pfam04392, ABC_sub_bind, ABC transporter substrate
FT                   binding protein; no significant swissprot; good Ref ZP hit
FT                   to probable sensor histidine kinase of two-component system
FT                   from Roseovarius sp. HTCC2601; unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92262"
FT                   /db_xref="GOA:A8LNV4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV4"
FT                   /protein_id="ABV92262.1"
FT                   /translation="MRRASSTWWRPKAGHNGPDLRHLLAAIAALLFIGTSQAMAQEEDL
FT                   PEQVRFLVLYSSSSTLYANIAIQEGISSALTQADARSRFEVYGEHRDLQRFPGAEEDRH
FT                   FIHKVTRKYSDDTLDAVLTVGPKALSLAITHQDRFAPGLPIVFGGVDSEDLRGFDLPPN
FT                   AYGVFGSFDLVGTLELARALQPDATRVAIFTGSAAFDQSWKASAEQQLAGLAELDVTHL
FT                   SDLTLEEFRDAAAALDRDTIAIVLTIFRDAAGRLFTPVEAAVTLAEVSGTPVYGVYDTY
FT                   VGCGLVGGHFSTFQSLGTALTETALQLVDDPTNVSQTIEVPASSVLD"
FT   gene            complement(501109..502149)
FT                   /gene="araF2"
FT                   /locus_tag="Dshi_0517"
FT   CDS_pept        complement(501109..502149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araF2"
FT                   /locus_tag="Dshi_0517"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; COG4213, XylF, ABC-type xylose
FT                   transport system, periplasmic component; low swissprot hit
FT                   to D-ribose-binding protein precursor from Bacillus
FT                   subtilis; High Ref YP Hit to sugar ABC transporter,
FT                   substrate-binding protein, putative from Roseobacter
FT                   denitrificans OCh 114; periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92263"
FT                   /db_xref="GOA:A8LNV5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV5"
FT                   /protein_id="ABV92263.1"
FT                   /translation="MLRRHFMAFASAASLALGAGAATAQEAPAPLDTPEEVTIALVRYL
FT                   STGDFFQAYLSGVETQAAALGVNLRVFDSRQDAALQADMVDQAIALGVDGIIIQHGLTE
FT                   SMREAAQRAVDAGIKVVAFDVNVENAAIPQVEQSDYLLGKLALEQAIKDNGDSFAAGYV
FT                   YVPGIAPLDRRHAAWEEVKTANPGITEEARIGTLDNPIANANANQARAALQANPNISVF
FT                   FAPYNEFAKGVKIAADELGLSGEMSIYSADISTADIALMREPGSAWKATVATNPAVVGE
FT                   VSVRALALMLAGEDPGASVIVPPTLITQAFLNDNDIRNMEDLGAKMPQFQHADVAMADW
FT                   MPLPAR"
FT   gene            complement(502175..503185)
FT                   /gene="araH1"
FT                   /locus_tag="Dshi_0518"
FT   CDS_pept        complement(502175..503185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH1"
FT                   /locus_tag="Dshi_0518"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; NCBI conserved
FT                   domains: COG1172, AraH, Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems, permease components; PRK09512,
FT                   rbsC, ribose ABC transporter permease protein; middle
FT                   swissprot hit to Ribose transport system permease protein
FT                   rbsC from Bacillus subtilis; High gb hit to ribose ABC
FT                   transporter, permease protein [Roseob; permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92264"
FT                   /db_xref="GOA:A8LNV6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV6"
FT                   /protein_id="ABV92264.1"
FT                   /translation="MNDRLLDIAIRYGFLMLLFGLIVYFSLAAPGFLGPLSAAFVLQSV
FT                   AITGILALGVTCTLVVGGFDLSIGAVATSALMLSAYSMVILEHPAIVAVLLCLAMGALV
FT                   GFINGLLIVKFRVPDLLATLGMMFLLIGLQRIPTQGNSIATGMTLSDGTVAEGTFSAAF
FT                   LWLGRHRFDVVIERLLPMPVVIFVGIAVLIWLFLGFTRHGRLMYAIGSNERAAGLVGTP
FT                   VNRYKIAAYMISGVTASIGGILLAARLGRGDIASGNNLLLDSVAAALIGFAVLGAARPN
FT                   AFGTAMGALFVGILLQGMTMMNAPYYTQDFVKGAVLVAALVFTFYLSSRRSGPGH"
FT   gene            complement(503182..504678)
FT                   /gene="araG1"
FT                   /locus_tag="Dshi_0519"
FT   CDS_pept        complement(503182..504678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araG1"
FT                   /locus_tag="Dshi_0519"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase,
FT                   high swissprot to Arabinose import ATP-binding protein araG
FT                   from Pseudomonas syringae pv. tomato; high gb hit to sugar
FT                   uptake ABC transporter ATP-binding protein from Roseobacter
FT                   litoralis Och 149; ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92265"
FT                   /db_xref="GOA:A8LNV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV7"
FT                   /protein_id="ABV92265.1"
FT                   /translation="MNGLQKSFGKNNVLRGIDLTLDPGSVTVLMGANGAGKSTLVKVIC
FT                   GQHRADGGTMRLATNAFDPEDAADAIRQGVVTVHQSIDDGVIPDLDVANNLMLDRLAEH
FT                   SHGLFVRERHLRTEAAKVAAAMGIEVNLRARVSDLSVADRQMIAIARAMARAPKVLILD
FT                   EPTSSLSATEADRLFELIDRLRAQGVAILYISHRMSDIRRIADRIVVMRDGMISGVFET
FT                   EPLDLEAAVTAMLGHRMTEVDAEVRQGTHPVLEIKNLQLFEGASPITLTAHDGEVVALV
FT                   GLLGSGKSRLAEILFGIARPIRGSIRIKGKDYSPRSVKDAIAQGVFMSPKDRGTNAVIP
FT                   AFDIADNMTLPFLQGMSVGSFLKSRQQRGTAQGMVDRLGIVCQSVRDGIGTLSGGNQQK
FT                   VMIARWLLEPAQVLLLDEPFQGVDIGARRDIGHHIRATTQGRATLVFLAEIDEALEIAD
FT                   RIVVMSEGAIVGEHTNRNIDLAALVADISGATSTVTGTSP"
FT   gene            504830..506089
FT                   /gene="mtnK"
FT                   /locus_tag="Dshi_0520"
FT   CDS_pept        504830..506089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnK"
FT                   /locus_tag="Dshi_0520"
FT                   /product="5-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /note="TIGRFAM: 5-methylthioribose kinase PFAM:
FT                   aminoglycoside phosphotransferase; NCBI conserved domains;
FT                   mtnK; good swissprot hit to Methylthioribose kinase (MTR
FT                   kinase) from Bacillus cereus ATCC 14579; high Ref YP hit to
FT                   methylthioribose kinase [Roseobacter denitrificans OCh
FT                   114]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92266"
FT                   /db_xref="GOA:A8LNV8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV8"
FT                   /protein_id="ABV92266.1"
FT                   /translation="MGAGTAYEALTVETLPERLRGVSALASRVGNDPGAWQVEEVGDGN
FT                   LNLVFIVSGPSGKVIVKQALPYVRLVGDSWPLPLYRAYFEYHALTRQAARDPGAVPTVY
FT                   HFDEAQALIIMEYLSPHVILRRKLIAGEHVAGLAAFLGRFCARTAFRGSELSMPSPEKK
FT                   ADVALFAGNVEIPAITEALVFTDPYFDAEMNSHTEGLEPVIARLRADVGLKVKVQQALQ
FT                   RFVSNTETMVHGDLHSGSIMSTDSDSRVIDPEFVQYGPLGFDIGMLCANFLMAYFSQPA
FT                   HRGEDLATYQEWILSVIADTCSVFEAEFRDLWRSERTGILYPQTLFEDQGQDSTPACDA
FT                   VLAEIWRDAWAVCGIEMHRRCLSLAHNADFEDIADVRVRAPLEARNLLMGAELIHSAAT
FT                   LADAKAVCALARDFNRKDVL"
FT   gene            506086..507189
FT                   /gene="mtnA"
FT                   /locus_tag="Dshi_0521"
FT   CDS_pept        506086..507189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="Dshi_0521"
FT                   /product="methylthioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein PFAM: initiation factor 2B related;
FT                   NCBI conserved domains: mtnA; good swissprot hit to
FT                   Probable methylthioribose-1-phosphate isomerase from
FT                   Thermotoga maritima; high gb hit to
FT                   methylthioribose-1-phosphate isomerase [Roseobacter
FT                   litoralis Och 149]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92267"
FT                   /db_xref="GOA:A8LNV9"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNV9"
FT                   /protein_id="ABV92267.1"
FT                   /translation="MKIDGTHYRSLWWNHEQNVLEIIDQRWLPHDFRVVPVATMQDFAD
FT                   AIYQMRVRGAPLIGATAAYGMALAMAEDPSDANMDAAWSFLEKTRPTAINLRWALDRCR
FT                   AALRPLPQADRAAAALTLAHDIADEDVEINRRIGEHGLALIREIAACKPEGEPVRLLTH
FT                   CNAGWLATVDWGTATSPMYHAHDAGVPLQVWVDETRPRNQGALTAWELGKHGVPHTYIT
FT                   DNAGGHLMQHGLVDMVITGTDRTTRQGDVCNKIGTYLKALAARDNGVPFYVALPSPTID
FT                   WTVRDGVAEIPIEERDAFEVTHVQGITGTGEIGMVQVTPDGTSGGNPAFDVTPNRLVTG
FT                   LITERGVCNASAEGLASLFPEFSKAAE"
FT   gene            507247..508206
FT                   /gene="deoR3"
FT                   /locus_tag="Dshi_0522"
FT   CDS_pept        507247..508206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR3"
FT                   /locus_tag="Dshi_0522"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: putative sugar-binding domain protein; NCBI
FT                   conserved domains: pfam04198, Sugar-bind, Putative
FT                   sugar-binding domain; COG2390, DeoR, Transcriptional
FT                   regulator, contains sigma factor-related N-terminal domain,
FT                   good swissprot hit to Uncharacterized transcriptional
FT                   regulator yjhU from Escherichia coli K12 (related to SorC);
FT                   high Ref YP hit to transcriptional regulator, putative
FT                   [Roseobacter denitrificans OCh 114]; DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92268"
FT                   /db_xref="GOA:A8LNW0"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW0"
FT                   /protein_id="ABV92268.1"
FT                   /translation="MRMASRDDALFVEAAWLYYHDGLNQTEIAERMRISRASVVNYLNE
FT                   ARTRGWVRVHLDSDVFRGHRLAAELCALFGLTDALVVPDDPLDPEGAAASVARVTRTAA
FT                   DWLPRLLEPGDRLGVSWGATIYQMAQQVPNAPVPDLRVIQLLGSRPAALGFAAEACTAM
FT                   LAQRLGGECINLHVPLVLSNKALRDALCDEPVVREQLEALASCNKTVLACGTCDADAHV
FT                   VRSGIVTSDSISDYRAKGAVGVICGRLIDVKGQPVVAEVEDRMIGVTLDQMRGKDMALL
FT                   VAAGPGRAAPAKAAIKGGFVTHLVTSKRIAEDLLETAP"
FT   gene            508203..508898
FT                   /gene="fucA"
FT                   /locus_tag="Dshi_0523"
FT   CDS_pept        508203..508898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="Dshi_0523"
FT                   /product="L-fuculose-phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   COG0235, AraD, Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases; good swissprot hit to L-fuculose
FT                   phosphate aldolase from Escherichia coli K12; good Ref ZP
FT                   hit to L-fuculose phosphate aldolase [Stappia aggregata IAM
FT                   12614]; unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92269"
FT                   /db_xref="GOA:A8LNW1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW1"
FT                   /protein_id="ABV92269.1"
FT                   /translation="MTPATPLPDTTATRQALIDACLWMNARHLNQGTSGNISARIASGI
FT                   LITPSGVPYEYLTPDALVTIPLDGLPDSNGAQPSSEWPFHQGMHQARPDMPVVLHAHPP
FT                   YCSVLAVQRRSIPACHYMIAAFGGNDVPLADYALFGSPELCANMARIMADRHGCLMANH
FT                   GATVLGETVDKARWRLEELETLARTYLFSSIGGAPHILSDAEIAEVMVAFSSYGPRHPE
FT                   ERNGEGERS"
FT   gene            508895..509974
FT                   /locus_tag="Dshi_0524"
FT   CDS_pept        508895..509974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0524"
FT                   /product="aldo/keto reductase"
FT                   /note="pfam00248: aldo/keto reductase; COG0667, Tas,
FT                   Predicted oxidoreductases; good swissprot hit to
FT                   Uncharacterized oxidoreductase yajO from Escherichia coli
FT                   K12; high Ref NP hit to oxido-reductase, and dehydratase
FT                   mocA from Mesorhizobium loti MAFF303099"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92270"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW2"
FT                   /protein_id="ABV92270.1"
FT                   /translation="MKYRTLGRSGLKISVITMGTFTFGGRGDFGRTASQDVADARRLVD
FT                   SCIDHGVNLFDTANMYSTGLSEEILGEVLEGRYDDILVTSKARMPIGDGPNDEGVSRWH
FT                   LIRECERSLKRLRTDHIDIYYMHEWDGLTPVEEKMEALDTLIRHGKIRYAGCSNYSAWH
FT                   VMKSLAAAPRHSSRFVTQQIHYTIEAREAEYELLPLSVDQGLGVLVWSPLAAGLLSGKH
FT                   RRGRQAPEGSRQAEGWNEPPIRDMERLWSIVDVLVEIAEAHQVEAAQIALAWLLTRPAV
FT                   ASLVVGGRTVDQFERNFRAVDVVLSEDELKRLNDVSRLPLVYPYWHQHNFARPRFSPAD
FT                   QALHADYPDRHYGGEDPLV"
FT   gene            510058..510609
FT                   /locus_tag="Dshi_0525"
FT   CDS_pept        510058..510609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0525"
FT                   /product="ATPase-like protein"
FT                   /note="no significant swissprot, unsure GC frame plot;
FT                   COG3911, Predicted ATPase; cd00009, AAA, AAA-superfamily of
FT                   ATPases; good Ref ZP hit to ATPase-like protein [Sagittula
FT                   stellata E-37]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92271"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW3"
FT                   /protein_id="ABV92271.1"
FT                   /translation="MSRRFILLTGCSGGGKSTLLQSLSAKGFATVEEPGRRIVADEIAK
FT                   GGTALPWLDMGAFARRAVEMAQSDLQRATEHEGLVFFDRGIFDAAVALEHSGGPSIRET
FT                   LGAARAYAGRVFVVPPWEEIFGQDAERRHHFNAAVQEYHRITDALDALGYDGRVLPRVS
FT                   VRDRVEMVLQGCTGRSARSP"
FT   gene            complement(510637..511236)
FT                   /gene="dahL"
FT                   /locus_tag="Dshi_0526"
FT   CDS_pept        complement(510637..511236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dahL"
FT                   /locus_tag="Dshi_0526"
FT                   /product="PTS-dependent dihydroxyacetone kinase"
FT                   /note="PFAM:PF02734 Dak phosphatase; NCBI conserved
FT                   domains: PRK10005, dihydroxyacetone kinase, C-terminal
FT                   domain; low swissprot hit to PTS-dependent dihydroxyacetone
FT                   kinase, ADP-binding subunit dhaL from Escherichia coli K12;
FT                   middle Ref ZP hit to Dihydroxyacetone kinase [Psychroflexus
FT                   torquis ATCC 700755]; unsure GC frame plot; ADP-binding
FT                   subunit dhaL"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92272"
FT                   /db_xref="GOA:A8LNW4"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW4"
FT                   /protein_id="ABV92272.1"
FT                   /translation="MTITRDTLLGAIDRIAAAMERDFDLLNSADAALGDGDLGVTMTRG
FT                   MRAIVAMKDDLPEDIGMALLGCAQAFTKSSGSSYGTLMATGLMSAAKELRGQQEIESES
FT                   IPGLIAGARDKMQERGKAELGGKTVLDSLDYVARTTDKADDKASAAAEAVDRALEDFRD
FT                   KPATVGRARIFGEKSIGLDDPGMLAMQSVVRAAVDK"
FT   gene            complement(511233..512234)
FT                   /gene="dahK"
FT                   /locus_tag="Dshi_0527"
FT   CDS_pept        complement(511233..512234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dahK"
FT                   /locus_tag="Dshi_0527"
FT                   /product="PTS-dependent dihydroxyacetone kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="PFAM: Dak kinase; NCBI conserved domains: PRK11468,
FT                   dihydroxyacetone kinase subunit DhaK; good swissprot hit to
FT                   PTS-dependent dihydroxyacetone kinase,
FT                   dihydroxyacetone-binding subunit dhaK from Escherichia coli
FT                   K12; high Ref ZP hit to putative dihydroxyacetone kinase
FT                   [Aurantimonas sp. SI85-9A1]; dihydroxyacetone-binding
FT                   subunit dhaK"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92273"
FT                   /db_xref="GOA:A8LNW5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW5"
FT                   /protein_id="ABV92273.1"
FT                   /translation="MKKILNKPEDYVDEMLAGLIAAHPEYYRLHGDTGKVVARANPGKD
FT                   GKVGIVTGGGSGHLPVFTGYVGEGLLDACAIGDVFASPSAEQMADAIRVADSGAGVLRL
FT                   YGNYGGDVMNFDMAGELVEFDDITCTTVLLADDVASAPPAEAEKRRGVAGMVYAFKIAG
FT                   AAAEEGRDLDGVTAVAQKAADACRSIGAALSPCTVPQAGKPTFEIAEDEMEMGMGIHGE
FT                   PGVWRGKLQTADQIAEEMMDRLLADMPIGNGDRVSVMVNSLGATPPEELYILYRRVKAR
FT                   LEAAGARIVMPLVGRYATSMEMAGVSFTLCKLDDELEKLLLAPCDCAFWRVG"
FT   gene            complement(512265..513269)
FT                   /gene="araH2"
FT                   /locus_tag="Dshi_0528"
FT   CDS_pept        complement(512265..513269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH2"
FT                   /locus_tag="Dshi_0528"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; NCBI conserved
FT                   domains: COG1172, AraH; middle swissprot hit to Ribose
FT                   transport system permease protein rbsC from Bacillus
FT                   subtilis; good Ref NP hit to ABC transporter, membrane
FT                   spanning protein (sugar) [Agrobacterium tumefaciens str.
FT                   C58]; permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92274"
FT                   /db_xref="GOA:A8LNW6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW6"
FT                   /protein_id="ABV92274.1"
FT                   /translation="MNTSVKDFTASPEFRLLIIMVFVFGLMSVLSPDRFLSSQNLTSMA
FT                   FQFPEFAILALAMTIAMMTGGIDLSVVGIANLSAVVAALILTHFSNAEMPAAQSAIWLA
FT                   IAITAALCIGAIAGLINGSLVAFFGLPPILATLGSGLVFTGFAIAMTGGSAVMGFPDTV
FT                   ALIGNATLAGVPVPLILFAVLAFLLHLVLTRTAFGLRVTMYGANPLAALYAAIDINRML
FT                   LKVYVIAGMFASVAGLIIMSRANSAKADYGSSYLLLAVLIAVLGGVNPYGGYGRVIGVV
FT                   LAVLSMQFLSSGLNMLGVSNFARELIWGALLILVMVINTHAVTALRSSLKPPK"
FT   gene            complement(513283..514284)
FT                   /gene="araH3"
FT                   /locus_tag="Dshi_0529"
FT   CDS_pept        complement(513283..514284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araH3"
FT                   /locus_tag="Dshi_0529"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; NCBI conserved
FT                   domains: COG1172, AraH; middle swissprot hit to Ribose
FT                   transport system permease protein rbsC from Bacillus
FT                   subtilis; good Ref ZP hit to putative permease protein,
FT                   ABC-type sugar transporter [Aurantimonas sp. SI85-9A1];
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92275"
FT                   /db_xref="GOA:A8LNW7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW7"
FT                   /protein_id="ABV92275.1"
FT                   /translation="MTDWLPKDFWTRNETLVAGVIMLFCFVATVSDPRFLTITTVSDLL
FT                   RASIVIGILAVGAMLVLVSGGIDVSFTAIAVFAMYSSTVLSLTIWPEIPWPVIFVISVV
FT                   FGAALGAINGFFIAFLGLPTLIVTLGTLSIFRGFLLTFIGSQRISDLPPSMRDFSRGVI
FT                   ARGTTEAGNFYSIPWAALALLFVIVLTWFILKKTMLGRSIYAIGGSVESARRIGINVKW
FT                   TQFFVYVYVGALAGLAGIIHGSVGRMADPFSLVGLELSVIAAVVLGGARLIGGYGTLTG
FT                   TMLGVALIVIVQNSLIVIGIPTTWQSVTIGILILLGTGVPAYRAKRAAAQAG"
FT   gene            complement(514281..515777)
FT                   /gene="araG2"
FT                   /locus_tag="Dshi_0530"
FT   CDS_pept        complement(514281..515777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araG2"
FT                   /locus_tag="Dshi_0530"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase;
FT                   high swissprot hit to Ribose import ATP-binding protein
FT                   rbsA 3 from Rubrobacter xylanophilus DSM 9941; high Ref YP
FT                   hit to ABC transporter related [Nocardioides sp. JS614];
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92276"
FT                   /db_xref="GOA:A8LNW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW8"
FT                   /protein_id="ABV92276.1"
FT                   /translation="MSSDHDTAFIDLRAITKRYAGVTALDSVDFTVQPGEAVCLAGENG
FT                   SGKSTLIKIISGVEPATAGTVQIAGQEHVTLNPRISAAAGVMVIFQDFSLFPNLSVAEN
FT                   IAFTTQLSTRQRLFKFRAVRDIARAALDRIGVQIDLDARVETLPVAQKQLVAICRALAS
FT                   KAQLIIMDEPTTALTEKEVRRLQGIIRMLKEEGVAVIFVSHKLAEVLEVSEKVVVLRNG
FT                   KKVAEGPASEFDTQSLTYHMTGRDVPEVPPSDVAAGAQTLMQVQGLGKAGSFSDISFDL
FT                   RTGEVLGITGLLGCGRTSVAKALFGLVTPDAGSILVDGSPVPLGDPQAASLARIGYVPE
FT                   DRLTEGLFLSQSILRNVAVGRLDAHTSGGFLDMTGLAKEASDWLRRLKVKAPDVEAPVQ
FT                   SLSGGNQQRVALARWLSRAPRVLILNGPSVGVDVGSKADIHDIIRELAREGIGVIVISD
FT                   DLPELLATCHRVLVMREGRIIDALEGTALTEDDLAHRLAS"
FT   gene            complement(515852..516841)
FT                   /gene="araF1"
FT                   /locus_tag="Dshi_0531"
FT   CDS_pept        complement(515852..516841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araF1"
FT                   /locus_tag="Dshi_0531"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="NCBI conserved domains: COG4213, XylF, ABC-type
FT                   xylose transport system, periplasmic component; low
FT                   swissprot hit to Uncharacterized protein yneA precursor
FT                   from Escherichia coli K12; high Ref ZP hit to putative
FT                   periplasmic substrate-binding protein, ABC-type sugar
FT                   transporter [Aurantimonas sp. SI85-9A1]; periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92277"
FT                   /db_xref="GOA:A8LNW9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNW9"
FT                   /protein_id="ABV92277.1"
FT                   /translation="MKTKFTLLASVAMASSALFATQAVADGHSKDIATVVKIAGIQWFN
FT                   RMEEGVKKFAEETGMNAFQVGPAQADPQQQVALIEDMIAQGVDALAVVPMSPEALEPVL
FT                   GRAMEAGITVITHEAAAQQNTTYDLEAFVNEDFGANLMEQLATCMGGEGEYAVFVGSLT
FT                   SQTHNQWVDGAIAYQEANYPNMTLVGDKNETFDDAEQAYTKTQEVLRAFPNIKGMQGSA
FT                   STDVAGIGRAIEERGMEDATCVFGTSLPSIAGQYLETGAVDGIGFWDPAVAGEAMNKLA
FT                   VMVMNGEEVTDGMDLGLPGYESVSLDGKVIYGQAWVNVDAENMSEYPF"
FT   gene            517065..518039
FT                   /gene="deoR2"
FT                   /locus_tag="Dshi_0532"
FT   CDS_pept        517065..518039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR2"
FT                   /locus_tag="Dshi_0532"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: putative sugar-binding domain protein; NCBI
FT                   conserved domains: pfam04198, Sugar-bind and COG2390, DeoR;
FT                   middle swissprot hit to Deoxyribonucleoside regulator from
FT                   Bacillus subtilis; good Ref YP hit to transcriptional
FT                   regulator, DeoR family [Sinorhizobium medicae WSM419]; DeoR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92278"
FT                   /db_xref="GOA:A8LNX0"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX0"
FT                   /protein_id="ABV92278.1"
FT                   /translation="MLMQKRQADDDIAQAAWLYYVGNLSQQEVSKRLGVSRFKVLRMLA
FT                   DARDQGLVRVAVEHRTSRALSLADRLVTAFGLQEVQVAPIGADSGDEVLSRNAVAILAS
FT                   GYLSRIAASDSQATIGLGWGRTLSAMADNLTGVRHPGLTFVSLMGSVTYASHTAPGDVC
FT                   VRLAAQTGGRAILMPAPFVTDSADACAGIMSQRLVREAMSVARKADHALMSVGECREGA
FT                   ILFDSDIFTPAQIQQLRDADVVGDCCGVFYKADGSVADIELNRCTPCVQPQDMGAMDTV
FT                   LLAGGAGKLTATLAVLRAGFVKKLLIDEGLATKLVTASEHVGV"
FT   gene            518039..518887
FT                   /locus_tag="Dshi_0533"
FT   CDS_pept        518039..518887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0533"
FT                   /product="xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   NCBI conserved domains: cd00019, AP2Ec, AP endonuclease
FT                   family 2; middle swissprot hit to Uncharacterized protein
FT                   sll1304 from Synechocystis sp. PCC 6803; high Ref YP hit to
FT                   Xylose isomerase domain protein TIM barrel [Sinorhizobium
FT                   medicae WSM419]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92279"
FT                   /db_xref="GOA:A8LNX1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX1"
FT                   /protein_id="ABV92279.1"
FT                   /translation="MEGFGVHTSMWTMTWDQAGCEKAVAKARAYGMDFLEIALLDPPNV
FT                   DAAHSRSVLEAAGMRAVCSLGLPQEVWASRNPEGAVDFLTIALDKCAAMGAEALSGVVY
FT                   GGIGERSGKPPTRAELDNVADALTRAARHARSLGLLFGIEPVNRYETHLLNTGWQAVEM
FT                   IERIGAENMFIHLDTYHMNIEEKGIAQGIIDAREHLRYIHLSESDRGTPGAGTIAWDEI
FT                   FSALRAVGFKGGLAMESFINMHAEIAEGLSVWRPVASGEAEVMENGLPFLRNKARQYGL
FT                   I"
FT   gene            518910..519929
FT                   /gene="pdhA2"
FT                   /locus_tag="Dshi_0534"
FT   CDS_pept        518910..519929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA2"
FT                   /locus_tag="Dshi_0534"
FT                   /product="pyruvate dehydrogenase E1 component subunit
FT                   alpha"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase E1 component; good swissprot hit
FT                   to Pyruvate dehydrogenase E1 component subunit alpha from
FT                   Zymomonas mobilis; high Ref YP hit to dehydrogenase E1
FT                   component [Sinorhizobium medicae WSM419]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92280"
FT                   /db_xref="GOA:A8LNX2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX2"
FT                   /protein_id="ABV92280.1"
FT                   /translation="MKNTTLPQLYEDMRRVRTFEERVGELFVRGKSAGSMLHLSIGEES
FT                   AAVGVCAHMRDGDTFTTHHRGHGIFLARGADPDRMMAEIAGKESGYCHGKGGSMHIADM
FT                   GLGHLGANAIVGGGIPSVVGAGLSARHKKSGAISVAFFGDGATGQGILYESMNMAALWK
FT                   LPVIFVCINNQYGMGTRIDQATANPNLHERAAAFGLAARTVDGLDVEDVADAAADLIAG
FT                   AREGRPAFLSIDCYRFFGHARKDKSPYRDEAEEAEGRKKDPVLRARDKLISDGLMSEAE
FT                   LDALDTRVASEMDGSIDFAVAGNEPQMQSMFRDVYAPSQPEPEPVRTRLDRILAQEPR"
FT   gene            519929..520912
FT                   /gene="pdhB1"
FT                   /locus_tag="Dshi_0535"
FT   CDS_pept        519929..520912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB1"
FT                   /locus_tag="Dshi_0535"
FT                   /product="pyruvate dehydrogenase E1 component subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; high swissprot hit to Pyruvate
FT                   dehydrogenase E1 component subunit beta from Rickettsia
FT                   bellii RML369-C; high Ref YP hit to Transketolase central
FT                   region [Sinorhizobium medicae WSM419]; Transketolase
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92281"
FT                   /db_xref="GOA:A8LNX3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX3"
FT                   /protein_id="ABV92281.1"
FT                   /translation="MAVQQTTYRDALRLALSEAMTKDENVIVMGEEVGRYGGAYGVTKD
FT                   LIKEFGPERVIDTPISEAAIVGAAVGAAMTGLRPVAELMYVDFIGMTMDQLANQAAKIR
FT                   YMFGGQIGVPMVLRTQGGTGRSAGAQHSQSLEGYIMHTPGLRLAMPATVEDAYHLLRQS
FT                   LQQPDPVVFIEHKGLYTMKGALDPDAAPAGWGEATVLREGDDLVIVTYSRQVHHALEAA
FT                   ETLAGAHGINVTVVDLRTLNPLDFDTIRPLVEAAGRAMVVSEGVMTCGVAAELSARITE
FT                   ECFDFLEEPVVRVAGEDIPISVSPLLEQNSVPTPELIVDIARKMFA"
FT   gene            520939..522135
FT                   /gene="pdhC2"
FT                   /locus_tag="Dshi_0536"
FT   CDS_pept        520939..522135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC2"
FT                   /locus_tag="Dshi_0536"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="PFAM: alpha/beta hydrolase fold; biotin/lipoyl
FT                   attachment domain-containing protein; E3 binding domain
FT                   protein; middle swissprot hit to Acetoin dehydrogenase E2
FT                   component from Pseudomonas putida; high Ref YP hit to
FT                   branched-chain alpha-keto acid dehydrogenase subunit E2
FT                   from Sinorhizobium medicae WSM419; unsure GC frame plot;
FT                   pyruvate dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92282"
FT                   /db_xref="GOA:A8LNX4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX4"
FT                   /protein_id="ABV92282.1"
FT                   /translation="MPRLGETMEEATIADWLVQPGQSFKRGDPLLEVETDKTMVEYPAL
FT                   GDGILVETLVGPGDVVEVGTPIAVIETRDAWDSVEEPDAAASSPGAAPSEVAGTAAQAL
FT                   VSPDAARLRATPLARRIARENHIALSQVTGTGRRGRIEAGDVRVMLTEGASTPAVIQAA
FT                   PGATASVYCVHGFAGLGSNWAALRASLQRAGITSSAPDLPGHGRNRVDAGSIEALADWL
FT                   AADLASQPEPVQLVGHSLGAHVAARAAQRVPSRVARLTLLAPAGCGIEINGAFLSGMAA
FT                   APSVGELAHLMRLLGRKAAELDNHALEALSRELQGDRLSALAAAAARADVQRIDTIAPL
FT                   RSLAGKIPVRAIFGLSDQIIPRDHAFHLPPAVACHMLEAGHMPHWDATEEVASIIAAP"
FT   gene            522165..523658
FT                   /locus_tag="Dshi_0537"
FT   CDS_pept        522165..523658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0537"
FT                   /product="carbohydrate kinase FGGY"
FT                   /EC_number="2.7.1.-"
FT                   /note="PFAM: carbohydrate kinase FGGY; NCBI conserved
FT                   domains: AraB, XylB; good swissprot hit to Ribulokinase
FT                   from Bacillus clausii KSM-K16; high Ref YP hit to
FT                   carbohydrate kinase FGGY [Sinorhizobium medicae WSM419]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92283"
FT                   /db_xref="GOA:A8LNX5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX5"
FT                   /protein_id="ABV92283.1"
FT                   /translation="MAYFLAADGGTESLRVRIYDINGVCVASHAEPYETTFSPGARAEQ
FT                   NPEDWWICLCKASRASLAEAGLAGEQIDAMAYATTSCTVVALDKAGKPLRPALLWMDVR
FT                   ADQEAEAVLATGDARLRLNSDGAGPVSAEWMIPKALWIKRNEPDVYDAAATICEYQDYL
FT                   TLRLTGERCASLNNVGLRWHYANRDGGWAESLVTALGMPDLVEKWPARVAAPGEVVGSL
FT                   TPDAAEALGLTPKTKLVQGGADALIGMIGLGVSQPGQLCLITGSSHLQFGVTEKPFHAP
FT                   GMWGAYADIVYPGRHIVEGGQTSTGSIINWLRRFVGGEFDIDEMNRKAAALPPGSEGLV
FT                   VQDHFQGNRTPYTDARSRGAITGLTLAHEPHHVFRAIMEGISMGTRAILDSFAKGGYEG
FT                   SEMVAGGGATNSDLFMQIHADTAGIPVRIPASTDGPTLGSAILAAHGAGYFATIDEGIA
FT                   AMVKPGRVIEPNPKAVQAYEEIYARYLALYPALSGALAR"
FT   gene            523844..524515
FT                   /locus_tag="Dshi_0538"
FT   CDS_pept        523844..524515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0538"
FT                   /product="protein of unknown function DUF1045"
FT                   /note="unsure GC frame plot; no significant swissprot;
FT                   PFAM: protein of unknown function DUF1045; high Ref ZP hit
FT                   to hypothetical protein SSE37_12456 [Sagittula stellata
FT                   E-37]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92284"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX6"
FT                   /protein_id="ABV92284.1"
FT                   /translation="MSYQRFAIYHVPPQGALSAFGAAWLGWDVTAGCPSVPLAVPERDA
FT                   VTATAHRYGFHATLKPPFRLGEGCALEGLSEAVSTLARRLSPARCDGLALGRMGRFLAL
FT                   LPVGDATGLNHLAAACVTQLDAFRASPTAEEFSRRRGSGLRPELEANLTNWGYPYVLSA
FT                   YRFHMTLTDRLPAAALPDWEVVLADLLPPLPAPFEISGLALVGERADGRFEVIDTFPLA
FT                   G"
FT   gene            complement(524529..525467)
FT                   /locus_tag="Dshi_0539"
FT   CDS_pept        complement(524529..525467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0539"
FT                   /product="oxidoreductase"
FT                   /note="PFAM: aldo/keto reductase; COG0667, Tas, Predicted
FT                   oxidoreductases; high Ref ZP hit to oxidoreductase,
FT                   aldo/keto reductase family protein [Sagittula stellata
FT                   E-37]; good swissprot hit to Uncharacterized oxidoreductase
FT                   yajO from Escherichia coli K12; aldo/keto reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92285"
FT                   /db_xref="GOA:A8LNX7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX7"
FT                   /protein_id="ABV92285.1"
FT                   /translation="MTQLTTRSGAPASSLCFGCMQFGGTADKPASAAMFEACRAAGINF
FT                   FDTAHVYTEGRSETWLGEMVTDQADDLLIATKVGYVGGSGRANIRTTFDESLRRLGLDA
FT                   VDILYLHRWDAETPLEETFEALADLQSAGRFRYIGVSNFAAWQVMKAQAVAEQFGTRID
FT                   ILQPMYSLIKRQAEVEILPMALSEGIAVAPYSPLGGGLLTGKYAEGGTGRLTENEKYEM
FT                   RYSMPWMHEAAVALRVLAAEIGAAPATLAVAWAAAHPGVKAPIISARDVAQLDASLAAR
FT                   DMALPPDLYARITALSQTPPPATDRLEEALS"
FT   gene            525545..526321
FT                   /locus_tag="Dshi_0540"
FT   CDS_pept        525545..526321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0540"
FT                   /product="NnrU family protein"
FT                   /note="unsure GC frame plot; no significant swissprot;
FT                   PFAM: NnrUfamily protein; NCBI conserved domains:
FT                   pfam07298, NnrU, NnrU protein; good Ref ZP hit to NnrU
FT                   family protein [Roseovarius sp. TM1035]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92286"
FT                   /db_xref="GOA:A8LNX8"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX8"
FT                   /protein_id="ABV92286.1"
FT                   /translation="MRDIYAAAILRLEGYRAAGRLLVSAACGAALQKGCMHMGWVEFIL
FT                   AFTVFFLSHGVPVRPPMRPWLEARLGARGFTLAYSALSLGVLAWLIGAAGRAPFVPLWD
FT                   WAPWQAHLVLAAMLPVCVIIALTLGRPNPFSFGGARNDIFDPDRPGIVRVTRHPLLLAL
FT                   AIWAGAHLFPNGDLAHVILFGTFAAFALLGGRLVDRRARRTLGSQWSPLLQKSRQTPVF
FT                   RAFPLGESLLRLGLGVVLYLVLIGVHPWLFGVSPLP"
FT   gene            526456..527820
FT                   /gene="hemN1"
FT                   /locus_tag="Dshi_0541"
FT   CDS_pept        526456..527820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN1"
FT                   /locus_tag="Dshi_0541"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="TIGRFAM: oxygen-independent coproporphyrinogen III
FT                   oxidase PFAM: Radical SAM domain protein; HemN domain
FT                   protein SMART: Elongator protein 3/MiaB/NifB; high
FT                   swissprot hit to Oxygen-independent coproporphyrinogen III
FT                   oxidase from Bradyrhizobium japonicum"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92287"
FT                   /db_xref="GOA:A8LNX9"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A8LNX9"
FT                   /protein_id="ABV92287.1"
FT                   /translation="MRNKTVDEIVEKYARVATPRYTSYPTAPHFEPAFPEVTYRGWLSA
FT                   LDASEPISLYVHIPFCREMCWYCGCNMKLVKREGPLAEYVETLLKEIALVRAAMPGRVP
FT                   VAHLHWGGGTPTALSPDQIARIMDALRASFDILPDAEIAIESDPRTLTEPMVARLAELG
FT                   FNRASFGVQEFDPKVQRAINRIQPPEMVAKAVGMFRRHGIAAVNFDLIYGLPYQSVETL
FT                   LHTVDLVSEMGPDRIALFGYAHVPWVAKAQRMIPEESLPDARARAAQASAAARALTEAG
FT                   YRAIGIDHFAKPEDGLARAQAEGRLYRNFQGYTDDPAATLVGLGATSIGRTPQGYIQNQ
FT                   PETRAWARAIENGALPVAKGRAFAGEDLMRAAVIERIMCDGYVDPDAIGARYGVPAGWW
FT                   GPERDSLRDMERDGLVQCGATGLRVTSKGAPLARVVAAAFDSYFAASKARHSVAL"
FT   gene            complement(528241..529869)
FT                   /locus_tag="Dshi_0542"
FT   CDS_pept        complement(528241..529869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0542"
FT                   /product="phosphate transporter"
FT                   /note="NCBI conserved domains: pfam01384, PHO4, Phosphate
FT                   transporter family; COG0306, PitA, Phosphate/sulphate
FT                   permeases; high swissprot hit to Putative phosphate
FT                   permease jhp_1384 from Helicobacter pylori J99; high Ref YP
FT                   hit to phosphate permease [Azoarcus sp. EbN1]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92288"
FT                   /db_xref="GOA:A8LPG5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPG5"
FT                   /protein_id="ABV92288.1"
FT                   /translation="MRRPTLKEYGAADLAPEGACAVLRTDHIEKAVQRNRDEVFRFGTA
FT                   LIFIVGIMLFTIVRTEGGTDGILMVAAAMIGGYMAMNIGANDVANNVGPAVGSHAITLT
FT                   GAIVIAAFFEAGGALIAGGDVVGTIKSGIIDPDLVGDRDTFIWLMMAALLAAAVWLNCA
FT                   TAIGAPVSTTHSIVGGVLGAGIAASGWGIADWSVVGRIAASWVISPVMGGLVAAGFLYV
FT                   IKRTITYKRDVLAAANRMVPILVAGMAWAFATYLMLKGVKKLIAVPLPLAVLIGLAVAA
FT                   AVYVILRPHIVARTAAMENRKASVNELFTVPLIFAAALLSFAHGANDVANAVGPLAGIT
FT                   EAIAEGGVSTSAGIPLWVMAVGAIGIALGLALYGPKLIRTVGSEITELDKMRAFCIAMA
FT                   AAITVIIASQLGLPVSSTHIAVGGVFGVGFLREYIKSSYARMLDEIREHHAESDPEAVE
FT                   AFLAKFEAADVAGKGEMLREMKAQASADRLLKKRERRGLGHVHRVELVKRTLLLRIAAA
FT                   WIITVPIAALLAAMFFFMIRGMMLP"
FT   gene            529946..531796
FT                   /locus_tag="Dshi_0543"
FT   CDS_pept        529946..531796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0543"
FT                   /product="Na+/Pi-cotransporter"
FT                   /note="NCBI conserved domains: pfam02690, Na_Pi_cotrans,
FT                   Na+/Pi-cotransporter; COG1283, NptA, Na+/phosphate
FT                   symporter, bad swissprot hit to Na(+)/Pi cotransporter 2B
FT                   from Bos taurus; high Ref ZP hit to Na+/Pi-cotransporter
FT                   [Oceanospirillum sp. MED92]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92289"
FT                   /db_xref="GOA:A8LPG6"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPG6"
FT                   /protein_id="ABV92289.1"
FT                   /translation="MKRFYLPLVIAALVVTFWVSPDAQEIAAGVAIFLFGMLMLEDGFK
FT                   SFGGGTLERLLERTTDSVPRALSFGIVATTLLQSSSLVSIVTISFLSAGLITLVGGVGI
FT                   IFGANIGTTTGAWLVAGLGLKVDIAAYAMPMIAISIVLVFQKSKVARGIGYALGGLGFL
FT                   FLGIHYMKEGFDAFKDEIDLTRFALSGLLGLAVYSLIGTAATVVMQSSHATMVLILTAL
FT                   AAGQISYDNALALAIGANIGTTITAMIGAIGANYQGKRLALAHLIFNLVTAGVALVLID
FT                   PLRQSVDWISDLVGIAATDFTMKLAVFHTIFNVLGVVLMLPFLSRLIAFLERRIVEPVP
FT                   DISLPRYLNEAVDEFPQTLEVALRKEVLHLYDNAAELILHGLNLHRDEVYAAEDVGALV
FT                   RKCRKPLDLDLTEGYDRRVKTLYSGIVEYTTRAGDKRTPPDIAERIYALRDVSAEIVRA
FT                   VKAVKHLRKNVLRYTVRPQGATTELYDELRTQIARIAVEIRKLDRAAPEDRSTLWLEQE
FT                   RARIEEDALSTSRRVDALIRKGVLTPAAATSFMNDSGYAFSAMRALIEAARSYYVERDR
FT                   AVAEVESLLSLDEDELAEAMTTPREVPIASRADDRVTEQS"
FT   gene            531843..532091
FT                   /locus_tag="Dshi_0544"
FT   CDS_pept        531843..532091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0544"
FT                   /product="hypothetical protein"
FT                   /note="no significant BLAST hits, no conserved domains
FT                   detected"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92290"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPG7"
FT                   /protein_id="ABV92290.1"
FT                   /translation="MGLKKLADKVTDYNARLDSGKASRITPSHVEKVLRKLRVKSTELE
FT                   AEIAAASSAKKKARLESKLGIARTHIARAEWLLKELG"
FT   gene            complement(532144..532884)
FT                   /locus_tag="Dshi_0545"
FT   CDS_pept        complement(532144..532884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0545"
FT                   /product="HAD-superfamily hydrolase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 PFAM: Haloacid dehalogenase domain protein hydrolase,
FT                   NCBI conserved domains: COG0637, Predicted
FT                   phosphatase/phosphohexomutase; low swissprot hit to
FT                   Phosphatase yieH from Escherichia coli K12; good gb hit to
FT                   HAD-superfamily hydrolase subfamily IA, variant 3 [Hoeflea
FT                   phototrophica DFL-43]; subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92291"
FT                   /db_xref="GOA:A8LPG8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPG8"
FT                   /protein_id="ABV92291.1"
FT                   /translation="MNTPRKLRLPQTCTDLFGDVDLVIFDFDGVIADSEVISLATLQAS
FT                   LKAFGMDLTIEEIRQKFLGKSLKTISTYVDQHSSSQAAADFGNAWQAELYSRFRAELKP
FT                   LPHLEKLLFELAETATRFCIASSGTFERINVALSAMSMSDCFDHVFSSEQVSRGKPAPD
FT                   LFLMAAEALDVSPSRCLVIEDSLYGIRAAKAAGMRGVGFLGGAHLQGIVEQHGKTLLEN
FT                   GADMILASHQDIAARLAPKRTQQN"
FT   gene            complement(532894..533910)
FT                   /gene="ugpC2"
FT                   /locus_tag="Dshi_0546"
FT   CDS_pept        complement(532894..533910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC2"
FT                   /locus_tag="Dshi_0546"
FT                   /product="ABC-type sugar / sn-glycerol-3-phosphate import
FT                   ATP-binding protein ugpC"
FT                   /EC_number="3.6.3.20"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein SMART: AAA ATPase;
FT                   high swissprot hit to sn-glycerol-3-phosphate import
FT                   ATP-binding protein ugpC from Silicibacter pomeroyi; high
FT                   gb hit to sorbitol/mannitol ABC transporter, ATP-binding
FT                   protein [Hoeflea phototrophica DFL-43]; following three ABC
FT                   transporter genes (Dshi_0547 to Dshi_0549) com"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92292"
FT                   /db_xref="GOA:A8LPG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPG9"
FT                   /protein_id="ABV92292.1"
FT                   /translation="MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRTLAGLEGVSSGRIEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNG
FT                   FEPDLRKERIAEAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSN
FT                   LDAKLRVQMRVELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLY
FT                   HKPNSRFVAEFIGSPAMNVFSSDVGLQDISLDASAAFVGCRPEHIEIVPDGDGHIAATV
FT                   HVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFDEAGRAI"
FT   gene            534071..535414
FT                   /gene="ugpB4"
FT                   /locus_tag="Dshi_0547"
FT   CDS_pept        534071..535414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB4"
FT                   /locus_tag="Dshi_0547"
FT                   /product="ABC-type sugar / sn-glycerol 3-phosphate
FT                   transport protein"
FT                   /note="PFAM: extracellular solute-binding protein family,
FT                   NCBI conserved domains: COG1653, UgpB, ABC-type sugar
FT                   transport system, periplasmic component; low swissprot hit
FT                   to Putative binding protein BruAb2_0484 precursor from
FT                   Brucella abortus; high gb hit to sugar ABC transporter,
FT                   periplasmic binding protein, putative from Hoeflea
FT                   phototrophica DFL-43; periplasmic component ugpB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92293"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH0"
FT                   /protein_id="ABV92293.1"
FT                   /translation="MKTLRNLLCSAAVASVMASGAMADGHGWSLKDAAAPYAGTTVDVV
FT                   FLLRPGYEAIEAMLPAFEEETGIKVNVIKHPYENALGEQVRDFVAGGDLDVALIDLVWI
FT                   GSFAENEWILPLADVQAKFPDAVDPDLDIDDFFPLVLNAFGGWNDTIYGLPFDNYSGLM
FT                   FYNRCMLEEAGFDGPPSTWEELKDVYGPALTKDGKYAFALQSKRNETQSADSFARMLWP
FT                   FGGSFLNEEFRSNLMSEGSQAGLKFRQELMEYMPDGIVAYDHAETVNAFSQGDVAMITE
FT                   WSAFYSSVVSPETSRVADCVEIAPEPMGPAGRKPALGGFSLAVASQADEAEQAAAYLFI
FT                   QWATSKANAREYLERGGVPARQSVYQQDGLEEFKFVPALVESWQDGVPEFRPRFAEWPE
FT                   ITEIVQEWGTKMMLGEVTTEEGAQEIGTRMEEVLDAAGYYSGEKPLAQ"
FT   gene            535489..536355
FT                   /gene="ugpA1"
FT                   /locus_tag="Dshi_0548"
FT   CDS_pept        535489..536355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA1"
FT                   /locus_tag="Dshi_0548"
FT                   /product="ABC-type sugar / sn-glycerol-3-phosphate
FT                   transport system permease protein ugpA"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component, NCBI conserved domains: COG1175,
FT                   UgpA, ABC-type sugar transport systems, permease
FT                   components; middle swissprot hit to Probable ABC
FT                   transporter permease protein y4oQ from Rhizobium sp.
FT                   NGR234; high gb hit to putative sugar ABC transporter,
FT                   permease protein [Hoeflea phototrophica DFL-43]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92294"
FT                   /db_xref="GOA:A8LPH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH1"
FT                   /protein_id="ABV92294.1"
FT                   /translation="MSGQVPRKTVFAFIGPAVIGLALVGIAPLLYALWTSLHFYNLTKL
FT                   RRVEFIGLENYWTVLTDEVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKT
FT                   LARLSLVLPMATTYAVVGLLGQVMFNQKFGVVNQLLGGADINWIGDPENAFAMIIFWDV
FT                   WQWTPFVALVLLAGLTMVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTAD
FT                   TLKLFDMVFTLTRGGPGSSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYI
FT                   RVFYKEV"
FT   gene            536359..537177
FT                   /gene="ugpE4"
FT                   /locus_tag="Dshi_0549"
FT   CDS_pept        536359..537177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE4"
FT                   /locus_tag="Dshi_0549"
FT                   /product="ABC-type sugar / sn-glycerol-3-phosphate
FT                   transport system permease protein ugpE"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; NCBI conserved domains: COG0395,
FT                   UgpE, ABC-type sugar transport system, permease component
FT                   and COG3833, MalG, ABC-type maltose transport systems,
FT                   permease component; middle swissprot hit to Probable ABC
FT                   transporter permease protein y4oR from Rhizobium sp.
FT                   NGR234; high gb hit to sugar ABC transporter permease
FT                   protein [Hoef"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92295"
FT                   /db_xref="GOA:A8LPH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH2"
FT                   /protein_id="ABV92295.1"
FT                   /translation="MTSTRSLFSQIALLVLIITVCVFPFYWMVTTSLKTQIVALEAPPV
FT                   WIFEPTLSNYREALFEDGVLRTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDL
FT                   WFWFITNRMISPIVLALPFFLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIP
FT                   YDLDEAARLEGASQFTIMRKICLPLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTA
FT                   PAMAVSFMEGYNLPYGKIMATSTLIVIPVLIFALIASKQLVRGLTMGAVK"
FT   gene            537246..538217
FT                   /gene="deoR1"
FT                   /locus_tag="Dshi_0550"
FT   CDS_pept        537246..538217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR1"
FT                   /locus_tag="Dshi_0550"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: putative sugar-binding domain protein; low
FT                   swissprot hit to Deoxyribonucleoside regulator DeoR from
FT                   Bacillus subtilis; high gb hit to putative transcriptional
FT                   regulator protein, DeoR family [Hoefleaphototrophica
FT                   DFL-43]; DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92296"
FT                   /db_xref="GOA:A8LPH3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH3"
FT                   /protein_id="ABV92296.1"
FT                   /translation="MSRTIKLDQIDPEEQLLVRLAWACEFEGMTQAAAAKRFNVTRLRV
FT                   NRALSEARRRGILRVNIDSVFAAAAELEWNLERRFRLKQAVVVPSPQDARSVTQLVSAG
FT                   LGGLLGELLRDKEITHFGMSWGNTLNMATRHMQPLDRPDLEIVSIMGGVSRGSDVNGYE
FT                   ITTRLADLCNAEHSFFTAPLYAGSAESRTLFVEQDVIRDMLEKIRSCQAIALATGDLES
FT                   SLLVQDALPSGITADELRALGGVGDITGHILDAKGELIDHPLNQRVIGMSLDDMAKIDN
FT                   VILAAGGLHKVAVINAALTRGFVDTLVTDEYTAVALLEDRAK"
FT   gene            538237..539280
FT                   /gene="xylD"
FT                   /locus_tag="Dshi_0551"
FT   CDS_pept        538237..539280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylD"
FT                   /locus_tag="Dshi_0551"
FT                   /product="D-xylulose reductase"
FT                   /EC_number="1.1.1.9"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; high
FT                   swissprot hit to Putative D-xylulose reductase from
FT                   Sinorhizobium meliloti; high gb hit to D-xylulose
FT                   reductase, putative [Hoeflea phototrophica DFL-43]; Xylitol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92297"
FT                   /db_xref="GOA:A8LPH4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH4"
FT                   /protein_id="ABV92297.1"
FT                   /translation="MARALVLEAARKLALRDIDLPDELGPEDVRIAIDTVGVCGSDVHY
FT                   YTHGKIGPFVVKQPMVLGHEAAGIVTEIGAAVTHLALGDRVCMEPGIPNGSSKASKLGV
FT                   YNVDPAVQFWATPPVHGCLTPSVVHPAAFTFKLPDHVSFAEGAMVEPFAIGMQAAAKAR
FT                   IKPGDVALVTGAGPIGVMVALAALAGGCAKVFVSDLVEDKLAIAAGYDNIHPILIPRDN
FT                   PAEVLQEATEGWGADVVFECAGAAASIQAALEAAAPAGCVVWVGMPVDPVPVDIVLAQS
FT                   RELRMETVFRYANMYDRAIALLASGKVDLKPLISATFPFEDSIAAFDRAVEARPTDVKI
FT                   QIKMGAS"
FT   gene            539277..539843
FT                   /locus_tag="Dshi_0552"
FT   CDS_pept        539277..539843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0552"
FT                   /product="sugar isomerase"
FT                   /note="PFAM: sugar isomerase (SIS); middle swissprot to
FT                   3-hexulose-6-phosphate isomerase from Bacillus subtilis;
FT                   good gb hit to 6-phospho-3-hexuloisomerase [Hoeflea
FT                   phototrophica DFL-43]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92298"
FT                   /db_xref="GOA:A8LPH5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH5"
FT                   /protein_id="ABV92298.1"
FT                   /translation="MTLALDGLADRLLDELRPGLSAEVLAQVATLSQALAGAKRILCYG
FT                   VGREGLMMKALAMRLYHLGCDAHVVGDMTAPPVGQGDLLFVSAGPGQFATVAALVEVAR
FT                   LSGAATICITAEPGGAVPRSVDACVTLPAQTMAADQGDKTTSILPMGSLYEVYMFLFFE
FT                   ILVLDLRALMEVAPEAMRANHTNLE"
FT   gene            539847..540614
FT                   /locus_tag="Dshi_0553"
FT   CDS_pept        539847..540614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0553"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NCBI conserved domains: PRK12825, fabG,
FT                   3-ketoacyl-(acyl-carrier-protein) reductase; middle
FT                   swissprot hit to3-oxoacyl-[acyl-carrier-protein] reductase
FT                   from Bacillus subtilis; good ref ZP hit to Short-chain
FT                   dehydrogenase/reductase SDR [Synechococcus sp. WH 5701]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92299"
FT                   /db_xref="GOA:A8LPH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH6"
FT                   /protein_id="ABV92299.1"
FT                   /translation="MPWQDRFSLQDKTALVTGASSGIGRAIAEVFADAGADIVGQGRDL
FT                   DRLTDLGAQIKTTGRQFAAITGDLADPDQTQNVADRALAAFGKIDILVNSAGIAVTGPV
FT                   TNYDLDDWQRTLAVNLTAPFILSKAVMPGMMQRKQGKIINISSQTGVIALKDHAAYATS
FT                   KGGLNALTKSLMTEAAPHNVQVNAICPTVVLTEMGKELWSAPERKDPFIARTPLGRFGE
FT                   PIEIADMALYLASPASDLVNGAVMMIEGGYSSI"
FT   gene            541133..541858
FT                   /gene="rbtD"
FT                   /locus_tag="Dshi_0554"
FT   CDS_pept        541133..541858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbtD"
FT                   /locus_tag="Dshi_0554"
FT                   /product="ribitol 2-dehydrogenase"
FT                   /EC_number="1.1.1.56"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; high swissprot hit to Ribitol
FT                   2-dehydrogenase (RDH) from Klebsiella aerogenes; high Ref
FT                   YP hit to probable ribitol 2-dehydrogenase protein
FT                   [Rhizobium etli CFN 42]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92300"
FT                   /db_xref="GOA:A8LPH7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH7"
FT                   /protein_id="ABV92300.1"
FT                   /translation="MTDLSGKVVAITGGASGIGLACARACIDAGAKVAIIDRNATALEE
FT                   VRAELGAQAVPIVTDLMDKASVAQMLSRILDKAGRLDAFHANAGAYVGGDVLAGDPDEW
FT                   DHVLNLNINAAFRSVHAVLPHLAKQGSGDVILTSSVAGVIPVVWEPIYTASKHAVQAFT
FT                   HSVRRQMSKHGVRVGAILPGPVVTALLDDWPKPKMEQALAEGSLMQPKDVADCVVFMLT
FT                   RPSNVTIRDLVLLPNAVDL"
FT   gene            541855..543489
FT                   /gene="araB"
FT                   /locus_tag="Dshi_0555"
FT   CDS_pept        541855..543489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="Dshi_0555"
FT                   /product="ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="TIGRFAM: FGGY-family pentulose kinase PFAM:
FT                   carbohydrate kinase FGGY; good swissprot hit to
FT                   Uncharacterized sugar kinase YDR109C from Saccharomyces
FT                   cerevisiae; high gb hit to ribitol kinase [Escherichia
FT                   coli]; unsure Gc frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92301"
FT                   /db_xref="GOA:A8LPH8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH8"
FT                   /protein_id="ABV92301.1"
FT                   /translation="MTCFIGVDVGTGSARAGVFDLEGTLLASRKHDIQMWRALGNIAEQ
FT                   SSDDIWQAVCSCVRGAISDAGISPQEVRGIGFDAACSLVALDGDMRPLSVSASGDVARN
FT                   VIVWMDQRATDQAARINAKEYPVLEFVGGAISPEMQTPKLLWLRENMPESFAAAGQFFD
FT                   LVDYLTWAATGSLARSCCTVTCKWTYLAHEDRWDNSYFEEIGLRELASENFSRIGTEIV
FT                   PPGSALAQGLSHGAAAQMGLLAGIPVAAGLIDAHAGGIGTVGADPERGPEATMAYVFGT
FT                   SACTMSTSPEAHRVPGVWGPYYSAMVPGMWLSEGGQSAAGEAIAHLVTVHPASAEAEAA
FT                   ARAEGLSLQTYLLRQVDRRVSEKSEVALLAGARVVVPDFLGNRAPFADPGATGAILGLT
FT                   LSADFEDLLATYVAAVLGVGYGLRQIMQAQGQHGVRPSTIVVSGGAGESDTIKQLLADS
FT                   SGFPVLSTRSAEPVLLGAAMLGAVAAGAYPTIQSAMSAMSSVKARFDPSSAEILALHQK
FT                   RFEAFEMLQKADQTVRQAMVALPKGSV"
FT   gene            544002..544445
FT                   /locus_tag="Dshi_0556"
FT   CDS_pept        544002..544445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0556"
FT                   /product="hypothetical protein"
FT                   /note="unsure GC frame plot, no significant swissprot, bad
FT                   gb hit to nucleoside diphosphate kinase regulator from
FT                   Oceanibulbus indolifex HEL-45; NCBI conserved domains:
FT                   PRK05753, nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92302"
FT                   /db_xref="GOA:A8LPH9"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPH9"
FT                   /protein_id="ABV92302.1"
FT                   /translation="MFDLDHPEVELEPSSGALQDRRTRLPAADYRQLQEHLESCVCAIP
FT                   PASELLVYVLANKVMNTRPSENLHQGDLVVGGSRVTYAIDGGDPLRGQLVHRVRKGPTS
FT                   ALIPVASLLGATLIGMQVGQRAPLLFGNGRIGRLAVIAVDHAT"
FT   gene            544496..544927
FT                   /gene="greA2"
FT                   /locus_tag="Dshi_0557"
FT   CDS_pept        544496..544927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA2"
FT                   /locus_tag="Dshi_0557"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   domain protein, NCBI conserved domains: COG0782, GreA,
FT                   Transcription elongation factor, bad swissprot hit to
FT                   Transcription elongation factor greA from Sinorhizobium
FT                   meliloti; middle gb hit to GreA/GreB family elongation
FT                   factor [Oceanibulbus indolifex HEL-45]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92303"
FT                   /db_xref="GOA:A8LPI0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI0"
FT                   /protein_id="ABV92303.1"
FT                   /translation="MSTSLQATKKQTKRSPKIVINADDLEHLEGLADGMMRRQPALADR
FT                   LFDEIARARIVAPSKMPKNVVSMGSRVTYRDEATGQEKSVTLVYPEEADIARLRVSVTT
FT                   PIGVALLGLAEGASFHWETRGNQRRMLTIIQVEQPAATR"
FT   gene            545054..546313
FT                   /gene="dadA"
FT                   /locus_tag="Dshi_0558"
FT   CDS_pept        545054..546313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="Dshi_0558"
FT                   /product="D-amino-acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; NCBI conserved
FT                   domains: PRK00711, D-amino acid dehydrogenase small
FT                   subunit; high swissprot hit to D-amino acid dehydrogenase
FT                   small subunit from Bradyrhizobium japonicum; high gb hit to
FT                   D-amino-acid dehydrogenase, small subunit protein
FT                   [Oceanibulbus indolifex HEL-45]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92304"
FT                   /db_xref="GOA:A8LPI1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI1"
FT                   /protein_id="ABV92304.1"
FT                   /translation="MKVVIMGAGVIGVTTAYYLAKQGVKVVVIDRQTGPGLETSYANAG
FT                   QLSYGMSSPWAAPGIPLKAVKWMFMKRRPLFIMPLLSPTMWKWCLQMLRNCNAESYAIN
FT                   KGRMVRVSSYSRDVMPDLIADTGIEYDGRQMGTLQLFRTAKQMKASKADQAVLAEYGSP
FT                   YEVLGRDACIEVEPALAEVRGKFVGGLRLTSDRTGDCRMFTIALTDKCIEMGVEFQYGQ
FT                   TIKAIAVENGKISGVDTEIAGRISGDAYVCAMGSYAVNVLNPIGIRLPVYPVKGYSVTL
FT                   PVTNDAFAPQSTIMDETHKVAITRLGDRIRVAGQAEIVGYSNRLGPHATDTVRHVIGDL
FT                   FPKGGDLSRAEGWTGLRPMTPDGTPVLGPTRYENLFLNTGHGTLGWTMACGSGRAVADV
FT                   VMGKPPEISMEGLTAARYAR"
FT   gene            546760..547167
FT                   /locus_tag="Dshi_0559"
FT   CDS_pept        546760..547167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0559"
FT                   /product="protein of unknown function DUF1636"
FT                   /note="unsure GC frame plot, no significant swissprot,
FT                   PFAM: protein of unknown function DUF1636; NCBI conserved
FT                   domains: COG5469, Predicted metal-binding protein; middle
FT                   Ref ZP hit to hypothetical protein RCCS2_05834 [Roseobacter
FT                   sp. CCS2]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92305"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI2"
FT                   /protein_id="ABV92305.1"
FT                   /translation="MDATGYHSHRITICTSCRHKGRDCRPGLELIDRLRAALKAAGGLL
FT                   SNDFEISGVACMAGCDRPCTVAYHASAKATYLFGDIEPGQDIEDLVAFARQYRDLDDGW
FT                   CSSTTRPGKLQRTTLARVPAALIVAEAGPVQ"
FT   gene            547164..547937
FT                   /gene="fhuC"
FT                   /locus_tag="Dshi_0560"
FT   CDS_pept        547164..547937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="Dshi_0560"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system protein"
FT                   /EC_number="3.6.3.34"
FT                   /note="PFAM: ABC transporter related SMART: AAA ATPase;
FT                   good swissprot hit to Ferrichrome transport ATP-binding
FT                   protein fhuC from Escherichia coli K12; high Ref ZP hit to
FT                   iron ABC transporter, ATP-binding protein, putative
FT                   [Roseobactersp. CCS2], unsure GC frame plot; ATPase
FT                   components; alternative gene name: fecE/fepC/btuD"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92306"
FT                   /db_xref="GOA:A8LPI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI3"
FT                   /protein_id="ABV92306.1"
FT                   /translation="MTAAALLVEDLSWAPKRGASVLHPTSFALAPGRILGVVGANGAGK
FT                   STLLRLLYRYLRPAGGRVLLDGVDIWSISAREVARSIAVVLQEQPTDFALTVREIVALG
FT                   RTPHRSGLASAGDSDARIVRAALARLDLAAFADRMFGTLSGGERQRVMVARALAQEPRL
FT                   LVLDEPTNHLDIRHQLEVLDLIGTLGPTIVTSLHDINLAATHTDEVLVLSDGQALACGP
FT                   PGEVLSEDLIARAFGVRVSRQTLAPSGDPHLTFHL"
FT   gene            547953..548888
FT                   /gene="fhuD"
FT                   /locus_tag="Dshi_0561"
FT   CDS_pept        547953..548888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="Dshi_0561"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system protein"
FT                   /note="PFAM: periplasmic binding protein; low swissprot hit
FT                   to Vitamin B12-binding protein precursor from Escherichia
FT                   coli O6; high Ref YP hit to putative iron ABC transporter,
FT                   periplasmic binding protein from Roseobacter denitrificans
FT                   OCh 114; NCBI conserved domains: fhuD, btuF; periplasmic
FT                   binding protein; alternative gene name: fecB/fepB/btuF"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92307"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI4"
FT                   /protein_id="ABV92307.1"
FT                   /translation="MRPLLSLALLAFAGPAFAHPVTVQSCDREVTFDAPPKAAVSNDVN
FT                   LTEMMLVLGLTERMVGFTGINGWNKLDEAMRADVGELPELSEKYPSKEVLIGAGADFYF
FT                   AGWNYGMRVGGEVTPDTLAPFGIQVYELTESCTHIMDKPPARMDDMYADLLNLGRIFGV
FT                   AERAEALVAGYRAELDAILAEMTPLENAPRVFVYDSGEDMPFTAGRYAMPNALIQAAGG
FT                   TNIMDDVEKSWTTVGWEAVVERDPEVIVIVNYGDVTAAQKRDFMMQNPAFADLSAVRND
FT                   RFVTLEYVEATPGPRNIGAVRTLAEAFRAE"
FT   gene            548885..549931
FT                   /gene="fhuB"
FT                   /locus_tag="Dshi_0562"
FT   CDS_pept        548885..549931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="Dshi_0562"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system protein"
FT                   /note="PFAM: transport system permease protein; NCBI
FT                   conserved domains: fecCD, fepDG, btuC; good swissprot hit
FT                   to Ferrichrome transport system permease protein fhuB from
FT                   Bacillus subtilis; high gb hit to putative hemin ABC
FT                   transport protein, permease component from Roseobacter
FT                   litoralis Och 149; permease protein; alternative gene name:
FT                   fecCD/fepDG/btuC"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92308"
FT                   /db_xref="GOA:A8LPI5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI5"
FT                   /protein_id="ABV92308.1"
FT                   /translation="MTETRVGAPARRAFVMPSLTVAGVAVLLLSISVAVSLGAVAVPLG
FT                   TVWGIMADRILPGLLTPDWTTGQAAIVWEIRLPRALLAAMVGAGLALVGASLQSVTRNP
FT                   LADPHLLGISSGAAFGAILALLHTGLFLGLLTVPLLAFAGALAATLLVLGVTSFAQATG
FT                   ADRLVLAGVAVSFIVMSCANILIFIGDPRATHTVVFWMLGGLGLAQWDQLLFPAVILVG
FT                   CGLWFLANASRLNAMTIGDETASTLGIPIARFRLSVFVVGALLTGCMVAFSGIIGFVGL
FT                   MIPHIVRMLVGGDYARVLPASALVGAIFLVWADIAARTVMAPEDIPIGIVTGLIGGAFF
FT                   VWLLRRRA"
FT   gene            550566..551828
FT                   /gene="irpA"
FT                   /locus_tag="Dshi_0563"
FT   CDS_pept        550566..551828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irpA"
FT                   /locus_tag="Dshi_0563"
FT                   /product="iron-regulated protein"
FT                   /note="unsure GC frame plot; NCBI conserved domains:
FT                   COG3487, IrpA, Uncharacterized iron-regulated protein; low
FT                   swissprot hit to Iron-regulated protein A precursor from
FT                   Synechococcus elongatus PCC 7942; high Ref ZP hit to
FT                   lipoprotein, putative [Rhodobacterales bacterium HTCC2150]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92309"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI6"
FT                   /protein_id="ABV92309.1"
FT                   /translation="MTRLPHLSTALALVLATPAFATEPAEVLDHYADMAVAKYEDSLIT
FT                   AQRLQAAVDALVSTPSAEALTAARAAWLAARVPYQQSEVYRFGNAIVDDWEGKVNAWPL
FT                   DEGLIDYVDASYGGPTDENAFASLNVIASPTFTLSGAEVDATEITPALLEETLHEADGV
FT                   EANVATGYHAIEFLLWGQDLNGHGAGPGDRPWTDYAPGDDCTNGNCDRRGAFLKAATDL
FT                   LVSDLEWMVAQWADDGAARAELTADAEAGIAAILTGMGSLSYGETAGERMRLGVMLNDP
FT                   EEEHSCFADNTHNDHFYNGIGIQNVYLGEYVRVDGTLVSGPALSDLVVAADPALDAEMQ
FT                   GKLAMAVMQLGRIKTAAEAGFAYDQMLEQGNAAGEALIMGGVNGLVDQTRSIERVIAVL
FT                   NAEGIEIEGSDSLDNPSAVFE"
FT   gene            551932..553464
FT                   /locus_tag="Dshi_0564"
FT   CDS_pept        551932..553464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0564"
FT                   /product="protein of unknown function DUF1111"
FT                   /note="PFAM: protein of unknown function DUF1111; NCBI
FT                   conserved domains: COG3488, Predicted thiol oxidoreductase;
FT                   no significant swissprot; high Ref ZP hit to probable thiol
FT                   oxidoreductase with 2 cytochrome c heme-binding sites
FT                   [Sulfitobacter sp. EE-36]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92310"
FT                   /db_xref="GOA:A8LPI7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI7"
FT                   /protein_id="ABV92310.1"
FT                   /translation="MLTRHIPALLYIFAAVPAAWADSPFASLGDPHLNVVPRTAEEAAR
FT                   IAAVTALTEDFSAAAKFEERSAGAATVRALDNPNAFSLPSGNISFEDEMTFKLGNGLFR
FT                   KLWVSSPASTLASDGLGPIFNARSCQRCHIKDGRGHPPENADDNAISMFLRVSIPGPVD
FT                   AGIPEIQGYIATLPDPTYGTQLQDFAVQGHAAEYRLDVRYTEDIVVLADGTEVSLRHPT
FT                   YTAANLGYGPLHPEAMLSPRVAPQMIGLGLLEAIPAADILARADPEDLDGDGISGRPNI
FT                   VWSFEYDQPMLGRFGLKAGNPTVMQQSAGAFAGDIGISNPLFPAGAGECTPAQAACQTA
FT                   VHGDGDARGTEIDALGMDLVAFYSRNLGVPARRNVDTPEVLRGKEVFYNTGCVSCHTPS
FT                   FVTHRLADRPEQSFQLIWPYTDMLLHDMGPGLADNRPEARATGREWRTPPLWGIGLTET
FT                   VSGHTYFLHDGRARSLLEAVLWHGGEAQPHRDAVVAMSTEDREALIAFLESL"
FT   gene            553461..554477
FT                   /locus_tag="Dshi_0565"
FT   CDS_pept        553461..554477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="low swissprot hit to Iron-regulated protein A
FT                   precursor from Synechococcus elongatus PCC 7942; high Ref
FT                   ZP hit to hypothetical protein RB2150_00045
FT                   [Rhodobacterales bacterium HTCC2150]; NCBI conserved
FT                   domains: COG3489, Predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92311"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI8"
FT                   /protein_id="ABV92311.1"
FT                   /translation="MKHLLVTFLLTCAPVLAFADDNAPDIDGIVSDHILPRFAMLSETS
FT                   ADLSHAAAQECRADAPELRAAYGAAFDAWIAASHLRFGPTEVDDRAFALAFWPDSRGAT
FT                   PRVLSDLIATEDPVAQGGETYSDVSIAARGFYALEFLLYDPGLSTVGNADFRCTLVRTI
FT                   TADIAATAAAILADWETRYADLLRTPRADGVYRTEQEALQEMFKAVTTGLQFTADTRLG
FT                   RPLGTFERPRPMRAEARRSGRSARHVAISLASVEDLALRLATGNAALRERLGDQFARAQ
FT                   SRLKALDDPIFASVTAPQTRLKVEVIQQSVNEIRSTVSDRLGPKIGVYAGFNALDGD"
FT   gene            554479..555561
FT                   /locus_tag="Dshi_0566"
FT   CDS_pept        554479..555561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="NCBI conserved domains: pfam07433, DUF1513, COG3490,
FT                   Uncharacterized protein conserved in bacteria, no
FT                   significant swissprot; high Ref ZP hit to hypothetical
FT                   protein RB2150_00040 [Rhodobacterales bacterium HTCC2150];
FT                   unsure GC frame plot"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92312"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPI9"
FT                   /protein_id="ABV92312.1"
FT                   /translation="MAGGLSGRRAFLGGLLSAGLTPALTWADAGSPAFLSAAVTSDGRY
FT                   VLCGIDAALRVRFEVPLPARGHAAAAHPSRPEAVAFARRPGRFALVLDCVSGAQKAMLQ
FT                   TPEGRHFYGHGTFSADGSLLYTTENDYEAGRGRVGLWDVTRGYIRLGEWDSGGIGPHDI
FT                   ERLPGTDTLIVANGGIDTHPDSGRAKLNIPTMRPNLAYLDQGRIIEIAELPPELHRNSI
FT                   RHLAVAPDGAVAFGMQWQGDGPVAALAGLHRRGSEPRLVHAPAPEMRALAGYVGSIAIS
FT                   RDGATIAVTSPRGNTLQCHDARSLTFLEAYELTDVCGVVKAGTGFLATSGVGQLVALAN
FT                   RAPVRTAQTALRWDNHLISV"
FT   gene            complement(555614..556162)
FT                   /locus_tag="Dshi_0567"
FT   CDS_pept        complement(555614..556162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0567"
FT                   /product="TonB family protein"
FT                   /note="unsure GC frame plot; TIGRFAM: TonB family protein;
FT                   low swissprot hit to Protein tonB from Pseudomonas putida;
FT                   low Ref ZP hit toPutative TonB protein [Roseobacter sp.
FT                   SK209-2-6]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92313"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ0"
FT                   /protein_id="ABV92313.1"
FT                   /translation="MPPPDPATPPPPPAPPAPPEPAVAQAQLPEAAKSPPAPRPERAQA
FT                   PKAETAAAPQPAAPPQKAQRAKGDGDAAAAGRGTQTDISSLSPGVRERLMTRWGSQIRA
FT                   RVERRKPSGTRDRGTAVVRLVVSTEGQLVAVSLAQSSGVAAIDAAAISAVQRAGRFPKA
FT                   PRDLDGTQHAFTLPIRFGR"
FT   gene            complement(556657..557049)
FT                   /gene="exbD"
FT                   /locus_tag="Dshi_0568"
FT   CDS_pept        complement(556657..557049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="Dshi_0568"
FT                   /product="biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; low
FT                   swissprot hit to Biopolymer transport protein exbD1 from
FT                   Vibrio cholerae; low gb hit to Biopolymer transport protein
FT                   ExbD/TolR [alpha proteobacterium BAL199]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92314"
FT                   /db_xref="GOA:A8LPJ1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ1"
FT                   /protein_id="ABV92314.1"
FT                   /translation="MRIPPPPKPLRNESIIPMINVVFLLLIFFLITAEIRPADPIEVVL
FT                   PSTEDQELASETPVRLFLSADGLIAFDAFTGETALAAALEEYGPEPGVPLQIRADYRVP
FT                   GTALAALLRRLAEAGIRDVELTTAPS"
FT   gene            complement(557437..558129)
FT                   /gene="exbB"
FT                   /locus_tag="Dshi_0569"
FT   CDS_pept        complement(557437..558129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="Dshi_0569"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; low swissprot
FT                   hit to Putative biopolymer transport protein exbB homolog
FT                   from Methanothermobacter thermautotrophicus str. Delta H;
FT                   good Ref ZP hit to MotA/TolQ/ExbB proton channel
FT                   [Roseobacter sp. SK209-2-6]; NCBI conserved domains: MotA/
FT                   ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92315"
FT                   /db_xref="GOA:A8LPJ2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ2"
FT                   /protein_id="ABV92315.1"
FT                   /translation="MIDLASLALLDLSALQSFMAQGGPAIWVIAGLSVITLTVILWKLW
FT                   RFARIGAWSGQRADRAVQHWVKGDMGAAHRALSGQQGVRARLVARALAALDDPGLSFEG
FT                   AKEETYRIAQRELAQSRAGLRVLELIATIAPLIGLLGTVLGMIAAFQALQDAGARADPG
FT                   TLAGGIWEALLTTAAGMAVAIPASMALSYFESVVDRIRQDMEDLATRIFIRAETRELTP
FT                   KPLQRAAE"
FT   gene            558999..561026
FT                   /gene="fhuA"
FT                   /locus_tag="Dshi_0570"
FT   CDS_pept        558999..561026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="Dshi_0570"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system protein"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; low swissprot hit to Vitamin B12 transporter
FT                   btuB precursor from Photobacterium profundum; high Ref NP
FT                   hit to putative outer membrane receptor for iron compound
FT                   or colicin [Escherichia coli O157:H7 EDL933];
FT                   TonB-dependent outermembrane recepter protein; alternative
FT                   gene name: fecA/fepA/btuB"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92316"
FT                   /db_xref="GOA:A8LPJ3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ3"
FT                   /protein_id="ABV92316.1"
FT                   /translation="MLKQALTITTVLVTATGLSARISAAQDATALEAITVLGTGLPTSV
FT                   FESPSSVTVIDDGQLRRIAPEKIGSYLESVPGVIIGEQGIQRIQIRGEAERRVLIKVDG
FT                   QALTDHTTYGQPVLVDPLNIERIEVIRGASSVVSGSRAIGGVVNIVTKRGAPDTAAEVT
FT                   FGAGYFGGSDGYRASGSVGGTIGAFDYRITAGTADFGDRETPDRTLVPSESASDSLAVH
FT                   LGYQIDPNQYVMFKAQRYDQSADVFTDDPDFTITLPNRDLTKYSAFYEGTDLAPWMPKL
FT                   NADVYYQTVDRVFENDVNTGVPPFVPNAPTNIQGLSDDEGRTWGLNVTAELSIFDIGRS
FT                   FVGFEYEDDRLDTARSSIVTANPPPGPPGPPVVSVDSREEDASIKTTSLYALQEFDLSD
FT                   TVTGFLGGRYYAVDAELIRSTRSAPRSNDDDRFLGSAGLVWTPNPETALRLNISQGYSY
FT                   PSLGQLFLETSAGGQTVIGNPDLEPETATTLELGARYDGAGATIDATFFYTDSSDYIEL
FT                   TGAGGGTLSYTNIAAAEAFGLEVLAETRIGASNWSPYASLTYVRREFDFGNGFKTKDSG
FT                   TPELFGRVGVKYDFDWFGMTGVLDAHVRGETSATLRDETGAVVRSGDGFGLLEVDAFVN
FT                   ISENASLTVALNNLLNTTYDPIDQIEGQKRSVDVFLTWTF"
FT   gene            complement(561072..561854)
FT                   /gene="hmuV"
FT                   /locus_tag="Dshi_0571"
FT   CDS_pept        complement(561072..561854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="Dshi_0571"
FT                   /product="hemin import ATP-binding protein hmuV"
FT                   /EC_number="3.6.3.-"
FT                   /note="PFAM: ABC transporter related; high swissprot hit to
FT                   Hemin import ATP-binding protein hmuV from Jannaschia sp.
FT                   CCS1; high Ref ZP hit to putative hemin transport system
FT                   atp-binding abc transporter protein from Roseobacter sp.
FT                   MED193"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92317"
FT                   /db_xref="GOA:A8LPJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ4"
FT                   /protein_id="ABV92317.1"
FT                   /translation="MSLHARNITVRLGRRDVLSGVDFTAQPGALTAIVGPNGSGKTTLL
FT                   RALVGEIGASGDVRLNGLQTASAKPWALAAMRGVLPQAASLAFPFTVIEVITMGLEAGR
FT                   HAARRTLPLQALQKVGLSGYEDRYYQELSGGEQQRVQLARVLCQVWEPVSAEGPCWLFL
FT                   DEPVSSLDIGHQLGIMRIAADYAARGGGVIAVMHDLNLTAMFADQVALLKGGAIRAVGT
FT                   PRQVLTDTNLSEAYDCAVRVNTPPAADHTFILPHAAQM"
FT   gene            complement(561851..562933)
FT                   /gene="hmuU"
FT                   /locus_tag="Dshi_0572"
FT   CDS_pept        complement(561851..562933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="Dshi_0572"
FT                   /product="hemin transport system permease protein hmuU"
FT                   /note="PFAM: transport system permease protein; good
FT                   swissprot hit to Hemin transport system permease protein
FT                   hmuU from Yersinia pestis; high embl hit to HmuU protein
FT                   [Rhizobium leguminosarum]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92318"
FT                   /db_xref="GOA:A8LPJ5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ5"
FT                   /protein_id="ABV92318.1"
FT                   /translation="MATDLSHQAGTAAGAEGGRYARAMRLHLWLWIFLLAVSAFSLGIG
FT                   AAGAQVRAAVADWIRTGTLDAGAQVILFDIRLPRLALGLLVGAALAVAGAVMQGLFRNP
FT                   LADPGIVGVSAGAGLGAILAIVLGAALPAFFIDALGNYLIPLAAFAGGWGSTILLYKVS
FT                   TRRGRTSVATMLLAGIALAALTGALSGILVYIADDRQLRDLTFWGLGSLAGATWTKVLI
FT                   AGPLIAVAFLSAPLLARGLNGMALGEAAAAHMGVALERLKTGAILIVASATGAAVAVSG
FT                   GIGFVGIVVPHLLRIAVGPDHRTLLPNAALLGASLLVLADCISRTIIAPAELPIGIVTA
FT                   VLGAPVFLWILLRARGVVDL"
FT   gene            complement(562923..563759)
FT                   /gene="hmuT"
FT                   /locus_tag="Dshi_0573"
FT   CDS_pept        complement(562923..563759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="Dshi_0573"
FT                   /product="hemin-binding periplasmic protein hmuT"
FT                   /note="PFAM: periplasmic binding protein; good swissprot
FT                   hit to Hemin-binding periplasmic protein hmuT precursor
FT                   from Yersinia pestis; high Ref YP hit to hemin ABC
FT                   transporter, periplasmic hemin-binding protein [Roseobacter
FT                   denitrificans OCh 114]"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92319"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ6"
FT                   /protein_id="ABV92319.1"
FT                   /translation="MMFRLALILFLVTGPVLASDRVLAIGGAITEIVYALGEDARLVGR
FT                   DTTSVFPPEAEALPDVGYMRALSPEGVLSLAPDLIIADEGAGPAEALDVLTSARVPIVM
FT                   VPNQPDAEGLVSKIMTISDALGVPERGAELAEAVKSDLEKARARVAELSDGDDPKRVLF
FT                   ILSTQGGRILASGTDTAAAAMITLAGGVNANTGFEGYKPLNDEAVTALAPDLILMMDRG
FT                   GDHDVAVDELLAMPALASTPAAQNRAVVRMDGLFLLGFGPRTAQAVRDLSLALYGN"
FT   gene            complement(563756..564787)
FT                   /gene="hmuS"
FT                   /locus_tag="Dshi_0574"
FT   CDS_pept        complement(563756..564787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="Dshi_0574"
FT                   /product="hemin transport protein hmuS"
FT                   /note="PFAM: Haemin-degrading family protein; NCBI
FT                   conserved domains: hemS; good swissprot hit to Hemin
FT                   transport protein hmuS fromYersinia pestis; high Ref ZP hit
FT                   to Haemin-degrading [Roseovarius sp. TM1035];
FT                   hemin-degrading"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92320"
FT                   /db_xref="GOA:A8LPJ7"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ7"
FT                   /protein_id="ABV92320.1"
FT                   /translation="MLDAKEIREARTHKAGRARDIAQALGLPEAALVAAQVGHDAVALR
FT                   PHPNDLIPALGALGPMMALTRNDACVIEKDGEYTDYHGGDHATMTLNEGIDLRMFPRHW
FT                   VHAFAVSEQVKSGLRHSVQVFDAAGDAVHKAYLRDGADMAAWTRLQSDLALPAQTDTLA
FT                   LKDREPPEGARINLDKRDILLKEWARLTDTHQFLRLCAKLKMNRLGAYRIAEPPFVRPL
FT                   APSAVDTMLRAIQVAGFEIMLFVGNRGCIEIHTGPLRRIEPMGPWVNVLDPDFNLHLRG
FT                   DKVAEVWQVEKPTQRGPAVSVEAFDADGVLILQAFGVPKEGKDTRTAFTEIVNGLPTQE
FT                   TTA"
FT   gene            complement(564854..565354)
FT                   /locus_tag="Dshi_0575"
FT   CDS_pept        complement(564854..565354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="no significant swissprot, no conserved domains; low
FT                   Ref ZP hit to hypothetical protein SSE37_21645 [Sagittula
FT                   stellata E-37]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92321"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ8"
FT                   /protein_id="ABV92321.1"
FT                   /translation="MFDHQGPRTTESCCGRRNDPMSVRIEKAGLEPRDQVVLQTARYFF
FT                   ESFANPEHQSWLLGFKCPTLTYGEIDGVRVASLVLGAVQAMRQARQSCFRFNNPHCANC
FT                   ARLLSEHEGLFMRSFIALREGRRPVAFSYAMLLCETNPVDTFLAAQTRLINATDALEMQ
FT                   PMS"
FT   gene            complement(565766..566635)
FT                   /locus_tag="Dshi_0576"
FT   CDS_pept        complement(565766..566635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dshi_0576"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; low swissprot hit to Uncharacterized
FT                   HTH-type transcriptional regulator ydcI from Escherichia
FT                   coli K12; middle Ref ZP hit to transcriptional regulator,
FT                   LysR family protein [Roseobacter sp. AzwK-3b]; LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92322"
FT                   /db_xref="GOA:A8LPJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPJ9"
FT                   /protein_id="ABV92322.1"
FT                   /translation="MPIKLEMLRTFSVVATQGTLAGAAAVLGRSPSAVSMMLAQLEDDI
FT                   GAPLFETDRKSRLTPLGQLVLEESQRATDVFDRSVAAIRRHAMSAGGIVRIAAVPSATV
FT                   ALLPDVIEAFRKAHPDVRIEISDVDSAAVRARIQRDAADIGIVSAQPRDTPEGTRIRSD
FT                   DLGIVCVEGGAIHLAHMNTQGMSGWDLLKREPLISNPLCELVDDPLVAEMRIASTLEAR
FT                   NTTAILSFVKRGFGASILPFDAVRNQPDGVEFFVPAHSTSQRELRKIRQDNGRMRGPVA
FT                   AFWDLLKD"
FT   gene            566726..568177
FT                   /gene="aldH2"
FT                   /locus_tag="Dshi_0577"
FT   CDS_pept        566726..568177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH2"
FT                   /locus_tag="Dshi_0577"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase, NCBI conserved
FT                   domains: pfam00171, Aldedh, Aldehyde dehydrogenase family;
FT                   high swissprot hit to Aldehyde dehydrogenase, thermostable
FT                   from Geobacillus stearothermophilus; high Ref ZP hit to
FT                   aldehyde dehydrogenase family protein [Roseovarius sp.
FT                   217]."
FT                   /db_xref="EnsemblGenomes-Gn:Dshi_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV92323"
FT                   /db_xref="GOA:A8LPK0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8LPK0"
FT                   /protein_id="ABV92323.1"
FT                   /translation="MTDRTQLYIDGAWTEGTAQIENRNPSDTTDLIGMYAQADAGQLDT
FT                   ALAAARRAQPAWWAAGIQKRHDVLMAIGTELMARSDEIGRLLSREEGKPLAEGKGEVYR
FT                   AGQFFTYFAAEALRQHGDLAESVRPGIEIDVRREAVGVVAIISPWNFPVATPAWKIAPA
FT                   LAFGNAVVWKPANVTPASAIALTEIIARQDIPKGLFNLVAGPGRDVGQRLVESAEVDAI
FT                   SFTGSVPVGRGIAAAAVQNMTKVQMEMGSKNPLIVMDDCDLDLAVAHAASSAFGGTGQK
FT                   CTAASRLIVHSAVHDAFVEKLVAAAR