(data stored in ACNUC7421 zone)

EMBL: CP000849

ID   CP000849; SV 1; linear; genomic DNA; STD; PRO; 1528980 BP.
XX
AC   CP000849; AARC01000000-AARC01000001;
XX
PR   Project:PRJNA17237;
XX
DT   03-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Rickettsia bellii OSU 85-389, complete genome.
XX
KW   .
XX
OS   Rickettsia bellii OSU 85-389
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; belli group.
XX
RN   [1]
RP   1-1528980
RA   Madan A., Lee H., Madan A., Yoon J.-G., Ryu G.-Y., Dasch G., Ereemeva M.;
RT   "Complete genome sequencing of Rickettsia bellii";
RL   Unpublished.
XX
RN   [2]
RP   1-1528980
RA   Madan A., Lee H., Madan A., Yoon J.-G., Ryu G.-Y., Dasch G., Ereemeva M.;
RT   ;
RL   Submitted (27-SEP-2007) to the INSDC.
RL   Neurogenomics Research Lab, University of Iowa, 200 B EMRB, Iowa City, IA
RL   52242, USA
XX
DR   MD5; 47123c6092a9a799a9a2629c3db3134c.
DR   BioSample; SAMN02604191.
DR   EnsemblGenomes-Gn; A1I_r08025.
DR   EnsemblGenomes-Gn; A1I_r08027.
DR   EnsemblGenomes-Gn; A1I_t07957.
DR   EnsemblGenomes-Gn; A1I_t07959.
DR   EnsemblGenomes-Gn; A1I_t07961.
DR   EnsemblGenomes-Gn; A1I_t07963.
DR   EnsemblGenomes-Gn; A1I_t07965.
DR   EnsemblGenomes-Gn; A1I_t07967.
DR   EnsemblGenomes-Gn; A1I_t07969.
DR   EnsemblGenomes-Gn; A1I_t07971.
DR   EnsemblGenomes-Gn; A1I_t07973.
DR   EnsemblGenomes-Gn; A1I_t07977.
DR   EnsemblGenomes-Gn; A1I_t07979.
DR   EnsemblGenomes-Gn; A1I_t07981.
DR   EnsemblGenomes-Gn; A1I_t07983.
DR   EnsemblGenomes-Gn; A1I_t07985.
DR   EnsemblGenomes-Gn; A1I_t07987.
DR   EnsemblGenomes-Gn; A1I_t07989.
DR   EnsemblGenomes-Gn; A1I_t07991.
DR   EnsemblGenomes-Gn; A1I_t07993.
DR   EnsemblGenomes-Gn; A1I_t07995.
DR   EnsemblGenomes-Gn; A1I_t07997.
DR   EnsemblGenomes-Gn; A1I_t07999.
DR   EnsemblGenomes-Gn; A1I_t08001.
DR   EnsemblGenomes-Gn; A1I_t08003.
DR   EnsemblGenomes-Gn; A1I_t08005.
DR   EnsemblGenomes-Gn; A1I_t08007.
DR   EnsemblGenomes-Gn; A1I_t08009.
DR   EnsemblGenomes-Gn; A1I_t08011.
DR   EnsemblGenomes-Gn; A1I_t08013.
DR   EnsemblGenomes-Gn; A1I_t08015.
DR   EnsemblGenomes-Gn; A1I_t08017.
DR   EnsemblGenomes-Gn; A1I_t08019.
DR   EnsemblGenomes-Gn; A1I_t08021.
DR   EnsemblGenomes-Gn; A1I_t08023.
DR   EnsemblGenomes-Gn; EBG00001234911.
DR   EnsemblGenomes-Gn; EBG00001234912.
DR   EnsemblGenomes-Gn; EBG00001234913.
DR   EnsemblGenomes-Gn; EBG00001234914.
DR   EnsemblGenomes-Gn; EBG00001234915.
DR   EnsemblGenomes-Gn; EBG00001234916.
DR   EnsemblGenomes-Gn; EBG00001234917.
DR   EnsemblGenomes-Gn; EBG00001234918.
DR   EnsemblGenomes-Gn; EBG00001234919.
DR   EnsemblGenomes-Gn; EBG00001234920.
DR   EnsemblGenomes-Gn; EBG00001234921.
DR   EnsemblGenomes-Gn; EBG00001234922.
DR   EnsemblGenomes-Gn; EBG00001234923.
DR   EnsemblGenomes-Gn; EBG00001234924.
DR   EnsemblGenomes-Gn; EBG00001234925.
DR   EnsemblGenomes-Gn; EBG00001234926.
DR   EnsemblGenomes-Gn; EBG00001234927.
DR   EnsemblGenomes-Gn; EBG00001234928.
DR   EnsemblGenomes-Gn; EBG00001234929.
DR   EnsemblGenomes-Gn; EBG00001234930.
DR   EnsemblGenomes-Gn; EBG00001234931.
DR   EnsemblGenomes-Gn; EBG00001234932.
DR   EnsemblGenomes-Gn; EBG00001234933.
DR   EnsemblGenomes-Gn; EBG00001234934.
DR   EnsemblGenomes-Gn; EBG00001234935.
DR   EnsemblGenomes-Gn; EBG00001234936.
DR   EnsemblGenomes-Gn; EBG00001234937.
DR   EnsemblGenomes-Gn; EBG00001234938.
DR   EnsemblGenomes-Gn; EBG00001234939.
DR   EnsemblGenomes-Gn; EBG00001234940.
DR   EnsemblGenomes-Gn; EBG00001234941.
DR   EnsemblGenomes-Gn; EBG00001234942.
DR   EnsemblGenomes-Gn; EBG00001234943.
DR   EnsemblGenomes-Gn; EBG00001234944.
DR   EnsemblGenomes-Gn; EBG00001234945.
DR   EnsemblGenomes-Gn; EBG00001234946.
DR   EnsemblGenomes-Gn; EBG00001234947.
DR   EnsemblGenomes-Gn; EBG00001234948.
DR   EnsemblGenomes-Gn; EBG00001234949.
DR   EnsemblGenomes-Gn; EBG00001234950.
DR   EnsemblGenomes-Gn; EBG00001234951.
DR   EnsemblGenomes-Gn; EBG00001234952.
DR   EnsemblGenomes-Tr; A1I_r08025-1.
DR   EnsemblGenomes-Tr; A1I_r08027-1.
DR   EnsemblGenomes-Tr; A1I_t07957-1.
DR   EnsemblGenomes-Tr; A1I_t07959-1.
DR   EnsemblGenomes-Tr; A1I_t07961-1.
DR   EnsemblGenomes-Tr; A1I_t07963-1.
DR   EnsemblGenomes-Tr; A1I_t07965-1.
DR   EnsemblGenomes-Tr; A1I_t07967-1.
DR   EnsemblGenomes-Tr; A1I_t07969-1.
DR   EnsemblGenomes-Tr; A1I_t07971-1.
DR   EnsemblGenomes-Tr; A1I_t07973-1.
DR   EnsemblGenomes-Tr; A1I_t07977-1.
DR   EnsemblGenomes-Tr; A1I_t07979-1.
DR   EnsemblGenomes-Tr; A1I_t07981-1.
DR   EnsemblGenomes-Tr; A1I_t07983-1.
DR   EnsemblGenomes-Tr; A1I_t07985-1.
DR   EnsemblGenomes-Tr; A1I_t07987-1.
DR   EnsemblGenomes-Tr; A1I_t07989-1.
DR   EnsemblGenomes-Tr; A1I_t07991-1.
DR   EnsemblGenomes-Tr; A1I_t07993-1.
DR   EnsemblGenomes-Tr; A1I_t07995-1.
DR   EnsemblGenomes-Tr; A1I_t07997-1.
DR   EnsemblGenomes-Tr; A1I_t07999-1.
DR   EnsemblGenomes-Tr; A1I_t08001-1.
DR   EnsemblGenomes-Tr; A1I_t08003-1.
DR   EnsemblGenomes-Tr; A1I_t08005-1.
DR   EnsemblGenomes-Tr; A1I_t08007-1.
DR   EnsemblGenomes-Tr; A1I_t08009-1.
DR   EnsemblGenomes-Tr; A1I_t08011-1.
DR   EnsemblGenomes-Tr; A1I_t08013-1.
DR   EnsemblGenomes-Tr; A1I_t08015-1.
DR   EnsemblGenomes-Tr; A1I_t08017-1.
DR   EnsemblGenomes-Tr; A1I_t08019-1.
DR   EnsemblGenomes-Tr; A1I_t08021-1.
DR   EnsemblGenomes-Tr; A1I_t08023-1.
DR   EnsemblGenomes-Tr; EBT00001581076.
DR   EnsemblGenomes-Tr; EBT00001581077.
DR   EnsemblGenomes-Tr; EBT00001581078.
DR   EnsemblGenomes-Tr; EBT00001581079.
DR   EnsemblGenomes-Tr; EBT00001581080.
DR   EnsemblGenomes-Tr; EBT00001581081.
DR   EnsemblGenomes-Tr; EBT00001581082.
DR   EnsemblGenomes-Tr; EBT00001581083.
DR   EnsemblGenomes-Tr; EBT00001581084.
DR   EnsemblGenomes-Tr; EBT00001581085.
DR   EnsemblGenomes-Tr; EBT00001581086.
DR   EnsemblGenomes-Tr; EBT00001581087.
DR   EnsemblGenomes-Tr; EBT00001581088.
DR   EnsemblGenomes-Tr; EBT00001581089.
DR   EnsemblGenomes-Tr; EBT00001581090.
DR   EnsemblGenomes-Tr; EBT00001581091.
DR   EnsemblGenomes-Tr; EBT00001581092.
DR   EnsemblGenomes-Tr; EBT00001581093.
DR   EnsemblGenomes-Tr; EBT00001581094.
DR   EnsemblGenomes-Tr; EBT00001581095.
DR   EnsemblGenomes-Tr; EBT00001581096.
DR   EnsemblGenomes-Tr; EBT00001581097.
DR   EnsemblGenomes-Tr; EBT00001581098.
DR   EnsemblGenomes-Tr; EBT00001581099.
DR   EnsemblGenomes-Tr; EBT00001581100.
DR   EnsemblGenomes-Tr; EBT00001581101.
DR   EnsemblGenomes-Tr; EBT00001581102.
DR   EnsemblGenomes-Tr; EBT00001581103.
DR   EnsemblGenomes-Tr; EBT00001581104.
DR   EnsemblGenomes-Tr; EBT00001581105.
DR   EnsemblGenomes-Tr; EBT00001581106.
DR   EnsemblGenomes-Tr; EBT00001581107.
DR   EnsemblGenomes-Tr; EBT00001581108.
DR   EnsemblGenomes-Tr; EBT00001581109.
DR   EnsemblGenomes-Tr; EBT00001581110.
DR   EnsemblGenomes-Tr; EBT00001581111.
DR   EnsemblGenomes-Tr; EBT00001581112.
DR   EnsemblGenomes-Tr; EBT00001581113.
DR   EnsemblGenomes-Tr; EBT00001581114.
DR   EnsemblGenomes-Tr; EBT00001581115.
DR   EnsemblGenomes-Tr; EBT00001581116.
DR   EnsemblGenomes-Tr; EBT00001581117.
DR   EuropePMC; PMC2519523; 18606739.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000849.
DR   SILVA-SSU; CP000849.
XX
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group.  Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1528980
FT                   /organism="Rickettsia bellii OSU 85-389"
FT                   /host="Dermacentor variabilis adult female tick"
FT                   /strain="OSU 85-389"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Franklin Co., Ohio"
FT                   /collection_date="13-May-1985"
FT                   /note="isolated in Vero cell culture at 34 C by Karl
FT                   Poetter and Chip Pretzman; spaghetti forms seen"
FT                   /db_xref="taxon:391896"
FT   gene            1..822
FT                   /locus_tag="A1I_00005"
FT   CDS_pept        1..822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00005"
FT                   /product="hypothetical protein"
FT                   /note="COG1806 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV76942"
FT                   /db_xref="GOA:A8GUB7"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUB7"
FT                   /protein_id="ABV76942.1"
FT                   /translation="MTKLIIHLVSDSSVQTAKSAAHSSLAQFTSLKPKLYHWPMIRNSE
FT                   LLKEVLSNIESKHGIVLYTIADQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEI
FT                   EKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQLLNELQFADIVLIGPSRTSKTPTSVFLA
FT                   YNGLKTANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIRETRLNLLQINENRNYT
FT                   DFNIVQKECLEVKKICELRNWPVIDVSTKSIEETAALIMRIYYNKKNKYNK"
FT   gene            856..1215
FT                   /locus_tag="A1I_00010"
FT   CDS_pept        856..1215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00010"
FT                   /product="Thioredoxin"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV76943"
FT                   /protein_id="ABV76943.1"
FT                   /translation="MVIYNFTCKKYRGHMASNVTDKSFEEEVLKSDLPVLVDFWAEWCG
FT                   PCRMLTPIIEEISKDLESKVKVLKMNIDENPEIPSKYGIRSIPTVMLFKNGEQKDTKVG
FT                   LHQKNSLIEWINNNI"
FT   gene            1227..1973
FT                   /locus_tag="A1I_00015"
FT   CDS_pept        1227..1973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00015"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /note="COG1134 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV76944"
FT                   /protein_id="ABV76944.1"
FT                   /translation="MSFNHSKVFIEIKNAYVEGIDTHKRAQGLKHFFLNRGTSFSPNIP
FT                   ILKKINFSCYEGEKVAFVGSNGSGKSSLLKMIAGIYPPIKGTINVCGEIAPIIDMGVGF
FT                   EQEQTGRDNIKMLMLYNNMLDKYNKETEQEIIDFSELGKKIDLPIKNYSSGMLARLAFS
FT                   TSIFQNPQILLLDEVFATGDNYFVEKSLNLMKNKFRNTPISIIVTHQENIVKENCTRCI
FT                   LLRDGNIVGDGKPSEIFKIYTRRKRK"
FT   gene            1970..2746
FT                   /locus_tag="A1I_00020"
FT   CDS_pept        1970..2746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00020"
FT                   /product="O-antigen export system permease protein RfbA"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV76945"
FT                   /protein_id="ABV76945.1"
FT                   /translation="MIKYFLSKKYWESVILLVKASIIRQNKDSFLGSLWSLIQPFVNIL
FT                   VISYFFGFLLHQPREFLIMNLVGGMPLWTFIVSSLTISSNSLVTRDQVIKKVRISKTFF
FT                   PVADSLAQLYNLFCSFLAMYCAFILLFPEKFTWQIIFMPILILPLIVCIISGSIVMAFL
FT                   TPYIRDIPQILNVVLGVIYWSIPIIYPYSLIPESKRKFFELNPFFIIIRPAQSLVINGA
FT                   LPDLISIGKSVLVAFITVCISYLVYKRFSKRVIYYL"
FT   gene            2743..5997
FT                   /locus_tag="A1I_00025"
FT   CDS_pept        2743..5997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00025"
FT                   /product="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV76946"
FT                   /protein_id="ABV76946.1"
FT                   /translation="MKLGFNLDFKKLDLTGLKKLDQIFLDYLFKANKSLYDSILLFRSN
FT                   PYSILSQDYSEFLLNISPYLDDFLAELFCISNEITSLRLQHKDFDIIYECKRKFVQRYA
FT                   IKKYSQEKIKDIDFEDIYLKLVDLIGKNFTSRDFAKQVIIWQQAEESFVKELDIAAQYA
FT                   AYRVSSRGFIDGVIPWSRHGIQKKQIDSAIKLRNDILFDLPQKLDKENLIDDKKISKYQ
FT                   KNERLNFDYTDSFLNLDEALNHSHYCIYCHKQDKDSCSKGQNVIPTEAFSYSSNLSSRG
FT                   LGTRSSNKKYNCKKLDFSRFILDLVPKPRDDTERIFRSIQQLQSSQGMKGCPLKQKISE
FT                   MNYVKAQGFNLSALAIIVIDNPMVAATGHRICNDCSKACIYQKQDPVNIPLIESNILEE
FT                   TLKLPYGLEIYLLLTRWNPLNIYNPLPKESTNYNILVTGLGPGGFSLSYYLLRSGHNVT
FT                   AIDGLKITPLPFDIHKPIKFWHEYKNKLSERVPKGFGGVAEYGITVRWDKNNLDILRLI
FT                   LERNSQFKYYDGVALDFNITKEQAFDLGFDHIAFCIGAGKPKILDIENFDVKGVKTASD
FT                   FLMTLQSGGAFLENSNTNMLIRMPIAVIGGGLTSLDAATESLYYYKKQVKSFVKDYEFV
FT                   VAKYGKDYTEEDKEIAEEFIAHAKLFEKAKNNEELKEVFKKLGGATIYYRGKLQDSPAY
FT                   KLNHEELIYALALGVNFEENMQPLRINNDKYGHVESVEFRNQTYLMSSRGLTTGSSKST
FT                   NCNAVADFLDPVVKPRIDIIVKAKTVIMAIGIENNTEFDEDKYSYFGDCNPKYSGSVVK
FT                   ALANSKDGYEAINKKLANNNPNFKGDYKNFVKQLDDLLISKVHKINILGDKIFELVIHS
FT                   PLAARNFKPGQFFRLQNYSNDITKLIEPIALSVADIDIESGLISFIIYDIGKSTSLCKL
FT                   FSEDEKVVLMGPSGMPLEIPSNKRIVVIDTEPNNILIKALKDNNNEVMFFTYPEIKTQK
FT                   LTSVDRVIINASPEIAEELQSLKIFGESAEIIVSVNSSMQCMMKGICGQCIQKVEDERK
FT                   YIFACSCQNQKAEIVDFESLKTRLRQNSLQEKMKKL"
FT   gene            complement(6020..6439)
FT                   /locus_tag="A1I_00030"
FT   CDS_pept        complement(6020..6439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00030"
FT                   /product="SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /note="COG1974 SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78418"
FT                   /protein_id="ABV78418.1"
FT                   /translation="MQIKEIFSCSVEKACELPLFDTKVQAGYPSPADGYMSNSLDLNSH
FT                   LIKHPKSTFFVQVTGDSMIDAGIRENDLLIVDKSLPPTNNKIVIAVINNEFTVKRLKFI
FT                   NDEAYLMPENKDFPPTKIENGTYIWGVVTSVIQQF"
FT   gene            complement(6506..7612)
FT                   /locus_tag="A1I_00035"
FT   CDS_pept        complement(6506..7612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00035"
FT                   /product="Acyltransferase family protein"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78419"
FT                   /protein_id="ABV78419.1"
FT                   /translation="MQKLVLLHVQKRDELIDVLRGIAIILVLILHFHLSYTIESWNFNF
FT                   LMHGNYGVTIFFVISGYLISTNALKRYGDLASIDIKHFYLLRCARILPPLFFALIIISL
FT                   FYALDLKSFINLVYKDGVNNPSLGLTIFSVLTFWHNVMMDYYGYFNYAINIYWSLSVEE
FT                   FFYLIFPLACVILRNRKLIIFILISIIAISPIYRYMNRNDEIIFMYSYLACSDAISIGI
FT                   LSALLKSNIKYFPQKNLIRVFGFSLIGFVYFILGIHGFEAIGFSLVSLGTGLIIISSYS
FT                   QTFKSNVVSKLLSFLGKISYELYLFHIIILGLIRGIIVPKNLSGLPAIGLLSMFLFCSV
FT                   LISYLISRFYSEPINRFFRRCLMAKYNC"
FT   gene            complement(7643..8665)
FT                   /locus_tag="A1I_00040"
FT   CDS_pept        complement(7643..8665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG4804 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78420"
FT                   /protein_id="ABV78420.1"
FT                   /translation="MSTNIVNSEYLEFLEQLKIRVSQSRYQAARSVNSELIRLYHYIGS
FT                   EILNRQERYGWGAKVIDNLSRDLHSAFPEMKGFGSRNLKYMKRFAEEYRDTEFVQQPAA
FT                   QLPWFHIVVLLDKVKDNQHRIFYIKKTIENGWSRSTLIRQIELELHKRQGQAITNFQNK
FT                   LTSSQSDLAHYTLKDPYIFDFLSVGKEAHKREVEKELTKHIEKFLLELGAGFAFVGRQY
FT                   HLEIGEQDFYIDLLFYHLKLRCFVVIELKDKDFKPEYAGKMNFYLSVIDDLLKHPNDNL
FT                   SIGLILCKSKNNVLAEYALRDMSKPIGLAEYKITENLPKEIKGELPTIEELEAELAKDF
FT                   "
FT   gene            complement(8771..9265)
FT                   /locus_tag="A1I_00045"
FT   CDS_pept        complement(8771..9265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00045"
FT                   /product="hypothetical protein"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78421"
FT                   /protein_id="ABV78421.1"
FT                   /translation="MLADKKIVKVEVSKEHLKTLNEASTLLISCVDFRLIDETDKLMKQ
FT                   LGLEDDFDKVSLPGASLALVNEKYTHWGKTIEDTIEILQDLHNIKQIIFLDHRECGAYK
FT                   KLIAEERLSTKEKETEAHTEILNKARKIIKEKFPQLKVYTFLMGLDGVIEQIYERHPAD
FT                   C"
FT   gene            complement(9284..9829)
FT                   /locus_tag="A1I_00050"
FT   CDS_pept        complement(9284..9829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00050"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78422"
FT                   /protein_id="ABV78422.1"
FT                   /translation="MKIDENLPNYLTIARIAAIPVIILTFYINSPLARMLGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMLDPIADKLLVGCVIIMLLKKSDVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSTLAKTKTFLQMFALSILVLGSKGSNIIYLDLVGEIILWIAA
FT                   FLTITTGYSYFKACKKYF"
FT   gene            complement(9853..11532)
FT                   /locus_tag="A1I_00055"
FT   CDS_pept        complement(9853..11532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00055"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="COG0706 Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78423"
FT                   /db_xref="GOA:A8GUC7"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUC7"
FT                   /protein_id="ABV78423.1"
FT                   /translation="MNNNIVNLVAAIVLSLGIIFGWQYFIVKPQQQKQQQQIALQKAKD
FT                   LKKKESAQLEATPVIVQEASQAPRIKIDSNALSGSISLKGLRFDDLILKKYKQDLSENS
FT                   PEVVLFSPSDTKDAYFAEIGWVSNLSSVKLPNNETIWNSDSEILTPEKPVNLFWVNEDG
FT                   VKFLVAITVDENYLFTIEQTIVNNSNQELPVQSYGLINRKYTAVEKAVNILHQGPIGCI
FT                   DENLKEYSYDDIKDKKSEKFSASKVDWIGITDKYWLTSLIPDKSSNYSSNFNYAVKQEV
FT                   ERYQVDFISPVQIVKPGENFSIKGRLFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYI
FT                   ITKPVFYAMNFFYKYVGNFGISILIVTVIIKLLMFTLANKSYRSMKRMKNLQPEINRIK
FT                   NLYGDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYG
FT                   WIKDLSAPDPTSIFNLFGLLHFSLPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQV
FT                   MKFMPLVFLVMFSSFPAGLLIYWSWNNILSIIQQYYINKLDK"
FT   gene            complement(11826..12944)
FT                   /locus_tag="A1I_00060"
FT   CDS_pept        complement(11826..12944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00060"
FT                   /product="hypothetical protein"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78424"
FT                   /protein_id="ABV78424.1"
FT                   /translation="MLFVMLVSIIPLVFLIKKLIFVPVKNYLTRHHYEDYERVLKKYPI
FT                   FRYLLHSLLGIYFISWGNIFHPSSFKAHILLGIKDTIVILYVSLSFTMLLLTLIDAGAD
FT                   LYHNRIKTFAKKAPLSLYFQILKIFVMIISAMITISYLLNISLSAFLTSLGAAAALLTF
FT                   IFKDTMLGLIASLQLTSQDIINIGDWVHIGEVEGTVEKITISVVTIRNFDQSISTIPTS
FT                   SVLSSNVINYKGVDETGARRVKREFNINMATINFCDSTILTNLKKSPYLSKDVINKITL
FT                   DKDEKDLTNIKIFKLYVQEYLKNNPAIYTEGFTFLVRQLQPTVNGLPIEIYIFVKETSL
FT                   IGYEKVQADIFEHIISVLPEFKLKIFQNVGIV"
FT   gene            13108..13899
FT                   /locus_tag="A1I_00065"
FT   CDS_pept        13108..13899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00065"
FT                   /product="putative carbamate kinase"
FT                   /note="COG0682 Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78425"
FT                   /db_xref="GOA:A8GUC9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUC9"
FT                   /protein_id="ABV78425.1"
FT                   /translation="MTFPNINPIIFSVGPLAVSWYSLSYVVGILFGWFYASKIIEKFPT
FT                   QITKKNLEEFVTYAIIGIIVGGRLGYILLYNPYKYFSNPIEILKTYEGGMSFHGGAIGV
FT                   IIAAYIFCKRHKLNFLSLTDIIAPVVPIGLFFGRIANFINGELYGRVTNSSIGVIFPDS
FT                   DLNLRHPSQLYEAFFEGLVLFCILAYAVFKRNTIKKQGLNSGLFLMFYSLFRIIIEIFR
FT                   EPDVQIGFIFDSLTMGQILSMPLLLLGIYLIIKTECRSITK"
FT   gene            13878..14978
FT                   /locus_tag="A1I_00070"
FT   CDS_pept        13878..14978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00070"
FT                   /product="hypothetical protein"
FT                   /note="COG1565 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78426"
FT                   /protein_id="ABV78426.1"
FT                   /translation="MSIDHKIREIIEQSGYITCDRLMQEVLHVSPTSYYRQTKSLAEEG
FT                   DFTTAPEVSQLFGEIIGLWCIKEWQRIGSPKNLSIVELGPGRGLLMRDLLRTAKLVPEF
FT                   YNALSINLIDINENFIVQQKSNLQNFDLPINWYASIEDIPKKPALIIANEFFDAMPIKQ
FT                   YIKVKESWYERIFVVQPVDGKIKYDKIAVSKQLQEYLQKTHLDAKDGAVLEESYKSIEI
FT                   MKFISEHIKELGGSGLIIDYGYDINPNIRTRYQYNSTLQAIKNHKYCPIIENLGEEDLS
FT                   AHVDFYVLKTVAQNSKINVIDTISQRDFLIENGILLRKQTLQNKLNPEQAELIERQVNR
FT                   LISLKEMGGLFKVLQVMKTPPTVSPP"
FT   gene            complement(15224..15703)
FT                   /locus_tag="A1I_00075"
FT   CDS_pept        complement(15224..15703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00075"
FT                   /product="hypothetical protein"
FT                   /note="COG3807 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78427"
FT                   /protein_id="ABV78427.1"
FT                   /translation="MIKILFALIAIILSTTINADNKKLPIPRFVSIKSNEVNARSGPTT
FT                   KAAIEWVFVKKGEPVEIIAEYEQWRQVRDIHGESGWIHSSILSGRRSVIIIADQEIELL
FT                   KHANIESRVIAKLMPKVRCGLKKCKEQFCQITCKNYTGWVLKKDLWGVYDDKDRY"
FT   gene            complement(15696..17423)
FT                   /locus_tag="A1I_00080"
FT   CDS_pept        complement(15696..17423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00080"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /note="COG0475 Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78428"
FT                   /protein_id="ABV78428.1"
FT                   /translation="MNDHILINVIVLLGTAVFIVAILKRFKLSPVLGYLIAGAAIGDHG
FT                   LKIVTYDQTKLLGELGVVFLLFAIGLELSFERLKAMRRYVFGLGTLQVLTTAIVIAGAM
FT                   VLIDGNSSAAIITGGGLALSSTALVMQVIEENRSQSTQIGRISLAILLLQDLAVVPLLV
FT                   IVPLLSGNSQASLATALGIAFLKAIVALLTIFVAGRVLLRPIFSFISSESNSANELPIS
FT                   MTLLIVLSAAWATETFGLSLALGAFVAGVLVAETEFRLQAEESIYPFKSLFLGLFFMTV
FT                   GMNIDALEMYEKLSHILTLSIALIGIKTLIITAFCILFGFNKGVAFYSGLLLSQGGEFA
FT                   FILFSLGKESGVLEESSANILLLVVTFTMALTPLLAALGQKIAEKVDKGLGKTPTQIIE
FT                   LGARDLTNHIIIAGLGNIGKMVARVLEAEGTSYVILDLDEDRVKEGLTDGFPVFKGDVS
FT                   QADTLKALGTDRALAIILTMNNQVTIKKSLKTVTANYPDMQVIVKLKSLKNSREFYDLG
FT                   ATTIIPESYETGLQIGGTVLKFIGISEQEINRIKVQFRLGNYIVAKKEDSLSEVEYND"
FT   gene            complement(17434..17808)
FT                   /locus_tag="A1I_00085"
FT   CDS_pept        complement(17434..17808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00085"
FT                   /product="Iojap-related protein"
FT                   /note="COG0799 Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78429"
FT                   /protein_id="ABV78429.1"
FT                   /translation="MILANIINIKIIYYSNMKKESEELKLFILECLNEKKAEDIDVIDL
FT                   SGKNKIADYIIFANGRSTKNVGAIAEYVALELKNKAGISTNIEGLGKSEWVLIDAGTIL
FT                   VNIFYPEARTHFKLEEIWKK"
FT   gene            17880..18110
FT                   /locus_tag="A1I_00090"
FT   CDS_pept        17880..18110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00090"
FT                   /product="BolA-like protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78430"
FT                   /protein_id="ABV78430.1"
FT                   /translation="MAISVEELEKILKKSFPNGVIKITDLVGDQDHYALELSDIQFRGL
FT                   TLINQHKLVKNALSEVLNKKLHAITIKTIVI"
FT   gene            complement(18134..18208)
FT                   /locus_tag="A1I_t07957"
FT   tRNA            complement(18134..18208)
FT                   /locus_tag="A1I_t07957"
FT                   /product="tRNA-Thr"
FT   gene            complement(18331..18459)
FT                   /locus_tag="A1I_00095"
FT   CDS_pept        complement(18331..18459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78431"
FT                   /protein_id="ABV78431.1"
FT                   /translation="MKNWLNNLLQTYLDSKNSEDAAIHFEEFYIFKEVDMCGKAFG"
FT   gene            complement(18475..19719)
FT                   /locus_tag="A1I_00100"
FT   CDS_pept        complement(18475..19719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00100"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78432"
FT                   /protein_id="ABV78432.1"
FT                   /translation="MNRKKIVFSSGIANTFEWYDYVLFGYFAPIIGTKFFPNDDANTSL
FT                   LQAFLVFAIGYLARPLGGIFFGVIGDKFGRKAALTGALFCMSAPTVLIGILPTYHTIGI
FT                   TATISMIVVRILQGLSMGGALTGSISFVIEHTHPKHRGFTGSISMSSICAGLLLGSFVS
FT                   YIVKNILNAEQFDSFGWRIPFLLGFFILFAAFYIKNHTHETPNFKNLKEQKKIQNSPLK
FT                   KVITKHWFDILISIFINAPGSIIFYLHAIYLVSFLKISRNFTENEVNSLASICYVIMIA
FT                   VTLLSGYLSDVIGRRKIFVINLVVIIIATPFLLNNFETGNFTGVIISQFILAVLAASYI
FT                   GPEPALQAEFYPTEIRNTALSLSYNTATTTFGGTTPLVFEYLVQKTGQVTSAVYYIILS
FT                   CILALIALFFYKNRT"
FT   gene            complement(19716..20591)
FT                   /locus_tag="A1I_00105"
FT   CDS_pept        complement(19716..20591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00105"
FT                   /product="S-adenosylmethionine transporter"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78433"
FT                   /protein_id="ABV78433.1"
FT                   /translation="MNDALKTYSIGIGWFLLSLVSSSANDVMSKYLGTRLHSFEVAFFR
FT                   FFFSSIVLLPFVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLSIAPVTTATVISF
FT                   SIPLFTLILAVFFLNENIIWQRWVVTIVGFVGLVITLKPHAEDFNPEMLYFVLAAISFA
FT                   MLDIINKKFVVKESMISMLFYSAIVTAVVSIPAAANYWLTPTLFELALLFILGSSGSLI
FT                   LFLLLKAFSMVDATATAPYRYLELVISAIAAYFIFNEFPDKSTLHGAVIIIPATLFIIY
FT                   SEKKAMSKKI"
FT   gene            20743..21480
FT                   /locus_tag="A1I_00110"
FT   CDS_pept        20743..21480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00110"
FT                   /product="OmpW family outer-membrane protein"
FT                   /note="COG3047 Outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78434"
FT                   /protein_id="ABV78434.1"
FT                   /translation="MIRMSKRLGVILFVSCISINSFAKSMEADVNAVPEYNYDNIPYYE
FT                   NEGSLLVKMRLNGVFAHAKQKNLPAPTVPQPLPVGEFVKNGYGGDISTTIFFNNYFATE
FT                   LSLGFNVLRTKNSVLSNVSYNYGVGATPGKSKPLYMIPATITGQFHVAPFGGIRPYVGL
FT                   GYHGSYMITQSSGIKIRNGNGFVGQIGLDFYAKDDTVINLDIKQYYLNPKIVYKPSLVG
FT                   NQNITSRTKLNPLVVSIGIGFSF"
FT   gene            21905..22093
FT                   /locus_tag="A1I_00115"
FT   CDS_pept        21905..22093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00115"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78435"
FT                   /protein_id="ABV78435.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            22099..22860
FT                   /locus_tag="A1I_00120"
FT   CDS_pept        22099..22860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00120"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78436"
FT                   /protein_id="ABV78436.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            22959..24356
FT                   /locus_tag="A1I_00125"
FT   CDS_pept        22959..24356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00125"
FT                   /product="NAD(p) transhydrogenase subunit beta"
FT                   /note="COG1282 NAD/NADP transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78437"
FT                   /protein_id="ABV78437.1"
FT                   /translation="MSLQIIQLLYLVAAICFILSLKFLSSQKQARLGNTIGILGMTIAV
FT                   GVTFFLPDFAHKLPIIATILVGGIIGGVIALKISMTAMPQLVAGFHSFVGLAAVFVSYA
FT                   TVLAPENFAIGIAGSLTISSLIEISLGVSIGALTFSGSIIAFLKLQGLMKSSPLKFYGQ
FT                   QYVCLLTTILLVALIVLFIRSENIFLFNLIILLSLLIGVLLIIPVGGADMPVIVSMLNS
FT                   YSGFAAAGIGFTLSNSLLIITGALVGSSGAILSYIMCKAMNRSLIKVIFGAFLPAPSGA
FT                   SKNIDDDKIAKASCPEDAANLLRNASSVIIVPGYGMAVAQSQHIIKEMVDILEGLDVNV
FT                   RFAVHPVAGRMPGHMNVLLAEANIDYEKVLELEEINRDFATTDIVLVIGANDVTNPAAK
FT                   NDPDSPIYGMPVLDVEKARSVLFIKRSMASGYAGIENELFYHDNTFMLFGDAKKVVEEI
FT                   VKFLNED"
FT   gene            24411..24980
FT                   /locus_tag="A1I_00130"
FT   CDS_pept        24411..24980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00130"
FT                   /product="hypothetical protein"
FT                   /note="COG3820 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78438"
FT                   /protein_id="ABV78438.1"
FT                   /translation="MNSQKILPLLPKATAMWLIENTSLTFKQIADFCGIHELEIKGMAD
FT                   GEVAQSIKGLDPIANGQLTLEEIDRCSKDPKNVLQISHSPAYELMKNQKKQRAKYTPIA
FT                   RRQDKPDAIYWLLRNYPDIQDNQVVKLIGTTKTTIDAIRTRSHWNMKSIHPRDPVLLGL
FT                   CRQVELNKVVAVLESASSHNKETKES"
FT   gene            complement(25138..25494)
FT                   /locus_tag="A1I_00135"
FT   CDS_pept        complement(25138..25494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00135"
FT                   /product="Putative colicin V production membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78439"
FT                   /protein_id="ABV78439.1"
FT                   /translation="MGLLAGFAVGAAISAVIFFITMIFTSENYYKSKSLEDFIASSKSN
FT                   KYSGVLKDSLTTEYFDELNKNIIVIIPVETLKSVKTLNSKDLGNFKSNDENNQSSQELD
FT                   DELNDNDAFSDVDD"
FT   gene            25875..26444
FT                   /locus_tag="A1I_00140"
FT   CDS_pept        25875..26444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00140"
FT                   /product="hypothetical protein"
FT                   /note="COG1678 Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78440"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUE4"
FT                   /protein_id="ABV78440.1"
FT                   /translation="MNDKIFYNLSGKTLVSTPYVITKGIYHKSLIYMLSHTEEGAIGLM
FT                   FNRLVNHIDLKSFFKIKNDEIVNPVMVPIYLGGPVEHEKGFFLHSTDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGKGPKNSLLIVGYTGWKAGQLEKELEENLWLVMDCDKEFIFADN
FT                   PENKWHNALKHLGIDEAHFSSQVGSA"
FT   gene            26749..27660
FT                   /locus_tag="A1I_00145"
FT   CDS_pept        26749..27660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00145"
FT                   /product="Signal recognition particle-docking protein FtsY"
FT                   /note="COG0552 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78441"
FT                   /protein_id="ABV78441.1"
FT                   /translation="MISIFSKLKQGLSKTSGKISAGIDKIFYKKKLDAETLEELEELLI
FT                   STDMGSLVAAKIIEDFKSLKFDKEVETTEIKETLANLIEQQLLESEIPFTLNENKLNVV
FT                   LVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFRAAAVNQLDSWVTRAKALLITGE
FT                   EAADPASVAYRAVEESIKQDIDILFIDTAGRLHNKKNLMDELTKIVKVIKKVDENLPTH
FT                   SVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQRFNLPIYFIGI
FT                   GEQIEDLKIFNRHDFAKSLVGL"
FT   gene            28699..31131
FT                   /locus_tag="A1I_00160"
FT   CDS_pept        28699..31131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00160"
FT                   /product="hypothetical protein"
FT                   /note="COG2956 Predicted N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78442"
FT                   /protein_id="ABV78442.1"
FT                   /translation="MINHPKHPKHPRYIREKQISSTNSSSQESITSNKNETQTKQVEES
FT                   TKTVAKLGIEKEIENIFESENFINLVNKYSDESIFSKNKKVLIILGQEQEDLNIIVNFF
FT                   KDNKLSLERNTHKDWYFSKKNPVDNPEILDSFRGYVTYKSPYLNSKASTQELTLDKFLL
FT                   PKILSTAPTKFILAVKNIDTTKNAEEGIKNIAQIFKKFTQLLGNVDINEGNVAIVVTDS
FT                   KPDDDKERISNIFHDAIELCNFNDKQKSFINKIQDSIYLLPQVSEQAKDYKALPSFKSG
FT                   NYITQNENNKITIDEKLIPYFIIQTVKNNITNEVSKFKELVYAKWEKEKSLVFKFKVSN
FT                   NTDKLQKLVETIKNYKATDNSNKTIGSFLEVVKELNQILETPNSKLESFLNYLKHFCDT
FT                   KLSDQHDLDIIDVKDWFSTLFAPFNKINLEAELIESFKTVLKSDEFSFVGKLNDAIKDF
FT                   YQDIKNSKILDINQINNIENLKAFLKSIKDAKIQNLKDITDTLTNNIHCISFKSLDMSK
FT                   IILDSISNFKKLVSSISEQEAKSLWSCITAFKSIDEKSFTEVIYSKLLHSQIAPMQGQS
FT                   AYNSLGELLIATHGSIAFHNKQDELYKNQLAEIYCQHAQVVNTPSAIDLYKKAAALDSV
FT                   KANIKLGNIYLQQREYAKALEYLRKTKCIDDEKKAFKGLIDEMKHNPEINDRNLADEYL
FT                   LQAGYYEKHSRIDDATKAYLIAIGKMEGIVEPKDYLKLSKIYTNLAKIVLPSNNNKTEY
FT                   FMQATGYKVLAEKFDIPQKIEQDTSVDLSRPIYDPKDVLLSGDNSSNDSDYYSDSGN"
FT   gene            31206..31874
FT                   /locus_tag="A1I_00165"
FT   CDS_pept        31206..31874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78443"
FT                   /protein_id="ABV78443.1"
FT                   /translation="MTQDYPADDTKKIAEQIKDALMGISDSLVLESTEVEELFEELSQS
FT                   EDFEYEIEQILAILNEQTMDLTQLQSQIILLIRKYLGKTKNLKLKMLKMDEKLISKNIS
FT                   EVSNYLMHQHSKIVRDANKNLANQKDKLQGLTKQARIDLKRLIKSFAVYQIYMFMNPKR
FT                   IAGETKLMNFAYNFIRGGMKLAQKYEGGKPRDIKSYSPKLIKKLERARAGFKKSGGISI
FT                   "
FT   gene            32335..33651
FT                   /locus_tag="A1I_00170"
FT   CDS_pept        32335..33651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00170"
FT                   /product="Folate synthesis bifunctional protein"
FT                   /note="COG0801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78444"
FT                   /protein_id="ABV78444.1"
FT                   /translation="MIYISIGSNLGNRFLNIRRALNLLKSHGFVLLRQSIIFETQAILP
FT                   PNADSSWDRPYYNMVVQGTTALLPNALLTVLKKIEQQIGRKENYDKWCPRVIDLDILLW
FT                   DSYHIDLPDLKIPHSQLLNRPFLIHLIASLSIECRYICPDNNLYNDKAFAEIAHLIENQ
FT                   GVIRSLVLNPQFVGILNITPDSFSDGGLSFHKEDAVKNFVHLMDAGSSMIDLGAQSTRP
FT                   SAFMISEDEEYTGLDSVLEELKGVIEKTEALISIDSFSPEVIKRILKKYPVHCINLVKT
FT                   NLDNDTLRLIADYNCKIVIMHSLTVPPQKQQCLDFDKSLIISLNIWAEQEIAKLEKCGF
FT                   DRKDIIFDPGIGFGKSVYQNLHILQNIQEFKKLGCEILVGHSRKSYISTFYNSIAKERD
FT                   LETIAISKYLAENGVNYLRVHNVEDHQRFFVTQAYTLNK"
FT   gene            33660..34163
FT                   /locus_tag="A1I_00175"
FT   CDS_pept        33660..34163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00175"
FT                   /product="Dihydrofolate reductase"
FT                   /note="COG0262 Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78445"
FT                   /protein_id="ABV78445.1"
FT                   /translation="MKNRKITGIMACDPKGVIGLKGRMPWSYPEEFEYFYQIVKNNIIV
FT                   MGHKTFDSLPPKILQNCICIVFSRNTPTSDNDVFFVESLDEFWQVIEIFADKKIFMVGG
FT                   AEIATFFLKQNLLDEFLLTRINNDYEGDAFFPLDLLKGWDSMMIYKTNNYQIYKFTKNA
FT                   IMNI"
FT   gene            34181..35263
FT                   /gene="recF"
FT                   /locus_tag="A1I_00180"
FT   CDS_pept        34181..35263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="A1I_00180"
FT                   /product="recombination protein F"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78446"
FT                   /db_xref="GOA:A8GUF0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUF0"
FT                   /protein_id="ABV78446.1"
FT                   /translation="MKNIFLHSLIVENYRNFKNLELKTDNIPITIIGENGSGKTNILEA
FT                   ISLFYPGRGLRSARLADICRESEDHCSVRALLQSKLGLAEFSTQIKRISNRRTTEYNNS
FT                   KIANNELSKFTSMVWLTPQMEGIFMSGTSDRRKFFDRIVYNFDPKHAELVSKYEHYMQE
FT                   RNKILAEDMWDNNWLKTIEEKMADTSIYIANNRLKTLEFMQQAIDDLENEFPKAELSID
FT                   GMVEQKILNGEEDVVGFIAAELHKTRDKDKLLGRTSFGVHKSDFLVKHKHKNILAKFCS
FT                   TGEQKAILIAIILAEMNYAIKLTKTAPILLLDEVFVHLDDRRRNYLTEFFISINLQLWV
FT                   TATDLKGIEEFGNKSQLIKL"
FT   gene            complement(35581..35724)
FT                   /locus_tag="A1I_00185"
FT   CDS_pept        complement(35581..35724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78447"
FT                   /protein_id="ABV78447.1"
FT                   /translation="MTKQLGELNSSLSSEINETNQTTTSDLTEFVPPMGEDTNMQDHHD
FT                   IN"
FT   gene            complement(35905..37038)
FT                   /locus_tag="A1I_00190"
FT   CDS_pept        complement(35905..37038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00190"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78448"
FT                   /protein_id="ABV78448.1"
FT                   /translation="MKKKLTNEEVDRLKNIMEAQEANIIKEESVSLENTYDSEVVATML
FT                   SIINEYMQPYAREFKENAIKGRYYLDAGHKLFNQGDYQTAMFAYKKAFECGNVKYESGK
FT                   THFELNFDVEPFLAIGSVFEIEEQYDKAMAFYNKAIKQKDNFQISESTTVMFENQLDYY
FT                   NKSLAKAYCYKALLLEKLKAIDEALQNLDEAIKYNKFSCIAYWEKANILKEAGQFDKAI
FT                   AVYDELMTHKGNMSDNDRVVTETYHYKAQLLKIMSKNEEAIVNFDKFITSDKGYLTPKK
FT                   ISLKDAYWEKAEALINLNKIGEANYCKALALYHSEETNDHEKAIAFFDEALKDANEADN
FT                   IALYNFHKGCSLVKLQQEFDANECFNNAEANAKHQNI"
FT   gene            complement(37127..38464)
FT                   /gene="trmE"
FT                   /locus_tag="A1I_00195"
FT   CDS_pept        complement(37127..38464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="A1I_00195"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="COG0486 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78449"
FT                   /db_xref="GOA:A8GUF3"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUF3"
FT                   /protein_id="ABV78449.1"
FT                   /translation="METIFAQSSSFGKAGVAVFRVSGTKSLEVLKLLTGKSNFKPRFMY
FT                   YQKLTSPESNDLIDNAMVVYFKAPNSFTGEDVVEIHTHGSKAISIMLTNALLNIPGVRL
FT                   AEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQHKQAIRQAGGALEELYNSWRSQLL
FT                   RIISLLEAYIDFPDEDIPESVLKDVTNTHKTLINTISEYLNDNRKGELLRSGLKLAIIG
FT                   PPNAGKSSLLNFLMRRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIRGESNDVI
FT                   EQEGIKRAIDSAKKADIKIVMFDAETLDSAVNEDITGLIDENTIVIINKIDLIPENRIF
FT                   NIENKYRCLKVSIKNNIALPSILKNIEEIAENMAGFTETPYITNERHRHHLKQALVYLK
FT                   DFNLDNDLVLATEDIRMTMHRIGAITGIIDVEEILGEIFKNFCIGK"
FT   gene            complement(38545..39306)
FT                   /locus_tag="A1I_00200"
FT   CDS_pept        complement(38545..39306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00200"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78450"
FT                   /protein_id="ABV78450.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(39312..39500)
FT                   /locus_tag="A1I_00205"
FT   CDS_pept        complement(39312..39500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00205"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78451"
FT                   /protein_id="ABV78451.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            39907..40248
FT                   /locus_tag="A1I_00210"
FT   CDS_pept        39907..40248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00210"
FT                   /product="HicB-like protein"
FT                   /note="COG4226 Uncharacterized protein encoded in
FT                   hypervariable junctions of pilus gene clusters"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78452"
FT                   /protein_id="ABV78452.1"
FT                   /translation="MTKNDFISYKGYFGSVHFNASEEIFFGKIEFIRDLVSYEASDAKT
FT                   LIKSFHEAVDSYLEDCNILGKAPDKPFKGSFNVRIDPELHKEVSLYAMQHGDSLNGIVK
FT                   KDLNEYIKC"
FT   gene            40273..40473
FT                   /locus_tag="A1I_00215"
FT   CDS_pept        40273..40473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78453"
FT                   /protein_id="ABV78453.1"
FT                   /translation="MHNLTNLLKQYNTSSGYKKAEKENYTMWLNKEIQVGLDQAAQGKL
FT                   VSWEKVRQDIKQFYLEQKIPK"
FT   gene            40760..41194
FT                   /locus_tag="A1I_00220"
FT   CDS_pept        40760..41194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78454"
FT                   /protein_id="ABV78454.1"
FT                   /translation="MPDTKKIIIFLTPLSNSKNRKCRKELITNYCKQYNFTILKIIEKN
FT                   TFEYSILRDLVNQTKDASTTITALVEDKLLNNPNSIILTTVLGTLYLLGLIDTQIYKKS
FT                   YQEIKLYNGIIIKNDFLSIAAFSLYYTLESYKDKNNFSFS"
FT   gene            41239..42546
FT                   /gene="gltA"
FT                   /locus_tag="A1I_00225"
FT   CDS_pept        41239..42546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="A1I_00225"
FT                   /product="type II citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG0372 Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78455"
FT                   /protein_id="ABV78455.1"
FT                   /translation="MTSENNNTEFAELKIRGKIFKLPILKASIGQDVIDISKVYSEADC
FT                   FTYDPGFMSTASCRSTITYIDGDQGILRHRGYDIKDLAGKSDFLEVAYLLIYGELPNNK
FT                   QYNDFTKKVAHHALVNERLHYLFQTFCSSSHPMAIMLAAVGSLSAFYPDLLNFFKEADY
FT                   ELTAIRMIAKIPTIAAMSYKYSIGQPFVYPDNSLDFTENFLHMMFATPCEKYEVNPVIK
FT                   NALNKIFILHADHEQNASTSTVRIAGSSGANPFACVSTGIASLWGPAHGGANEAVINML
FT                   KEIGSVENIPKYIAKAKDKNDNFRLMGFGHRVYKNYDLRAAVLKETCKEVLKELGQLDN
FT                   NPLLQIAIELEAIALKDEYFIERKLYPNVDFYSGIIYKAMGIPPQMFTVLFATARTVGW
FT                   MAQWKEMHEDPEQKISRPRQLYTGQVHREYKTIKER"
FT   gene            42658..43644
FT                   /gene="obgE"
FT                   /locus_tag="A1I_00230"
FT   CDS_pept        42658..43644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="A1I_00230"
FT                   /product="GTPase ObgE"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78456"
FT                   /db_xref="GOA:A8GUG0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUG0"
FT                   /protein_id="ABV78456.1"
FT                   /translation="MNFIDEVKIYIKGGNGGNGCVSFHREKFIDRGGPDGGDGGRGGSI
FT                   IFRSNHHLNTLVNYRYKQHFIADSGENGKGSNKSGKSGKSLTLDVPIGTQIFAEDSDIL
FT                   LHDFTEDDQTFEIIKGGNGGLGNSHFKTSVNQAPRRRTEGEIAEEMWVQLSLKLLSDVG
FT                   LVGLPNAGKSTFLSVVSAAKPKIADYPFTTLVPNLGVVYIDDEEFVIADIPGLIEGASQ
FT                   GHGLGDKFLKHIERCNVLIHLIDGSSEDVVADYNIVRTELESYSDYLKDKTQIICLNKI
FT                   DVLTDEEIAEKTTQLQKITGKEIFPISTYTNTGITKIIKLALQTIKD"
FT   gene            43704..44273
FT                   /locus_tag="A1I_00235"
FT   CDS_pept        43704..44273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78457"
FT                   /protein_id="ABV78457.1"
FT                   /translation="MTTNFPSNDILLILVVNLLIYENFLSSVNIYLFNLQIKDDFICND
FT                   KYFRVNIMYKLMTSFIGSPKQEHKTEIEKTVNNIDEFPEYFNDLFNKENNGDATAKSKI
FT                   ENINIGKILTPKSESHNPPTNKEVFAYLFNNFRNKFNEKLEKPNGTIEKFIPAKSFEFS
FT                   YNFSKKEDREFLADCLRNDITIEKIL"
FT   gene            45706..46047
FT                   /locus_tag="A1I_00250"
FT   CDS_pept        45706..46047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78458"
FT                   /protein_id="ABV78458.1"
FT                   /translation="MGSNLSFLKAKREKGEFEDLSIFKEKALGKLVKTKKLLNNITKIP
FT                   QETQYKDLYDEIDPPQPQAVIQPEPQPQQSQAPVPSAPNPPVNENVPPLNPNEVGALGE
FT                   NNEIQSNIA"
FT   gene            complement(46164..47246)
FT                   /locus_tag="A1I_00255"
FT   CDS_pept        complement(46164..47246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00255"
FT                   /product="Putative permeases"
FT                   /note="COG0795 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78459"
FT                   /protein_id="ABV78459.1"
FT                   /translation="MLLYRKYFIKNILPLLIVITFSMTSLVWITQVLKLLYLFDKGIKV
FT                   MDFLSLIILVLPTLLFILLPIITVITIIYIYNNLKIERQLIILQTSGVGNLQLALPALY
FT                   VALIVALLAYYISSTVMPLSHINLKSRLSFIKNNYISSMIEEKTFNKITKDITVYIDKK
FT                   STGNVMKGVIIFDNRNTDNPSVVFANSGILNIYENDPIFELSKGSRQEYDINGNITQLT
FT                   FDSLMIKLQNDNPLISQRTTHNKEANEYYIEELLEPPVDLNPMKKIKLIAEAHQRIIWP
FT                   LYNFVLPFLALAVFLKYPYSKKTTFMPILFAALSVLIATSAHFTLQNFASKNLAFITAC
FT                   YLNIFFILSIGLYLFIRKRI"
FT   gene            complement(47353..48030)
FT                   /locus_tag="A1I_00260"
FT   CDS_pept        complement(47353..48030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00260"
FT                   /product="hypothetical protein"
FT                   /note="COG0671 Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78460"
FT                   /protein_id="ABV78460.1"
FT                   /translation="MFEVFYNFCGLNQEIFLFLNKITNIGLFAYFLRIFSFCFNIANFA
FT                   IIYILYCIYLYIQLKKIKNDNERQNKFWHSYNKLVEIGIVYGVSGLVFTALKFTVNLPR
FT                   PYCSLPEGSFITILNTASERCLSSFPSSHAALSVLLTYFIWNYVKLPIKILMICVIILV
FT                   SLSRISLAMHYPSDIIYGIITGLITILIGKLIYRIFKNNIIRWVGALSFRGLLTKSSNK
FT                   KYK"
FT   gene            48045..48809
FT                   /locus_tag="A1I_00265"
FT   CDS_pept        48045..48809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00265"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /note="COG1235 Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78461"
FT                   /protein_id="ABV78461.1"
FT                   /translation="MLQVTILGCGASIGVPVIGCGCSICLSDSKYNKRTRSAIYINDEN
FT                   SQILVDFGFDIKHQLIREKVNKLDCAVLTHYHSDHVNGIDDLRIFSFMEKKALEIYTDE
FT                   NTAVNLHKSFDYLFGYNSFMQGPVLETKNIGFFDKIKINTIEIQFFRQNHGPIDSLGLR
FT                   IGDFVYSPDVINFPPESEKFLQNIKIWILDCMDYTSNKNHAGLDKVLEWREKYKPEQIL
FT                   LTNMRHTIDYHEIIKILPDNVKPLYDGYRFIV"
FT   gene            48813..49535
FT                   /locus_tag="A1I_00270"
FT   CDS_pept        48813..49535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00270"
FT                   /product="Glutamine ABC transporter ATP-binding protein"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78462"
FT                   /protein_id="ABV78462.1"
FT                   /translation="MIILEKVCKRYGKNYGIKNIDLSFTAKETTVIIGPSGGGKTTLLR
FT                   VLNNLEEPTSGTLLVDGKKLLPKDRRKLRLKVGMVFQNFNLFPHLTVGNNLIYTPVNVL
FT                   KIPKDEAILKAKELLEKFKLSQKFDSYPANLSGGQKQRIAIARALMMKPEILLFDEPTS
FT                   ALDPENIKDVIENINLLKEQMSMVVVTHHLKFAKLIADCIIFMDQGQILANQPVQEFFS
FT                   KPASHRARLFLENIGDFL"
FT   gene            49621..50331
FT                   /locus_tag="A1I_00275"
FT   CDS_pept        49621..50331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00275"
FT                   /product="Putative aspartyl protease"
FT                   /note="COG3577 Predicted aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78463"
FT                   /protein_id="ABV78463.1"
FT                   /translation="MLYFQYGQKIHKLIFIICGTIFVTGLAYKYINQHYPKFFKEPQNI
FT                   GSFCASLLILFSVIYSTISQNEIRKFCLQLAAWAAIFLVIIIGYAFRFELNYAYQRVAS
FT                   VLIPSYNWSTEAGEIIIARSGDGHFYIDAVVNNVKISFMVDTGASDVALTKEDAQKLGF
FT                   DLTQLKYTRTYLTANGENKAAPIKLDSVIIGKEFKDVSGHIGLGDLDVSLLGMSVLERF
FT                   KGFKIDKDLLILNY"
FT   gene            51765..52229
FT                   /locus_tag="A1I_00290"
FT   CDS_pept        51765..52229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00290"
FT                   /product="Putative integral membrane protein"
FT                   /note="COG5528 Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78464"
FT                   /protein_id="ABV78464.1"
FT                   /translation="MVYLFIKTIHIISSTILFGTGIGTAFFMWWANKTGDLYAKAYAAR
FT                   TIVITDFLFITPTVIIQPISGIILVNMLGHNYSELWLFLTYIGYIIAGICWLPVVWIQI
FT                   QLRNMAVEALKQQASLPEKYYKLFKLWFYLGWPAFISLIVIFFLMVFKPL"
FT   gene            complement(52468..52671)
FT                   /locus_tag="A1I_00295"
FT   CDS_pept        complement(52468..52671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78465"
FT                   /protein_id="ABV78465.1"
FT                   /translation="MSESENNSKESLLEGAKNLINTTQKILDTARDALDHPESLLGKAK
FT                   DLMKSSEKQEQEKKVDSTESKE"
FT   gene            complement(52966..53604)
FT                   /locus_tag="A1I_00300"
FT   CDS_pept        complement(52966..53604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00300"
FT                   /product="(Di)nucleoside polyphosphate hydrolase-like
FT                   protein"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78466"
FT                   /protein_id="ABV78466.1"
FT                   /translation="MLNHLKSLLQNYNSIHPEEIISKEKMLEFLDNFTYSNDLENWNVK
FT                   RGASTHSLYLIGEHTSSLKFCRANSSNHLSMGHFTASAFLLNHDQTKFLLMHHKKLNKW
FT                   LQLGGHCESDDILTEAIREAREESGINEIEAVSNNIFDIDVHYIPQTPKEPSHYHYDIR
FT                   FLLKTINNDNFIKNNESHELKWFSFSDYPQLGVELERSVTRMIEKFKNV"
FT   gene            complement(53588..54496)
FT                   /locus_tag="A1I_00305"
FT   CDS_pept        complement(53588..54496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00305"
FT                   /product="Hemolysin C"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78467"
FT                   /db_xref="GOA:A8GUH1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUH1"
FT                   /protein_id="ABV78467.1"
FT                   /translation="MLKSSKKEDDSKKNHDNKSIFHLRKLFSPIKSLFSNKVPDDFFSV
FT                   IKRLKTNSQKMTLDERNILANLLKLKGKTIEDIMVPRSDIAAIKLTTNIEELNESIKVK
FT                   IPHTRTLIYDGTLDNIVGFIHIKDLFKALVTKQNFRLKKLIRKHIIAAPSMKLLDLLAK
FT                   MRREKTHIAIVIDEYGGTDGLVTIEDVMEALVGRIDDEHDQKSEYDNYKVINNSTIISN
FT                   ARVEVEVLEEIIGEKLKDDDDDEFDTIGGLVLTKMGNVPAVGTKINVSENIEIEVTDAN
FT                   PRSLKQVKITLKNSLKRAKSS"
FT   gene            complement(54505..55056)
FT                   /locus_tag="A1I_00310"
FT   CDS_pept        complement(54505..55056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00310"
FT                   /product="hypothetical protein"
FT                   /note="COG0319 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78468"
FT                   /db_xref="GOA:A8GUH2"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUH2"
FT                   /protein_id="ABV78468.1"
FT                   /translation="MINVEIIKNYSKWREHKQINKALIKKITQKTLSQFDNFSEIKQFE
FT                   LSILLTNNEEILTLNKQFRNIEKATNVLSFPANELNWQDLRFSGNEIASSNKPIILENL
FT                   GDSDYMHLGDIAFCYDVIYNESYEQQKTFENHFIHLLIHSILHLIGFDHQNDTETKIME
FT                   NLEIEILAHFGISSPYLLIK"
FT   gene            complement(55135..56202)
FT                   /locus_tag="A1I_00315"
FT   CDS_pept        complement(55135..56202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00315"
FT                   /product="lipoyl synthase"
FT                   /note="COG0320 Lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78469"
FT                   /db_xref="GOA:A8GUH3"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUH3"
FT                   /protein_id="ABV78469.1"
FT                   /translation="MTNLDRHLSKFAYREEFAGNTEVLATAAYKEDCTDASTGLTPKLP
FT                   LEVEFGKMSKRPDWIKVKAPNSSEYYNTKDLIKNLKLNTVCEEAACPNIGECWSKKHAT
FT                   VMILGSVCTRACRFCNVKTGRPDLLDPHEPQRLAEAVQKLGLKHVVITSVDRDDLEDGG
FT                   ATHFAECISEIRKSSPNTTIEILTPDFLRKDGAAEIIANAKPDVFNHNVETVPSLYNTI
FT                   RPGARYYNSLSLLHNIKKLSPEVFTKSGMMVGLGEEISEVVQVMDDLREAKVDFLTIGQ
FT                   YLQPTKNHAEVAKYVTPEEFKYLERVARTKGFLMVSASPLTRSSYHADEDFEKLKENYR
FT                   HRHCEERRSIDVAIS"
FT   gene            complement(56195..57457)
FT                   /gene="glyA"
FT                   /locus_tag="A1I_00320"
FT   CDS_pept        complement(56195..57457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="A1I_00320"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG0112 Glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78470"
FT                   /db_xref="GOA:A8GUH4"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUH4"
FT                   /protein_id="ABV78470.1"
FT                   /translation="MNIFNNKLQEIDKGIFEIIKHEKTRQNSVIELIASENFVSPAVLE
FT                   AQGSVLTNKYAEGYSGKRFYNGCEEVDKAENLAIERAKKLFNCKYANVQPHSGSQANQA
FT                   VYLALMQPGDTVLGMSLDSGGHLTHGSTANMSGKWFNAVSYSVDKETYLIDYDEVERLA
FT                   ILHKPKLLIAGFSAYPRNLDFAKFREIADKVGAYLMADIAHIAGLVAAGEHQSPIPHAH
FT                   IVTSTTNKTLRGPRGGLILSNDEEIGKKINSALFPGLQGGPLMHIIAAKAVAFLESLQP
FT                   EYKSYIKQVIINAKALAGSLQERGYDILTGGTDNHIVLVDLRKDGITGKIAANSLDRAG
FT                   ITCNKNAIPFDKTSPFITSGIRLGTPACTTRGFKEKDFVLVGHLIADILDGLKNSEDNS
FT                   KAEQKVLSEVTKLIKLFPFYD"
FT   gene            complement(57618..58361)
FT                   /locus_tag="A1I_00325"
FT   CDS_pept        complement(57618..58361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00325"
FT                   /product="Serine esterase"
FT                   /note="COG0400 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78471"
FT                   /protein_id="ABV78471.1"
FT                   /translation="MAQDPVIKSRDDNIIDWIPAVAKNDIYNNKLQKTMNKNFEYPEIA
FT                   SLEQPAKKLVVLLHGVGSDGHDLIGLVPYIKDDLPDCHFISPHGIEPYDMAPYGRQWFS
FT                   LQDRSPDNISKLLVKNISKLDDIIKQKQEELNLTNKDTIIIGFSQGTMIGLYLTLIQKE
FT                   PFYCTVGFSGALIPPAEINNKTTPICLIHGELDDVVSVNEMYNASHYLSKYHIPHSGHK
FT                   LTRLSHSIDGRGIEIAVNFICHTVA"
FT   gene            complement(58466..58822)
FT                   /locus_tag="A1I_00330"
FT   CDS_pept        complement(58466..58822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00330"
FT                   /product="glutaredoxin-like protein grla"
FT                   /note="COG0278 Glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78472"
FT                   /protein_id="ABV78472.1"
FT                   /translation="MVYNVTNKIKHIRFLMLENKSFKFIENEIKNNKVVLFMKGTKEAP
FT                   MCGFSGKVVMILTKLGVEFRDIDVLSDPELRESLKVFSDWPTFPQLYINGELVGGCDIV
FT                   TELYSSGELEKMLK"
FT   gene            58821..59462
FT                   /locus_tag="A1I_00335"
FT   CDS_pept        58821..59462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00335"
FT                   /product="Endonuclease III"
FT                   /note="COG0177 Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78473"
FT                   /protein_id="ABV78473.1"
FT                   /translation="MQAEIVNKIFEVFSKNNENPKTELVYKNNFTLLVAVILSAQATDV
FT                   SVNLATKSLFEIYDTPEKILGLGEEGLKKYIKSIGLFNSKAKNVIALCQILISNYDSKV
FT                   PNNFEELVKLPGVGRKTANVVLNCLFGLPTMAVDTHVFRVAKRIGLAKGNTPEAVEKEL
FT                   LQIIDGKWLSHAHHWLILHGRYICKARKPDCEICPIKEYCEYYKSATKII"
FT   gene            complement(59737..61947)
FT                   /locus_tag="A1I_00340"
FT   CDS_pept        complement(59737..61947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00340"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78474"
FT                   /protein_id="ABV78474.1"
FT                   /translation="MKEAKIENIDFGSALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTEICTLLMEDIDKDTVDFRPTYDDSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALMHLIDHPKAEISDIMNFIKGPDFPTGGIII
FT                   DKSDVITSAYMTGRGSFRVRARWEKEELNYGVYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLVSNIRDESTDIIRLVIEPRDRSCDPQIVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PKVMNILEVLQEFLSHRQNIITRRSTYLLNKIKHRLEILEGLRIAYLNLDEIIKIIREE
FT                   DEPKAIMMQRFQLTEIQVEAILNTRLRSLRKLEEQEIITEHSNLQKQQAILEEILNNPK
FT                   ELWKVVKKEIKAVQAKFGLNTTIGARRTSFEQVTLTNQVVDITAFITKEPITIICSKMG
FT                   WVRSLKGHNNDLSSIKYKEGDAEKFILEAYTTDKILIISSEGRFFTLLADNISKGKGTG
FT                   ESIKLLVDIGNNDITEILVYKPDHLLLLASSIGKGFVVNSNEVMAQTKSGKQIMNVPDG
FT                   HTCIACLPVNGDSVACIGESRKLLVFNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNRE
FT                   DGLSWNSGGKVKLEKNIIAFLGKRGSTGKLPPMGFPKNNRFS"
FT   gene            complement(62085..62348)
FT                   /locus_tag="A1I_00345"
FT   CDS_pept        complement(62085..62348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78475"
FT                   /protein_id="ABV78475.1"
FT                   /translation="MTTKEEDFDEITLEEDMYFSKLADKRLEETKHWIKHEDFWGTPPF
FT                   IAKVEKHSRCDLVDKPALLDVSYVIPAKAGIQQKKSLNTENF"
FT   gene            complement(62397..63083)
FT                   /locus_tag="A1I_00350"
FT   CDS_pept        complement(62397..63083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78476"
FT                   /protein_id="ABV78476.1"
FT                   /translation="MINNIFTKICLVFLICIAAIYFAYQYYQDSKPVITIYADELPTKI
FT                   KPTKVEDIMPSAVHSTIYENLISKNTNPKNAKLLPEPEKPVNINSRNQNDDPFEINSSD
FT                   DISNLLSLIEPNNTSQKDETELNIIKRDKESTNSNKNIKSSNNSNSYKVQLGSVKSEAD
FT                   ATNEGERIKKKFPKILKNAVITTQKVKCDDGKFFYLILAGNYDNLSQAKAVCKKLAQNK
FT                   QSCVLK"
FT   gene            complement(63245..64975)
FT                   /gene="argS"
FT                   /locus_tag="A1I_00355"
FT   CDS_pept        complement(63245..64975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="A1I_00355"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018 Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78477"
FT                   /db_xref="GOA:A8GUI1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUI1"
FT                   /protein_id="ABV78477.1"
FT                   /translation="MNIFNKLKHDIITASTQLYNNSEIANHASIETPKDSFNGDLSSNI
FT                   AMIIAAKKNVPPREVALKFKEILNELPYIASIEIAGPGFINFTIKADSWHTAIKDILQN
FT                   ESKFFEIDVDKNKNINIEYVSANPTGPMHIGHARGAVYGDVLANILKKVGYPVTKEYYV
FT                   NDAGSQINDLVSTVILRYREALGEKITITEGLYPGEYLIPVGQALAKEYGDKLLNMDEL
FT                   ERFKIVKNFAIQKMLDLNKEDLKELGVKHDVFFSEQTLHDNGKIEKTVKLLTDMGLIYE
FT                   GSVPAPKGKVHAEWENRTQELFKSTKYGDDQDRPIRKADGSWTYFASDLAYAKDKIDRG
FT                   ANHLIYVLGADHSGYVKRIEATVKALGKEQVKVDVKICQLVNFVENGVPVKMSKRLGTF
FT                   ASVQDVNHEVGKDIIRFMMLTRENNKTLDFDLIKVKEQSKENPIFYVQYAHVRTLSILS
FT                   KAMETIPQSYNSFEAGTYDLSLLSSEEEIEIIKLLASWTKTLETAAKYFEPHRVAFYLI
FT                   NLASKFHALWNFGKENNDYRFIIENNVELTTARLALAKAIQKIIASGLEVIGVEPMTRM
FT                   "
FT   gene            complement(64985..66136)
FT                   /locus_tag="A1I_00360"
FT   CDS_pept        complement(64985..66136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00360"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="COG0232 dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78478"
FT                   /db_xref="GOA:A8GUI2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUI2"
FT                   /protein_id="ABV78478.1"
FT                   /translation="MLASYASDPLKSRGRLYREIPTSYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEGDHYRNRLTHSLEVSTVARSIANTLNLSSDLAETIALAHDLGHTPFGHA
FT                   GERALNECMKEHNGFSHNAQSLKILTLLEKRYAAYRGVNLTWEVLEGIVKHNGPISGEV
FT                   NEYIEEYNSQNDLELNTYASAEAQIAALADDISYISHDLEDSIGAKIIDFNNLAELKYI
FT                   DQHVFELKSKYKNISSSCLIYEVVRKLMHELITDLLWQTKTNINKEKITHIDEIRNLNY
FT                   QIVDFTEKTNERIKEIKKFLHERVYKSNRITAISLKCTKIVQGLFKVYMEDVNLLPVNW
FT                   KIQIDSNNPNSKARIIADYIAGMTDRFAIQEYNQLCSLNFNNI"
FT   gene            complement(66328..66618)
FT                   /locus_tag="A1I_00365"
FT   CDS_pept        complement(66328..66618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00365"
FT                   /product="Endonuclease"
FT                   /note="COG2827 Predicted endonuclease containing a URI
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78479"
FT                   /protein_id="ABV78479.1"
FT                   /translation="MKQYYVYILASKRNGTLYTGITSNIIKRIYEHKNKIIKGFSSKYN
FT                   TNKLVYFEQYHYVIAAISREKLLKEYKRQWKLNLIESQNPEWLDLYEKIIL"
FT   gene            66832..67164
FT                   /locus_tag="A1I_00370"
FT   CDS_pept        66832..67164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00370"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78480"
FT                   /protein_id="ABV78480.1"
FT                   /translation="MTITITDRAFERVKELIELEKDKDLVLRVSVDSGGCSGLMYNYEL
FT                   VSKDTLEKDDYVFTKHNATVIIDPISQKFMLDCTLDFIEELGSSYFNVSNPQAKAKCGC
FT                   GNSFAV"
FT   gene            complement(67445..68755)
FT                   /locus_tag="A1I_00375"
FT   CDS_pept        complement(67445..68755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00375"
FT                   /product="hypothetical protein"
FT                   /note="COG3203 Outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78481"
FT                   /protein_id="ABV78481.1"
FT                   /translation="MKKLLLASIIGLASTTSFASGSTTPVISSSDSEIKLEGFYLFESG
FT                   FSNQNRLGEFENLSDNRKKTAFYTEAAFAATITKTINDVIGGVKIVLQPTTRSKTSTSY
FT                   NGSHIFIETSYGKVELGSPYDAGNKLRITGGQVAAGSGGYWRYINVGSKYMQYEKLKPD
FT                   FDTSPSFYIESFSNNFDEFNVKAEAARKISFYTPKMKGFQAGISYTPDSANTGGNKNIN
FT                   NVVFDDSITGITNVRTGIKRNIVENDEIITINQNVTDSISGGLTYEHALGEDADLKLSV
FT                   TGEYGKPARLAVRSKVIDKTYTVLDTYKLSNLKAYNLGAVFTYGNFSCGASYGSLGKSL
FT                   TTPQYHKNGRNTYYYNGAIAYGQGPIKTSLSYFKSSRYKNTVDTITVATEYKIMPGLLP
FT                   YAEISHFQAKGKPVYYPEAPNKKTKGTVGLIGTKLKF"
FT   gene            69050..69616
FT                   /gene="dcd"
FT                   /locus_tag="A1I_00380"
FT   CDS_pept        69050..69616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="A1I_00380"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG0717 Deoxycytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78482"
FT                   /db_xref="GOA:A8GUI6"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUI6"
FT                   /protein_id="ABV78482.1"
FT                   /translation="MSIMSDKWIREAVINHKMIEPFAEKQVRVKDSEKIISYGLSSYGY
FT                   DARVSNEFKIFTNINSTMVDPKNFDKYNLVDREVDVCIIPPNSFALGRTVEYFKIPRDV
FT                   LVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLKGD
FT                   QICDLSYADRQGKYMKQLGVTLPLT"
FT   gene            69749..70207
FT                   /locus_tag="A1I_00385"
FT   CDS_pept        69749..70207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00385"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="COG1952 Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78483"
FT                   /db_xref="GOA:A8GUI7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUI7"
FT                   /protein_id="ABV78483.1"
FT                   /translation="MSTINTDANEAMPHISVNAQYIKDLSLENPDAPSSLAALEHRPQI
FT                   DLSLDINITNLSEENFYEVELNIEAVARNEKYKLFQVELKYAGVFNLINIAPEQHQILL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            70439..71152
FT                   /locus_tag="A1I_00390"
FT   CDS_pept        70439..71152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00390"
FT                   /product="Transcriptional activator protein CzcR"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78484"
FT                   /protein_id="ABV78484.1"
FT                   /translation="MRVLLIEDEPEMANLIELTLASEGIVCDKVSVGLEGLRLGKLGRY
FT                   DLMILDLMLPDINGFEILLRLRAAKIKTPILILSSLTDTDQKITGFSSGADDYLTKPFV
FT                   REELIARIKAIVRRSKGHAASVFRFDKVSVNLDTRSVEIDGKKVHLTNKEYAILELLIL
FT                   RRGTILTKEMFLNHLYSSLDEPEMKIIDVFICKLRKKLSDAAGGKDYIDTVWGRGYMLK
FT                   EYDENGHKEALAQGA"
FT   gene            71325..72146
FT                   /gene="queF"
FT                   /locus_tag="A1I_00395"
FT   CDS_pept        71325..72146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="A1I_00395"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="COG2904 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78485"
FT                   /db_xref="GOA:A8GUI9"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUI9"
FT                   /protein_id="ABV78485.1"
FT                   /translation="MTLSNSALGKKSTYKDTYDPTLLFKIPRIDNRKELGIVNDKLPFH
FT                   GVDIWNAYELSWLDKKGKPCVAIFTFFVPTTSSHIVESKSVKLYLNSFNNFVVDSMEEL
FT                   KRTILQDLSNNTHAEVTGEIFPINTKIEFGSPTGINIDDIDIECSEYGPPNNSLIKHED
FT                   VLVEEELNSNLLKSNCLVTGQPDWGTIIIKYKGKKLKHDALLKYLVSFRNCNEFAEQCA
FT                   ERIFTDIKNAINPEFLSIYIIYTRRGGIDICPYRSTDSNYTLPSSKRLIRQ"
FT   gene            complement(72668..73141)
FT                   /locus_tag="A1I_00400"
FT   CDS_pept        complement(72668..73141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00400"
FT                   /product="F0F1 ATP synthase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78486"
FT                   /protein_id="ABV78486.1"
FT                   /translation="MHFLDESFWLAISFIIFVYLIYRPAKKAILKSLDMKVLEVQERVL
FT                   KAEKLKDDAKLLFEQTEEQIKNLEALQLQMTKENNEITEKIVQEKTKEIEEFLEHKKVE
FT                   TIKLIESQKLLASKELQDEFSDEVVKLVSEYFHSTKNNNLSETDIAKNLMDKV"
FT   gene            complement(73144..73617)
FT                   /locus_tag="A1I_00405"
FT   CDS_pept        complement(73144..73617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00405"
FT                   /product="F0F1 ATP synthase subunit B'"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78487"
FT                   /protein_id="ABV78487.1"
FT                   /translation="MPQFDINTYYSQIFWLIVTFSLLYIFVYKFIVPKIERVLNNRQSN
FT                   IQDNIAKADELALEIEKLNKYYNEEITRISTEIDRLKKEKIDSLEAEFLIKKTNLEQNL
FT                   RKLINQNIKDIKLVAEKFRTSKVDATIMLAASIIEKITGTKADINLLKNIKIQ"
FT   gene            complement(73636..73860)
FT                   /locus_tag="A1I_00410"
FT   CDS_pept        complement(73636..73860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00410"
FT                   /product="F0F1 ATP synthase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0636 F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78488"
FT                   /db_xref="GOA:A8GUJ2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUJ2"
FT                   /protein_id="ABV78488.1"
FT                   /translation="MDMVSLKFIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQ
FT                   LQRMALIGAGLAEAMGLFSFVIAMLLIFS"
FT   gene            complement(73893..74621)
FT                   /locus_tag="A1I_00415"
FT   CDS_pept        complement(73893..74621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00415"
FT                   /product="F0F1 ATP synthase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0356 F0F1-type ATP synthase, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78489"
FT                   /db_xref="GOA:A8GUJ3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUJ3"
FT                   /protein_id="ABV78489.1"
FT                   /translation="MLHNPLVQFDIKKLIDIKVMDFDISFTNSAAYMLLASVLALTYFY
FT                   LAFSNPRLVPSRLQISGEIIYNLVTDMLNQNVGSKGRKFVPVIFTLFVFILFCNLFGMI
FT                   PYGFTVTSHIIITFALAILVFLMVTIVGFVKHGMHFLSLFLPHGTPLWLAPLMIIIELF
FT                   TYLARPASLSLRLAANMMAGHILLKVIASFVITLMIYLKFLPIPLMVILIGFEIFVAIL
FT                   QAYIFTILSCVYLNDAVNLH"
FT   gene            complement(74626..74889)
FT                   /locus_tag="A1I_00420"
FT   CDS_pept        complement(74626..74889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78490"
FT                   /protein_id="ABV78490.1"
FT                   /translation="MDNDKLKDIKTRINQLKTDKTPNSNLQQEISPFTIAIDLVSGTMV
FT                   GFVIGLLTDKFFHSKPLFIIIFTIIGIIAGFNIVRQRLISKK"
FT   gene            complement(74889..75653)
FT                   /locus_tag="A1I_00425"
FT   CDS_pept        complement(74889..75653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00425"
FT                   /product="Protein-disulfide isomerase"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78491"
FT                   /protein_id="ABV78491.1"
FT                   /translation="MRNSFITLIFLLLLSGCSEEKEKVVEQESSESITPAQASTSDENN
FT                   NQTTETITPAVQEQIEQKPEVKTFKVTFKIDENDMVLGNKDSKIVVVEYFSPTCPHCAY
FT                   YHSTIFPELKQKYIDTNKIAYVTREFIATKQDLDASILARCKGDINSFMLFHDIILKQQ
FT                   DKWSVSNKYRELLTDIGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAPKFIGTPSF
FT                   FVNGVQTENYSINSISAAIDKAIEESKNKIDL"
FT   gene            75840..76376
FT                   /locus_tag="A1I_00430"
FT   CDS_pept        75840..76376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00430"
FT                   /product="Transcriptional regulator"
FT                   /note="COG1329 Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78492"
FT                   /protein_id="ABV78492.1"
FT                   /translation="MVNIAQSEDKTEQQKSEFKIGQRIVYPAHGVGEITNIENHTIAGT
FT                   EIKVYVISFPQDKMTVKVPVSRATVVGLRAVASKKDLDLIYSTLQGKPKQGNRMWSRRA
FT                   QEYEGKINSGNIVAVAEVLRDLHKNVDNDRSYSERTLYEAALNRLAGELAILENIDSSE
FT                   AINKLVEVLREKLVA"
FT   gene            complement(76730..76990)
FT                   /locus_tag="A1I_00435"
FT   CDS_pept        complement(76730..76990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78493"
FT                   /protein_id="ABV78493.1"
FT                   /translation="MLLYDHFPATLEIHSIILSPRGSTNSTGQLLKKNVIFYSGVGDLI
FT                   CHSRIGGNPVKLHKNSKIFKIKSLGYLALFWIPAVAKNDVE"
FT   gene            77094..77522
FT                   /locus_tag="A1I_00440"
FT   CDS_pept        77094..77522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00440"
FT                   /product="Putative P-loop hydrolase"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78494"
FT                   /protein_id="ABV78494.1"
FT                   /translation="MLNSQTILNSEEETKNFAKAFAATLKPNNIVLLNGDLGVGKTFFC
FT                   REIIKYFCGENTSIISPTFNLLQTYKTPHFTIYHYDLYRLKSPEEIYELGLEEALSGNL
FT                   TLIEWSEIIKHLLPTPLIEVNLKLLDDDKRLCNITNEY"
FT   gene            complement(77509..79290)
FT                   /locus_tag="A1I_00445"
FT   CDS_pept        complement(77509..79290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00445"
FT                   /product="hypothetical protein"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78495"
FT                   /protein_id="ABV78495.1"
FT                   /translation="MTKLTKMELKELVEQNEYEIKLVQYYEQIDSYKNLDYITQNTEIP
FT                   GTQPTISVPGYRALLELYMASNDAPHKELENFSNSLEKISTYLFNDDHDKFTEQVFNDL
FT                   EEKNKSFIFYSNFNNSHANFIKYSKENNQYYRTFYNVGSGDIESENQSIKKFVSGAGFL
FT                   FQTKKILVGGKSEIQKKIKQDLVNNAKGVNNEPDELLKNQPFEVSDVQVKEQRYNNCST
FT                   RALCEALRDNIPTEEFRELYEFIANNSYSDMLKAAGIEKSIKQEEIKDFESALKKYIQL
FT                   QRKKFDMAQTNLKKEEDNELTQKYNNLKIEYAEIVKKIKELKAQLPESQDKINIRKKVK
FT                   ELLSQQGKLLDQQHKVLNQQEQLSQNPTNTSLNMKNHISNFRDQGFNILTKQQLLNETA
FT                   TQYSEKLDKERSQNLWLKLFKESLNDIDLPLTKELLEPVKRHFSNCLNKSSDDNEIFNE
FT                   WKKECIEDLRIDPIIKAPIIKSMIENKEDLPKSIKHYAKSDNAKIKNLTVNDIYKNLLK
FT                   ENIAQRDINAAHRQQDMKESNLTSEQLYKKYLKKEASKKTLDDIKKTLDSHLTKKHSST
FT                   NIVPNFKKQESNKSNTR"
FT   gene            complement(79831..80760)
FT                   /gene="tsf"
FT                   /locus_tag="A1I_00450"
FT   CDS_pept        complement(79831..80760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="A1I_00450"
FT                   /product="elongation factor Ts"
FT                   /note="COG0264 Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78496"
FT                   /db_xref="GOA:A8GUK0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUK0"
FT                   /protein_id="ABV78496.1"
FT                   /translation="MSEVNISASDVRELREKTGAGMMDCKKALIETKGNLEEAVDFLRT
FT                   KGLAAAAKKAGRVAAEGLTAAKVDGLTGVVVEINSETDFVARNEQFQNLVTNIANLAIN
FT                   VKDIEELKAAKMPNGKSVEEDVVENIATIGENLTLRRMEVLKVSEGAIGSYVHNEVASN
FT                   LGKISVLVGLQSSAKDTAKLEALAKQIAVHVAGNNPQSIDDSGLDQALVERERKVFFEK
FT                   SKEEGKPDNIIEKMVEGRIRKFFAEVVLLQQNFLFDNKLTVAEVIKNAAKELGAEIQIT
FT                   KFIRYELGEGIEQEEKNFADEVAAVMKG"
FT   gene            complement(80803..81678)
FT                   /gene="rpsB"
FT                   /locus_tag="A1I_00455"
FT   CDS_pept        complement(80803..81678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="A1I_00455"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78497"
FT                   /db_xref="GOA:A8GUK1"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUK1"
FT                   /protein_id="ABV78497.1"
FT                   /translation="MSKIPPVNVKDLLDAGVHFGHKTSRWNPKMAPYIYGERDEVHIID
FT                   LRQTAALMNVALNAIYETVKNDGKVLFVSTKIQASDIIAEYAEKCGQYYVNHRWLGGML
FT                   TNWKTISGSIEKLNKLEQTLENEEACIGYTKKEILDMNRKKDKLLLSLAGIRELHSKPD
FT                   LIVIIDTNKEHIAISEAVRLDIPIVAVVDTNSNPDHIDYPIPGNDDAIRSIRFYCSLFA
FT                   DAALQGLEESMKASGVDLGSIQEHGDKNLAPKNVSKLKQAKKFSKTKNINEEANTEFEQ
FT                   ALSDADEDKN"
FT   gene            complement(81954..83330)
FT                   /gene="cysS"
FT                   /locus_tag="A1I_00460"
FT   CDS_pept        complement(81954..83330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="A1I_00460"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78498"
FT                   /db_xref="GOA:A8GUK2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUK2"
FT                   /protein_id="ABV78498.1"
FT                   /translation="MQIYLFNTLTQNKELFEPEDQTNVKMYVCGPTVYDNPHIGNSRSV
FT                   VVYDLLYRILVDIFEAKSVKYVRNITDVDDKIIERAANLGISINELTDKVTKEFHTNMK
FT                   YLFCLPPTIEPKATQHIDVMIEIIEKLIKSGHAYIADDHVYFDVLLAPNYTELSNRKLE
FT                   DMFESVRVENSKTKKHPQDFVLWKPAKPDEDVHMNFKSPWGLGRPGWHIECSAMSYKYL
FT                   GKNFDIHGGGADLIFPHHTNEIAQSKCAFSNSTYAKYWVHNGFLTVNGEKMSKSLGNFI
FT                   TVRDLMDKQIKGEIVRLFLLTAHYRRPLDYNDKAIEDAKKTLDYWYRAIQNINIQKIDT
FT                   LPSDFMQSLFDDMNSPLAIKIINDYAKAIFTATNEEEKQFNASNLIACANFIGLMNETP
FT                   HEWFNKDVDENYINNLINERLEAKKQKNWGLADQIRNKLLNEKIILEDKPNGTTIWRKE
FT                   "
FT   gene            83506..86214
FT                   /locus_tag="A1I_00465"
FT   CDS_pept        83506..86214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00465"
FT                   /product="Cell surface antigen Sca2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78499"
FT                   /protein_id="ABV78499.1"
FT                   /translation="MSLGYKLKSTLLKYSFVVAISINLLAINSGILLLTLNNKAEAAPP
FT                   PPPPPPSPPPPSPPPPPSPPPKTPPVDPKSAAKDINAELGPTFNPYDTLKKNRKNIKNK
FT                   KGNSDLGAFLNLNGIAQMSKLFSIVLTQHTDNDELRTRFFKDIVRNNKLSPTEKFNLAN
FT                   QIAANNGIYEKDDKGNIIIDNTNLNNNIIGSTSYISKFNPNYKYIISYSTPTEILEKDL
FT                   TSEIIDITKGFEKDSKGNSYRKFDETKLKQIEQERVYGLIKSKVESLIELAYGANIKYV
FT                   DYYNSNINDNSYEKYFTEYEKEVITKALGYKRAYEEKTGLYKSEVDKLDRSILSEEEYI
FT                   KKCEEILEKIGESSWDTYQVSKPGSSSKISYEEYEKLVTNEAKKRAVIARFLMEDNNKI
FT                   NGKRLKIVKEDGSEEYIDNTEFNLIRAENNWDLTPANIPLSKVMKDTNNLSENEKMKKL
FT                   LARIEFLENNTNNLDIINELEDAKRQLDELKSKKITELFALNNNGENASISFDQDLIDI
FT                   LKILKEVPDFVSIIRAYPDLFPTVFNDPDTLAFLEKCSPEDYENIIIELSLLDSKSQDL
FT                   ESLIVKKQISEEVTLHNQVASITNKPIHMGIHGRLLLPTAAITGGDEEDAINRGVWISG
FT                   LYGVSNQKAWRSIPKYQGRTSGVTIGMDTELSNSSDVIGIAYSRIESHFKYNKKFAKTA
FT                   LNGHLLSVYGLKELPKNFSLQAIASVGHNYIKNKATTANNIIGKYQNNNFNFEALLNYK
FT                   YRINYNLYLIPNIGLKYDYSRSSGYKGNNFVQKLMIQKKSNRLLTTSLGSKVEFKSIKV
FT                   LNDITLVPSLYGSIENHFYNKDTKVNAKAVLNNQIIEEKIIISKQPKFGYNIGGNVLLT
FT                   KKNINVVFEYNHYTHKKYKSHQGLVKLKINL"
FT   gene            86362..86655
FT                   /gene="rpmB"
FT                   /locus_tag="A1I_00470"
FT   CDS_pept        86362..86655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="A1I_00470"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG0227 Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78500"
FT                   /db_xref="GOA:A8GUK4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUK4"
FT                   /protein_id="ABV78500.1"
FT                   /translation="MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFISDITTA
FT                   EYRLSVSARCISSVEKAGGFDAYMLKANNDALSTTAKAIKKKIIQTKMAKSL"
FT   gene            86652..86891
FT                   /locus_tag="A1I_00475"
FT   CDS_pept        86652..86891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00475"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78501"
FT                   /protein_id="ABV78501.1"
FT                   /translation="MKNGIHPDYKKFLIKVGSDVFETMSTHPAGEILMDVDFRKHPAWN
FT                   KDIGNVVNQSNKSISDFNKRFSGLSFGSQKKEAS"
FT   gene            87205..87281
FT                   /locus_tag="A1I_t07959"
FT   tRNA            87205..87281
FT                   /locus_tag="A1I_t07959"
FT                   /product="tRNA-Met"
FT   gene            87539..88177
FT                   /locus_tag="A1I_00480"
FT   CDS_pept        87539..88177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00480"
FT                   /product="GTPase EngB"
FT                   /note="COG0218 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78502"
FT                   /db_xref="GOA:A8GUK6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUK6"
FT                   /protein_id="ABV78502.1"
FT                   /translation="MTDEKVINKKLVGDNKLFRHQAKFVAGAMDIKQLPNFALPQIAFV
FT                   GKSNVGKSSLINTICNNKKLAKVSNTPGRTRQINFFNLVDKLIIVDLPGYGFAQVPNQV
FT                   KDQWEILINHYLRKSDNLKLVNLLIDSRRGIKENDKKVAELLLANKRDFQIIFTKSDKV
FT                   TDRKNLNLEAQNFLATLNYSCNLIYVSSRSKEGARELKTSLAKCIKLEK"
FT   gene            88125..89057
FT                   /locus_tag="A1I_00485"
FT   CDS_pept        88125..89057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00485"
FT                   /product="Acetylglutamate kinase"
FT                   /note="COG0548 Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78503"
FT                   /protein_id="ABV78503.1"
FT                   /translation="MQENLKLVWQNASNLKSKEIDNISELGDITIIRDIITCSNELRNQ
FT                   AIVLKLPINIIINEKLFASFIESIKLLEMCGAKIYIVHDHIDLGNLSLISQLDKSFSKK
FT                   FNKVRENSSIDNPIIMEILSSYVNKLIVTKLSNKGCYAVGISGKDANLLQARKSKLSHR
FT                   RVANRDVIDIGFVSEPIIVNPEILLNFEDSNIIPVITPFANDDQEKTHLLNVNLTAATI
FT                   AVTLGAEHLIFPYEMSQIFRGFQYNMKIQNANLLKSMLNDSNHYLEEELIKIAIKVIES
FT                   IGNNVYFVNSKIPNSILLTMFANKNINLY"
FT   gene            89113..89400
FT                   /locus_tag="A1I_00490"
FT   CDS_pept        89113..89400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00490"
FT                   /product="VirB3"
FT                   /note="COG3702 Type IV secretory pathway, VirB3 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78504"
FT                   /protein_id="ABV78504.1"
FT                   /translation="MAGTLATDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGI
FT                   MILFIAAGLHLIAYIICFKEPRFIELYMNKMSRTSQCPNKFYYGANSYGI"
FT   gene            complement(89502..89867)
FT                   /locus_tag="A1I_00495"
FT   CDS_pept        complement(89502..89867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00495"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78505"
FT                   /protein_id="ABV78505.1"
FT                   /translation="MKEINGIGNIVAFELLILLPELGKLTRRQIASLAGLAPKANDSGK
FT                   YQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGKKKMVALTALMRKII
FT                   VIANAKLKSLLFNLKHS"
FT   gene            89878..90783
FT                   /locus_tag="A1I_00500"
FT   CDS_pept        89878..90783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78506"
FT                   /protein_id="ABV78506.1"
FT                   /translation="MPTQEAFIILKELFVNPDNTVKHVVARNLTEIMEMIPSLIQEAFG
FT                   FLKELIVNPNTRYNLKSEAITNIAKIVRTTPSLAYEAFIFLKEIILSSNGEDNIRLEAI
FT                   RNILVPVTAEPSLTHEAFIFLKEIILSSKIYDNSKSKAIESIVSITRTMPNLTQEVFIF
FT                   LKEIIINSRIYDNAKSEAIESIVSIIWVMPNLAQEVFIFLKEIIINSNYKYEVKSKAIE
FT                   SIVEIVRAMPNLTQEIFTFSKAIITNIHPDVDYNINAKAIESLLEIVEEVPSLAQEAFI
FT                   FLKIVITDSKNDPYIMVYSY"
FT   gene            90752..92818
FT                   /locus_tag="A1I_00505"
FT   CDS_pept        90752..92818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78507"
FT                   /protein_id="ABV78507.1"
FT                   /translation="MIHILWSIATNNISNIVRAMPNLAEEAVTFLKRVNMTPKNNYNIK
FT                   SEAIRGIAVIAKMKPTHATFIFLKTAITNPKTYSYFKPIIAESIIGIVKIMPSLAQQAF
FT                   TFLREIITTLNTYNIENYAIRSIAKIVEINSSLALKAFTFLKVRVIDDKDKINYAAAIS
FT                   LIEVAESALFDKSSYKPINELLKIIEWTEAKDSYDNHLHTDATFVLNKITNHITQEYEK
FT                   RKNPKMIKWFNGCFKELPNITETRVFLKEICKTILKSGVINQLESQFILNCVKNYHFTF
FT                   TVAVNKDHKKIAGEIIFEDRRYEIFKNDNLEEFATMLLAATDDPLAEQYKTHKPLFQSK
FT                   GLGLKIAASDIMEVNSITYEKTKLPTEASLLSYVRDIKDNSVILLEKRNVFGNHLIYKF
FT                   NNNNFENVATIYPPYISNEIRKQIFEELESEKLIPCFIKNKIFNFNRCELVNEKGKSFL
FT                   QNVKNIIQDEKVELQTSNFKLLNAGTDKRLDTHEEIIDDLGKDLKDGGITNKAEINREV
FT                   ERLKEENPKLYNYCNALFWNTKNILKACGIAETEFFKNNILRHKIGMQDVEDYFKKIAI
FT                   TITHARKNEIINPKEISQPNSLVQKFQACVQEAGNMIYDKTRNILLPEIIESCDKDNKA
FT                   VQLALKDSIAFINYLYTNYDDILNDDFDLYEQCKKIVENGTLDALFTQTNKKF"
FT   gene            complement(92869..93777)
FT                   /locus_tag="A1I_00510"
FT   CDS_pept        complement(92869..93777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00510"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78508"
FT                   /protein_id="ABV78508.1"
FT                   /translation="MSKKPKHDEIIRSAFENPLVSKEFFEMHLPPHIQNLISFEKLKME
FT                   KDSFVDKRLKKSIVDILFSAKFGDGKGYLYLLLEHQSSPNHNMALRLFRYMFKIAEYHK
FT                   KSTKSKKFPFIYPLIFYNGVQKYNALRNLWELFENSELVKSTWSGDYQLINVHDIPDEK
FT                   LKEKAWSGILQFFMKHIHERDLLKRWEEVADLLPKFAKIDIGIEHIELILCYTLTRIKQ
FT                   DDIIEVEKLLQSKLNPKKRENVMKSIAHHWTQQGREEEKAIMLKKMQEEKVMMAKEMMK
FT                   EGFSLESVIKITKLSKEDLEK"
FT   gene            complement(93991..94206)
FT                   /locus_tag="A1I_00515"
FT   CDS_pept        complement(93991..94206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00515"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78509"
FT                   /protein_id="ABV78509.1"
FT                   /translation="MLEIITLNYPYTVAISNAITDKFNAGFIAKELSLFLGGSGGGGQP
FT                   SIAQAGGSDLAKLPKVKDQLQSLLDA"
FT   gene            complement(94298..95998)
FT                   /locus_tag="A1I_00520"
FT   CDS_pept        complement(94298..95998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78510"
FT                   /protein_id="ABV78510.1"
FT                   /translation="MLNGFVNSLKIKIMEELLILIGISIFYISFVGYSSFFQRVLQIEF
FT                   AHALIFSISSILSIYLVAAFLFCLDITIYISFTLGVILFLYYFFNFLKQKESTSSTSLF
FT                   TCEVWLFFPLLLIYYYSIKDYTIYSAWDEYSLWGILIKEMNINHGLRPPGSSTVVIDYM
FT                   RHYTQLPTIFYYSINKLLGIKISTNIFANGLLYIILSLVAWRKGSIFLSIVLQLILILP
FT                   SLFSELSSLQSLHTDLTVGFAFAALISLYIQAKNKYKTYYIKYVLLIPLIFILPNIKEV
FT                   GYWFSYIVILFIIIDIIYNKKYQELKWCTYLLFLVLLSKYMWYYYVNSVAFYNINSFYQ
FT                   VPFVSLFKILSIYREKAELIKIMIKGMSAYFYSSLVMRYTYYFIIITICSLIQFHRKYL
FT                   GEYLRNLFILFIGFCLYIAFRIDLYINIFSTYEAERIASCYRYFDTYMVVFSFLSVCYF
FT                   QDLLSYIHLKKKMCIIYYSLAIIFSTISIKQFWYIGEHTQHLLQYLKPLTRQNKLKNFI
FT                   KNKHDETLNFKDDNIDQLDCYIFNYLEAPYTKESEFKQCIQEARVFTGS"
FT   gene            98755..100266
FT                   /locus_tag="A1I_00535"
FT   CDS_pept        98755..100266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78511"
FT                   /protein_id="ABV78511.1"
FT                   /translation="MKNIFDLFKLKKNIVVLLGNKGIFLSAFLGDKILDKLFIPYKEEE
FT                   QIDLSLYKNFFNKFSKSDIYFLLDNTECKMRHDQLPVLQSIVKIDPIEQFIAGYFEKED
FT                   IIAHCVYEVTSQPSEIWSLLIMSSPLKAPLSDIVSCVIENRLFNFKGMYFLTLELQVII
FT                   NKIVQNVENNKFANYFQICAFATQASGIKFIIKHKNNIITIINFEYPFDKTASYVQGII
FT                   EQEINDCFILFKNYINNLNKEVCIILIVDEELKSLLEPISFEDYRVILVPVDDILNEPN
FT                   LENTRLIDTNISKLLIKHKNFPASNSYLKSIKKLTIIRSLTFKLSAALLATLIITAGVM
FT                   KYRTDTNYKDTNFINEKYYATNQEYDNIKYKYPYIKNTTSLADLYVIDKLLEAPVPLPF
FT                   ELLEKLIITLNPSFKVKEIKWELTNIDNILLVSKRHLLIKLLLNYNTQGISVDESIKML
FT                   NDQMTSVKNKLPHLYIDYVIYKDKIIDISNRVEIPLFVSIIDEKT"
FT   gene            100285..100920
FT                   /locus_tag="A1I_00540"
FT   CDS_pept        100285..100920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78512"
FT                   /protein_id="ABV78512.1"
FT                   /translation="MFQKYIVYLKNLIFFQFIIYFFFISLTVWVIKSLQQEYAQSILDK
FT                   QLAQESLTEEVLKLYSVQNSKEEILESYKKYVDLSLPNKVTCLNYQELIPKIKGLSNKY
FT                   NLLEPIDISINSVFFKNNIPAIENENKNIRVNNYSINIKYAAVDFITFLKIFHEIYSYM
FT                   PPNTLISFVRVRNEEVLTPKNIYKLSVAHPPNLIYAKLILYIRELSST"
FT   gene            100917..101843
FT                   /locus_tag="A1I_00545"
FT   CDS_pept        100917..101843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78513"
FT                   /protein_id="ABV78513.1"
FT                   /translation="MNNIDITLFKKDIINNFINNLTEITCSTLANMLAIDYAVRLNSKP
FT                   EAKKYINACISRLKNHLRLRVINDDSFSLALKLFVILITPEDQNNQNISEQSQDIVAEN
FT                   LVEMYFGAEKISSEEKLKIKNVFKVLLKEKNFDEIINYAQSYAKLFRTSLRYGINKYKT
FT                   PNEVNTYIQQEFSKVLEISSELTRRSNLFKQTTGKIAGAACALLVGAISVATAGAAFSI
FT                   VVLPVSIFAVKYAPKIGEKIGGLILNNDKAIKLEQNNINQIIAKISNNNENLLSQEKRQ
FT                   NIQKSIITTPTKLNIKLDKKLGNEKHR"
FT   gene            103510..104757
FT                   /locus_tag="A1I_00560"
FT   CDS_pept        103510..104757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00560"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78514"
FT                   /protein_id="ABV78514.1"
FT                   /translation="MKKVVISGMIGNALEWYENILYAQFAYIIGQHFFPNAETRDTLTF
FT                   AVFAAGFIVRPLGGIVFGNIGDRFGRRIALVVGIIIMAVPTAGIGLLPGYKTIGIAAPI
FT                   ILTIIRLIQGFSLGGEFSACISYIVEHASIEQRGIAGSASFVSMCGGMLLGVITAASFS
FT                   YFMPADMLFEWGWRIPFIAGLFISSVGLYIRKNLSESPIYKKAKENGRLARFPLRETLT
FT                   KYPKELIIALGLYITVTAPFYTSTVFIGNFMQTLGYTNQQSVIVSSIILVVMMIVFPIS
FT                   AYISDRVGRRPVLICGIILLILLVYPIFICLGSMNFALAIISQILFAGIIAVYMGPIPT
FT                   VLVEIFPTSVRFTGVALSYNLAAAIFGGTAPMVAMLLTKMTGDNYAISYYLIALALVSS
FT                   IILKFYKETYKKNLVS"
FT   gene            104992..105912
FT                   /locus_tag="A1I_00565"
FT   CDS_pept        104992..105912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00565"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78515"
FT                   /protein_id="ABV78515.1"
FT                   /translation="MPDKIKHDKFFQKALSNPIVAREFFNMHLPSSIKALFSPTTLTLE
FT                   NDSFIEPNLKESITDILFSVKINDREGYLYLLAEHQSSSDYFMAFRLFKYMLNIAERHL
FT                   NSYPDSKKFPFIYPLIYSNDHKKYTAPLNLWDLFENSELVKSTWSNDYQLINLRDISDE
FT                   KLKENPWLAPLQILMKYINEPDLLPRWQQIADILPEFAGSNIGVDYVKSAISYTLTKIK
FT                   EDDKIELEKILKSHLNPELGVIIMGSLAHRWEQQGIEKERARSAIKIKKEKINIAKKML
FT                   TRNKPLDEIIDFTGLKKEEIEKLKT"
FT   gene            105961..106590
FT                   /locus_tag="A1I_00570"
FT   CDS_pept        105961..106590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00570"
FT                   /product="hypothetical protein"
FT                   /note="COG1636 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78516"
FT                   /protein_id="ABV78516.1"
FT                   /translation="MNEVFEVPGGEEKVLLHTCCAPCVGPLMEKMMSSGINFTLFFYNP
FT                   NIHPKQEYELRKNENIRFAEKHNIEFIDADYDPQNWFKRAKGLEFEPERGKRCSMCFDM
FT                   RFERTALYAHENGFKVISSSLGISRWKDMNQINESGVKAASHYEGITYWTYNWRKDGGA
FT                   SRMYEIAKEEHFYKQEFCGCTPSLRDTNKWRVANGRPKIEIGKEYY"
FT   gene            106623..107531
FT                   /locus_tag="A1I_00575"
FT   CDS_pept        106623..107531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00575"
FT                   /product="Nucleotidyltransferase"
FT                   /note="COG1708 Predicted nucleotidyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78517"
FT                   /protein_id="ABV78517.1"
FT                   /translation="MDQLCLVTNGNKKYNLLPERSLHINGRLNFIVQQILELAQDKIAM
FT                   IILYGSYARGDWVRDLINGYHSDTDILIILNKAKYKGHATLNLKDRIYARLKRKGVIKD
FT                   QIIPYDSRISIILESIEEVNRQLEKGRYFYTDITKEGILLYDSGEFTLSEAKDLPWSEM
FT                   KEIAQDYFEQWFNKGKDFLDGVDYYLKNDRYAIAAFLLHQATESFYNTILLVFSNYKPK
FT                   LHDIEELGGMAKNYDNELLQVFPIATPVQKKCFELLQKAYVDARYDKNYKITKEQLLYL
FT                   IERIEKLKEITERICTTKIGR"
FT   gene            complement(107646..107951)
FT                   /locus_tag="A1I_00580"
FT   CDS_pept        complement(107646..107951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78518"
FT                   /protein_id="ABV78518.1"
FT                   /translation="MKNKEQNFTSTSIEPLMMIEDLLESIDIFTMIEDTLPVKSSNSFY
FT                   NTVVYGFNYALEVIAPLAKNICEYFAGTSQNIEDNLHVPNMGDAPELWDSFTSYSI"
FT   gene            complement(108072..108395)
FT                   /locus_tag="A1I_00585"
FT   CDS_pept        complement(108072..108395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78519"
FT                   /protein_id="ABV78519.1"
FT                   /translation="MSLLIINLLTYIKGIFMKNKKVLPEDLLMNTSLDTIAEIIGNFPG
FT                   MCVSTSMNLENSIVEANNSFFTNFYNTAAYCFNYALEVMIPLAGNVCEYFRGNTDHYDV
FT                   ECL"
FT   gene            complement(108451..109188)
FT                   /gene="truA"
FT                   /locus_tag="A1I_00590"
FT   CDS_pept        complement(108451..109188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="A1I_00590"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78520"
FT                   /db_xref="GOA:A8GUM4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUM4"
FT                   /protein_id="ABV78520.1"
FT                   /translation="MYRYKISVEYLGTNLAGWQRQSGVMSVQQILEEAIYKFSGEQVTL
FT                   FGSGRTDAGVHAIGQIAHFDLSKYFEPYKIIRAINYFTRPYIVGVCNCELVDNNFHARF
FT                   SAIARHYVYRILNRPYPSVIDFDRVWWISVPLDVSAMQKSSLYLLGKHNFTSFRASSCQ
FT                   SKSPIKTLTKLDIIKENEEIKLYFSAPSFLHHMVRNIVGSLVLVGKNIWQAEQMQQVLE
FT                   VADRKAAGPTAPACGLYFIKADY"
FT   gene            complement(109265..109744)
FT                   /locus_tag="A1I_00595"
FT   CDS_pept        complement(109265..109744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78521"
FT                   /protein_id="ABV78521.1"
FT                   /translation="MSKKIQKKDLKDKYTVPTYSSQTTEYGFVGYAKDIMFNASSQTPL
FT                   VTFGDHTRKFFIRNESFACLDNVKVLKLKQEYIGKIDIEYISFVWENLIPNLGYSRHWK
FT                   VAKNIEIKIPITQTGEFDLQKQKEIAEKYRKIEEIKKNIKTELEKIENIKVDIGL"
FT   gene            complement(109830..110381)
FT                   /locus_tag="A1I_00600"
FT   CDS_pept        complement(109830..110381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00600"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /note="COG0286 Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78522"
FT                   /protein_id="ABV78522.1"
FT                   /translation="MEWIVKALKPNGKAFVVVPDGIFNRQNDKNLRQLILDNCFIDAII
FT                   SLPLKTFFTTPKKTYILAITKKHNISQIQTDPVFTYLCSEIGESRDIYRFDIEQDDLKE
FT                   AVNLFNAFKGSKKYFANINHDKRCKLQGIDKFKADINWCVENFFTEEEKIDLGFIEKTG
FT                   FLYIKEFNELLNDTLFYYQL"
FT   gene            complement(110366..111808)
FT                   /locus_tag="A1I_00605"
FT   CDS_pept        complement(110366..111808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00605"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /note="COG0286 Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78523"
FT                   /protein_id="ABV78523.1"
FT                   /translation="MSEELLQRDLIKNPEKIGTWDFHQVGATTVKQLTEANIIRSIDYG
FT                   NVARKKVDAIITRQKEVIAIIEYKSPKQFNTKNKRDSAILQEIEVAKKLKTKLIIATDT
FT                   HETLWINVATGNSVKDAKGNDFKYLFNPKDTNLQKVITEIIQSINDKNDTILPKQLIDP
FT                   TDLAKQIWQDVWSVSGATPENCLYTFVELFIFKYLSDLNILKGDFSFDELLKKYNNNEI
FT                   NDVLQHYANVIRPKIKDLFPEGSDKTTIINGTIFVSRDQKAIDGYGTVFKKVLEKFRDY
FT                   GKLEHIDHDFKSKLFESFLKESISKKNWGQFFTPIKVVRAINEMAEGELKKNMSICDPA
FT                   CGVGKFPLEFVKENLDNFFELKNGKINSKVKIIGFDKGFDKDEQKTIILAKANMLIYFC
FT                   ELIKDNPEHTKEFAKLFNDSFILKTNSILGTLSEPIEGEYDLILTNPPYVTSGSSNLKE
FT                   EIAKITIKSVEWALKGFLWNGS"
FT   gene            complement(111939..112184)
FT                   /locus_tag="A1I_00610"
FT   CDS_pept        complement(111939..112184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00610"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78524"
FT                   /protein_id="ABV78524.1"
FT                   /translation="MLATLTPREERVLRMRFGIGMNTDHTLEEVGQQFKVTRERIRQIE
FT                   SKALRKLQHPIRSKKLNSFRRGGKRGDGNPSDLLEA"
FT   gene            complement(112225..112335)
FT                   /locus_tag="A1I_00615"
FT   CDS_pept        complement(112225..112335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00615"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78525"
FT                   /protein_id="ABV78525.1"
FT                   /translation="MKIAKEPISLENPVGDGDDNSYLGDFIEDKKRSSTD"
FT   gene            complement(112322..113866)
FT                   /locus_tag="A1I_00620"
FT   CDS_pept        complement(112322..113866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00620"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78526"
FT                   /protein_id="ABV78526.1"
FT                   /translation="MTNTDNNNLNKIDSLLKKAKSKKGSVTYNDINRALPDGTSVEEID
FT                   KVMFRFSEAEVDILDTNEDDAIKIDDIEMEEGFKISTNIDHEPEDETEEENIGTTDDPV
FT                   RLYLKDMGGVDLLTRENEVEIAKRIEEGRKTLIAALCRSPIAMDKFRKWYADLVNENNM
FT                   LLRDLIDLESNMMHDDETSESEDDHNSDHEEEEQDHDHDHEENILSMSKVETQILPNII
FT                   ERMKKIAFICEELLIETKKSFEKSAGPKILQNSKKYNDNLELLISEVSEIHFNSKRTEE
FT                   ILSEMYGINRDLINKETAFLKLAEKYGITRQNFLDEYIGAVINAAWKEKMLKNKKAGWK
FT                   ELLTKESDYIDQMIAELSAIEINTGLLVNDFKKLVNTIQKSERQTLQAKKDMIEANLRL
FT                   VISIAKKYANRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRAIAD
FT                   QARTIRIPVHMIETINKIIRTSRQMLNELGYEPTPAEIAARLSMPIDKVRKVYENS"
FT   gene            complement(113949..115748)
FT                   /gene="dnaG"
FT                   /locus_tag="A1I_00625"
FT   CDS_pept        complement(113949..115748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="A1I_00625"
FT                   /product="DNA primase"
FT                   /note="COG0358 DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78527"
FT                   /protein_id="ABV78527.1"
FT                   /translation="MKLAPEFYEVLRNRINISDVVRQKVVLTRKSGNYVGLCPFHQEKT
FT                   PSFTVSDSKRFFYCFGCKAAGDVIKFTSNISGLSYNDSAIKLATDYGVEIPKLTQKQKE
FT                   FYEESDEILNILELANKFFKSQLTPEILNYLNERNITNETIKEFSIGFAPRGNKFEKFF
FT                   HDKNITNVQLGKAGLIGKREDGEIYSLFSNRITIPIRNIYNKIVGFGGRVIGQGLPKYL
FT                   NSPETVVFQKSETLYGEHKAISSSYKKNYSILVEGYFDVISLHQAGFSEVVASLGTSVT
FT                   ENHLHKLWRAGDEIILCLDGDSAGIKASVRTINLALPLINSEKKISFIRLPTGLDPDDA
FT                   VNKNGVDFFTKLIDTRISLSEMIWQIEYAGKNFKTAEDKANLEKNLKDYCSKISDSNLR
FT                   ASYYRFFKDQIWQNLVTKQQKTVAKNVNLLPLSSGYSELEILEHAFCALLIKFPQILQE
FT                   FEIKEFILNLNFSNKLLEEFRNWYLSEVIDNAVEAGEIAAIVEKTSFFDIFLLLSEADN
FT                   LFLDIAFNKDNVRLDLLWQWLYKRYYLLNLQQEYAHITKEYVITNIDDYEKVLFYKKEI
FT                   LKIASELQDLNESFINHIIDNSK"
FT   gene            complement(115752..116366)
FT                   /locus_tag="A1I_00630"
FT   CDS_pept        complement(115752..116366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00630"
FT                   /product="Dolichol kinase"
FT                   /note="COG0170 Dolichol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78528"
FT                   /protein_id="ABV78528.1"
FT                   /translation="MNIEDFDFEKKRKAFHLSAIILPLIYIFISRTSITLMLFIVTAAT
FT                   LYLDISRHSSIKISEFVTKFFTKIMRADESNGSFALSGSSFMMLGFFLTALLFPKNLAI
FT                   CSWLILIISDCLAALVGTKIGNSLNNGKSFAGSTAFLLSAIFISILVYFYLGFNTSFII
FT                   IIISSIATTAIEFYSKDLKVNDNLSIPLTYCFSTAILSYII"
FT   gene            116469..116954
FT                   /gene="greA"
FT                   /locus_tag="A1I_00635"
FT   CDS_pept        116469..116954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="A1I_00635"
FT                   /product="transcription elongation factor GreA"
FT                   /note="COG0782 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78529"
FT                   /db_xref="GOA:A8GUN3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUN3"
FT                   /protein_id="ABV78529.1"
FT                   /translation="MAKFPITDQGFEKLEHELKHLKHVERKKVSEDIAEARAHGDLSEN
FT                   AEYEAAREKQAFVEARIKHLEDITARAEIINVAKLSGDSIKFGATVVLIDDETEEEVMY
FT                   HIVGEYEADITKKRVSIASPIAKALIGKSVGDIVEVMTPGGVKSYEVVTIKYEELVF"
FT   gene            116976..117605
FT                   /gene="lipB"
FT                   /locus_tag="A1I_00640"
FT   CDS_pept        116976..117605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="A1I_00640"
FT                   /product="lipoyltransferase"
FT                   /note="COG0321 Lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78530"
FT                   /db_xref="GOA:A8GUN4"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUN4"
FT                   /protein_id="ABV78530.1"
FT                   /translation="MVQFITIPTPIDYQDSLMLMEDYVNKVIDGEAPEAVYLVEHLDVY
FT                   TAGTNYKQEELLNHNNIPVIYTGRGGKFTFHGAGQRVIYPILNLALPNRTKDLKLYVRM
FT                   LEEWIINSLDIFGIKAYIIKNKVGIWVKTNDDIPSKIAAIGVRVRKWVTYHGIAINIST
FT                   DLSKFNGIIPCGLENSLVTSLNQLGVYIEMTEFDKILEVEFIKIFK"
FT   gene            117602..118126
FT                   /locus_tag="A1I_00645"
FT   CDS_pept        117602..118126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00645"
FT                   /product="hypothetical protein"
FT                   /note="COG1434 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78531"
FT                   /protein_id="ABV78531.1"
FT                   /translation="MIRKIALTILTIFAIWASGFVYYLYLVNSYKPSSNTANAIIVFAG
FT                   GGHKIETGIALLKAGYAPILFITGIETSDQLKNLLKENNVLEQQVILAPNQIMSEEDYI
FT                   KKASDFILKYNITSVRLVAYNYDIPSIVNNLTTAISSSNNNIYIAPYPVIAKQQNYMTL
FT                   IKHYNNYLLSL"
FT   gene            complement(119327..119650)
FT                   /locus_tag="A1I_00660"
FT   CDS_pept        complement(119327..119650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00660"
FT                   /product="hypothetical protein"
FT                   /note="COG0718 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78532"
FT                   /db_xref="GOA:A8GU86"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GU86"
FT                   /protein_id="ABV78532.1"
FT                   /translation="MVNFNQFLKQAQTMQKKMQEAQEQMANTRYTGKAGGGLVEIIATG
FT                   KGEVEKVSIDASLLKEEEKEMLEDLIKVAFNDAKQKCDSDSQNSMSGALSGMSLPPGFK
FT                   MPF"
FT   gene            complement(119662..121188)
FT                   /locus_tag="A1I_00665"
FT   CDS_pept        complement(119662..121188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00665"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG2812 DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78533"
FT                   /protein_id="ABV78533.1"
FT                   /translation="MTDINSNNQYIPFARKYRPSSFAELHGQEVLVKVLSYTILNNRLA
FT                   GGYLLTGIRGVGKTTSARIIAKAVNCSALITEDNNIKTCEQCVNCVSFNNHNHSDIIEI
FT                   DAASKTSVDDIRRIIESAEYKPLQGKYKIFIIDEVHMLSKGAFNALLKTLEEPPPHVIF
FT                   IFATTEVQKIPATIISRCQRYDLKRLSFEEIFKLLEYIVKEENLKTDIEALRVIAYKSD
FT                   GSARDAVSILDQAASLSAKSDSMITRQAINQMLGLVDNNVILEFSEYIVNRDIANSISL
FT                   INKLYSSSVNLEIFIESVSEFIAYLNKVKMLPSYSMPLYESFNDRIKNILSKISFPHLS
FT                   ILWQIYSKGIAEIKISYNQLIETEMLIIKSIYSASLPLDDSPSDNRDLKQPSTEEIKKK
FT                   FEIVDFLKYLYENNEIEIYYFLLNSIELKNFYDNKLEIVSSEITSKIKKQIENLLFAFS
FT                   NEKIEIIISKEQQQTTLKSQLTDKIESGDGFSLIKKHFPDAKIMDILLKN"
FT   gene            complement(121425..122069)
FT                   /locus_tag="A1I_00670"
FT   CDS_pept        complement(121425..122069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00670"
FT                   /product="Outer membrane lipoprotein-sorting protein LolA"
FT                   /note="COG2834 Outer membrane lipoprotein-sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78534"
FT                   /protein_id="ABV78534.1"
FT                   /translation="MKKIFFLIIVCIFTNSIAAFGSDDKAAILELKTYLRTMKSIAVDF
FT                   TQEDSKGNIVQGKLLISKPYNFRCNYYPPFPIIIVGTKNFVSMYDYDMEQVSRIARDEN
FT                   IFNFLLEDNENFDKDFVVESVVNEKEFSRINIYHKVTERHSEITLNKANKQIELLKIFE
FT                   DTNVVTIKFDNIVKVQKFDEDLFKLKNPEIYGVPERLTKSEIEKKYVVSSS"
FT   gene            122138..123262
FT                   /locus_tag="A1I_00675"
FT   CDS_pept        122138..123262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00675"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /note="COG3288 NAD/NADP transhydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78535"
FT                   /protein_id="ABV78535.1"
FT                   /translation="MKIVALREKVKHETRVAITPEVASLLVKKGFAVTVEKDIGVHAGF
FT                   LDEEYIAVGAKISAVPLEIISDADIILKVQPSPVSDKYSELEFAKKGAVIIGLLSPYLN
FT                   HEYIKAAAKKNLTSFAMELVPRITKAQNMDALSSQSNLVGYRAVIEASYHYTKAFPMMM
FT                   TAAGTVSPCKTLILGIGVAGLQAIATAKRLGSVVAGYDVRSATKEQVESLGAKFVSPEL
FT                   QEDLQDKSGYAGESSESYKAKQEEFLAKIIKNYDIVITTAQIPGKKAPLLVTDKMLKSM
FT                   RHGSIIVDIATATGGNVEGSELDKIITKHGVTIIGLSNLAAKIATDSSKLYSKNLYNFL
FT                   NYALQDDKLNMDDELVQSMLVTKDGKIVNEKYTR"
FT   gene            123421..123822
FT                   /locus_tag="A1I_00680"
FT   CDS_pept        123421..123822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00680"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /note="COG3288 NAD/NADP transhydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78536"
FT                   /protein_id="ABV78536.1"
FT                   /translation="MNQLPIIAKQASEIAQNTQELSDKLKDLVIDGSSQVAASTIDPLV
FT                   FAITVFVLASFVGYYVVWKVTPALHTPLMSITNAISGIIVLSSMIAASSSAFGFSGLLG
FT                   IFATLLASINIFGGFIVTKRMLEMFKKKS"
FT   gene            complement(123829..125022)
FT                   /locus_tag="A1I_00685"
FT   CDS_pept        complement(123829..125022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00685"
FT                   /product="hypothetical protein"
FT                   /note="COG1887 Putative glycosyl/glycerophosphate
FT                   transferases involved in teichoic acid biosynthesis
FT                   TagF/TagB/EpsJ/RodC"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78537"
FT                   /protein_id="ABV78537.1"
FT                   /translation="MCILAISQFTFAKNPSSKEVMFIVHTETQGGKGVYPIYQEMKKIG
FT                   YNVKVVAIPLYNGWYHLPIDKEFMENFDKEDVIYPCGIDEPYTKCLGIESYKPDYIFVQ
FT                   NPYNAYSNSILDPYFVNTTLKKIAKKIVYIPYGPHIFHQEFINDKELPNFVDLVFVDSE
FT                   STQNIYIEKYGFKKDNVIVSGYYTYKEIRDIMNNNIKVDRPETILWLPRWTLNFKHRDL
FT                   FESGSTFLNYHYFFYNYALKNPNIHFIIRPHPSLLFAISNQNLLTQEELDQIFEKFRSL
FT                   LNVTVSDSTYVPLVNDIMKSDVIISDGTSALAEVVVADKPIIYLSNGWNNEFNSNKLSK
FT                   ELKKYVYLAYSHTEIIDYIGKIRQNNYTLSGNREEFKKILDPVENPAKFIAEYLLNN"
FT   gene            complement(125054..126307)
FT                   /locus_tag="A1I_00690"
FT   CDS_pept        complement(125054..126307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00690"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78538"
FT                   /protein_id="ABV78538.1"
FT                   /translation="MKQKKSANKVLGAFLGTIIEYYDYSLYGFSAAIIAEKFFSPATDQ
FT                   LTKLVNVFAVYAVAYLSKPLGAYIFGRIGDKYGRKKALSFTIIGIIIPTLIIGLLPDYS
FT                   TLGVWSTIILVLCRFMQGIFIAGEYDGAAIYVIEHLGPKYQFTASAITRCTGVIGLLSG
FT                   IGVTNFFNAHIFPDWSWRIPFLLSVPLGLVTLYYRQKFDETPEFKKAGSNNSIQKFNVL
FT                   IRKQWKNILPLIFLAGGFGATYQIAIIFMKQYLPLVLPATGVIMSSFSVLVVLCFAVFM
FT                   PIAGFIADRIRVNIVLKTALISTIIASIIFTIAVEYQMTNLGLFASLMLAASVAPFNAL
FT                   AHSVVIKSFAVRERYRIISFGHTIGSMLMSGTANYICLLVIKKYNFTLFPILYICIFSV
FT                   LAYSMTLLYDRDNQVSNN"
FT   gene            complement(126630..126947)
FT                   /locus_tag="A1I_00695"
FT   CDS_pept        complement(126630..126947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00695"
FT                   /product="hypothetical protein"
FT                   /note="COG3027 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78539"
FT                   /protein_id="ABV78539.1"
FT                   /translation="MAIVTITLNNKNFQLYCNSGEEEKLLFLANKLNEKISEIKAVNPA
FT                   ASFDLLLVIALLNAQSEITHLANKIETNSLQKNSQDEEKFAETLSTIAGYLENLARKME
FT                   K"
FT   gene            complement(126950..127153)
FT                   /locus_tag="A1I_00700"
FT   CDS_pept        complement(126950..127153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78540"
FT                   /protein_id="ABV78540.1"
FT                   /translation="MNNEILMSLMQQVEYRLDNLLNVLANNQYEIHRLQNENNQLRNDY
FT                   VRILDQINIYVNELEEIKKLQK"
FT   gene            complement(127157..127513)
FT                   /locus_tag="A1I_00705"
FT   CDS_pept        complement(127157..127513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00705"
FT                   /product="hypothetical protein"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78541"
FT                   /protein_id="ABV78541.1"
FT                   /translation="MSSMLKRTRLDLGKTLNQVSLDLKIRKKYLIALEEGKLDVLPGEV
FT                   YVKGYLKLYLDYLNIRYRNAEQLETKKNNEQEKLLSRNKNKALVNYRHKKQLIFMSIVM
FT                   LSIIIIIYPFIELA"
FT   gene            complement(127516..132267)
FT                   /locus_tag="A1I_00710"
FT   CDS_pept        complement(127516..132267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00710"
FT                   /product="NAD-specific glutamate dehydrogenase"
FT                   /note="COG2902 NAD-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78542"
FT                   /protein_id="ABV78542.1"
FT                   /translation="MTPKTPLLDSGRLNCQIPNHKAKILELSKKQESNSLYVEFIEKFL
FT                   SYIPIDYDFENKQKLFFDFADEAFNFFKYREKGERKISITNTVIENDPAINVLILLDNK
FT                   PHIVDFIVCLLKNKALQTKFLLHPVIKCTRDSKGNLEKILENSAAEEKSESILHLTILG
FT                   NFDDSAANLLIKTINDRLDELEESHNALPNMQAKLQDLSKNIIDNEKLNSIEAKEFLSW
FT                   LQNDNLILLGIIDFEVNYTKLSNKIGTTKIWQEVKDEIEDIVKCSASPLYQNQLIILGK
FT                   INSASLIHTDNLIDYILVKKFDSSGEYISGSIIFGIYNSNMYYHSISNIPILRQKFNFV
FT                   IGKAGFALSGYNADKLKILMESLPREALIQIDQGDLYCICLHMLSSMMSKKLKLFIQYD
FT                   WSSSFLNIIIFLPRERLTSEIHNMIDCYLAEKFGSKILSNYITEVVGSFSYLFVTLEAQ
FT                   DKHKINFEAEKIQQDLDRISRCWSEDFYLKLSKKFGEYQAGINFKLFDNIFPADYRQKF
FT                   SPEIALTDIEYLTEASRNQRRMFNLIATGESEFYLKIYSPGVSLALSNILPPIENLGFS
FT                   AIDEQSFVKKEVGEIKESWIYNFILTSVVPVKDNVHELKINVEEALDKMVLGMLANDYL
FT                   SKLIVLAGFNWKQVKLVKALTRYLHQTGFSYGKGYVQLTLLKHPEYTKKLVNLFDIKFN
FT                   PKHLDHDFKDIKKQLNDYLLKVEVSSEDKVLRSMLGVLEAVTRTNYYQPNKHYFSFKFD
FT                   SSKVPHLPQPIPFAEIFVYSRSFEGVHLRGGPVSRGGLRWSDRAEDYRYEVLGLMKAQM
FT                   TKNSVIVPVGSKGGFYLHFTDEGLSRDKYMEKVVECYKNFLRGLLDITDNIVDGKVVHP
FT                   QDIIIYDKEDPYLVVAADKGTASFSDYANSVSREYNYWLDDAFASGGSAGYDHKKMAIT
FT                   SKGAWISVTNHFKTLGIDVQKDPITVTGIGDMSGDVFGNGMLRSKAIKLVAAFNHKHIF
FT                   IDPEPDPLTSFNERLRLFNLKGSNWSDYDSKLISKGGGIFERSSKSVKLSPEIKKLLDV
FT                   NDSEISPEELIKAILKAEVDLLWNGGIGTYIKAKTENHLEIGDKANDNLRCNGEEIRAK
FT                   VIAEGGNVGVSQRGRVEYAKKGGRINTDFIDNSAGVDCSDHEVNIKVAFSNSIASGKVT
FT                   LDERNKLLIDMTKQVEELVLEDNYKQTEAITIMQLSPTLTVSIFSQFIDILEEEKILVR
FT                   ENEFLPTSEELNRRAINGEVLTRPELCLLLSYSKRSASHELRNSTFSHDKYFDSYLVNY
FT                   FPKIMQEKFREEILSHPLKHEIIKTVVINKIVNQLGGPLISITKRETGAPLCDIIRSYT
FT                   IICEIFELDDIWEKVSNLATNIDYNIKIDMFTEITKLMRRGISWFIKNLKHPINISKTI
FT                   EEFKKPAQNLREVVGNLLAGEAKIKFEEKLNYYVSNGIDKSFAKDILTFDSLISVFDII
FT                   HVTKQVSGNDEEMAKAYFTIGNMFSLYWLRKTCDRQLNDSYWRRLGLQSLKDDLYDKQR
FT                   RLLIKIINKSQTTIDLDLWIDNNKSLVKNFLDFIKEIKSQEVIDLNVIILVNKKFEIFL
FT                   QKLE"
FT   gene            132764..132952
FT                   /locus_tag="A1I_00715"
FT   CDS_pept        132764..132952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00715"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78543"
FT                   /protein_id="ABV78543.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            133186..133440
FT                   /locus_tag="A1I_00720"
FT   CDS_pept        133186..133440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00720"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78544"
FT                   /protein_id="ABV78544.1"
FT                   /translation="MLVAEKNRLQQANTDKFVKNSCINMIDVLSNQITEITNQVEVIIS
FT                   SDQLLKAIAFAISNKPVAATNLSSYLGFTSSFFEILTAF"
FT   gene            complement(133326..134162)
FT                   /locus_tag="A1I_00725"
FT   CDS_pept        complement(133326..134162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78545"
FT                   /protein_id="ABV78545.1"
FT                   /translation="MTLKFLAGIASNDDSKELIEIFWESATCNVNEILELDIKKKIILL
FT                   MHLLAQSKIKGEFNNRIPHLKQIQNLIDDILLRDITIWEQHIIDSGYLSEKIVEAVNEK
FT                   LQNGKANFQEFKTAVEIITALTNRNQWGNKTKVYERLICLLKTRDTQLQKLVLQKLAQI
FT                   LDETIDKKVVHESSRKIILLLNKEVLNKYIKIILAKTIIFIPDLSEEVFNKIQKLKIKF
FT                   LNKTLIITVLTEVLIVMPTQKAVNISKKLLVNPKYELRFVAATGLFEIAKAMAFNS"
FT   gene            complement(134188..135627)
FT                   /locus_tag="A1I_00730"
FT   CDS_pept        complement(134188..135627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00730"
FT                   /product="NACHT family NTPase"
FT                   /note="COG0055 F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78546"
FT                   /protein_id="ABV78546.1"
FT                   /translation="MQEKTKAFNVLKTLYSFQDTLPKLIEDEQIKALSLDEYYIKLQIL
FT                   LSEDNDSVKAALHDKVTGEKKPVEIENIFKAIDVENRIRELLEKNYQVREEIINDIIKP
FT                   LIEEENKLNLLYRNIPNKSESEIKYIAESINRIQADVGKVLLLGGAGIGKTTLMHYLSY
FT                   KWGKDNLWNDKFDYVFRIKLKELLNENWSREYEAKELRQNKLACFIHYCLNLENIEPHE
FT                   IINISNKDRVLLLLDGYDEVAFLSQDNRDYRDIMEAVFQYKNVIMSSRPNAITENINNK
FT                   FERKVENTGWDSEGIKKYVYKSFEYDKEFGTPLKSFLDTHSQIKEICEAPINTAIICLI
FT                   WSDQEIRQNLQTTSNENFNISRLYSEIINWLNNRHLAKNRHKYKNKTEANNHLKNIMSF
FT                   LEQIAYESLSTRGKLVESKLVESKKNTLDIDEVIEQGLLRREGQNYQFIHLTFQEFLAA
FT                   RHLKNQLLDNYTKSKAASFYR"
FT   gene            135867..137204
FT                   /gene="tig"
FT                   /locus_tag="A1I_00735"
FT   CDS_pept        135867..137204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="A1I_00735"
FT                   /product="trigger factor"
FT                   /note="COG0544 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78547"
FT                   /db_xref="GOA:A8GUQ0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUQ0"
FT                   /protein_id="ABV78547.1"
FT                   /translation="MATTILKNEGLDFHIKISTPLSEIDNDIQKELVDLTKKVKIAGFR
FT                   AGKVPIAIVEKKYGASVRNDIIEKRINDSVNHVIKEHNLNIIGRPKIDDLQNEPNKPLE
FT                   FTIKMELLPKIDIPDLKKISINRPKLEVSPDDVEEQLKKLAEMMKSYTKESKAKAKDGD
FT                   QITMDAVGYVKDEAFEGGKLTDFKVVIGSNALIPGFEKQLIGSKAGSEVEVNVTFPENY
FT                   HAKDLAGKDARFVVQVKAVHTAEPTVIDDEFAKKFQSNSLEELRTHFTKKIENESEEAI
FT                   STIMKMNLFDQLEKLLDFDVPESLLDQEKNILKSETDKSEQDDSVFKDKSPEQVKEYYD
FT                   KLALRRVRIGLMLAEYAKDKNLQVEPDDLRRIIMQQARSFPGQENMLFDFYKNNPRAVE
FT                   QLKGPALEEKAVQHIFDNAVNLKEKKYNRKELEKLLESEEQRITAM"
FT   gene            137373..137618
FT                   /locus_tag="A1I_00740"
FT   CDS_pept        137373..137618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00740"
FT                   /product="Putative antitoxin of toxin-antitoxin (TA)
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78548"
FT                   /protein_id="ABV78548.1"
FT                   /translation="MNKWQLHEAKNKLSNIVDTAMQGTPQCITKRGEEAVVVISMKYYE
FT                   QLTKQKLDFKEYLLSIPKTDDLVIERVQGKARDFEL"
FT   gene            137615..137968
FT                   /locus_tag="A1I_00745"
FT   CDS_pept        137615..137968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00745"
FT                   /product="Toxin of toxin-antitoxin (TA) system VapC"
FT                   /note="COG1487 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78549"
FT                   /protein_id="ABV78549.1"
FT                   /translation="MKYLLDTNVVSEIQKKKPNPQVVAWFSVVHYSQLHISCITIGEIR
FT                   KGMLKLSKNDSVASLKLKKWLEELIIDYNERILNIDKEICEEWGELMSIDGTNAIDALI
FT                   AAQSKTKQYDISY"
FT   gene            138055..138924
FT                   /gene="glyQ"
FT                   /locus_tag="A1I_00750"
FT   CDS_pept        138055..138924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="A1I_00750"
FT                   /product="glycyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG0752 Glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78550"
FT                   /db_xref="GOA:A8GUQ3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUQ3"
FT                   /protein_id="ABV78550.1"
FT                   /translation="MKKLSFQQIILTLQNYWQDYGCAILQPYDAHVGAGTFHPATVLRC
FT                   LGSKPWSVAYVQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQELYLKSLECLGI
FT                   DLKAHDIRFVEDDWKSPTLGAAGLGWEVWCDGMEVSQFTYMQQIGGIECKLVAGEITYG
FT                   LERLALYIQGIDEVKELDWNGQTGEKALKYGEVDFEAERQFSKFNLEFADSEMLLRHFK
FT                   DSEEQCERLVEANLPLPAYDYCLNASHYFNLLNSRGIISVTERASYVLKVRHLAKICCM
FT                   KWLEMSGE"
FT   gene            138917..140893
FT                   /gene="glyS"
FT                   /locus_tag="A1I_00755"
FT   CDS_pept        138917..140893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="A1I_00755"
FT                   /product="glycyl-tRNA synthetase subunit beta"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG0751 Glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78551"
FT                   /db_xref="GOA:A8GUQ4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUQ4"
FT                   /protein_id="ABV78551.1"
FT                   /translation="MSELLLELFSEEIPAFIQKDAEEGYLSIFTKIFEENEIFAKIQVF
FT                   SGPRRITLYATHLPKVTLPKEIEIKGPSTEAPEAAINGFCKAHNVSKLELSTKLINNQL
FT                   YYFYIKKVEERQIKEILPEIIVEAINKYSWAKSMFWGNYNIKWIRPLRNILCIFDSEIL
FT                   PLQFGHLAANNVTFGHRLTDNKKLEVTDFEDYKTKLTENYVILERLKREEIIKTSLLEQ
FT                   ANSHNLTIKEDLRLIEEVAGLSEFPVVLCGAIPQKFLELPKEVLISSMRTHQKYFCLFD
FT                   RSENFAPYFLFVSNGQFANSKLVVQGNEKVLSARLSDALYFYKQDISKTLEANLEKLAA
FT                   VTFHTKLGSLKEKVERITNICKYIDPDNKDLITAAKLCKSDLVSEMVGEFPELQGIMGY
FT                   YYAKHENLNEEIAVAIRDHYKPQGLSDSVPVGNAALLAIADKLDSLVGLMIAGEAPTGS
FT                   GDPYALRRQVLGIIRIIIENKLELNLNSLIDFSLKLYSSDKDKDLIISFFEERAKFYFK
FT                   NEYDISLINAVLDLNLANIKFKLDALKEFLEKEDGKQLLNAYKRASNILGSQNIDGAVE
FT                   PSLFNTQPEKELFEVTQKLSLQIVDKDYDKALNLLQTLLTPITSFFDNVLVNDSDPKIA
FT                   KNRLLILQDVCKLFHKIAKFNRL"
FT   gene            140890..141828
FT                   /locus_tag="A1I_00760"
FT   CDS_pept        140890..141828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00760"
FT                   /product="Putative translation factor protein"
FT                   /note="COG0009 Putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78552"
FT                   /protein_id="ABV78552.1"
FT                   /translation="MIKQAVQFITSGKVVVFPTETVYGIGADATNQEACLKIFQFKNRP
FT                   AVNPLIVHVSSIEQAKEIGEFNYIAEKIAEKFWSGPLSIVVPLKENANVATAVTAGLKT
FT                   IAIRIPSHPLALELIKQSGKPIAAPSANPSNYISPTRLDHVTRHFKENEEIFILTDKDY
FT                   QSKYGLESTIVDTTADIPTILREGFITAEVLETVLDIKINKASKNINIKAPGMLEKHYS
FT                   PTVSIRLNATNLNDKEIGLNFGDSNLKGEYSLNLSSKGDLTEAAANLYAYLRLLDDYAA
FT                   AHNIEHIAVAPIPTINIGAAINDRLKRAANN"
FT   gene            complement(141829..142206)
FT                   /locus_tag="A1I_00765"
FT   CDS_pept        complement(141829..142206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78553"
FT                   /protein_id="ABV78553.1"
FT                   /translation="MIRNIIITISAILLLTSKGFADDTISNTSKKDTKTDITTQKILDE
FT                   FYAYAGTIKPEIREEIQKYRVEIVNINKKKRELYDKLSKEAQNFLAKEQEYKQRLSSSS
FT                   MATEDSKDNNTAKDNKDADKK"
FT   gene            142243..143160
FT                   /locus_tag="A1I_00770"
FT   CDS_pept        142243..143160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00770"
FT                   /product="Ribosomal protein L11 methylase"
FT                   /note="COG2264 Ribosomal protein L11 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78554"
FT                   /protein_id="ABV78554.1"
FT                   /translation="MFKSDSQSKDIFKISFNIQYKDINIFEEFFTEKVSAISVYEVKSK
FT                   TLESQPKDIWCFEIYCDNQTNLVSLKKEVQELAKLNNIEITSDIISEEIENRDWVALYQ
FT                   NQLVPIQTNRFFICTTLHQDKCPKDKTLILIEASRAFGTGTHETTSGCIEALEYLKAIK
FT                   ANKILDIGTGSGILSFIAEKLWNEAEILACDIDNASVEIAKENASFNNSNIKFYQNTSE
FT                   NILLDSYYNDKFDLVISNILALPLIELSTQISNLMNKNGYLVLSGFLDNQLEDVRNAYE
FT                   KIGFEVKEIIYKNSWVILIVAYYK"
FT   gene            143236..144732
FT                   /locus_tag="A1I_00775"
FT   CDS_pept        143236..144732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00775"
FT                   /product="ATP/ADP translocase"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78555"
FT                   /protein_id="ABV78555.1"
FT                   /translation="MSTTKSDNYISELRKVIWPIERYENKKFLPMAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGAEAISFLKTYIVLPSAVIAMIVYVKLCDILKQENVFYVITSFFLAY
FT                   FALFAFVLYPNPDLVHPNPEAIESLSLAYPNFKWFIRIVGKWSFASFYTMAELWGTLML
FT                   SLLFWQFANQITKTDEAKRFYSMFGLLANLALPVTSLIIGYFLHEKNQIVAEHLKFTPL
FT                   FVIMIISSLAVILTYRWMNKNVLTDPKLYDPALVKGKKAKAKMSLIESFKMIFTSKYVG
FT                   YIALLLIAYGISVNLVEGVWKSKLKELHPTKEAYTMYMGQFQAYQGWVAIAFMIIGSNI
FT                   LRKVSWLTAAMITPLMMLITGIAFFAFIFFDSVIAMYLTGILASGPLALAVMIGTIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRFGKSGGAIIQSTFFIIFPAL
FT                   GFVEATPYFASIFFVIVILWIYAVKGLNKEYQVLVNNTEK"
FT   gene            144795..146084
FT                   /locus_tag="A1I_00780"
FT   CDS_pept        144795..146084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00780"
FT                   /product="Sugar phosphate permease"
FT                   /note="COG2271 Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78556"
FT                   /protein_id="ABV78556.1"
FT                   /translation="MRNTKSEIKIPRTPYVKKYNSWRIRILYSIIIGYATFYFCRQNFN
FT                   IATPAIREYFDVTKTQIGWILTASSIMYGVSKFCNGFISDKTNARIFMVLGLLFVGIIT
FT                   ILIGFSDSLFLIGILWIASNWFQSMGWPPATKMLTHWFASKELGTKWAMGAISNQIGGA
FT                   LAMVSCGYLIDKFGWRSAFFVPGVVACVVSIFLYNRLRNSPKEVGLSTVEEYKNYPPEL
FT                   ISDYGKLPTAELIKIVFCNKLIWYVCLANMFVYIIRLGVIYWAPTFLKDLRGISLLNAG
FT                   LQVGLYEMISIPGALIAGFLSDKLFQGRRGPVSTICMLLLSVLLILFWKLPIQSELLSI
FT                   IILSLVGFFVSGPQLLVGIAAADFSTRQAVGTANGLSGLFGYLGAAIAGVGVGWISDNY
FT                   GWDGVFIFFSISALLGSSLFALTWNCSAKK"
FT   gene            146113..146535
FT                   /gene="ndk"
FT                   /locus_tag="A1I_00785"
FT   CDS_pept        146113..146535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="A1I_00785"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105 Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78557"
FT                   /db_xref="GOA:A8GUR0"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUR0"
FT                   /protein_id="ABV78557.1"
FT                   /translation="MTIQYTFSMIKPDAIKRNKIGQVNTYLENEGLKIVAQKMTTLTKY
FT                   EAECFYDEHRARPFFDSLVEYITSGPVVLQVLKGMDAITLNRKVMGATNPAEAEAGTIR
FT                   KDIGESIEANSIHGSDSENSAKREIKFFFKKSEIIE"
FT   gene            146539..148404
FT                   /locus_tag="A1I_00790"
FT   CDS_pept        146539..148404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00790"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="COG0445 NAD/FAD-utilizing enzyme apparently involved
FT                   in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78558"
FT                   /db_xref="GOA:A8GUR1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUR1"
FT                   /protein_id="ABV78558.1"
FT                   /translation="MQKYDVIVIGGGHAGVEAAAASARLGVSTLLITPKSENLGEMSCN
FT                   PAIGGIAKGTLVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKKA
FT                   MYQILTNYPNLEILYAKVEDIEIKSSEIKAVILNNGSKIPCQKIILTTGTFLSGLIHIG
FT                   SKKIPAGRVDEEPSYGLSNTLRRIGFKLSRLKTGTPPRIDGRTIDYSKVESQPGDKVPR
FT                   PFSELTDNVNVPQINCFVTKTTTETHNVIRANLDKSAMYSGQIEGIGPRYCPSIEDKIV
FT                   RFSTKSEHRIFLEPEGVDDHTIYPNGISTSLPEEVQHQLIKTIPGLENAIILRPGYAIE
FT                   YDYIDPREISSTLETKKITGLYFAGQINGTTGYEEAAGQGIVAGINAALAVKNQPPFIL
FT                   TRANSYIGVMIDDLTSFGTLEPYRMFTSRSEYRLSIRADNADLRLTEMGISIGVISEKR
FT                   KEIFTIKCKNIESTKSLLNTLCLTTSKLAKMGIQVAQDGTYKTVLDLFKIPNFDVEQAI
FT                   KIFPVLKNVDNNILQLLYIEAKYASYLVRQYADINLFQSEEAQLIPKNIDYFKIPSISL
FT                   EIQEKLSYNKPITIVAARRIPGVTPAAITAIIIYLKTKYNDRRST"
FT   gene            148385..148963
FT                   /gene="gidB"
FT                   /locus_tag="A1I_00795"
FT   CDS_pept        148385..148963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="A1I_00795"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="COG0357 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78559"
FT                   /db_xref="GOA:A8GUR2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUR2"
FT                   /protein_id="ABV78559.1"
FT                   /translation="MIDVPHEVIEKLQIFQDLVQKWNKAINLISENSTQNFWKRHILDS
FT                   LQLIQYINDKEIHLVDIGSGAGFPGIILSIAGVASTSLIEADLRKCIFLEKAAKISNNN
FT                   IQIINQRIEKTEISCNILTCRAFSNLNTIFDCTKNISVQNKFLLPKGKSYLSEIKEARK
FT                   KWLFKCLINQSITSKESKILEISDLTKII"
FT   gene            148960..149733
FT                   /locus_tag="A1I_00800"
FT   CDS_pept        148960..149733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00800"
FT                   /product="ATPase"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78560"
FT                   /protein_id="ABV78560.1"
FT                   /translation="MTVKVISVVNQKGGVAKTTTTVNLATALAAMDKKVLVIDLDPQGN
FT                   SSTGFGVSQQQRKNTIYQALTNIIKLKDTIISTDIPNLEIITSNTNLSAAELDLIKLEE
FT                   REYILMKLLEGIKVLYDYIIIDCPPSLNLLTINALVAGDEVLIPMQCDFYSLEGLSHLL
FT                   KTVEIVEKRLNPKIKITGILFTMYDRRNRLTEQVEEDVRSCLGELVFKTVIPRNIKLSE
FT                   APSYGKPAIIYDYKCAGAVAYMELTKEILGRYNEK"
FT   gene            149723..150586
FT                   /locus_tag="A1I_00805"
FT   CDS_pept        149723..150586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00805"
FT                   /product="ParB-like partition proteins"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78561"
FT                   /protein_id="ABV78561.1"
FT                   /translation="MKNKGLGRGLSSLLGEEVISTEKESLEIVQIINIDRIKPNENQPR
FT                   KHFEYDKIKELSDSILNNGLLQPIIIDNSFQIIAGERRWRACKLAKISEIPVIIKNLDA
FT                   KESMEIALIENIQRSDLTVMEEARGFKYLVENFNYTAEKLAERLGKSRSHIANLLRLNN
FT                   LPQSIQNKLDENTLSMGHARCLINHEHAEIIANYVIDNDLNVRQTEELVRQWSQNEYTK
FT                   YPDNNRIGKQLFKEKTEDNDLQSLVKILSEKFNIKVTIENYSLGGKLIFHYKDLKELDK
FT                   ILLELS"
FT   gene            150607..152274
FT                   /locus_tag="A1I_00810"
FT   CDS_pept        150607..152274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00810"
FT                   /product="putative ABC transporter ATP-binding component"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78562"
FT                   /protein_id="ABV78562.1"
FT                   /translation="MSSQYIYEINGLSKTINGKKILKETNLSFLPSAKIGIIGPNGVGK
FT                   STLLKIMAGIDKEFDGKAMAALNIKVGYLPQEPYLNPNKNVFDNIMEGLHEKKKLIDEF
FT                   NEISNKLATEITDEEMNQLFDKQAELQEKIDNCDAWDLEREIEIAMLALRCPSKEANIN
FT                   EISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLENYLKEYKGTVIVITHDRY
FT                   FLDNVTEWILEIDRGHCVPWKSNYSSWLEQKQEKLALESKEEDERKKQLNRELEWIRQA
FT                   PKARQSKSKARITAYQELLNKQQEQKSDPTQIIVPNGPRLGDLVIEAEHIAKKYNDKTL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKTTLFNIITGKVKPDKGSIKIGSTVKLGYVDQSRDH
FT                   LDGNKTVWEEIAEGLDELQLGSRIVKSRAYCAAFNFRGGDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIGTLRALEDTILDFAGCVLVISHDRWFLDRIATHIIAYD
FT                   IKGNATWFEGNYQDYHEYMLKINGENTLNPKYKHKKLI"
FT   gene            152277..152552
FT                   /locus_tag="A1I_00815"
FT   CDS_pept        152277..152552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00815"
FT                   /product="hypothetical protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78563"
FT                   /protein_id="ABV78563.1"
FT                   /translation="MSLIQTLIVLFIGLFVIKPDDIPMLINQIKKIKSYFSNVDSSEVE
FT                   QLNFYVQKIISIEGYYDGDYNLVAIKEKYNKLIKSVINNDLNNING"
FT   gene            152654..152956
FT                   /gene="secG"
FT                   /locus_tag="A1I_00820"
FT   CDS_pept        152654..152956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="A1I_00820"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78564"
FT                   /protein_id="ABV78564.1"
FT                   /translation="MLDILLFVHITIAILLIIVILMQRSGSDGISSISGGGNMGVISAK
FT                   TANNFLTKSTVILASLFLINAIILANLSSQKKPDLVSKINEIEENQVDNSLPIAK"
FT   gene            152973..153797
FT                   /locus_tag="A1I_00825"
FT   CDS_pept        152973..153797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00825"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78565"
FT                   /db_xref="GOA:A8GUR8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUR8"
FT                   /protein_id="ABV78565.1"
FT                   /translation="MQKIIKLKDLKIGNDLPFTLIAGPCQIEGLDHALFMAEELVKLTT
FT                   RLNIPFIYKSSFDKANRTSVNGARGLGIDKGLEVLAEVKRAFNCPIVTDVHSENQCAEV
FT                   AKIVDMLQIPAFLCRQTDLLQAAAATGKIVNVKKGQFLAPWDMKNVHKKLESFGAKDIL
FT                   LTERGTCFGYNNLVSDMRGLAIMAELNTPVIFDATHSVQQPGGLGGSTGGERKYVELLA
FT                   KAAVAVGVAGLYMEVHQDPDNAPSDGPCMIRLDNLERVLTKLKKYDEITKEK"
FT   gene            153800..154132
FT                   /locus_tag="A1I_00830"
FT   CDS_pept        153800..154132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00830"
FT                   /product="EMAP domain containing protein"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78566"
FT                   /protein_id="ABV78566.1"
FT                   /translation="MITYKEFENVELRSGTITKIEEFPRAKKPAFKVLADFGAEIGTLQ
FT                   TSAQITKHYTSQELIGKSIVGCVNLGEKNIAGFLSQFLLVGFPDSNNDICLVTIDPKVP
FT                   NGQKLC"
FT   gene            154129..154740
FT                   /locus_tag="A1I_00835"
FT   CDS_pept        154129..154740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78567"
FT                   /protein_id="ABV78567.1"
FT                   /translation="MKPKNIFSSICFISIFLFILLWQDLKINNEVAEDIGNCLYKSNYK
FT                   NLELNSREGDFNISYIPNAPRNCFNPSFPIIHIKLKQEHNAWLQIVRTDSSDKKLQKFI
FT                   DTNLELHPFYTLEQDFYDAPLWYYTLFSKPLTYWTAHTYAVKIDNQNKTIKIIGGIKWG
FT                   FRLAYFPIKPQMILPSSLDTNDWQVDVEVFKQALVGYKID"
FT   gene            complement(154755..155003)
FT                   /locus_tag="A1I_00840"
FT   CDS_pept        complement(154755..155003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78568"
FT                   /protein_id="ABV78568.1"
FT                   /translation="MFKNLLFILTILSISFNVYAINNRAYTTSDIVKIAIVLGIVALIF
FT                   SPAKFRIIVIGTALGLTLAYYTYKYIVPIFISSLNGP"
FT   gene            complement(155005..155760)
FT                   /locus_tag="A1I_00845"
FT   CDS_pept        complement(155005..155760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00845"
FT                   /product="Ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78569"
FT                   /protein_id="ABV78569.1"
FT                   /translation="MSVEEIKIKIRSLYKSFNGHKVLDGIDLDVKKGSSLVILGGSGSG
FT                   KSVLIKNIVGLIKPDQGQIFIDGAEIQNISSKKRFEIMKDIGFLFQGGALFDSLNVRDN
FT                   ITFDTNKLSKKEKNDLAGAKLDSVGLSPRILDLYPSELSGGMQKRVALARAICSTPSIL
FT                   FLDEPTTGLDPIMANVINELIIKIQEELGATTITITHDMISAEKIAKEIAMIYQGKIKW
FT                   YGSKDEMRNSNNPYLKQFINGLTTGPIEV"
FT   gene            complement(155767..156546)
FT                   /locus_tag="A1I_00850"
FT   CDS_pept        complement(155767..156546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00850"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78570"
FT                   /protein_id="ABV78570.1"
FT                   /translation="MLLNIANSIGKRTIRLAQSIGKFSIFSLAAITSIIRPPLYFSLII
FT                   KQLLFIGFYSLPVVAMTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLA
FT                   GLMVAGRVGASIAAEIGTMRVTEQVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIGD
FT                   VIGVMGGYLVGVYKLDFNSSTYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV"
FT   gene            complement(156805..158037)
FT                   /gene="alr"
FT                   /locus_tag="A1I_00855"
FT   CDS_pept        complement(156805..158037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="A1I_00855"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78571"
FT                   /protein_id="ABV78571.1"
FT                   /translation="MSLCTLEINLSAIKANYRLLKNICENSVDFLHNVANKEEFAGNTS
FT                   PRTAAYTLVREDASLGSTPKLPLGASYAKNLLVGAAVKANSYGLGAIEISKTLLEENCR
FT                   YFFVASSNEGISLRKAIGDEVNILILNGVFEHDALELIEYNLIPVLNNLNQIKIWQKFS
FT                   NLKNQLLPCYLHFNTGINRLGLNHNEIEQLINNRDLLKGLNVEYIISHLSASEDSDNPY
FT                   NLEQLNKFKAYLEYFPNAKASLANSGGIFLGKDYHFNLVRPGAALYGLNPLGSNKPNPM
FT                   QNPVTLKAPIIHLQNLTYGSRIGYNMTFTTKRDSLIATLPFGYADGFSRNFSNQGTVFI
FT                   NSRNVPIIGRISMDLVNIDVTDLPPSDIFLGQEVEIIGNNCTPDKIADIIGTIGYEILT
FT                   SLGNRYKRIYT"
FT   gene            complement(158060..158905)
FT                   /locus_tag="A1I_00860"
FT   CDS_pept        complement(158060..158905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00860"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /note="COG0462 Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78572"
FT                   /protein_id="ABV78572.1"
FT                   /translation="MKIIADSSNKLLATRLAITLNIKYIEPKITYFSDSEIKLEIQEPL
FT                   HNEDIIIVQSTSKPINDRLIELFLLIDTAKKVGANKIILVMPYFGYARQDKISNQAAMP
FT                   AQLIANFLEKLGVTHLITIDLHSDKIERFFNIPVSNLKPIELYLPFLQNYKNCIIVAPD
FT                   KGSINKVESIGNLLNVDLAYITKERDVNNSCNMVEITGNVEGKNCILIDDIIDSGETIY
FT                   KAANFLKQHGALSVNAFITHAVLSKNYDIALLDRIFVTDTIETDDLSSKFHIIPIYCLS
FT                   "
FT   gene            complement(159021..160031)
FT                   /locus_tag="A1I_00865"
FT   CDS_pept        complement(159021..160031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00865"
FT                   /product="hypothetical protein"
FT                   /note="COG0228 Ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78573"
FT                   /protein_id="ABV78573.1"
FT                   /translation="MNSDEMWEQGKIIHAEAYRQQEYEKQRRNGGNSSSNDGELLGTLI
FT                   VIGCYAAYQGAKFAGKAAIAGGKMAVEGGKIAGKTVINARKLHKGEVEIVNTDNQGNII
FT                   EKAPEYSPTLTGSQESPTFSKREKVKEWIGKGIKKSRSASELLTSAYKLTTSTTEEVVT
FT                   DAGDKTKVIIKPNTVNTEDHKIRPLINKQNKYYGEIQEDTINTMLKYRFNGNKIVEVTK
FT                   YKSFTIPSTILPGEKFELRFELNCPNGEKIRTDDTAYLQVNYDISGKLVKLAIPNQPVV
FT                   CHNPSYPALIAYHNELYVLPVNSGHYNYLTYKVHENGGVVEIGNADPGYHIEAIS"
FT   gene            complement(160143..161399)
FT                   /locus_tag="A1I_00870"
FT   CDS_pept        complement(160143..161399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00870"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78574"
FT                   /protein_id="ABV78574.1"
FT                   /translation="MMRLYYFLSFLLLPIYFVIIFIRLLIGKEDIRRVKERFAIGKHRQ
FT                   DNRFLIWIHAASVGESMIALNLVDNISKHFPEVRFLVTSWTQSSAKILSTKLPKIATHQ
FT                   LLPIDNIIFTKIFLNNWKPDLGIFIESELWPGTINEAAKQCKLLLVNARMSDKSFESWK
FT                   KRKGFFQLIVKNFSEVIVQSERDLQKFNELGISNTTNLGNIKFANEKLPVNQEELIKLS
FT                   EHLKNKQVILFASTHPEDEEIILPIIKNLKKQVIDCYIILIPRHPERIKSILDNCIAQD
FT                   LSATAKSQNDLPVLTDDLYIVDRFGEMGLFFSIASISFIGGSFKQGGHNILEAAHFSNC
FT                   IIFGPDMSKNTDIAKGVLQSKAAIQIKSGEELLNMLEYLLDPNNSRELKNYQENSLKFV
FT                   ERNQKILDEYLQIITKFFP"
FT   gene            complement(161396..162052)
FT                   /locus_tag="A1I_00875"
FT   CDS_pept        complement(161396..162052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00875"
FT                   /product="hypothetical protein"
FT                   /note="COG2121 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78575"
FT                   /protein_id="ABV78575.1"
FT                   /translation="MRKAFKKFLKRNKFVLSLITILLYWYLRFVYFTSKQKFIFYDDGN
FT                   KEKFLNEQGVIFAFWHNMLALSPAMFKGMPDVYALISPHLDGKILNDLVDKFGCKVIVG
FT                   SSNKNPLGALRNIIEKLSQGANVIITPDGPKGPVYRVNSGITEIAYKYNKKLIPVVSTT
FT                   SRCFRLKSWDKLIIPLPFGTIKVIIGSPLELTDNKVQNHMNLEKYLVNLTENLIK"
FT   gene            complement(162214..163413)
FT                   /locus_tag="A1I_00880"
FT   CDS_pept        complement(162214..163413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00880"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78576"
FT                   /protein_id="ABV78576.1"
FT                   /translation="MSIISTRLNAIKPSPTLAVVRKTLELKRAGIDIIALGAGEPDFDT
FT                   PDNIKEAAIKAIKDGFTKYTNVEGIPALKEAIQAKFKRENNIDYDLEEIIVSTGGKQVI
FT                   YNLFMASLNKGDEVIIPAPYWVSYPDMVLLAEGTPVFTNCGIESNFKLSGEALEQLITP
FT                   KTKWLIINSPSNPTGASYSHSELKNIAEVLRKHPYVNVMSDDIYEHITFDGFKFYTLAE
FT                   IAPDLKDRIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQVAAV
FT                   EALNGVQGYIAQNALNFEKKRDLALSILQRVKYFECYKPEGAFYLFIKCDKIFGAKTKS
FT                   GKVINNSNDFGEYLLEEAKVAVVPGIAFGLEGYFRISYATSMEELEEACLRMERACGSL
FT                   "
FT   gene            complement(163476..163619)
FT                   /locus_tag="A1I_00885"
FT   CDS_pept        complement(163476..163619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00885"
FT                   /product="hypothetical protein"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78577"
FT                   /protein_id="ABV78577.1"
FT                   /translation="MKSITDEDDESTKETLYLLSNSVNAKWIQESIKQAEKGEFIEVDL
FT                   DD"
FT   gene            163698..164711
FT                   /locus_tag="A1I_00890"
FT   CDS_pept        163698..164711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00890"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78578"
FT                   /protein_id="ABV78578.1"
FT                   /translation="MLSKIKDKIKHFCLTIINIPNFIKNKILEFKKYLNDCKYKMNHLS
FT                   ETNYELGLEHLYRGNLNDALLRFKLVDNFFSPNDSRVYYQLGWTYFLKNDYPKAIKYLE
FT                   KSNEKYKAIFINFLKNYKNATEIPVEIWGKYRDLTAKNYPSIFNNDKNIHLPYRFVNES
FT                   LKQITDLPDDYSILELGSNIGLVGYELEKRFPESFTLTAVEISNLMNDIQEEYYANLKI
FT                   YDQIYNISINEFLKQNSNKFDIILSFCGLTFTKDLSAYFNAIYSSLNQGGYFSLCLPTN
FT                   LDTHFSVKRKEFIFNLSEINNILQKNNFVILTSEEIILAENNKYGIIICKKTENKS"
FT   gene            164708..165475
FT                   /locus_tag="A1I_00895"
FT   CDS_pept        164708..165475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00895"
FT                   /product="VacJ lipoprotein precursor"
FT                   /note="COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78579"
FT                   /protein_id="ABV78579.1"
FT                   /translation="MRILIILSIILCSLFTKADLEYVDDDIYNYNGSSNINGCREVYDP
FT                   YEKFNRKIFAFNSVLDYIFLRPLAVGYKNLTNDYMKARVNSFVGNIDMPLTAVNYGLQL
FT                   NYDKTMKSVWRFIINTTLGIGGLFDVAGKVGLSSDRQTFGNTLAHYGVGPGPYLVLPII
FT                   GSTNARDMTDPIFTNYALNPLMYYTHKDFELSVLAVSKINDRYNVLSFSDYVMKNSLDP
FT                   YATIRSALHQAREASVQYPKNFKCPKPKNVNSN"
FT   gene            165487..166071
FT                   /locus_tag="A1I_00900"
FT   CDS_pept        165487..166071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00900"
FT                   /product="ABC-type transporter"
FT                   /note="COG2854 ABC-type transport system involved in
FT                   resistance to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78580"
FT                   /protein_id="ABV78580.1"
FT                   /translation="MQKIITSLFLLIFTFSSYADDNAPAGLNDYVTNLVNEASTTLNNP
FT                   NLSQDAKVAKARELMHNNLDFDWMARYTLGRNGVQTLSKEQIAKFTEVYSKYVTKAYTD
FT                   LIKDYKGEKPQVTGVHVLSPKDSMVSMNINNKGQDIKVEYLVRKMENGKFKVSDVITEG
FT                   VSLIGAQQQDFTSTLKDQGFDALVQSLQSRS"
FT   gene            complement(166164..166328)
FT                   /locus_tag="A1I_00905"
FT   CDS_pept        complement(166164..166328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00905"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78581"
FT                   /protein_id="ABV78581.1"
FT                   /translation="MSARNSKTSGLRLFYERLINNGKKKMVALTALMRKIIVIANAKLK
FT                   SLLFNLKHS"
FT   gene            complement(166315..167121)
FT                   /locus_tag="A1I_00910"
FT   CDS_pept        complement(166315..167121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00910"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78582"
FT                   /protein_id="ABV78582.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETTGGYELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKA
FT                   LGLYGKERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSC
FT                   INMIDVLSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKL
FT                   TRRQIASLAGLAPKANDSGKYQGYRKVGHGVEQESSYTIPCCYVSP"
FT   gene            complement(167496..169187)
FT                   /locus_tag="A1I_00915"
FT   CDS_pept        complement(167496..169187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00915"
FT                   /product="bifunctional N5-glutamine
FT                   S-adenosyl-L-methionine-dependent methyltransferase/tRNA
FT                   (m7G46) methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78583"
FT                   /protein_id="ABV78583.1"
FT                   /translation="MQYSIQKFLNEGAYKLQHIGINNPKLEARILLQHAINKPYEYLLA
FT                   NPEKQLNQLEIEAVEKVLERRLKHKPIAYILGTKEFYSREFIVNKHVLIPRNDTEILID
FT                   VVLQYHSQHFQYHSQHSLCHSSNGGNPDKKQLDSVVKPRNNIKSSNILELGTGSGCISI
FT                   SLLLELPNSQITATDISIDAIEVAKSNAIKHDVTDRLQIIHSNWFENIGKQKFDLIVSN
FT                   PPYISINEKPEMAIETINYEPSIALFAEEDGLLSYKIIAENAKKFLKQNGKIILEIGYK
FT                   QADQVSQIFLDHGYVIDNIHQDLQSHNRVIEISLIQLNRSYARRIGKSLSGIQQNLLDN
FT                   ELPKYLFSKEKLIGKNYNSCKIKSNYTKFNLEKSKESVSRGAERIKIREHLRTYKEDVA
FT                   NFSSSTSIFLEIGFGMGEHFINQAKMNPDKLFIGVEVYLNGVANVLKLAEEQNITNFLL
FT                   FPNNLDFILHDLPNNSLDRIYILFPDPWIKNRQKKKRILNKERLTILQTKLKNKGSLIF
FT                   TSDIENYFEEVVELIKQNGNFQITNEDNYSKPHDNYIITKIPPKSY"
FT   gene            complement(169190..169609)
FT                   /locus_tag="A1I_00920"
FT   CDS_pept        complement(169190..169609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00920"
FT                   /product="Toxin of toxin-antitoxin (TA) system"
FT                   /note="COG4113 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78584"
FT                   /protein_id="ABV78584.1"
FT                   /translation="MNLVVDCSFIMSSILPDESAQKNNKIYDQITENIYTLYVPSIFYL
FT                   ECNNVFINSLKRKRINKNDYDDYIKSLNLLPINVDKFCSTPESLYTIARLATEHNLTSY
FT                   DACYLELALRLEADILTLDKSLIASCQALGIKLVI"
FT   gene            complement(169606..169848)
FT                   /locus_tag="A1I_00925"
FT   CDS_pept        complement(169606..169848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00925"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system Phd"
FT                   /note="COG4118 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78585"
FT                   /protein_id="ABV78585.1"
FT                   /translation="MKTIGMFKTKTHLPELIKDVEAGEELCITNRGRKVAVIIPIDKYY
FT                   KKKYANIFQEFAELKKRAPLGSVDEILEMKNLGRK"
FT   gene            complement(169913..170851)
FT                   /locus_tag="A1I_00930"
FT   CDS_pept        complement(169913..170851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00930"
FT                   /product="Ribosomal large subunit pseudouridine synthase
FT                   RluD subfamily protein"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78586"
FT                   /protein_id="ABV78586.1"
FT                   /translation="MLEYSVPTELSGLRLDKALSQLLENVSRNQIQKAIKSSCVQINNV
FT                   IILDSDILVKENDIILFSFKEPEELTIEAADIKLDIVYEDEDLIVINKAAGMTVHPGAG
FT                   HHDDTLVNALLHHTRNLSDIGSSERPGIVHRLDKDTTGLMVVAKNNKAHMLLANQIEQR
FT                   QVVRKYKALVWGVINPLEGTIKNNIGRSRSDRQKMTILKYGGKEAVTYYKTLELFYGGS
FT                   ISMVECKLATGRTHQIRVQLSHLKHSVVGDQIYGNNDRKINHAPPELKAKLLDFKRQAL
FT                   HSWYLSFTHPTSNEVMEFSCELPKDMEGVIK"
FT   gene            170866..171657
FT                   /locus_tag="A1I_00935"
FT   CDS_pept        170866..171657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00935"
FT                   /product="Uracil-DNA glycosylase"
FT                   /note="COG1573 Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78587"
FT                   /protein_id="ABV78587.1"
FT                   /translation="MNNNTFKWLNAIGVEYYCSEHPPKLKVSDNTKLAEKPQAKPTPQK
FT                   ENGFNMNDKTHDNISLARSLADKANNIAELKESLLNFNGCDLKKLATNTVFGDGNPAAK
FT                   IMLIGEAPGSNEDLKGIPFCGESGNLLDNMLRAIGISRKDNAYITNTVFWRPPANRQPT
FT                   LEEVDVCRPFVEKHIALVNPKLIILVGSTAATSLLGKNAGITKIRQEYYFYTNKYLAAP
FT                   IQTTAMFHPAYLLRQPSQKRTSWYDLLKIKDYLESKNLVTG"
FT   gene            complement(171775..172536)
FT                   /locus_tag="A1I_00940"
FT   CDS_pept        complement(171775..172536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00940"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78588"
FT                   /protein_id="ABV78588.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(172542..172730)
FT                   /locus_tag="A1I_00945"
FT   CDS_pept        complement(172542..172730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00945"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78589"
FT                   /protein_id="ABV78589.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            173161..175578
FT                   /locus_tag="A1I_00950"
FT   CDS_pept        173161..175578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00950"
FT                   /product="VirB4"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78590"
FT                   /protein_id="ABV78590.1"
FT                   /translation="MKLFRTRAANELRAKQDRPTSHFIPYKCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMASGNIVVYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILYKPDTGGAAIVEYFLKKLRQKSNK
FT                   NVWENDMKEMKENLQEMSNRIVNTFRSYGARILGVRKTPTGNYCEMLEFLSSLVNCGDS
FT                   PGPVALPRSTIDEYLPTHRLFFDSRTIEARSSIGTKYAGIISILEYGPTTSAGIFDGFL
FT                   QMPFEFVMTQSFIFANRTVAIGKMQLQQNRMIQAGDKATSQIAEISTALDMATSGDIGF
FT                   GEHHLSLLCSANSIKALEDILSMASVELSNSGIQPVREKINMEPSYWGQLPGNMEYIVR
FT                   TSTINTLNMASFASQHNYPIGKVRNNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQ
FT                   LEDTSENRTFILEWLRVLVTSNGESITAQDNKILSQAVSGNFRLEKKDRRLSNVVAFLG
FT                   IDTPDSLASRIAMWVGNGSHAKVFDNEVDDIDLQKARVFGFDMTELLKDPISLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSRISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLVKQGVDA
FT                   VVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDPEKWLPIFYEAVKTL"
FT   gene            175772..178891
FT                   /locus_tag="A1I_00955"
FT   CDS_pept        175772..178891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00955"
FT                   /product="VirB6"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78591"
FT                   /protein_id="ABV78591.1"
FT                   /translation="MKLFPRTLLKILVVSFILNFGVTSKSYADDTLDTIVNTLQNLTCE
FT                   TQGVGDLLRTEFSQTCIVAPFFTFAIMNLVSPVLYMNTFLKLRINDNELFGTQFPGGQC
FT                   MRENRADPNDLKLTFGLCSNLKLAGVRAKAVVDSALAIAKAVLTGNDPWDDIKEAWKNN
FT                   KADYYNIYTQKPEDSGTMWDLGVPIFWKVVQDNDRICVGTYGFTGVVPVGCKYIKEPFP
FT                   KSMYNSFMDVNDTNFIDDPNNKAVDPLALVSCSAAGGGCYQKAYNASRTAVVMTSPLIE
FT                   CIRQMIARLLISEDVCSFDDVNAVVNSASRQTSALFQFQVGMYRIVTAFLTLYVMLFGA
FT                   KILLAGQVPPKNEYINFILKIIFVTYFSIGLNITPGSTSPYDRMDGMIQWAFPFLLNGI
FT                   NGLASWVMNAAPSGLCKFNGPDISYDNSVAYIALWDALDCRVAHYLGLDMLSTLLVENT
FT                   YKSHNFANFDFFSFSAPPYIYLLIPAIISGNMMLVSLALAYPLLVISVAAFMVNATVMC
FT                   MVSIVILGILAPLFVPMFLFDYTRGYFDSWVKLMISFLLQPMVVVTFMITMFSVYDFGF
FT                   YGKCQYQSKLIHNSIEGALQGQTFKRDVLVFFVDNDWTKYSKEDAESCQNSLGYMLNNP
FT                   ISTAFNFAKDSVEQIVGSKPNQTCDPKAADADTKCNPKPGDSSTSSFLSKFQFLSGVIL
FT                   GPGMFFVSPKLLFEKIKDILLALVTACFTLYLMYNFSSQLANFAADMTEGVALSSVAIK
FT                   PQAVFKAAMAALAAAGNATKGLDQFATKGGGGGDLLSTKGGRAGDLVKGSGGGGGSEGG
FT                   DSFTSGGLRETSSTAATPSSALSSVGKSVGGTATPSSASEEMLDTSFSNRKPIEAPVSQ
FT                   PTTVSTQIDTAIKTEPPKVSAAEVVRNTAEDKLEDLSSKLNVTKEIKEAVPESQKEEPK
FT                   EPRVKHTTEVEPELNLDENLGVTRTIRGLDKDRKFTEQESHELKIGEAGYVKQEMRNAQ
FT                   IRDRRAAFEKETEELYRSGGGRAKDKATERNDGTIENRSKKIDSGSDENP"
FT   gene            178878..180902
FT                   /locus_tag="A1I_00960"
FT   CDS_pept        178878..180902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00960"
FT                   /product="VirB6"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78592"
FT                   /protein_id="ABV78592.1"
FT                   /translation="MKIHNIIKIIIVVCLEGFALTSFAGFGDSCASLPTTTDGYLESDT
FT                   AYGYIIRSIDMKAPGGNCDANKPGITFCFKNKDGSSDPCTMYTLNQGDSKKISDLSKDN
FT                   NPDLGANPILKNIVLTVQTWQNDICLLMPTSRGPMPVACKALSNPPAPPPVDPSCSNIG
FT                   QSCYTGANYSQSLINFSGLAVQCLKETLDKIFFVGNSCGSQSQSSEITNLTAFPTFQGY
FT                   LKNAIGAALILYVMFFAFNMVLNKEYGNPDKIALFVIKLLFVTYFSIGLGPLNFNSSQP
FT                   TQENGMLKYGLPLLTGIAPEFAQIIFNAAGSKGLCVFDTSKYQSGYQFYALWDSIDCRI
FT                   GYYLGLDLLYNIDKNGVLSSFARGDGGNSSGSIPIPNLGNPDKNSPNALTSVGSLRFFT
FT                   VMFGFFMAGNVIILISGLVFAVIFLSILLYFITHYLVCMITIYVMTYVSPIFIPMMLFN
FT                   RTKGYFDGWLKVSLSCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKNNVKFSTF
FT                   ELRLPASSAEVCQESFGYKMLNYYAGKGWEEHLVILFPIKSIAKDVVSILAELLCVLVF
FT                   SVIFYYFSKSISQFAADLTNGPKMDAVTASPTKIVDLVKQGAAFIKDAAQATQGKPPSG
FT                   GDMPGDGGSKRSEGQKGDDSFISSGGNSSGDSLSSSGGK"
FT   gene            180909..183776
FT                   /locus_tag="A1I_00965"
FT   CDS_pept        180909..183776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00965"
FT                   /product="VirB6"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78593"
FT                   /protein_id="ABV78593.1"
FT                   /translation="MQSSLIKILGVLAIVATLVCFVFAALGMIGAVSVGNGCYMRYAPG
FT                   GKGGSDSITSTITLNANANYVNTSTMLPDGTMQLTPDPAHYGEWLNTQVEVKDKQAVSL
FT                   QVVGQISLCLAYVPKDNLQFTESTRPGKSNLDDNGKMIPIPRVTDVNKPPLSLIMDAKN
FT                   NEWRNITEMYANDRILVSVTPNYSPGAGGTVGAMDAFKGTNVTADCSQGKTAYDPICGR
FT                   YSIYSGPYVNACELKQNYWQGNKKQKCPNGCVWGTIDWCYTTPSAWCTYYYVCDSLSAW
FT                   VNNYGTMPEPYKDDGTFTFSWASNSGGIFIDYANLQCSNNINIPPNGKCPDSVDDRSPK
FT                   DKDYIGGAGCTSGVCNGGEFQSQRRFWYTSDGNGGKGPTGLIWQISNTSNVDSTLPSTL
FT                   QFAQFVTASDQPTEYGNEYKVIYNIPFNSNTDKCYLQYRLWCPTSQDASKNTGGYVMNI
FT                   KQTKCYRENGNSLTDVFNNRGQVQYLVVPSAENPNTSGKNYSPEAAIVDSKGKANFNAA
FT                   GEGYIWMRVLNDPNDYKDSEGSYKVHFSTSQSVGSFTIKVMNPLLQLFKGKVKGAAESI
FT                   FRNIVCYGGDTSSCTNFFNYIKALLILYVMVYGAMFLLGFAKINQKDLVVRIVKIGIVS
FT                   GLMNGNTFEFFNNYLFDTIANFSDEIISNMSGYSLFNSNGTVSNPFMFLDAVMSRILFS
FT                   QTFMAQLLALLSLGLSGIIYFIITVIAVMIVIITAFRAAAVYIMAFMATCILIGIAPIF
FT                   ISFLLFDFTRYLFDNWVRFTIRYMIEPVVLMAGIIVLTQLFTIYLDFVLGYSVCWKCAL
FT                   PIKIPFIGTILPVALLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAYGMYGYV
FT                   EFSGNMVARLTSAAGPSATSMGGAMSGAAEQGALSQVGMDEKTRKGITGRAKERLKQRN
FT                   ETLKQAEKTRKNAPKEEPPKAEIPK"
FT   gene            186614..190087
FT                   /locus_tag="A1I_00980"
FT   CDS_pept        186614..190087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00980"
FT                   /product="VirB6"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78594"
FT                   /protein_id="ABV78594.1"
FT                   /translation="MNRNIFITLLISLLALSGCSGDTCIDPDDFGFIKFNISSRYDPSE
FT                   VTSRQEGDQVAPWRDSAYKVNGYPLTIMVRPWDYMSGDKNTSGMLSAWCPWYGQQNNFT
FT                   TLAEFCVRLRPCQFTDGKMCPTPTPRDAPINNAPCILTNGVGLYFLIADKGSNPNMSPD
FT                   SQRSPKGITQHLGEPVASQDYEFYSISSTGKFLQAGGINYQYGCTSLPCDQASNYAQSS
FT                   LYFKILDKFYDDNSGQYRVVIKSGVSDTRPDPLQFLTNLIKNELFGTSDKDPGIVRQTY
FT                   QQIIETPGYRLSVSALLTLYIMFTGFSFLIGNINMTHVELVVRILKVSVVSILLSTSKA
FT                   WTFFHDYLFVFFVEGLAQILQIVQDASTGQSLLSLLISPQTLSKLFSLLFVDPLGFIYI
FT                   ILYLIALYFIFLLIFKATIIYLTALITIGMIITMAPIFICFMLFNITRSLFENWLRQLI
FT                   SYAIQPIILFVGIAFIGMIIKTEIQSTLGFAVCKKDFPDLGPINQIFGSFTEDLDSSIG
FT                   NSIFYWWFPVPMKGGIENFTQADILVPEDYTKKDGTKCLAYQCIDKRYIQLPFLDLVKD
FT                   ANRISNFINGKFVQLDGLLLIFVSIYLLSKFNDTAISTASFIAGTSGNLTSIQAVNQQS
FT                   YDSIMKQVNRPINYATGVISKPINRMQEQTSMFFAEKYQGLMMSRLENKALSSSANKAV
FT                   QNEVKRKYGIDHKDVNMQAGADYKNGISKLLDNKTFLPKGGDLDVKKLATMNFGQLRDE
FT                   FAKNKYGAKNYSSLTSDQKLELDKFMKSDLGEKGKSAKSLRELASDANFTRDYQSAYKY
FT                   AHKEMSGRGVGLFGKNIGVLRSWQEMENRMKTKRELKEQKRVAIGEKIYAGYTGLKRDA
FT                   LTAIVGKDLRDKYEGNLTSAEWHDFDYNDPQLRTYSESLKDKERAREVKELQMQINKET
FT                   LAVQEDILSPEYLARLKRPSDVEYYQELGQRRLIHEVRDRLSEGSDPVIMGDRFMQEKA
FT                   TDDQMRTMIDNAHQKHAEFIDQDRYTRRQEHYDIMHEKAQENIDRTYKEIKDHFKRDDI
FT                   KLEEMPALIAQYEREKPIESFDSKTELSLDKRIEEAVSNFNINAKNYEYSASVLNNIEE
FT                   RKQAITDEVNTQIDRINKYRENAKMPQYQKPVENSGRKLRKLEDHLRNMK"
FT   gene            complement(190318..191343)
FT                   /locus_tag="A1I_00985"
FT   CDS_pept        complement(190318..191343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00985"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78595"
FT                   /db_xref="GOA:A8GU95"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GU95"
FT                   /protein_id="ABV78595.1"
FT                   /translation="MKKILGIESSCDDTSVSIITEDREILSNIVISQNTEHADYKGVVP
FT                   EIAARSHLANLEKAMKQALLESNTSLDEITAIAATSGPGLIGGVIVGSMFAKSLSSVLN
FT                   KPFIAVNHLEGHALTARLTDNIPYPYLLLLASGGHCQFVAVLGLGKYKILGSTIDDAVG
FT                   EAFDKVAKMLDLPFPGGPKIEKRAKLGDPYKYKFPKPIINSGDCNMSFSGLKTAVRTLI
FT                   MSLQEINDTIINDIAASFQFTIGEILSSKILEAIKVYEQITNDFNRNIVIAGGVAANKY
FT                   LQELLSNCTKIHGYQLIYPPTTLCTDNAAMIAYAGLERYNNGLFTPLNFCPKARWSLEE
FT                   I"
FT   gene            complement(191340..191657)
FT                   /locus_tag="A1I_00990"
FT   CDS_pept        complement(191340..191657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_00990"
FT                   /product="hypothetical protein"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78596"
FT                   /protein_id="ABV78596.1"
FT                   /translation="MILLLDELQKLATLSFADNPHVLHIRCGYQLQDALLFLKLIFVVL
FT                   ILFIYISIMKKSIKSNKYSNAEKETLYLLKSPKNAKRLKRAINDFEANKNFKTTSLQKL
FT                   K"
FT   gene            complement(191641..192726)
FT                   /gene="tgt"
FT                   /locus_tag="A1I_00995"
FT   CDS_pept        complement(191641..192726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="A1I_00995"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG0343 Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78597"
FT                   /db_xref="GOA:A8GUA5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUA5"
FT                   /protein_id="ABV78597.1"
FT                   /translation="MSKFSFNINHQYKKARSGIITTAHGNIRTPAFMPVGTRGTVKAML
FT                   PESVAETGADILLGNTYHLMLQPSAERIAKLGGLHKFMNWGKPILTDSGGFQVMSLSKL
FT                   RKITEEGVSFNSHINGDKYLLTPERSTEIQHLLGSTITMAFDECTPYPATFEEAKTSMQ
FT                   LTTRWAHRSREAFVKRDGYAQFGIIQGSTYEELREQSAKDLIELDFEGYAIGGLAVGEG
FT                   QELMFKVLDYAPDFLPQNKPRYLMGVGKPADIIGAVSRGVDMFDCVIPTRSGRNGQAFT
FT                   KYGTVNIRNSKYAEDNDPLEADCLCPACQNYSKAYLHHLVRIGEILGAMLMTWHNLTYF
FT                   QNLMSRIREYIALGKDFDFTT"
FT   gene            complement(192956..193069)
FT                   /locus_tag="A1I_01000"
FT   CDS_pept        complement(192956..193069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78598"
FT                   /protein_id="ABV78598.1"
FT                   /translation="MNQFYPVMALFRGCQAVIANERSECGNLGKIIKNAIS"
FT   gene            complement(193118..193678)
FT                   /locus_tag="A1I_01005"
FT   CDS_pept        complement(193118..193678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01005"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78599"
FT                   /protein_id="ABV78599.1"
FT                   /translation="MYNVYLKLNILCNNQFLILSLLLIMNTIKHIDKIASERLKQRRIA
FT                   IGLSQKELGETLDISAIQIKKYEEGISTIPVSRLYVLAKILNTPLKHFFNTSISEEERL
FT                   NTDDNIFDNEIEYLSNEIDEHLLNNVAEEDEDYEYNIPFSREDLTRTLEREILSLTRAF
FT                   TKIQNPDVRKIIIELVRSLAICV"
FT   gene            complement(193728..195227)
FT                   /gene="lnt"
FT                   /locus_tag="A1I_01010"
FT   CDS_pept        complement(193728..195227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="A1I_01010"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="COG0815 Apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78600"
FT                   /protein_id="ABV78600.1"
FT                   /translation="MYKPKISCLLLGLLSGLVFAPTFLLPALLTLSYLCCLVQKSKDWQ
FT                   EAAKLGYIFGFGHFLSGIYWISIGVSVYISDFWWAIPFALFGLPIILAFFVSASCVFSF
FT                   FVRNNKYYHFIFCLYWVLFEWVRSWIFTGLPWNLIGYAFSFSDILIQSLNIIGIYGLSF
FT                   ILIYISTSFYPFFTKQFDQLKVLLLTSSITLAVIITYGSVRLHNHPTNFTDIKVRLVQP
FT                   SIPQTEKWSEEEFWHNLMLHINLSENSQPIDLVIWSEAALVVPYDIPVVKSELLGLLNS
FT                   VDATLITGGISDNKKRGEDFELYTAMYALEKNGNKLFEYHKSHLVPFGEYMPFKKILPF
FT                   KKLTHGFVDYTEGNGGLVYLDKYNLKIKPLICYESIFPDFVRTNNETADVIINVTNDAW
FT                   YGKSSGPYQHFHISRSRAVENGLPMVRVANNGISAIIDPLGRVIKKLDLNEINYIDGLI
FT                   PKKLDSPTIFSKFGNITILLIVFFIFLVNYLLDKKLINSRD"
FT   gene            195490..196278
FT                   /locus_tag="A1I_01015"
FT   CDS_pept        195490..196278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01015"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /EC_number="1.3.1.10"
FT                   /note="COG0623 Enoyl-[acyl-carrier-protein] reductase
FT                   (NADH)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78601"
FT                   /protein_id="ABV78601.1"
FT                   /translation="MTTGLLQGKRGIITGIANNMSISWAIAQLARKHGAELCFTYQSEI
FT                   LEKRVKPLAEEVGCNFVSELDVTNPESITNLFAEVKEKWGTFDFLLHGMAFSDRNELKG
FT                   RYIDTSLGNFNNSLHISCYSLVELAREAEKLMNDGGSIVTLSYYGAEKVIPNYNVMGVA
FT                   KAALEASVRYLANDMGENNIRVNAISAGPIKTLSGSVIGDFNSMLRSHAATAPLKRNTL
FT                   QQDVAGAAVYLFSQLASGVTGEIHYVDCGYNVMGSNKIVG"
FT   gene            complement(196594..199563)
FT                   /locus_tag="A1I_01020"
FT   CDS_pept        complement(196594..199563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78602"
FT                   /protein_id="ABV78602.1"
FT                   /translation="MLDLKSLNTILFSNKESELKIAIKKISDQFEPEKAKNILAYAKTY
FT                   NSNLLTEVDKLSKIVSDEEIINQFYNSETISPFFGFSSFKHLEEAKKSISQVQINTVKK
FT                   NYSKLEIKNKELANAKKSSNSSVAQKLEQEIGKLQASLNNSPSQTALKILQHDIAKEQY
FT                   VKSFKLSKLVADYIEENNTFHVGLKDHLIHKHAYDIIICLGGEVTQNQDIIAKLQNFLS
FT                   DKGFLRATKPLHDAFSDFYLPKNKQNITLKKWQELISKHGFDAMKLFAIADRIEAKKAQ
FT                   NTEMQYIAPENLQDAIFIQTQLTYAKANEYSELAELALKYKLSEESFNRCLEIEKQKKN
FT                   FDNLPNITIHGKDLDCKLESGTSLNGYHLVKLPINDPRAYILGDIVKDCQSIGGNSERC
FT                   VIDGITRENNGFYVLLKNKNSAKQNAEIFTSDGKIDYQNFDIVGQAYGWLSNSGNLVLD
FT                   SWENLRNEDEATKALNDDETIIPILQEFAKQVCNTTNIDRVVVGLGGKTPKKFKELEIK
FT                   FPEIILEGFSYGDAKEQALIWQKPELTELENKINGYITKTEYKFELNRIDRAKALLDLI
FT                   ENEPNFSDFLNNSNHNLLKLLNLSAVSTDLKNFNYEYFKEFSNLNLNIIKRLVDDNRAL
FT                   EGYSKKFFTLEKLKDLPLDKIKILTQRHKFNSYEQNIFNFDDLKDLNIEEIKLLTSSTS
FT                   IEGYENKYFTFNDFKGLNTKKIKALRGEEAVNGYSYFIFDELKNLDTALIKMLVSDEAR
FT                   SGYLDKYFTFDDLKNLDIDLIKVLTDRNNFINKGYEKQLFTFNDLKVLNIDTLKILTSS
FT                   NILEGYEKQLFTFNDLKVLSSDKLKIATSPNIIDCYQLNYFKFKDFVELDVEKMQAIYD
FT                   NIRGCQRVLSEEHCTFNDLKNVDPNKIKALTESIVILGYKSKYFTFNGLKDISLEKIQT
FT                   LTSKEALIKYGSKDLKFEDFKASLEIADDHKTEMSEVSSFTDLVINNHEENVDIIGRDL
FT                   "
FT   gene            complement(200158..201840)
FT                   /locus_tag="A1I_01025"
FT   CDS_pept        complement(200158..201840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01025"
FT                   /product="Putative hydrolase"
FT                   /note="COG0595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78603"
FT                   /protein_id="ABV78603.1"
FT                   /translation="MSSFNIKNHKNDLLFIPLGGSNEIGMNFNLYHYKGKWLIIDCGSG
FT                   FADDYLPGVDMMIADSSFIEKHKKDIVGMIITHAHEDHLGGVQYLWNSLKCPIYTTTFT
FT                   ANFLKIRLSEYDFAKNIKIHEVKPGGKIDLSPFSLEMVPLTHSAPEMQAIMIRTEAGNI
FT                   LHTGDWKFDNDPVLGKKADEELLKSYGDEGVLALVCDSTNVFNKGISGSEGDVRKSLID
FT                   IIAGCPQMVVVSTFASNLARLDTIIHAAQLAGRKVALTGRSLHRIKLAAEESGYFKDIA
FT                   PLISERDVSRFRREELLIIATGCQGEPLAATAKLASNSHQSIKLAPKDTMIFSSKIIPG
FT                   NEKKIFRLFNIFVKSGVEVITERDHFVHVSGHPSVDELQKMYSLIRPNICIPVHGEPVH
FT                   IHEHVKLAKKNGIKQAVEVENGSVVLLEPNNAKVIAKVESGYLAVDGNYLLPVESPIFK
FT                   ARRRMRESGIVIASIVIDQKGLLAAKPILSMPGLLDANEDMQLINIIKNDIAELIKTQQ
FT                   SQAKKALSKEQIEEKIKSTIRKTLKQEINKSPAIIVNIEKAIE"
FT   gene            202044..202811
FT                   /gene="ppnK"
FT                   /locus_tag="A1I_01030"
FT   CDS_pept        202044..202811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="A1I_01030"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78604"
FT                   /db_xref="GOA:A8GUT7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUT7"
FT                   /protein_id="ABV78604.1"
FT                   /translation="MNMNKIALVYNENSKSSSSIEEIKKLYTYCDVEDADVIMVAGGDG
FT                   ELLHNIHRYMHLNIPFYGVNLGSLGFLMNPLDIKNILQNIQESTASTLNPLLMQAEDVD
FT                   GQIHKALAINEVSIFRKTNQAAKFRIEVNGVERMSELVADGALVATPAGSSAYNLSAGG
FT                   HILPLESNMLCLTPICSFRPRRWHGALLPSSASIKFEILNTNKRPVNATADFQEFSNIK
FT                   SVTIKSTNDKSIKLLFNKNHTLEDRIIKEQFGG"
FT   gene            complement(204386..204499)
FT                   /locus_tag="A1I_01045"
FT   CDS_pept        complement(204386..204499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78605"
FT                   /protein_id="ABV78605.1"
FT                   /translation="MQEFKINSASVAHMATQVRVKQLATRDSQYISTSLYS"
FT   gene            204588..204680
FT                   /locus_tag="A1I_01050"
FT   CDS_pept        204588..204680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78606"
FT                   /protein_id="ABV78606.1"
FT                   /translation="MKSLQKNKLVYTMRSKNFNVKNMERKINSF"
FT   gene            204784..206685
FT                   /locus_tag="A1I_01055"
FT   CDS_pept        204784..206685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01055"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78607"
FT                   /protein_id="ABV78607.1"
FT                   /translation="MLKEIGFKDYLRITQNLNAPELALEFANLAITRIANKKNHLLKCL
FT                   LENYPYEKLKNHKLFIDYEISEDGSYLEHKFSKSVIFFEYKSFSNSSCLQDKIFNNFLA
FT                   KKSSFYLAAIEQNIQLMEAVFVDIFKTGHIVLNLLNTIDQEKYKTAFHFIIEIVHFVKP
FT                   EFQFDIIKQLVDTIAEDFNVLATLTNVLLELEKDEEIITLLEPKLLNIKNNVIPEEDGI
FT                   IFCRFNLSLAEKQLLHFLKTEPDDKDALYNLFNIYLTQQKLDKAKDLTKNSPKDLKILM
FT                   EMSLDLAEISTIKLNSINQDELPATSKSQFRCFEYIAKFNSYNDSERDSNYENLKEELI
FT                   EIDKVIDYAVLSFTTAIYTKQYELAAQFAKKIPKNIITPYIEKTRFLLTPVEYISEVHI
FT                   EELRSKFDLSQEDAIDLVIQVSSCLVADEQYKLALEKIEEILLLEPQNYSAIEIGLSAA
FT                   ELINNQEKIQEYSVLLHEKYEKDFINDIQNTHKYYRSIKELNLRHAINNTNSNVSKWII
FT                   KEGEINKNDAISLGKYKGLDCYGRISTDIKCDSTQYNEFINALEKGIIYKQQGNNGVKF
FT                   LKENAVEIKINGGNRLYTNILNTNPQGELLINFDHFGNHKDVIKFAGEHSLEFHEAF"
FT   gene            complement(206687..207289)
FT                   /gene="recR"
FT                   /locus_tag="A1I_01060"
FT   CDS_pept        complement(206687..207289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="A1I_01060"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78608"
FT                   /db_xref="GOA:A8GUU1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUU1"
FT                   /protein_id="ABV78608.1"
FT                   /translation="MNDNNNEIDQLIYLFSKLPGLGSRSARRIVLYLLQDKDVRLKTLI
FT                   NNLTEIDKKIVKCQVCGNMDTENICGICTSEYRDKSVIAIVETVAELWAMERSGNFKGL
FT                   YHVLGHNLSAASRQNPSILRLPELLDRCFKENIKEVIIATNSTLEGQTTAYFITEYLKD
FT                   HPAKISRLASGIPIGGELDYLDEGTLSAAINLRQPFE"
FT   gene            complement(207317..207811)
FT                   /locus_tag="A1I_01065"
FT   CDS_pept        complement(207317..207811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01065"
FT                   /product="RDD family protein"
FT                   /note="COG1714 Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78609"
FT                   /protein_id="ABV78609.1"
FT                   /translation="MKKQIIYPDFIARIFSTALDLSLFAFIAIPILQFCFFYLMVFFYR
FT                   DYFQSYNIDLHNQSEVLKSVMSQEFYEYLKAGNFNKYILFNVSILLINLTVIGSYFIGF
FT                   WYYKGATIGKIFMRMKIVDANDFNRPTLKQLIKRFLGYMTFPIGIFFILFSSQNKHYMI
FT                   K"
FT   gene            207870..208295
FT                   /locus_tag="A1I_01070"
FT   CDS_pept        207870..208295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01070"
FT                   /product="hypothetical protein"
FT                   /note="COG1238 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78610"
FT                   /protein_id="ABV78610.1"
FT                   /translation="MEQFEAFSLLFVDSFVSNLVIGFQRELIFHSMKMFGNYSYPIMFI
FT                   VATCASLSGNIVNYIFGKCALNIFYSSKNEQNILRHKNLAQLFYKYEIFILLLMAFPFW
FT                   GSFISLFSGFFKTKFSKFLGLGCLAKACYYIAELYII"
FT   gene            208302..208673
FT                   /gene="rbfA"
FT                   /locus_tag="A1I_01075"
FT   CDS_pept        208302..208673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="A1I_01075"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78611"
FT                   /db_xref="GOA:A8GUU4"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUU4"
FT                   /protein_id="ABV78611.1"
FT                   /translation="MKKLTSENSHRQQKVASIINEALIEILHRGKMLDPRLYDCPLTIT
FT                   KIIVTADLKIANCYFLPFNTKLTPQEITESLNNSKNAIRNFVTGKINMKYSPDIRFHYD
FT                   HGFDNALKVEQLLKDTNNI"
FT   gene            209059..209694
FT                   /locus_tag="A1I_01080"
FT   CDS_pept        209059..209694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01080"
FT                   /product="hypothetical protein"
FT                   /note="COG4395 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78612"
FT                   /protein_id="ABV78612.1"
FT                   /translation="MSPQIIELLIFAGIAFFIINKLITTLGATSDDDPAKQKSYFGEPV
FT                   IKDVTHSSNKSYEEEKDLPTAQDIKTFKNLIVEQNITAVVDGMETVHKRLNAFQPIKFI
FT                   NNAKIAFQMIIEAAYKNQTEELAELVDKRFLEEFEKISDSYGNFFDSTALNAKYSEIYT
FT                   FGNNIFIKLLFQGKNVVDKIEELKEEWTFTRNANTKEVDWFLSNIEKV"
FT   gene            209892..211928
FT                   /locus_tag="A1I_01085"
FT   CDS_pept        209892..211928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01085"
FT                   /product="Acylamino-acid-releasing enzyme"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78613"
FT                   /protein_id="ABV78613.1"
FT                   /translation="MNKLFYIIGTILIIGVFFMFQSKSTITGDDNQIIPRKVLFGNPDK
FT                   ARVSLTHDGKYILYIAPKDGVLNIWLAPSDDISKAEAITHDKGRGIWSYAKAYNNKNIL
FT                   YTQDFNGDENDRIYSYNIETKETKLLTPEKGVKAGLVGLSYKKPNEILIDSNERNPEYF
FT                   DIYKLNLDTLEKELIYQNDKFTNFVTDENLNLRFGSLLDKDGAVEYYELKDGKPQLFTK
FT                   ISMEDSFNTAILGFDASGETLYMLEGRDRNTSALKAINLATNSSEILAEDSKADIGLFA
FT                   VHPTKQTPQAVSINYDMVSYKILDKDIEDDIKYLQNLDRGDLIINSRTLDDKTWIIAYN
FT                   SDNSPVKYYKYDRTNKKAEFLFTNRKELEQYKLAKMIPVIIKSRDGFDLVSYITFPNDV
FT                   KLDENNIPDKKVPLIINVHGGPWARDSWGYDPEHQWLANRGYAVLSINYRGSTGFGKDF
FT                   LNAGNLEYAGKMHTDLIDGVNWAIKNNIAEADKIGIMGGSYGGYATLVGLTMTPDVFAC
FT                   GVDVVGMSNLLTHVQTKAPYLTPLLSIYKTRIGPWDTEEEKEFLRQRSPINFVDNIKKP
FT                   LFIAQGAHDVRVVQAESDQIVNAMKAKHIPVVYALYKDEGHGFAKPGNRISYYALAEQF
FT                   LAKILKGRAEEIGDDLKNANLILNDQENLNGAEAEKIIDKAVG"
FT   gene            212058..212261
FT                   /locus_tag="A1I_01090"
FT   CDS_pept        212058..212261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01090"
FT                   /product="hypothetical protein"
FT                   /note="COG3038 Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78614"
FT                   /protein_id="ABV78614.1"
FT                   /translation="MLLTNTENSYGLIAKLFHWVMSIMVILMLIAGFLMDDYIEPPLKW
FT                   QIFGLHEATGVLVLTLVTLRLL"
FT   gene            212676..212930
FT                   /locus_tag="A1I_01095"
FT   CDS_pept        212676..212930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01095"
FT                   /product="Transcriptional regulator"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78615"
FT                   /protein_id="ABV78615.1"
FT                   /translation="MSKSARVIVSSKGQVVIPKYIRNKLGLHSGSEVIINYKKNETLEL
FT                   LPIKKDIFSFFGKGKHKAKNGPIDVDEAISIAVIENDRD"
FT   gene            212917..213306
FT                   /locus_tag="A1I_01100"
FT   CDS_pept        212917..213306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01100"
FT                   /product="Putative nucleic-acid-binding protein"
FT                   /note="COG5611 Predicted nucleic-acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78616"
FT                   /protein_id="ABV78616.1"
FT                   /translation="MIGIDTNILTRTFLEDDEVQAKTAQNFLKNHVNHKIFISSYAILE
FT                   FAWVLKVKKFTRQEIYGAIINLIDNSGFIIGHQDIIISAAEKYIKGKADFADYMIISEG
FT                   ETNSVNNFVSFDKEIVQEIKSASYP"
FT   gene            213348..214505
FT                   /gene="sucC"
FT                   /locus_tag="A1I_01105"
FT   CDS_pept        213348..214505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="A1I_01105"
FT                   /product="succinyl-CoA synthetase subunit beta"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0045 Succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78617"
FT                   /db_xref="GOA:A8GUV0"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUV0"
FT                   /protein_id="ABV78617.1"
FT                   /translation="MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDKLNTKVYVV
FT                   KAQIHAGGRGKAGGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDI
FT                   LKEYYFSVVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGI
FT                   AYELGFKDHQVKQMKEIVKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNG
FT                   LFKHPEIMALRDQDEEDPLETRAADAGLSYVKMDGSIGCMVNGAGLAMATMDIIKLYGA
FT                   TPANFLDVGGGADRERVKEALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIG
FT                   IKVPLVVRLAGTNVEKGKEILSNSGLEIIPAHDLADAASKIVEAI"
FT   gene            214719..215594
FT                   /locus_tag="A1I_01110"
FT   CDS_pept        214719..215594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01110"
FT                   /product="succinyl-CoA synthetase subunit alpha"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0074 Succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78618"
FT                   /protein_id="ABV78618.1"
FT                   /translation="MAILVNKKTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   KTHLDLPIYNTVHEAKAKTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLD
FT                   MVRVKRALVGSRTRLIGPNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVA
FT                   QTTAVGLGQSTCVGIGGDPINGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFI
FT                   KHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADI
FT                   GKTMLDLLNG"
FT   gene            complement(215836..216795)
FT                   /locus_tag="A1I_01115"
FT   CDS_pept        complement(215836..216795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01115"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78619"
FT                   /protein_id="ABV78619.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETTGGYELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKA
FT                   LGLYGKERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSC
FT                   INMIDVLSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKL
FT                   TRRQIASLAGLAPKANDSGKYQGYRKVGHGRAGVKPIILFLAAMSARNSKTSGLRLFYE
FT                   RLINNGKKKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            217503..218555
FT                   /locus_tag="A1I_01120"
FT   CDS_pept        217503..218555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01120"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="COG0280 Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78620"
FT                   /protein_id="ABV78620.1"
FT                   /translation="MKKQHIINETFLDAILAKKLGTSYTPPKEINDPDFDEAAKHFINL
FT                   LVRADGFKPVKTAVVHPIDKESLLGAVRAAQFGVITPVLIGPQHKIEAVAKVNNVDLAN
FT                   YQVINVEHSHDAAKKAVELAKKREVAAIMKGSLHTDELMSAVVHKENGLRTERRISHAF
FT                   LMAVATFPKPFIITDAAINIRPTLEDKRDIVQNTIDLMHILKEDKQVRVAVLSAVETVT
FT                   SAIPTTLDAASLSKMADRGQITNAIVDGPLAFDNAISLFAAEAKGISSSVSGNADILVV
FT                   PDLESGNMLAKQLKYLGQAVMAGIVLGAKVPIILTSRSDPMDMRVISCVLASFIYNHSK
FT                   AKLHVQMKGS"
FT   gene            218557..219576
FT                   /locus_tag="A1I_01125"
FT   CDS_pept        218557..219576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01125"
FT                   /product="Acetate kinase"
FT                   /note="COG0282 Acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78621"
FT                   /protein_id="ABV78621.1"
FT                   /translation="MKNVILIANAGSSSLKISVFEIKDKKIKDKIYNIFLEKNDTKIVF
FT                   HINKKQESITEINGDAISAMIELFESWWKNQKDLHLIATGHRIVHGGKNFNKPVLVNHK
FT                   ISEDLKALIPLSPLHQPYNLKVLDLFLQKYKAVHHIACFDTSFHFTNPPIAKAFGLPKK
FT                   YYDKGIIRYGFHGLSYKYVSSHFKEMTKKDLSEKTIIAHLGSGSSLCAIKNGISLASSM
FT                   GFSVLDGVMMGTRTGSLDPGVVLYLLDHEKMTTTEITDLLYKKSGLLGISGESSDMRTL
FT                   LASNNPDAKFAVDLFVHRIVLEIGKLAAALEGLDCLIFTAGVGENSAIIHEMISDKLL"
FT   gene            219800..220048
FT                   /locus_tag="A1I_01130"
FT   CDS_pept        219800..220048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01130"
FT                   /product="Transcriptional regulator"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78622"
FT                   /protein_id="ABV78622.1"
FT                   /translation="MHIEYKVTVSENGRINIPTKIRDQLHISSGDQLMLVFDKELKLIP
FT                   LKNKIRAFQELVKSKNKNNISLVDSLIKSRKEEFDNE"
FT   gene            220041..220427
FT                   /locus_tag="A1I_01135"
FT   CDS_pept        220041..220427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01135"
FT                   /product="hypothetical protein"
FT                   /note="COG4374 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78623"
FT                   /protein_id="ABV78623.1"
FT                   /translation="MNKCILDSSALLALFNSEKGWEKVEELLPLSIMSTVNIAEVVAEL
FT                   DKKLAVSSIQSKEMIIAAINKIVPLDFDQSIEVGRLRKETKNFGLSLGDRACIALGLTT
FT                   GYTIYTADKVWVNLPLNCNIVLIR"
FT   gene            220432..220968
FT                   /locus_tag="A1I_01140"
FT   CDS_pept        220432..220968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01140"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78624"
FT                   /protein_id="ABV78624.1"
FT                   /translation="MDLNLDAEDESDKYNWELYHQFEEIVYKGSDAEIKKILDQFSIQD
FT                   FLHIPIIYQLISCKKLRLLKFLYKKGIPLTYEEWDGGNALHVACGAGGSLKMVKFLVEN
FT                   NILTNIHKKSEKFGDTPLTLAISYDHHDIVDYFKQKFNITSVTLKDLDVIIDRVKANYR
FT                   RYYNIKKYYENQSKK"
FT   gene            220968..222416
FT                   /locus_tag="A1I_01145"
FT   CDS_pept        220968..222416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78625"
FT                   /protein_id="ABV78625.1"
FT                   /translation="MSLIANKRKEKSLVKILFYKLLLAMVIIYLIILFYNYMDKLKIPT
FT                   LIKHSDFYNEDKYNRIQGIIDYVNALRNALYNQEELDQIIPQAQQVYFVDYYLSQVENG
FT                   GLTQYFSNSNFNGKQNNIVLKGLEDIKAYKNKEIFFQACQLLNNMDASLREEYLFSGMY
FT                   REEEVRQKPIIKEIHIELEKLTDLFFEINEKEEPILDLNFKYVEKIDNLKIIDDKLYDK
FT                   EIEAIVALVPNYDERKKYSEEQWLKNMPRYTKIARKLCSKYNLELLSINALSYGESLIS
FT                   EEKVKENYNNNIMFYHISTDQGYFYIIDFGKTSVLINGEDNQPIGKINNLEINFDQSNI
FT                   DINSFEIEKSTNIFKTPKWSIQLEENWKSEISEDCYSFFNPEGYGTLQISDYTKDTSIT
FT                   YDDVLDLVGFSYKEKTHLEVVKFGDFEGFQYVYVNTENTLWRKLWLKNDKILLFIIYNC
FT                   DINYEDHTVETTNKMLSSLKVITK"
FT   gene            222462..223268
FT                   /gene="trmD"
FT                   /locus_tag="A1I_01150"
FT   CDS_pept        222462..223268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="A1I_01150"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78626"
FT                   /protein_id="ABV78626.1"
FT                   /translation="MFPGTLGHSLAGQALQKNIWSYDVINIRDFGLTKHKNVDDEAYGG
FT                   GDGLIMRPDVLGNAIDHALSLNPGAKIYYPSPRGKVFTQGFAKEILRDIQLNSESFRQD
FT                   EFKEEPAEHIIIREQRRMPQNSLVSSLLNDAVNMIFLCGRYEGIDERVIEEYNVTEISV
FT                   GDYILSGGEIPTLTILDCLIRLLPGVLMNQNTLASESFEKDGEFEGGLECGLYTRPEVW
FT                   YNRKVPSVLLSGNHKLINEWKKEQSLMITKLRRPELLKDLRDKERS"
FT   gene            223272..223700
FT                   /gene="rplS"
FT                   /locus_tag="A1I_01155"
FT   CDS_pept        223272..223700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="A1I_01155"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78627"
FT                   /db_xref="GOA:A8GUW0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUW0"
FT                   /protein_id="ABV78627.1"
FT                   /translation="MNIIDRFEQENISKLIENKKIPDFKAGDTVKVTVKIVDRSVEKDG
FT                   KEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPVVHAIDVVKYGV
FT                   VRRAKLYYLRERSGKSARIKERHMHIAKKPKAKVAEAV"
FT   gene            complement(223968..224585)
FT                   /locus_tag="A1I_01160"
FT   CDS_pept        complement(223968..224585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78628"
FT                   /protein_id="ABV78628.1"
FT                   /translation="MRYNKNHEELDYLEMAKFLVGENIQIPDNLNELCSEGLVNRHPGK
FT                   NNIKNFLLSIKNLEKLYIITQNSDFINAYKTSNAEVQKAWNARISLSKLAKFIVEKFNT
FT                   ENSIDYKEYNLLREYSSLPKYKKEALKILLAQMNFNSDDLNKVDNFINNNFFEIAVIAN
FT                   NLQDSAFKLLVPTIIPQVTKYLQFENASIKIAGNIIENAEVI"
FT   gene            complement(224612..224989)
FT                   /locus_tag="A1I_01165"
FT   CDS_pept        complement(224612..224989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01165"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78629"
FT                   /protein_id="ABV78629.1"
FT                   /translation="MSLVQQQYSNYKLDGILQEAARHDLLPVIENYITRGGNLHIVVLD
FT                   ECGEKVNILNVAAANNSVTVINYLLDNNIFNVDQRVSENSRTALHSAVKENAMESTKFL
FT                   LKKEQILILNLNINISDLKVK"
FT   gene            complement(225225..226154)
FT                   /locus_tag="A1I_01170"
FT   CDS_pept        complement(225225..226154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78630"
FT                   /protein_id="ABV78630.1"
FT                   /translation="MASFDISDLESRLRKLQDRDNIPSLEELEARLAKLQDKPYVPSKK
FT                   PSSEAEKLIEQIESEIKLEKKSKELSDRPNQELGDRLKRLKEDRPKKPVINKPKNLTFR
FT                   QTKSIIADSLDTQAKMASKAVKQINEKEAKIPLMDFTNKLYDMRDIIANTPDISKEQEP
FT                   KLLDIIANTLSKIYDGIKKITTPAINTLKKIGNIFTDSIKSLSKKSSDKQMAESKAQLK
FT                   ELYKSYVDLKGVDEKVKKEFLKNHYSQIDQLQTPQQIFLETAKVTRSIAAAGAKKVQQH
FT                   SQAINRLGNLQPSNTLNNRTKTSKNRQR"
FT   gene            complement(226279..226620)
FT                   /locus_tag="A1I_01175"
FT   CDS_pept        complement(226279..226620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78631"
FT                   /protein_id="ABV78631.1"
FT                   /translation="MRRSVYPLSSCELVAGSRKATKDINNIDIFNWIPWTSHGMILRVL
FT                   KNEKFTFEELTTKADNFVNNNFFKLARIANSLEKSDFEILETIMPQITQYLKFEDSSVK
FT                   IAGSNIDHH"
FT   gene            complement(226688..228472)
FT                   /locus_tag="A1I_01180"
FT   CDS_pept        complement(226688..228472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01180"
FT                   /product="Penicillin-binding protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78632"
FT                   /protein_id="ABV78632.1"
FT                   /translation="MLNKKILHNELISRRAFIIGASKLGLLSLLGMRMFYLQLIKSEEY
FT                   KTLSDKNRINFVVLPPSRGRIYDLENNILATNKPCYQLLIDRSVNNNYKDELEIVSKVL
FT                   NLSEEKYNYIQQKIKKSSRHVPLMILDQLDWQQVSLIEEQKHKLTNIFIDIGYLRSYPF
FT                   SNVTSHLIGYLGQINEQEKQGLNVYNLSDFNIGKSGIEKYYDDKLRGEFGYKKVEVNAY
FT                   GKQIREISGVSSKSGNDIHLNIDVNLQQKIQEYLNPQGSSAIVMDTENGNVLICTSSPA
FT                   FESNNFSKLSESYWQSLTNDPYKPLINKVVQNSYPPGSVFKIITILAALEAGVKPNKTF
FT                   FCSGTSVLGTNSFRCWKHTGHGTLDMSSALKHSCNTYMYEISRIVGPDKILEVARKFGL
FT                   GSKTGIDLAPESSGFVPSKEWKKKKLKLPWSIGDTFNLAIGQGYLGVTPIQLARFITAI
FT                   ASTGKLYTPRIVKNDLEYHNIDINSENIKIVQESLYNAVNVAGGTAYYNRILGEDRQLA
FT                   GKTGTSQVQGKANANDDLSRDSIAWERRNHALFIGFAPYHNPRYSITVFVDHGGGGSKA
FT                   AAPIARKIMSDVLDKYTR"
FT   gene            complement(228447..228983)
FT                   /locus_tag="A1I_01185"
FT   CDS_pept        complement(228447..228983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78633"
FT                   /protein_id="ABV78633.1"
FT                   /translation="MFKIKQEIINNTVQIVFRLLFALLCFFIILFPEFAYKIGVKSRIF
FT                   PAIEIIFIYYFMTLYSLNMLGIFLIGLLFDQINSMPIGTNSLVFLSAYIILKLSSKFFA
FT                   VKNYLVNFIVFCVYCLFILNFKYLLVTMKKLEIDGYLTILFQYLTTIFSYNLIRLIFDS
FT                   SLSYFKKHAKQKNIT"
FT   gene            complement(229353..230297)
FT                   /gene="gpsA"
FT                   /locus_tag="A1I_01190"
FT   CDS_pept        complement(229353..230297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="A1I_01190"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="COG0240 Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78634"
FT                   /db_xref="GOA:A8GUW7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUW7"
FT                   /protein_id="ABV78634.1"
FT                   /translation="MKRFKNIAVYGGGSFGTSLAAIAARVCENVTLFLRDEEIAKEITD
FT                   KKTNTKYLGNIKLPSNLQATTNLDKIKDFELIIIAVPSYAFDEAIKLLKTHISNDNILL
FT                   IATKGFARNPTELFSDRLKTLLSNNPIAFLSGPNLAKDLAKGLPASATIASLDIDLANK
FT                   ISYNLSSEAFVASTINDVITLQVAGALKNIFAIKSGIDMAKEQGENAKATLIVSALKEI
FT                   AILSKALGGMKNNMDILLEAGVVGDLVLTCYSRSSRNTKFGYEFGISKDKQKFLQEYKE
FT                   LVEGREAIKLVLELIERYDLDMPIVSSLGNVIR"
FT   gene            230715..230903
FT                   /locus_tag="A1I_01195"
FT   CDS_pept        230715..230903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01195"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78635"
FT                   /protein_id="ABV78635.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            230909..231670
FT                   /locus_tag="A1I_01200"
FT   CDS_pept        230909..231670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01200"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78636"
FT                   /protein_id="ABV78636.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(231689..233836)
FT                   /locus_tag="A1I_01205"
FT   CDS_pept        complement(231689..233836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01205"
FT                   /product="hypothetical protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78637"
FT                   /protein_id="ABV78637.1"
FT                   /translation="MINLRAELIELQKVFDEAISPEESNNNLDMKYSKISNIINSIQNI
FT                   LEPFLHHQQIYDNTVFLIGPTGVGKSTLLNYITGKDLYFRTYNDKPGIFPMDGEGIAYV
FT                   GQGEGSTTIVPNIFRASTGDFQNISFIDCAGDFDSNGIIPEIINSKIKSIIAQNVKNAK
FT                   ILMVTSQDSISPSGSYGIIFKNGLEKSAQFLSDINYFKDSIGLIVSHAGRISNTNKTIE
FT                   SYLKSVSNNPQILKYKPAIENLIQHNRIATFSKYSDEIEENNLYTPPTWNLDQRNKIID
FT                   LIRNMTFKSIPKGLFNYSSSVEVREQMSIAFEIVKTKAASLLQFSVEQALHDKLIIRAT
FT                   ELKHFVNFVEEKVCHKQNTSLTDYFNHLNYHNFLKLLISEGIKKLSQELEFLASFTKPN
FT                   NQTQQVKENWGTLIDANSLFKNILDEAKIIIHEADELFSSFVEKTKIVTIGCFGENSKN
FT                   IKTLFAELFNAYKNKANIESNKNNDKYYFYDTEKKFIGFKSESYTEEQLYSDKEPYTET
FT                   VPYEDVEHYTRKMWVNTQTGQKLGYRNEYKHELEHDPDRKSVFVIKLIRGEIKLQDVPH
FT                   TRPIIKSKEVTKERDVIKVRTVTKNKEVPEYKDVKVKKFDETKYNEDINNANTTINNLK
FT                   LNISEILSQLKAINITKKCNISLDLSDKIENEAKALCFTNLGKYDEIKANFSFLTDEWK
FT                   YLEYEAQELSEYESQIIGGNL"
FT   gene            complement(234249..234998)
FT                   /locus_tag="A1I_01210"
FT   CDS_pept        complement(234249..234998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01210"
FT                   /product="hypothetical protein"
FT                   /note="COG3637 Opacity protein and related surface
FT                   antigens"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78638"
FT                   /protein_id="ABV78638.1"
FT                   /translation="MKKLLLITAASTAILSSAAIFAATDPCEGVVMNAPMTDSAMNSSM
FT                   PASAMENQWYLKLDAGAVIFDSQKDKVTGIKVKSNTGFTGEIGAGYYIMDNLRTDFTVG
FT                   LVTSNHLKKSANDKYGDRVSVKHRPNIVSFLLNGYVDVVDLNMFKVFAGAGIGAAMVKE
FT                   KISYTFPDPDIENGKVNIKNKTNFAYQLSLGASFEVAQGVKAELVYSWRDYGKTKTKTI
FT                   TEGSDSTRYGGTRYRGNNLMAGLRFDM"
FT   gene            complement(235143..235829)
FT                   /locus_tag="A1I_01215"
FT   CDS_pept        complement(235143..235829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01215"
FT                   /product="Putative outer surface protein"
FT                   /note="COG3637 Opacity protein and related surface
FT                   antigens"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78639"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUX2"
FT                   /protein_id="ABV78639.1"
FT                   /translation="MKKLLLIAATSATVLSSALSFADCGNDSWYLRVDAGAAMFNKEKD
FT                   NQTGLKLKSNTAFTGDIGVGNYIAENFRADLTLGTTFSGKLKKSGAVSSLGGANISASH
FT                   KPNITRLLINGYVDLSNFEMFDVFAGAGIGASMLKEKVSFSGINSGATVSTSYSSKNTT
FT                   NLAYKLTLGASSQISDGVKAELAYSWISDGKTKGGNVNLFGLGNKQVKGTRYQSHNLTA
FT                   GLRFDV"
FT   gene            complement(235996..236319)
FT                   /locus_tag="A1I_01220"
FT   CDS_pept        complement(235996..236319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01220"
FT                   /product="Ferredoxin"
FT                   /note="COG1146 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78640"
FT                   /protein_id="ABV78640.1"
FT                   /translation="MTYVVTDECVKCKYTDCVEVCPVDCFYEGEFMLVINPDECIDCGV
FT                   CVPDCPIDAIKPETPELIEWVERAKHFIEHEKWQVITKKKPALPDADKFKDEKDKFNKY
FT                   IGV"
FT   gene            complement(236324..237016)
FT                   /locus_tag="A1I_01225"
FT   CDS_pept        complement(236324..237016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01225"
FT                   /product="Heme exporter protein C"
FT                   /note="COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78641"
FT                   /protein_id="ABV78641.1"
FT                   /translation="MFKLLNPHYFDKLSKIVIPILTILTFLTSAIGLYLGLVVSPPDYQ
FT                   QGDFVRIMYVHVPASWMALAIYVFMAACSFSYLVWKTTMSYLLAVAASYTGATFTLISL
FT                   VTGSIWGKPIWGVWWVWDARLTSMLILFLLYLSYIIIVNSAEDIRKAQNPASIIALIGL
FT                   INIPIIKFSVNLWYSLHQPASVLRLGSPTIHSSMLKPLMIMFVSFILYFLLILFLRTSI
FT                   LINKIKNR"
FT   gene            237454..238410
FT                   /locus_tag="A1I_01230"
FT   CDS_pept        237454..238410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01230"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78642"
FT                   /protein_id="ABV78642.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETTGGYELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKA
FT                   LGLYGKERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSC
FT                   INMIDVLSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKL
FT                   TRRQIASLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYER
FT                   LINNGKKKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            238601..241216
FT                   /locus_tag="A1I_01235"
FT   CDS_pept        238601..241216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01235"
FT                   /product="DNA polymerase I"
FT                   /note="COG0258 5'-3' exonuclease (including N-terminal
FT                   domain of PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78643"
FT                   /protein_id="ABV78643.1"
FT                   /translation="MTKKNTLLLIDGYGFVFRAYYAQQPLTSPKGEPVGALYGFTSMLL
FT                   KLLNDFKPKHAAVVFDSGGKNFRHEIYPEYKANRPPPPEDLIAQLPLVRDVARNLNFPI
FT                   LEKNGFEADDIIATFAAKTASIGEEVVVISSDKDLLQLMNDNVKIYDPLKAKYITEDNV
FT                   VEKFGVTSDKLREVMALIGDKSDNIPGVPSIGPKTASSLITQFGTVENIFNSLEQVSSI
FT                   KQRETLQNSKEAALISWQLIGLDYNVDMDFKLDALEWSPPDHNKLTEFLHEYGFKSLYK
FT                   RAENLFDIKISEHKEVIEEKAVEIKDISNKAELEAFAEKAKKVGIFGIYILQNKGANIA
FT                   FILSLKNQAYIIKISNEANNLFTYNSKADNEWFTDIIFNLLTDQSIKKITYSLKPLLKF
FT                   YASRAQQITAIEDLELMNYALSAGLPQKNLFEAVEKEATIEEAAKIVVGFIDLYQQTIL
FT                   ELKDNKAFRIYKEIDLPVCFVIDKMEKAGIKVDANYLNQLSSEFGAEILKLEEEIFVLS
FT                   GMKFNIGSPKQLGEILFEKMQLPFGKTSAKANSYSTGADILEKLSEQGYPIADLLLRWR
FT                   QLTKLKNTYTDSLPKQIDNITRRIHTTFLQTSTTTGRLSSQEPNLQNVPIRSGEGNKIR
FT                   QAFVAEQGYKLISADYSQIELRILSHIADIKALKQAFINKDDIHTQTACQIFNLQKEEL
FT                   TSEHRRKAKAINFGIIYGISAFGLAKQLNVSNTEAAEYIKKYFAEYKGVQEYMEATKSF
FT                   AQANGYVTDFFGRKCFVPLINDKRLKQFAERAAINAPIQGTNADIIKIAMTLLDREIEK
FT                   RKLKTRLVLQIHDELLFEAPIDEIETIMPIIKQIMENSTNMDVPIITEIRAGNNWMEIH
FT                   "
FT   gene            complement(245036..247672)
FT                   /locus_tag="A1I_01250"
FT   CDS_pept        complement(245036..247672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01250"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78644"
FT                   /protein_id="ABV78644.1"
FT                   /translation="MKKLIYYFGSNGSDGNASMKDILGNKGAGLAEMSNLKLPIPDGFT
FT                   ITTELCNYFYTHDNSFPKNFRNELRTAVEKLEATTGKVFGSTENPLLLSVRSGSIVSMP
FT                   GMMDTILNLGMNDEVCAALGEVCKDKRFALDSYKRFLEMYGATILSIPSDLFEQIYERH
FT                   KIQADIYRDSDVTPQLLEKIIEDFKKLHVKYAEKLITDPYEQLESAIKAVLNSWMSNRA
FT                   VIYRKINNISESFGTAINIQSMVFGNLSKTSATGVIFTRSPSTGEKKLFGEFLINAQGE
FT                   DIVSGTRTPLPIISDDSNSMKATMPKVFDELSKISETLEKHYLDMQDIEFTIENSKLYI
FT                   LQTRTAKRTAIAAIKIAVQMVEEKLISKEQALMRIDPESLNQLLHTRIDYSKGLTSIAD
FT                   GLPASPGAATGIIVFSPYDAEKLSHHHKVILVRHDTSPEDINGMHVSSGILTIRGGMTS
FT                   HAAVVARGMGKPCVCGTNNLVIDEKKQTLIAGDLILKQGDIITIDGGTGKVFLGAVPLI
FT                   QPTFSEESKLILEWADETSKLKIRTNAETVSDALVSVKFGAKGIGLCRSEHMFFDKNKI
FT                   PLVREMIIAPDIDRRKLAVQKLLPLQTQDFKALFRVMGDKPVNIRLLDPPLHEFLPTTE
FT                   EDKKNLASSLNLPLSMINQRLHAMHEVNPMLGHRGCRLGICSPEIYQMQVEAIFTAIFE
FT                   LHKEENIECKLELMIPLISNVNEIKKLKGDIYEMIHELEERYEHKFSFSLGTMIELPRA
FT                   ALNSKKIAEEVDYFSFGTNDLTQTTYGISRDDIASFLPYYLEERIFESDPFTTLDEEGV
FT                   GELIEIAIKRGKSSNPSLKLGACGEHAGHPASIEFFHKMNLDYVSCSPYRIPIARIAAA
FT                   QAKIKHG"
FT   gene            248355..249023
FT                   /locus_tag="A1I_01255"
FT   CDS_pept        248355..249023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01255"
FT                   /product="Glutathione S-transferase"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78645"
FT                   /protein_id="ABV78645.1"
FT                   /translation="MKKLYHYPICPISRQARVFLKELDIQFTTIKEDYWQFNKEFLKIN
FT                   PAGTLPVLEEQYGLSVVGIYPLVEYLHSKYPNFNFLDEDVDVCCEIRRLFFWFNDKFYR
FT                   EVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYMTSLLEKRSYIVLDSLTIAD
FT                   IAAACHLSVLDYFSEIYWDKWTVIKHWYSLIKSRPAFRLLLQDRIPGFTPPSYYTDLDF
FT                   "
FT   gene            249055..249204
FT                   /locus_tag="A1I_01260"
FT   CDS_pept        249055..249204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78646"
FT                   /protein_id="ABV78646.1"
FT                   /translation="MDNKKKQEKELNAESLKILEESVNGLNINEYSSYQEMYKKLDLDS
FT                   VEEN"
FT   gene            249286..249837
FT                   /locus_tag="A1I_01265"
FT   CDS_pept        249286..249837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01265"
FT                   /product="BioY family protein"
FT                   /note="COG1268 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78647"
FT                   /protein_id="ABV78647.1"
FT                   /translation="MQLSTISFPTVKQRTLEVFLGVALLAICSQIIIPMKPIFISLQTV
FT                   AVMFIGLTYNKTTAPLTILSYITLGVVGMPIFGEFSSGLRILFGPTAGYLAGFIIAVYV
FT                   MASLKDKIFINNKLLNQISLCLIGNIIIMSLGWMWLAKMIGASGAFYGGVLPFIIPGII
FT                   KSALLIGLINIVKPKAKYTS"
FT   gene            250177..251469
FT                   /locus_tag="A1I_01270"
FT   CDS_pept        250177..251469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01270"
FT                   /product="Folylpolyglutamate synthase"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78648"
FT                   /protein_id="ABV78648.1"
FT                   /translation="MPHFPVPKPNWKNQIKYDLENINSLLKALGDPHLRLPPVIHIAGT
FT                   NGKGSSSAMLKSIFTQAGYKVHCYTSPHLLEFNERIIVAGEKISDNELWQVCEHVRVVS
FT                   EKFNIEPSFFEGTTAAAFLAFANNKADILILETGLGGRFDATNVIDQPLITLITPISYD
FT                   HMHVLGSTLQLIAFEKAGIMKQDTPCVISVQVPEVHEILFAKAENLAAPTFCYEYDFGI
FT                   QKTDNGFIYSSQNFTYEFPAPSLVGDHQLINAASVIALISLINKQFNINNEAIAKGLQN
FT                   TVWSAIIEKINPQKYSKLIGDDVQIWVDGAHNNSGAQVLTAWIRNNLKSPIYLILGMTK
FT                   NRNIEEFCAYFKGLITKGYGIKVLSETLSYNAEIIALEASKTGIDFTSSESLEEAIMDI
FT                   KKINGDNKANIIITGSLFLAADFYKLLQSLI"
FT   gene            complement(252615..252690)
FT                   /locus_tag="A1I_t07961"
FT   tRNA            complement(252615..252690)
FT                   /locus_tag="A1I_t07961"
FT                   /product="tRNA-Phe"
FT   gene            252967..254187
FT                   /locus_tag="A1I_01285"
FT   CDS_pept        252967..254187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01285"
FT                   /product="Putative dihydrouridine synthase Dus"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78649"
FT                   /protein_id="ABV78649.1"
FT                   /translation="MSLRNVDKLREQRRIPKFGLYEDQLQKEQEVHKTRNGSSYLIRGY
FT                   LRTYRTLSPIFEVLSEYLPNLEVLKVYIIIYTAFFMIKIGNIELSSNVILAPMSGVTDL
FT                   EFRRLVKRFGAGLVVSEMIASRAMIVESRQSLQKCSIMQDDATSACVQLAGCEPNVIAE
FT                   AAKMNEDMGAKIIDLNFGCPAKKVVNGYSGSALMRDEGLAAKIFEAAVKAVKIPVTVKM
FT                   RMGWDDQTKNAPTLAKIAERSGIQMVTVHGRTRCQFYSGNADWEFIKNVKEAVKIPVIA
FT                   NGDITNFAKAKEALEKSSADGVMVGRGAYGKPWLISQIDHYLKTGEEKPAPSIESQLDI
FT                   VLEHYQAIVDYYGESAGVPIARKHMGWYSSGLPNSAEFRGAVNLMNDPIAVKDKIVEFY
FT                   TSVINRE"
FT   gene            254187..255131
FT                   /locus_tag="A1I_01290"
FT   CDS_pept        254187..255131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78650"
FT                   /protein_id="ABV78650.1"
FT                   /translation="MRKVLSFIFIILFFNSSYANEKIVDYKSVFLPVITSDKETKIAIR
FT                   SYLTNSKKYFVLVDPNSFKTALIPQDQVELPSNEAEKQNLLKKLGNTPYIKALNKYTKP
FT                   PYVQQNYGATHSMYEVKGQFLTIDMCPSSKSFEEEFFNKLVELSVKLNKPMPIAICVSG
FT                   LWINKHEKEFLWLVQQQEKGYLQITWVNHSFSHPYFKDKPLENNFLLSNKENFEREVLE
FT                   AGKVLVSHNIAPSPFFRFPGLVSDQTLIEKLKDFGFIPLGSDAWLAKGEKVQDGSFILV
FT                   HGNSNEKAGIKLIMPMLPSLKLLPLEKAFLLAN"
FT   gene            complement(255558..255800)
FT                   /locus_tag="A1I_01295"
FT   CDS_pept        complement(255558..255800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78651"
FT                   /protein_id="ABV78651.1"
FT                   /translation="MQKVKEIEGVIKSLRALEESNVNIDDNSQQHLYIGHVTDLNKIFA
FT                   FSNIYTSSDSGMRSSNTSNELEETMTFLGETSETI"
FT   gene            complement(255929..256486)
FT                   /locus_tag="A1I_01300"
FT   CDS_pept        complement(255929..256486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78652"
FT                   /protein_id="ABV78652.1"
FT                   /translation="MPVGLTEITSNLGNNMKYAISQIASKTFLSVYTTNDDGEFREGYS
FT                   ANILSCDLPQIYKDSKQEGASLTTVFKNCGNRNAIHEIAGLINKDGQNHVILNQAATVS
FT                   QNDTATVLDQLYEVVDNRFSLGNETILGLEDCSPETANNALQQFKDYLISLIPTTTTTT
FT                   TTTESPIDKGWDIKNHLNITYN"
FT   gene            256781..257410
FT                   /locus_tag="A1I_01305"
FT   CDS_pept        256781..257410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01305"
FT                   /product="Superoxide dismutase"
FT                   /note="COG0605 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78653"
FT                   /protein_id="ABV78653.1"
FT                   /translation="MTYCDKSNQTSYPFVLPNLPYEKESFKPHFTAETFEYHHGKHHNA
FT                   YVQNLNNLLKDKEELQKKNLEEIIDWSSQNQNIAIFNNAAQVWNHTFFWHSIKPNGGGK
FT                   PSGKILKQINEDFGSFEEFCEQFKAEATGQFGSGWAWLVYHNNRLQIVKTANAGTPIAN
FT                   GMQPLLACDVWEHAYYIDYRNKRPDYVDIFIKHMINWEFVENNLTK"
FT   gene            257420..259183
FT                   /locus_tag="A1I_01310"
FT   CDS_pept        257420..259183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01310"
FT                   /product="Putative esterase"
FT                   /note="COG1752 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78654"
FT                   /protein_id="ABV78654.1"
FT                   /translation="MAEIENFKKNRNFIKPIVDLKEVQEEQVKYIDDLKEVQETPIRNI
FT                   EDSKEALIEYVAFSGGGAKGAIYSGVYAALKKADLLDNVKAVAGSSAGAITAAIVAFGT
FT                   PAERFEEISKTTNLQDLLGQKGFSAGVLQLNKDGKPLYNLLDKTIKDNVGDFLQRPDIV
FT                   NVKDNKALDELRERHKSGGKIYFRDLALLRKYDPTNYKDLVVTAVEKDAGVLTIFSSLD
FT                   TPDVEVALACRASASIPLVFEPVEINGKKYVDGGYLDNVPTKYFKDNEPEFDVKEITND
FT                   TDKIILAKKQGRTLSMAFGVGMEADANIAIYSAGEFKSPGEIVKFLVDVLFKMIAKIGG
FT                   KFKYTDTLKETNEQLRENALNTVVLDTQGIDTLDFKDAQKYANYLHIKGYCQTMEYANN
FT                   HGLAKEKDKTLEHQKFLLNVYEVYDNKNLNKTFGTKLLEMFIPSKENNDSKWQQGVVEN
FT                   HDDKAKILLSFCNVNALTKENLQPLLTEYVIAAATSRNGTLKDNTNSVKALFHVLNDPS
FT                   ASNEVKESFIEVFAIDKSKDTRFNKTKTYDENIAKFKFTKDDLESFITKNKSNAIKVQN
FT                   KYAPPKHREHG"
FT   gene            complement(259192..259521)
FT                   /locus_tag="A1I_01315"
FT   CDS_pept        complement(259192..259521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78655"
FT                   /protein_id="ABV78655.1"
FT                   /translation="MACPRDDTLNYKLIRSLFKSPCNKIILIIDKQLLKSYLGLVRSII
FT                   LGTLSYLKLIKIFICDEKYNADFSDILLGKVNKISGCDSTISFDIKALNLKEFDDPINI
FT                   LEKDK"
FT   gene            259743..259970
FT                   /locus_tag="A1I_01320"
FT   CDS_pept        259743..259970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01320"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system StbD"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78656"
FT                   /protein_id="ABV78656.1"
FT                   /translation="MNISATELNKNPGKIIDQALREPIVINKQGRPTVVLVDYEYFTKL
FT                   EDDYWGKAAKNIAEQPEWLSAKESEKFLRS"
FT   gene            259974..260246
FT                   /locus_tag="A1I_01325"
FT   CDS_pept        259974..260246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01325"
FT                   /product="Cytotoxic translational repressor of
FT                   toxin-antitoxin (TA) system RelE"
FT                   /note="COG2026 Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78657"
FT                   /protein_id="ABV78657.1"
FT                   /translation="MREIVLEKRVIKTLERYPEKHQRQVKNKILSLMENPIPNNSKLLV
FT                   GYPHFHRCDIEEYRIIYNFNESTIYVILVGKRNDSEVYKLLKNIF"
FT   gene            complement(260338..260754)
FT                   /locus_tag="A1I_01330"
FT   CDS_pept        complement(260338..260754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78658"
FT                   /protein_id="ABV78658.1"
FT                   /translation="MNNIVEKRIALIEPYLDFIIKSEELLREIYPNGIDRDLMIEFILA
FT                   KKPYKSYAYYTLIRSLFKSPCNKIILIIDKQLLKSFLGLFRSIILGTLSYLKLIKIFIY
FT                   DENDFALDIKALKSNENYFWSYKINYFKKLINWE"
FT   gene            261397..262380
FT                   /gene="lpxD"
FT                   /locus_tag="A1I_01335"
FT   CDS_pept        261397..262380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="A1I_01335"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="COG1044 UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78659"
FT                   /protein_id="ABV78659.1"
FT                   /translation="MAIADFLQDFIEAPKIHEDVAIHDIKILQEASSNDISFLSNIKYS
FT                   RFLKNTKAAACIVPKDFTGEVNPNTVLLRAENSYFAYGKLIDFFYAPVKSYPAKIMKSA
FT                   YVAESATIGKNCYVGHNAVIEDNVVIGDDSIIEAGSFIGTGVVIGRNARIESNVSINYS
FT                   VIGDDVVILSGAKIGQDGFGFSTEKGMHHKIFHTGIVKIGNNVEIGANTTIDRGSLQDT
FT                   IIEDLCRIDNLVQIGHSVKIGKGSIIVAQAGIAGSSVIGKYCALGGQVGVAGHLYIGDG
FT                   AQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSIIMKQLINKRSK"
FT   gene            262381..262818
FT                   /gene="fabZ"
FT                   /locus_tag="A1I_01340"
FT   CDS_pept        262381..262818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="A1I_01340"
FT                   /product="(3R)-hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78660"
FT                   /db_xref="GOA:A8GUZ3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUZ3"
FT                   /protein_id="ABV78660.1"
FT                   /translation="MTIDITEIMDLIPHRYPFLLVDKVVEIDPNKSITGIKNVTVNEPQ
FT                   FTGHFPARPVMPGVLMVEAMTQLAAILVAKSLGSTKNKEVFLMAIENSKFRKVVQPGDT
FT                   MHIHATIDQQRANVWKFSSTVKVDGEMAAESKFTAMIKDKS"
FT   gene            262829..263674
FT                   /locus_tag="A1I_01345"
FT   CDS_pept        262829..263674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01345"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COG1043 Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78661"
FT                   /db_xref="GOA:A8GUZ4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUZ4"
FT                   /protein_id="ABV78661.1"
FT                   /translation="MSNSNIHPTSIIAEGAKLGKNVKVGPYCIIGPEVILHDNVELKSH
FT                   VVIEGITEIGESTVIYPFASIGQPPQILKYNNERSNTIIGSNNIIREYVTVQAGSQGGG
FT                   MITRIGNNNLFMVGVHIGHDCKIGNNVVFANYVSLAGHIEVEDYVIIGGLSAVHQYARI
FT                   GKHSMIGGLSPVGADVIPFGLASGKRAVLEGLNLVGMNRKGFDKAESLNALKIVQEIFL
FT                   GEGNFADRIKQAQEKYKNNTIVMQIIDFLEHGSNRSFCSFEKTMSLRGELQSNLTKQPN
FT                   "
FT   gene            complement(263817..264749)
FT                   /locus_tag="A1I_01350"
FT   CDS_pept        complement(263817..264749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78662"
FT                   /protein_id="ABV78662.1"
FT                   /translation="MTDISIELEAVNFRDSVIQIIAESIQQKFLFDYQTQKEVFKYIKF
FT                   NINSKSYILPKTISNSEIIDEFIDLRANFREYIKWKLSNKVESVNLEKTTAELLNQIYF
FT                   LSIKFIDETISEITDKIDRIKNCKSENEEEEIALKWFNSSEVEKNKIVENYQKKLEQKL
FT                   SDTIKSQKEIIDSQKSETNPGVISYQIEHILDFDQDFNSKSISNSIKLKSLNFNETGSG
FT                   NLDISVLHLTDALEQNTTITNLYLNSHNTNQPNNNIIFSERASTLELSLDKIDFTLGKI
FT                   HFNHLYNLINFSETSIEIVGELENNPDLE"
FT   gene            complement(264962..265135)
FT                   /locus_tag="A1I_01355"
FT   CDS_pept        complement(264962..265135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01355"
FT                   /product="hypothetical protein"
FT                   /note="COG3750 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78663"
FT                   /protein_id="ABV78663.1"
FT                   /translation="MSEVVVKEQLEQYLSKIERLEQEKADLSEEIKDIFQDASSHGFDV
FT                   KAMKNCFKAKKT"
FT   gene            265207..266118
FT                   /gene="secF"
FT                   /locus_tag="A1I_01360"
FT   CDS_pept        265207..266118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="A1I_01360"
FT                   /product="preprotein translocase subunit SecF"
FT                   /note="COG0341 Preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78664"
FT                   /db_xref="GOA:A8GYD9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GYD9"
FT                   /protein_id="ABV78664.1"
FT                   /translation="MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGMYKFN
FT                   FGIDFAGGIVIEVRLDQTPDLPKMRQVLGELGIGEVVLQNFGSERDLSIRFGSSSEDNL
FT                   MKNIELIKSTLQNNFPYNFEYRKVDFVGPQVGRQLIEAGTMAMLFSFAAIMIYIWVRFE
FT                   WYFGLGILIALVHDVILALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENL
FT                   RKYHKKGITEIINLSINETLSRTILTVVTTLLANLALVLFGGEAIRSFSVLVFFGIIAG
FT                   TYSSIFISAPILTIFANKKFEK"
FT   gene            266321..267574
FT                   /locus_tag="A1I_01365"
FT   CDS_pept        266321..267574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01365"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /note="COG1894 NADH:ubiquinone oxidoreductase, NADH-binding
FT                   (51 kD) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78665"
FT                   /db_xref="GOA:A8GYE0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GYE0"
FT                   /protein_id="ABV78665.1"
FT                   /translation="MLKKEDRIFTNLHGEQSHDLKSSKKLGDWDNTKALLNKGKEWIIE
FT                   EVKKSGLRGRGGAGFSTGTKWSFMPKESKKPSYLVVNADESEPGTCKDRDILRYEPHKL
FT                   IEGCLLASFAIGANSCYIYIRGEFYNEASNIQRALDEAYKDGLIGKNACGSGFNCDIYL
FT                   HRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILR
FT                   RGASWFASIGKPNNTGTKIFCISGHVNKPCNVEEAMGIPLKEIIEKHAGGVRGGWDNLK
FT                   AIIPGGSSVPLLPKSLCETADMDFDSLKAAGSSLGTGGIIVMDKSTDIIYAIARLSKFY
FT                   MHESCGQCTPCREGTGWMWRVMMRLVKGDAKKSEIDQLLEVTKEIEGHTICALGDAAAW
FT                   PIQGLIKHFRNEIESRIQ"
FT   gene            267741..268610
FT                   /locus_tag="A1I_01370"
FT   CDS_pept        267741..268610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01370"
FT                   /product="Signal peptidase I"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78666"
FT                   /db_xref="GOA:A8GYE1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GYE1"
FT                   /protein_id="ABV78666.1"
FT                   /translation="MKKLTSTTTTLWDNKLFINNLKNFMQTNTESNNNKTTAQEWKSFI
FT                   LVVVIALMIRILIIESFVVPTGSMKATILENDRIFGTKYSYGYSNYSLSFFDFIHLFKG
FT                   RIFARTPERGDIIIFRPPHEMNTRYIKRLIGLPGDKVQLIDDVIYINDEKIERVESGIY
FT                   VSEEGRKYLKFKETLPNGKTYFSYKLAPVLGIMFNDKYGNTDAFYVPEGEYFFLGDNRD
FT                   QSNDSRIDLGFVPFENFIAKAQFIWFSTKITWWDSDIGVINLILKLKPWAESIRFNRIF
FT                   RNLYSIED"
FT   gene            268610..269293
FT                   /gene="rnc"
FT                   /locus_tag="A1I_01375"
FT   CDS_pept        268610..269293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="A1I_01375"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571 dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78667"
FT                   /db_xref="GOA:A8GYE2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GYE2"
FT                   /protein_id="ABV78667.1"
FT                   /translation="MESFEELEKLLDYSFKNKALLTEALSHPSLRQHHEYKANKDYERL
FT                   EFLGDAVLNLIITEILFNNFKEYNEGNLAKIRSYLVCKETICVVGAKLGLKNYIIMTHG
FT                   EEIAGGRDNPNNIENVTEALIAAIYLDSDITTIHNIIGKLWAEFIKVKDLTDYDPKTAL
FT                   QEWAQSKDHHIPIYRLIKREGVAHLSTFTVSVKINGYEQTGKGHSIKEAEKNAARELLH
FT                   KLKLL"
FT   gene            269300..269932
FT                   /locus_tag="A1I_01380"
FT   CDS_pept        269300..269932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01380"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78668"
FT                   /protein_id="ABV78668.1"
FT                   /translation="MKYLKNLLFIFLLFSMSIASANDGTSYANYYNEAVEFYNLKKYDL
FT                   AIEAFNKAIILNPTFPNIYLGKSRALSRLHKYDLAIETLNKAIELEPNNPELYGFKGFI
FT                   LAMLTQYDLSIKAYDKAIILNPNDYGFYDGKAFVLYKLEKYSLAVEASNKAIELNPNNS
FT                   DVYYNKSLILEKLGHYKLALEAVNKALELNHLNYDAQQLKQELMQKL"
FT   gene            269949..270836
FT                   /gene="era"
FT                   /locus_tag="A1I_01385"
FT   CDS_pept        269949..270836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="A1I_01385"
FT                   /product="GTP-binding protein Era"
FT                   /note="COG1159 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78669"
FT                   /db_xref="GOA:A8GUZ8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUZ8"
FT                   /protein_id="ABV78669.1"
FT                   /translation="MTKQIQKTVSVCIIGRPNSGKSTLLNRIIGEKLSIVTPKVQTTRS
FT                   IITGIITLNDTQIILYDTPGIFEPKGTLEKAMVRCAWSSLHSADIVMLIIDSLKPLDSI
FT                   THDILNKLRSLNVVPVFLLNKIDVESKYIDDTKAFLAENYSDSLLFPISAISGENVDKL
FT                   LEYITSKAKIAPWLYEEDDITDLPMRFIAAEITREQLFLGLQQELPYKLTVQTEKWEEL
FT                   KDKSVKINQIIVVSRESYKTIILGKNGSKIKELGAKSRMQMQQFFGFPVHLFLFVKVRE
FT                   LWEDNSDYYEYMKI"
FT   gene            271116..271589
FT                   /gene="ruvC"
FT                   /locus_tag="A1I_01390"
FT   CDS_pept        271116..271589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="A1I_01390"
FT                   /product="Holliday junction resolvase"
FT                   /EC_number="3.1.22.4"
FT                   /note="COG0817 Holliday junction resolvasome, endonuclease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78670"
FT                   /db_xref="GOA:A8GUZ9"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GUZ9"
FT                   /protein_id="ABV78670.1"
FT                   /translation="MIVLGIDPALGSLGWAVVAKESAKLKYLASGVIKTSSKDEIHHRL
FT                   SYINSILEKVILEYKPNMATIEETFVNTNSVTSLKLGYARGAIMSLIGRYDLDMREFKP
FT                   NTIKKTVTGYGHAEKDQILHMIKLLLPGTAAITNSDEADAVAIAYTCLVTKNY"
FT   gene            271591..272286
FT                   /locus_tag="A1I_01395"
FT   CDS_pept        271591..272286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01395"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78671"
FT                   /protein_id="ABV78671.1"
FT                   /translation="MKPIIILVAPQMGENIGATARAMKNFGLDELRIITPRDGWPNEQA
FT                   RSNAVGAVNIIDNAKIYNSLEECIKDLEYLYATTCIKRAINKDYVFSQNLTSDYPSLAK
FT                   VGIMFGRENNGLSNEEISLANKIITINTTEFSSLNIAQAVIIVCYELFRNSESREDIYN
FT                   IQKLATKEEIDHFLTHLFGKLDKAGFFKIPERKLIMQQNITNIFMRINNLSTPEIQILQ
FT                   GIIKSLNNN"
FT   gene            complement(272373..272795)
FT                   /locus_tag="A1I_01400"
FT   CDS_pept        complement(272373..272795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01400"
FT                   /product="Nucleotidyltransferase substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78672"
FT                   /protein_id="ABV78672.1"
FT                   /translation="MLKTNIRLKTKLENFRKAFIALEAIYLKPITEDRAYIDATIQRFE
FT                   FTFELAWKFLKEYFAQMGIVLNYPKEVIKEAYAVGIINDEDLWIHMLLDRNMTSHTYDK
FT                   KLADEIYEHIKNYTPEFKRLLSIHLKLLDEDQIGKE"
FT   gene            complement(272776..273081)
FT                   /locus_tag="A1I_01405"
FT   CDS_pept        complement(272776..273081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01405"
FT                   /product="Nucleotidyltransferase"
FT                   /note="COG1708 Predicted nucleotidyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78673"
FT                   /protein_id="ABV78673.1"
FT                   /translation="MNKDIQSYIFIKKLKSLPFIEEIWLFGSRARGDSNKRSDIDLAII
FT                   CPNITDQEWLKVVDIINDADTLLKIDCVRFDNTKISRELYENIIRNKKILYVKNKY"
FT   gene            complement(273096..274277)
FT                   /locus_tag="A1I_01410"
FT   CDS_pept        complement(273096..274277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01410"
FT                   /product="Putative nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG3660 Predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78674"
FT                   /protein_id="ABV78674.1"
FT                   /translation="MTNTDFLYNEANKEEFAGDTERRTAAYKNVREDSSNGSTHKLPLE
FT                   ASYTENLWVLTDSRTGNNHQAIALAEKLAEEYTVIRLEYNCLAKLPNFLLKYHPVHIKK
FT                   EILRDILDKPLPDIIITAGRRTAALAFYLKKKFKKEIKLIQIMQPNLSYEVFEAVILPY
FT                   HDQRHCERLQGAWQSQDFFTRLLRQCYAFPRNDDFIIPINGAINNVTEKFATANLELQK
FT                   HYPKLKEFIALIIGGNNKKFNFTEKEAIHFSSLLKRIYDNQKTPFFISFSRRTPDIVKS
FT                   IIKNNMPASTIIYDPTTDTGFNPYIAMLASAKYIISTADSISMCSEAASSGKPLYIFCP
FT                   SNFNSSKHKIFVKKLVKLKIAKMFDESVTKLEEYSYPPLDEAGRVAEIIKPLI"
FT   gene            complement(274274..275230)
FT                   /locus_tag="A1I_01415"
FT   CDS_pept        complement(274274..275230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01415"
FT                   /product="Mrp"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78675"
FT                   /protein_id="ABV78675.1"
FT                   /translation="MADLHQNQIIDKLHNIAFKDGTFLKQVISNIIIKHNNVGFSIDIS
FT                   GIDKLEVEEIKNTAIKKLNEIVGIGKITIVFTESKTVEKKPQKPKHFVENVKKIILVAS
FT                   GKGGVGKSTISALIAQQLSLENHRVGIVDADIYGPSIPHIFGINEVPQTVGGRIIPVRA
FT                   KNIEVISIGFFVKNYSAIIWRGPMASKTIYQLLSVTKWDNLDYLIIDMPPGTGDIHLSM
FT                   LENYHLNGVVIVTTPQKMSEIDVVRSIDLYQKLNLPIIGIIENMSDLFDGNSGSHLSQK
FT                   YNIPLIAQIPVIPKIANACDKSLPLTDLLKLSLKEYL"
FT   gene            275338..276348
FT                   /locus_tag="A1I_01420"
FT   CDS_pept        275338..276348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01420"
FT                   /product="Protease activity modulator HflK"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78676"
FT                   /protein_id="ABV78676.1"
FT                   /translation="MLSKKYIPIFKKSPWKDFNNDKDDNIFTRPRKNQFNFSTKTIILV
FT                   ALASFVLWLASGIYEVKEGEEAAVTRFGRFVRKGYAGLNYRLPAPFEKEIVEKVKQSRR
FT                   IEIGYRTNNFVRSGGDTKNIAGESIMLTGDENIVALNCDVMWHISNLEDFMFNIQKPEE
FT                   TVKSTVESAVREVIGNTPITWVLSDQKQEITHKIETLAQKILDSYNAGVMIEKVQLLKA
FT                   EPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKVLPEARGAAARIIEEAEAYREEIISK
FT                   AEGDSQRFSAIYKQYAANKQVTRDRLYLEVAEEVLSGSNKTIINNALLPHMAIKP"
FT   gene            276548..277405
FT                   /locus_tag="A1I_01425"
FT   CDS_pept        276548..277405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01425"
FT                   /product="Membrane protease subunit,
FT                   stomatin/prohibitin-like protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78677"
FT                   /protein_id="ABV78677.1"
FT                   /translation="MQKIYYIIFTAIFGLILISSSLFSVDQRQSAVVFQFGEAVRTIEK
FT                   PGLHIKVPLIQNVEFFDKRLLDVEVEAKELTAADGKRVIVDAYAKFQINNPVMFYKTVH
FT                   DYQGVKIRLTRNLESSMRKVIGKISLSSLLSQERSNVMLNILNQVDGEAKSFGIDVVDV
FT                   RILRADLPKENSAAIYRRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYKD
FT                   AQIIKGDGDEKAAKIYNSAYSTDPEFYKFYKSLLVYKNSLKKEDTNFIISPDAEVLKYL
FT                   NLAK"
FT   gene            277409..278947
FT                   /locus_tag="A1I_01430"
FT   CDS_pept        277409..278947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01430"
FT                   /product="Periplasmic serine protease"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78678"
FT                   /protein_id="ABV78678.1"
FT                   /translation="MNLKIFFVIIILIFNNNILAKENNKSSKAIDLEEESEFTEINSIP
FT                   LKVNNASRYSFADIVEPLIPAVVNISTIEYVNSKSEAAEKDPLQEKKPLDFINDFLERL
FT                   NIPLNLEEVDPTPKAMPLGSGFIIEPNGLIVTNYHVIANVSKINVKLADNTELPAKLIG
FT                   SDTKTDLALLKIDVEEPLPFVEFGDSNDARVGDWVIAIGNPFGNLGGTVTAGIISSKGR
FT                   DIDIDTNNIVDNFIQTDAAINNGNSGGPMFNLDQKVIGVNTAIFSPLGTNIGIGFAIPS
FT                   NTAKPIIERLKKDGKINRGRLGVTIQDLTEEISEGLGLKDTNGVLVAKIQKDDPGDKAG
FT                   IKTGDIILEFAGQTVKNTKRLRVIVADIPVDQEVKVKVLRDGEAIELPIKMTSDNEEVK
FT                   QEAAEENIEKVTKKEDNGTSITKSNITFSNLTEELKQKFAISVDKVGLVITNVDEEDSS
FT                   FRVGDLVSNVNQESISDINKLEELYENAKKSEKQNILLLIERGDSSMFVPLSVM"
FT   gene            279122..279868
FT                   /locus_tag="A1I_01435"
FT   CDS_pept        279122..279868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01435"
FT                   /product="hypothetical protein"
FT                   /note="COG1054 Predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78679"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV08"
FT                   /protein_id="ABV78679.1"
FT                   /translation="MSEKIAILSAYSFVNIEEPESLIPKLLFVGKRKYVKGTILLSKEG
FT                   FNGSFSGSYESVNLVLEELKKLTNTKDVNVKINYSEIHPFQKLKVRLKKEIVAMNVDNL
FT                   NVNLFKGEYIETKDWDEFITKQDVIVVDTRNDYEVEVGTFKAAINPYTETFKQFPAWAE
FT                   QNAELLKGKKIAMFCTGGIRCEKSTSLLKSMGHEEVYHLKGGILQYLEDTQNKNNLWQG
FT                   ECFVFDDRRAVADDLAPAEGYWLERK"
FT   gene            280019..280396
FT                   /locus_tag="A1I_01440"
FT   CDS_pept        280019..280396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01440"
FT                   /product="Succinate dehydrogenase cytochrome b-556 subunit"
FT                   /note="COG2009 Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78680"
FT                   /protein_id="ABV78680.1"
FT                   /translation="MTKTKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVS
FT                   ILAWWFILSKFDSNYIKLANCCCIIKICLILTSFAWFYHLCNGIRHLFWDIGLGFSIKA
FT                   VNLTGWSVVICSVLFTILLWV"
FT   gene            280599..280976
FT                   /locus_tag="A1I_01445"
FT   CDS_pept        280599..280976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01445"
FT                   /product="Succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /note="COG2142 Succinate dehydrogenase, hydrophobic anchor
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78681"
FT                   /protein_id="ABV78681.1"
FT                   /translation="MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYF
FT                   TLANKNSDVNIIIWELKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLII
FT                   AVKLFSILTIVAFIVAVFYRG"
FT   gene            280994..281230
FT                   /locus_tag="A1I_01450"
FT   CDS_pept        280994..281230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01450"
FT                   /product="hypothetical protein"
FT                   /note="COG3609 Predicted transcriptional regulators
FT                   containing the CopG/Arc/MetJ DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78682"
FT                   /protein_id="ABV78682.1"
FT                   /translation="MNINLTNNLEELVAAKVNSGMYNNESEVVAEALRLLDKFEKAQSV
FT                   KLELLRQAVGVGIYQAKNNIFSEKSILDLIDDE"
FT   gene            281220..281507
FT                   /locus_tag="A1I_01455"
FT   CDS_pept        281220..281507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01455"
FT                   /product="Toxin of toxin-antitoxin (TA) system ParE"
FT                   /note="COG3668 Plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78683"
FT                   /protein_id="ABV78683.1"
FT                   /translation="MMSKILPYKLTRIAESDLLQIKYYSEEIWGQDITKKYLTQIHNKC
FT                   IEICNFPHIGINRPEIFESVKSIAINSHMILYALVDNKIEILRVLHKTWI"
FT   gene            281536..283326
FT                   /gene="sdhA"
FT                   /locus_tag="A1I_01460"
FT   CDS_pept        281536..283326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="A1I_01460"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78684"
FT                   /protein_id="ABV78684.1"
FT                   /translation="MTKSYNIIHHKFDVIVVGAGGAGLRAAFGMAKEGLNTACISKLFP
FT                   TRSHTVAAQGGISAALGNMGADDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELE
FT                   HYGVPFSRTEEGKIYQRPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKV
FT                   QFFIEYFAIDLLMENGECRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMAIRAGLPLQDMEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYA
FT                   PAAKDLASRDVVSRAMTIEIREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVIIKDGKNHNSVVKGLMSIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRSAALKAAELIKPASLHKPVSEEALEKIISRFDKIRHSSGNIS
FT                   VADLRLKMQRTMQSHASVFRTQEVLDEGAEMISEIRSGYKDIKVNDKSLIWNSDLVEAL
FT                   ELDNLLDQALVTVYSAAARKESRGAHAREDYPDRNDKEWMQHTLSGVDEAGKVVLDYKP
FT                   VTLTTLSDEVKAIPPAKRVY"
FT   gene            283605..284261
FT                   /locus_tag="A1I_01465"
FT   CDS_pept        283605..284261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01465"
FT                   /product="Amino acid ABC transporter permease protein"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78685"
FT                   /protein_id="ABV78685.1"
FT                   /translation="MFEYLIKFSPKILFIVEGTLITLKYSVIAVIFGLVIGVLLALCKV
FT                   NKNRALRLFADFYTSIFRGTPLLIQLSIIYFASPYLIGIKFTVFMAGAISFSLNSGAYV
FT                   SEVIRAGINAVDKGQFEAAEALAIPKFLIMKDIILPQAIKNIFPSLTNELINLIKESAI
FT                   ISMFGEMDLMKRAQIVSLETYNYFSPMIVAACCYYILVMLISFIARIIEKKLIVS"
FT   gene            284556..284945
FT                   /gene="rpsL"
FT                   /locus_tag="A1I_01470"
FT   CDS_pept        284556..284945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="A1I_01470"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78686"
FT                   /db_xref="GOA:A8GV15"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV15"
FT                   /protein_id="ABV78686.1"
FT                   /translation="MPTYNQLVRFKRKSKVRKTKSPALEANPFKSGVCLVVKTVTPKKP
FT                   NSALRKVATVRLSNKRTVNVYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHVVLGAYDI
FT                   AGVKGRKQGRSRYGAPRKQVVATKK"
FT   gene            285061..285462
FT                   /locus_tag="A1I_01475"
FT   CDS_pept        285061..285462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01475"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78687"
FT                   /protein_id="ABV78687.1"
FT                   /translation="MKEGKKALAEKIVYSAFDKIEKKHKADPYQTFSNAMNNVKPYLEV
FT                   TSVRVGGANYQVPTPVDERRGYALASRWIITAATKRSEKMMIDKLAEELFEASNNRGVA
FT                   IKKKEDTHKMAEANKAFSHFSPKKTKQGN"
FT   gene            285465..287558
FT                   /locus_tag="A1I_01480"
FT   CDS_pept        285465..287558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01480"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78688"
FT                   /db_xref="GOA:A8GV17"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV17"
FT                   /protein_id="ABV78688.1"
FT                   /translation="MSKKLENIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHEGG
FT                   ATMDWMEQEQERGITITSAATTCRWQDKQINIIDTPGHVDFTIEVERSLRVLDGAVAVF
FT                   DGVAGVEPQSETVWRQADKYNVPRMCFVNKMDRMGADFYRCVDMIKDRLGAKPLVIQLP
FT                   IGIEENFKGVVDLVKMQAVVWKDESLGAEYSYQEIPDDMKAKAEEYRANLLDMVVELDD
FT                   KIMEKYLSGEEVTEEEIKKLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDYLPSPI
FT                   DIATVKGVEVSTGEEKDFPISVSEPFSALAFKIMNDPFVGSLTFIRVYSGKITSGTTVI
FT                   NTVKNKREKIGRMLLMHANNREDVKEASAGDIVALAGLKDTTTGDTLSDEDKKVILERM
FT                   EFPEPVIELAVEPKSKVDQEKMGLALSRLAAEDPSFRTSTDQETGQTVIKGMGELHLEI
FT                   IIDRMRREFKVEANIGAPQVAYRETITKACEIDYTHKKQSGGAGQFARVKIIFEPLKDV
FT                   KDLKEEDKNKSFIFESKIVGGAVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLIDG
FT                   AFHDVDSSVLAFEIAAKAAFREGMPKGNPKLLEPIMKVEVITPDEYMGDVIGDLNSRRG
FT                   QVQGMEPRGNAQVIKAYVPLAEMFGYVNTLRSLSQGRAQYSMVFNHYDQVPTQVADTIK
FT                   AKK"
FT   gene            287647..287722
FT                   /locus_tag="A1I_t07963"
FT   tRNA            287647..287722
FT                   /locus_tag="A1I_t07963"
FT                   /product="tRNA-Trp"
FT   gene            287764..287964
FT                   /gene="secE"
FT                   /locus_tag="A1I_01485"
FT   CDS_pept        287764..287964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="A1I_01485"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78689"
FT                   /protein_id="ABV78689.1"
FT                   /translation="MFKEYKIYKFFEQVKQEAYKVVWPTKKELTASTLVVIVAVFVFSL
FT                   ICLVLDYGIHNIIQILLNIGK"
FT   gene            287983..288555
FT                   /gene="nusG"
FT                   /locus_tag="A1I_01490"
FT   CDS_pept        287983..288555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="A1I_01490"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78690"
FT                   /protein_id="ABV78690.1"
FT                   /translation="MAEQNIDDILSNSEKDTKKWYVIHTASGAENRIKRIMLERISKQK
FT                   MSDFFDDILVPVFGVSEVKRSKNVKVEKKLMPSYILIKMNMTDKSWHLVKNIPGVTGFL
FT                   GSKTTPKALTESEIQNIRLETEAKEAKDAKLYEVGEIVTVTEGPFETFTGTVEEVDQEK
FT                   ARLKVSVSIFGKATPIELSFTQVKKND"
FT   gene            288657..289091
FT                   /gene="rplK"
FT                   /locus_tag="A1I_01495"
FT   CDS_pept        288657..289091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="A1I_01495"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78691"
FT                   /db_xref="GOA:A8GV20"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV20"
FT                   /protein_id="ABV78691.1"
FT                   /translation="MAQKIEGHINLNVNAGEATAAPPIGSTLGQRKVNIMEFCKAFNAA
FT                   TQSIEKGTPLPTVITIYVDKSFTFIVKTPPASYLIKKYAKVKKGSGATKKEAVVGKITM
FT                   DDCREIAKLKMPDLNTKDIKAATKIICGSAASMGIEVVGN"
FT   gene            289097..289816
FT                   /gene="rplA"
FT                   /locus_tag="A1I_01500"
FT   CDS_pept        289097..289816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="A1I_01500"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78692"
FT                   /db_xref="GOA:A8GV21"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV21"
FT                   /protein_id="ABV78692.1"
FT                   /translation="MSNNKDVAIKSSGGKKIREARIKVRSDSLYNLTTAVEKLKSASYV
FT                   KFDPTLEIVMKLGIDPRHSDQMVRGVVNLPAGTGKTVRVAVICKEEREEEAKVAGADLV
FT                   GSTNIIDEIKAGKINFDVCIATPDMMAVIGSVARILGPKGLMPNPKLGTVTLDIKGAVK
FT                   NAKSGQVEYRAEKAGIIHAGLGKLSFPDQDLLKNLKAFIDAVVKAKPTGVKGSYLKAIY
FT                   LSSTMGASVQIDLASIA"
FT   gene            290094..290603
FT                   /gene="rplJ"
FT                   /locus_tag="A1I_01505"
FT   CDS_pept        290094..290603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="A1I_01505"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78693"
FT                   /db_xref="GOA:A8GV22"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV22"
FT                   /protein_id="ABV78693.1"
FT                   /translation="MLRSEKPEVVEEIASIYKDSPSVIVAHYHGLTVSEVNSLRESLKS
FT                   KDAGFKVVKNTLAKIAANKAGLDDIVSLFSGPTAIVYSKEPVEMAKLVVNFAKSNENLK
FT                   IVGGIVDKQVLNEHSIKELSKLPSLNELRSKIVGLLQAPATKIAGVLQAPSSSLARVIQ
FT                   ANASKN"
FT   gene            290642..291013
FT                   /gene="rplL"
FT                   /locus_tag="A1I_01510"
FT   CDS_pept        290642..291013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="A1I_01510"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78694"
FT                   /db_xref="GOA:A8GV23"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV23"
FT                   /protein_id="ABV78694.1"
FT                   /translation="MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAAA
FT                   PAAEAAAEKTDFEVVLASSGDKKVEVIKVVKEITGLGLIEAKKLVDEAPKPIKSNVKKA
FT                   EAEEIKSKLEAAGAKVELK"
FT   gene            291638..295756
FT                   /gene="rpoB"
FT                   /locus_tag="A1I_01515"
FT   CDS_pept        291638..295756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="A1I_01515"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78695"
FT                   /db_xref="GOA:A8GV24"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV24"
FT                   /protein_id="ABV78695.1"
FT                   /translation="MVSLRDNIEVQPLSHNKRVRKNFGHINLVADIPNLIEIQKNSYEK
FT                   NFLQLDTKDSERKNKGLQSILNSIFPISDPSNIANLEFVKYEFDTPKYDVEECTQRSLS
FT                   YDSALKVTLRLSIWDIDEDTGSREIKGIKEQQVYMGNIPLMTKNGTFIINGTERVVVSQ
FT                   MHRSPGVFFYHDEGKVHSSRKLLYSARVIPYRGSWLDLEFDAKDIIYFRIDRKRKLYAT
FT                   TLLKAIGMSTEEIIKFYYDSVNYKVVKNKGWAVKFMPSHITAHRLTSDLIDADTGNVLL
FT                   KAGQKITPRLAKKYAGEGLNNILVSHEALIGKYLSEDLKDPESDEILAKIGEMITVELL
FT                   SVISDLKIKNISVLVINPQSGPYIRNTLFSDKNQDRESALFDIFRVLRPGEPANIEAAE
FT                   SLFYNLFFDPERYDLSEVGRIKMNSRLELNISDETTVLTTDDIKNILRVLVELKDRKGI
FT                   IDDIDHLGNRRVRSVGELIENQFRIGLVRMEKSVVERMSAGDIDTVMPHDLVNSKILVS
FT                   VVKEFFSTSQLSQFMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRIC
FT                   PIETPEGQNIGLINSMATYARINKHGFIESPYRKVKDGHVTDEVVYLSAIEEGKYKIGQ
FT                   ANSKVDKDGILQGEFINCRVEGGNFVMVEPHEVDFIDVTPMQVVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKTDAPFVGTGVEGVVAKDSGASVLALNDGIVEQVDSNRIVIR
FT                   AIGQKTESAPSVDIYNLLKFQKSNHNTCINQKPLVKVGHYVKKNDIIADGPSTDNGEIA
FT                   LGRNVLVAFLPWNGYNFEDSILISERIVKEDVFTSVHIEEFEVIARDTRLGPEEITRDI
FT                   PNVSEEALRHLDEVGIIYVGAEVKAGDILVGKVTPKSESPITPEEKLLRAIFGEKAFDV
FT                   KDSSLHVPSGVSGTVVEVRVFSRRGVEKDQRAIAIEKQQIEKLAKDRDDELEIIEHFVF
FT                   SWLEKLLVGQVSINGPKTVKTGQTITSEILKGLSKGQLWQFTVEDANVMNEIEQLKGHY
FT                   DGKKEALNKRFATKVEKLQSGDDLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVIS
FT                   RIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIGQVLETHLGWASVNLAKKIAGLVEEHK
FT                   TKHASIEKIKKFLIELYGENINHILEKSDEEIISFCNEAAKGVYFATPVFDGAKVEDVK
FT                   DMLRLAGQDLSGQVKLIDGRTGEYFDRLVTVGQKYLLKLHHLVDNKIHSRSIGPYSLVT
FT                   QQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDVNGRIKIYDSIVRGENN
FT                   FESGIPESFNVMIKEFRSLCLNVKLEVTS"
FT   gene            295898..300103
FT                   /locus_tag="A1I_01520"
FT   CDS_pept        295898..300103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01520"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086 DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78696"
FT                   /db_xref="GOA:A8GV25"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV25"
FT                   /protein_id="ABV78696.1"
FT                   /translation="MRRRKLREHKPPNLEVSKVYKSNFKEKVFMSVVNFYGQLSNTQQF
FT                   DQIRINIASPEQVRSWSFGEVIKPETINYRTFKPEKDGLFCARIFGPVKDYECLCGKYK
FT                   RMKNRGITCEKCGVEVTVSRVRRERMGHIELAAPVAHIWFLKSLPSRISTLLDMTMRDI
FT                   EKILYFENYVVVDPGLSILQKGELLTEEELQKAKDKYGEDAFTASIGAEVVQQMLKELD
FT                   FPTLKQELYEELQNTTSEVKKKKLVKRLKLVEDFLESENKPEWMIMNVLPVMPPELRPL
FT                   VMLDGGRFATSDLNELYRRVINRNNRLKKLIESKAPDIIVRNEKRMLQEAVDALFDNGR
FT                   RGRAAKNANKRPFKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPK
FT                   KMALELFKPFIYSKLELYGIATTIKAAKRMVEAEKPEVWDVLEEVIREHPVLLNRAPTL
FT                   HRLGIQAFEPLLIEGKAIQLHPLVCAAFNADFDGDQMAVHIPLSIEAQLEARVFMMSTN
FT                   NILSPANGRPIIVPDKDIVLGLYYLTLAFDHEVGEGMMFSDLTEMEHALYNKFITIHTK
FT                   IKYRRNQLNAEGKIVPVIVDTTYGRLMVGELLPSNPNIEYKFINKPLTKKDISLVIDLV
FT                   YRHCGQKATVIFADQLMKLGFKYACSSGISFGMDDMVVPKSKIVHIDETQLEIKEFEQQ
FT                   YSNGLITYGEKYNKVIDAWSRCTDRVANDMMKEIAKPPVSDDSNQQKINSIYMMAISGA
FT                   RGSFQQIKQLGGMRGLMTKSNGQIIPIPIIANFKEGLTVFECFNSANGMRKGQIDTALK
FT                   TASSGYLTRKLVDVAQDCIITEKDCNTDKGIEVKSIIEGGEVIAPLAEMILGRTAAINI
FT                   YHPVTNDLILTKGELINESKLEQIESAGLDRIMIKSVLTCESSTGICAICYGRDLATGS
FT                   LVSEGEAIGVIAAQSIGEPGTQLTMRTFHIGGAATKGAEVSSVEASYDAKVKILSRNVV
FT                   INSEERKIVMSRNCELLLLDNNGNEKAHSKIPYGARLLVDEGDMVTKTQKLAEWDPYTI
FT                   PIITEKSGKVLFKDMVEGISVRDVTDEATGIPSKVIIESKQYSRGAELRPRIQLLDAKG
FT                   EIIMLSNGLEARYYLPVGAVLSVEDGVQISVGDIIARIPKESTTTKDITGGLPRVAELF
FT                   EARRPKDHAVIAEIDGRVEFGKDYKSKRRIIINPVDGSMGLEYMVPKGKHVVVNEGDFV
FT                   KKGDLLIDGNPVLQDILKVMGVELLASYIVKEVQAVYRLQGVKIDDKHIEVIIRQMLQK
FT                   VEITDSGGTTLLVGEKIDRREFDEINEKAIKNGLRPADAQLILQGITKSSLQTRSFISA
FT                   ASFQETTRVLTEAAIAGKVDKLRGLKENVIVGRLVPAGTGFFMDKMRKVAAKLDEENA"
FT   gene            complement(300252..300488)
FT                   /locus_tag="A1I_01525"
FT   CDS_pept        complement(300252..300488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01525"
FT                   /product="hypothetical protein"
FT                   /note="COG2155 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78697"
FT                   /protein_id="ABV78697.1"
FT                   /translation="MLINTSSNPLITTIHLLSSIGAINWGLIGLFNFNLVTLLFGSFPI
FT                   IVKLLYIIIGFCGIYSFLCLGKLLCKPGVEKGK"
FT   gene            complement(300621..303647)
FT                   /locus_tag="A1I_01530"
FT   CDS_pept        complement(300621..303647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01530"
FT                   /product="Hydrophobe/amphiphile efflux-1 (HAE1) family
FT                   protein"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78698"
FT                   /protein_id="ABV78698.1"
FT                   /translation="MLLSEICIKRPVFATVLSLVILVLGTIFFTKLQIRGTPDISIPII
FT                   NVNAFYSGADALYMEKEITTRIEKALKTVKNLDYITSQSSTGQSSITLSFLLSTDIEVA
FT                   LNDVRSKISDITYMFPQDMKAPSVAKLDADSFPSLFISVESEQYNDLELTKIVEDYLQT
FT                   PLDKLESVGQSQIYGGNEYIMRIEPDPKKLYQHKISLLDIEVAIREQNKDYPAGNIKTG
FT                   VNNFIVTLEGSLSKPEEFGNIIIKVQDNSIIKLQDIAKVYLTAPDSEVLFRYNGKNSIA
FT                   LGLIKESKANVIDLSNDVTKEIEKVKESIPKGISLNIAYDGAKPVRASIYAVFQTIFEA
FT                   LILVILVTYLFLASAKITLIPFVTIPVSLIGTFSVMYAMGFSINIFTLLAMILAIGLVV
FT                   DDAIVMLENIFRYNEMGHKPMEAALLASKEIGFAIIAMTITLAAVFLPVGFIDGFVGKL
FT                   FIEFAWTLAFCVLFSGFVALTLTPMMSSRMITKHNAPTLKFLVKFNELLQLIQDKYIYY
FT                   LNLTFDNKKKFVLIIAASFVVLIISFKFVQKTFIPQEDDGFLQLSFKGPEGSSLEHSTE
FT                   VVIEAEKILANYKDIAGYLMVIGAGGSDNVLSFVPLKDWKQRSRSQETIKNMLNKQFSE
FT                   IAGMKVFAMDPRSMVSSGGGSPIEFTIQTNLEYDDLDKISQQFIDIMKANPIFSNVNRN
FT                   LQSAMPTIAIEINRDKAYLYGMNMANIGKTVQYLLADQQVGDFRMGNDLYEVMLQFNQK
FT                   DRSSISDFSKILIPTKNNNMLPLESIANITEKISVKSYSHYNNSKSVTISSNLSPDSKI
FT                   EEAINEINKIAVKLLDPGNTILEYIGEIKQMKEADSNMLMTFGFALIFIYLVLAAQFES
FT                   FVDPLLILLAVPFSITGGVLTLWISGNSLNMYSNIGLITLIGLITKNSIMIVEFANQLR
FT                   EKGANIRNAIIEACTLRLRPILMTTLAAVVGSIPLIFATGAGASARNSIGLVIVGGLSI
FT                   GTIFTIFVIPVIYQTFKKN"
FT   gene            303944..304270
FT                   /locus_tag="A1I_01535"
FT   CDS_pept        303944..304270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01535"
FT                   /product="DNA-binding protein HU"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78699"
FT                   /protein_id="ABV78699.1"
FT                   /translation="MSTQPKKMNKTEFIAFMTEHGHHHKHQGHKSFTKADAEKALNWVL
FT                   ESIISATKHQHSVNITGFGSFGIQSRKSREGRNPKTGAKMTIPAYKQPVFKAGSKLKEA
FT                   CNNK"
FT   gene            304406..305206
FT                   /locus_tag="A1I_01540"
FT   CDS_pept        304406..305206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01540"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78700"
FT                   /protein_id="ABV78700.1"
FT                   /translation="MIIEHLEFSLKHKKLHNSWLIEAENIEQALKDIEKFICSKLLKNS
FT                   IPLENNPDYHLIAREVSATSNAKNISIEQIRKLQEFLSKTSAISGCKVAVIYSADLMNL
FT                   NAANSCLKILEDTPKNSYIFLITSRASSIISTIRSRCFKISTKSSERHSEEELYSKFIQ
FT                   PIADNENLNSKLEFIKQFNTKDRELWLDFTDSILLLMNRILKKSSGINIEFSDLENKIF
FT                   HALPNRTPSYLVQKFADIKKLIYNTIDYDLDLKASYILVMSEFS"
FT   gene            305547..306896
FT                   /locus_tag="A1I_01545"
FT   CDS_pept        305547..306896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01545"
FT                   /product="Signal recognition particle protein"
FT                   /note="COG0541 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78701"
FT                   /protein_id="ABV78701.1"
FT                   /translation="MFKTLTQNLMKIFDRLVSSGLLTEEQIDAALRDIRVALLESDVAL
FT                   PVIKNFVAEVKQKALGQEVIKSVSPGQMIIKIIHEEMINILSSSEDEIKLNLNAKPPVN
FT                   LLMVGLQGSGKTTASGKLALCLKNQNKKVLLVSLDTYRPAAQEQLEILANSVKINSLPI
FT                   VKGDKPLDIVKRAMAEAKLSAYDIVIYDTAGRTQIDQEMMNEAIAIKKIVEPTETLLVI
FT                   DSMTGQDAVVTASSFNEQLEISGLILSRIDGDSKGGAALSVKYITQRPIKFLSSGEKLT
FT                   DLEEFDAKRIASRILDMGDIISFVEKAASIVDREQAEKTAAKLKKGKFDLNDYLQQMKS
FT                   IKKMGGFGSILSMLPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTPKERRNPDIINASR
FT                   RKRIALGAGTTVQKVNILLKQFKQISDMMKKASNMNPKNLLRSGLGKLFS"
FT   gene            307119..307949
FT                   /locus_tag="A1I_01550"
FT   CDS_pept        307119..307949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01550"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78702"
FT                   /protein_id="ABV78702.1"
FT                   /translation="MSKKPKHDEIIRSAFENPLVSKEFFEMHLPPHIQNLISFEKLKME
FT                   KDSFVDKRLKKSIVDILFSAKFGEKKGYLYLLLEHQSTPEYKMALRLFRYMFKIAEYHK
FT                   KSTKSKKLPFIYPLIFYNGQKKYNAPRNLWELFENSELVKTTWTNDYQLINVHDIPDEK
FT                   LKEKAWSGILQFFMKHIHERDLLKRWEEVADLLPKFAKIDIGIEHIELILCYTLTRIKQ
FT                   DDIIEVEKLLKSKLNLKKRENIMKSIAHHWMQQGREEEKAIMVKKIAGRKDCHS"
FT   gene            307921..308034
FT                   /locus_tag="A1I_01555"
FT   CDS_pept        307921..308034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01555"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78703"
FT                   /protein_id="ABV78703.1"
FT                   /translation="MQEEKIAIARNLIKAGLKIDLIATSTGLNEDEIKKLK"
FT   gene            308126..308242
FT                   /locus_tag="A1I_01560"
FT   CDS_pept        308126..308242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78704"
FT                   /protein_id="ABV78704.1"
FT                   /translation="MESIVHHWIQQGKVEVREEATRLANIKMQKKKLLWQKK"
FT   gene            308227..308310
FT                   /locus_tag="A1I_01565"
FT   CDS_pept        308227..308310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78705"
FT                   /protein_id="ABV78705.1"
FT                   /translation="MAKEMMKERLTLESVIKITKLSKAEIK"
FT   gene            308329..309495
FT                   /locus_tag="A1I_01570"
FT   CDS_pept        308329..309495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01570"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="COG0635 Coproporphyrinogen III oxidase and related
FT                   Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78706"
FT                   /protein_id="ABV78706.1"
FT                   /translation="MKEVKANDLSIYIHWPFCLSKCPYCDFNSHIANSIDDDNWLKSYE
FT                   KEIEYFKDIIQNKYIRSIFFGGGTPSLMNPKIVEGIINKISGFARIDKQTEITLEANPT
FT                   SFETEKFKAFKLAGINRVSIGVQSLRENDLKKLGRTHDSLQAIKTIESASKIFPRVSFD
FT                   LIYARSGQELKDWQQELKQAMELVTGHISLYQLTIEKGTPFYKLFHDGNLILPNSDLAA
FT                   EMYEWTNDYLESQKYFRYEISNYAKKGQECVHNLTYWNYNDYLGIGPGAHSRIIENPSS
FT                   VSAIMMWHKPEKWLEAVNNKNNGVQTNVKLTKQEIIEEILMMGLRLKDGINISALEQKI
FT                   DAKLENILDISSLNHYQELDLIRLDDNIYLTYKGLMLHSYIVPRLLQV"
FT   gene            complement(309544..309693)
FT                   /locus_tag="A1I_01575"
FT   CDS_pept        complement(309544..309693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78707"
FT                   /protein_id="ABV78707.1"
FT                   /translation="MLSNEEDTNTAYERLNNHADKWHDAEKILEQGFKDEQKHKKWIEN
FT                   QLND"
FT   gene            complement(309648..309989)
FT                   /locus_tag="A1I_01580"
FT   CDS_pept        complement(309648..309989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01580"
FT                   /product="hypothetical protein"
FT                   /note="COG1633 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78708"
FT                   /protein_id="ABV78708.1"
FT                   /translation="MTTLVGIQNNFVDGIKELVELDYDAIEAYEAAINRITDENYKTQL
FT                   QRFKEDHERHVKELNELLSKHKEDEITGPSSKQWLTKGKVDLLHRLAIELYYMLCFQMK
FT                   KILTLLMKG"
FT   gene            311060..311701
FT                   /locus_tag="A1I_01595"
FT   CDS_pept        311060..311701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78709"
FT                   /protein_id="ABV78709.1"
FT                   /translation="MYISCPNCQTKFIVSNNQIGINGRRVKCSKCSHIWYQKLDYKTSK
FT                   LSDFDENKVEAVKTPIKNGYGNQFSANVPVILPYIPPKQKYNVFPLLWTSFIIFCLAIL
FT                   LLDSFKSLSKYDQLKIEEIKLGSSHNAGTIKMFYKISNNSDYLISNPLIKVRAMDGNNR
FT                   ALDEYISVTKLKAKIPPKQDTYIEMEIKGLPAAAKYIDVTVGNRLGLLLE"
FT   gene            complement(311822..312526)
FT                   /locus_tag="A1I_01600"
FT   CDS_pept        complement(311822..312526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01600"
FT                   /product="hypothetical protein"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78710"
FT                   /protein_id="ABV78710.1"
FT                   /translation="MKFNRIYINNHLAENIKLELGSDHTHYIKTVLRLKVNDQFRIFNG
FT                   TDGEFLAQITKLDRNNLIITIQECLRKPRAESSLTLAMSIIKQDKLMLAINMATQLGVT
FT                   KIVTLITERCQFRSVNIERLTKCVIEATEQSERLNPPVIEPAISIQNYLKKNNNFVLYA
FT                   NEHEKEENSILKLNKDITNISIVIGPEGGFTNDEIALLASYKNAYSISLGKNILRAETA
FT                   AIAALAQVNLVR"
FT   gene            312538..312681
FT                   /locus_tag="A1I_01605"
FT   CDS_pept        312538..312681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01605"
FT                   /product="hypothetical protein"
FT                   /note="COG5508 Uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78711"
FT                   /protein_id="ABV78711.1"
FT                   /translation="MDNKKDNILEEENLPKEKEMPKEIGGAKGLEPTRYGDWQHKGKVT
FT                   DF"
FT   gene            complement(313087..313800)
FT                   /locus_tag="A1I_01610"
FT   CDS_pept        complement(313087..313800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01610"
FT                   /product="Integral membrane protein"
FT                   /note="COG0670 Integral membrane protein, interacts with
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78712"
FT                   /protein_id="ABV78712.1"
FT                   /translation="MIDYTKTLTASSSKNKTFDEGLRKYMLKVYNYMALALLLTGIAAV
FT                   TTISVEPLYNLMFQTGFGTLIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAALTGMSL
FT                   AYLALVYTGESIARTFFICASVFGAMSLYGYSTNRDLTSMGSFCAMGLIGLIIASLVNM
FT                   FLKSSGLSFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDETGQKLSIMAAFTLYLDFI
FT                   NLFLYLMRFLGNRRD"
FT   gene            complement(313844..314596)
FT                   /locus_tag="A1I_01615"
FT   CDS_pept        complement(313844..314596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01615"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78713"
FT                   /db_xref="GOA:A8GV42"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV42"
FT                   /protein_id="ABV78713.1"
FT                   /translation="MIINIGLSGATGKMGRTILERIDNFKNCKISAKFNSTRDLHELND
FT                   LCKNSDVVIDFSTPEILEKLVDSALKYDTKLVIGTTGFTSSQFKLLEKAAKTLPILYSA
FT                   NMSIGANLLGYLAKEATKILDDYDIEILEAHHRAKKDAPSGTAIMLAEMVTAEKELDIT
FT                   FNRGNKTRRTNEIGISSLRGGNVHGTHEIFFLGDDETITLKHEALNKNSFADGAIRAAI
FT                   WLQDKQTGLYSMLDFYKNLINYHLKKPI"
FT   gene            complement(314593..315075)
FT                   /locus_tag="A1I_01620"
FT   CDS_pept        complement(314593..315075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01620"
FT                   /product="Flavoprotein oxygenase DIM6/NTAB family protein"
FT                   /note="COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78714"
FT                   /protein_id="ABV78714.1"
FT                   /translation="MAGTVTENQFKDAMSCFPAGVTIITTNLNNKFFGFTASSFTSVSL
FT                   KPPLILFCLNKNSFSIKGFENSSKFAISILAENQIDISEHFARSHTDKFTSISYELGSA
FT                   TSCPLINGAICHIECLKHATYDGGDHVIFIGKVINTAIKNDSKPLIYHHKSYIKLI"
FT   gene            complement(315060..315785)
FT                   /locus_tag="A1I_01625"
FT   CDS_pept        complement(315060..315785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01625"
FT                   /product="Amino acid ABC transporter substrate binding
FT                   protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78715"
FT                   /protein_id="ABV78715.1"
FT                   /translation="MKFLKVLLLSLLLISCEKKEQEATLIVGTSADNPPYEFIQNGEIV
FT                   GIDIDIINAIGERLNKRVIIKNFDFNGLLAALVSENIDIAVAELSVTPERAEYISFSDN
FT                   YATAKFAVLYRLEDNVQSIGDLDNKIIGVQLGSVLEKKAEELSKTMNIKVHSLANSLML
FT                   VEELKAKVVDVIISEEFQNKKLQEANPNLASYTLEEFSSEFALGLSKNSGLIKEINEAI
FT                   DSLKKDGTINKIMKKWLGQ"
FT   gene            complement(315913..317364)
FT                   /gene="gatB"
FT                   /locus_tag="A1I_01630"
FT   CDS_pept        complement(315913..317364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="A1I_01630"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78716"
FT                   /db_xref="GOA:A8GV45"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV45"
FT                   /protein_id="ABV78716.1"
FT                   /translation="MAYIESNSGKWEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQV
FT                   SYVDAAMPGMLPVLNEYCVHQAIKTGLGLKAKVNKYSVFDRKNYFYADLPQGYQISQFY
FT                   YPIVQDGTMEIPTSTGELKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIV
FT                   TEPDISSPDEAAEFVKKLRSLLRYVGSCDGDMEKGSMRCDANVSVRRKGEPLGTRCEIK
FT                   NINSIRNIVRAIEFEAKRQVDLIENGESVIQETCLFNADSGETRTMRSKEEAADYRYFP
FT                   DPDLLPVILSDELINELKASLPELPDQKIDKYITKFGLSKYDAEVIVADESAAKYFEEA
FT                   ANECDPKLLANWLINELFGQLNKASAEISECKITPNDFAKLIKLIEDNTISGKIAKTVF
FT                   EIMFETGKAADKIVEEQGLVQVSDSNVLNTVIDEVIRENPDSVEGYKGGKDKLFGFFVG
FT                   QVMKKTGGKANPGLVNQLLKEKLGS"
FT   gene            complement(317367..318848)
FT                   /gene="gatA"
FT                   /locus_tag="A1I_01635"
FT   CDS_pept        complement(317367..318848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="A1I_01635"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78717"
FT                   /db_xref="GOA:A8GV46"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV46"
FT                   /protein_id="ABV78717.1"
FT                   /translation="MTELNKLSVADSLKGLKNKEFTSKELVNAHIKQIEKHKNLNAYVT
FT                   ETFDLALKQAEEADQSYAKNHSRTLEGIPFAAKDLFCTKGIRTTACSNILREFIPNYES
FT                   GVTQNIFNKGGVMLGKTNMDEFAMGSANITSCFGNVISPWKALDDGADLVPGGSSGGSA
FT                   AAVSGFMATAALGSDTGGSVRQPASFTGLVGFKPTYGRCSRYGMVSFASSLDQAGIFTR
FT                   SVLDSSIMLEAMIGFDERDSTSIKMEVPQLQPAIGSSIKGMKIGVPLSLGEGGIIEPDI
FT                   MKMWHSTIELLKDAGAEIIDISLPHAKYGVAVYYVIAPAEASSNLSRYDGVRYGLRVEK
FT                   ENMSLDEMYEITRSSGFGDEVKRRIMIGTYVLSSSFMDAYYLKAQKVRRLVADDFNNAF
FT                   AKVDAILLPSAPTEAFRIGEKQNDPTIMYLNDLFTIPASLAGLPCVSVPAGLSNRGLPL
FT                   GMQVICKQLDEYNVLRVASAIEAGVKHIKFEPVGF"
FT   gene            complement(318850..319152)
FT                   /gene="gatC"
FT                   /locus_tag="A1I_01640"
FT   CDS_pept        complement(318850..319152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="A1I_01640"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78718"
FT                   /db_xref="GOA:A8GV47"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV47"
FT                   /protein_id="ABV78718.1"
FT                   /translation="MITKEEVKKITKLARLKFEEDKVEEFSSRLSSIMDMINILNEIDC
FT                   TDVKPLTSVCDMQARMRPDEVTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE"
FT   gene            complement(319364..319924)
FT                   /gene="frr"
FT                   /locus_tag="A1I_01645"
FT   CDS_pept        complement(319364..319924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="A1I_01645"
FT                   /product="ribosome recycling factor"
FT                   /note="COG0233 Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78719"
FT                   /db_xref="GOA:A8GV48"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV48"
FT                   /protein_id="ABV78719.1"
FT                   /translation="MDKVTLKKNLQEKMDKALKVLDHELKGLRTGRASVNLLDSVTVEA
FT                   YGDRMPLSQVASLTTPDARTINVQVWDKSMVSSVEKAITVANLGLTPSSDGQLIRLPIP
FT                   ALTEERRKELAKLAHKYGEDTKISLRNIRRDGNEELKKMEKDNIIAKDEHHSLAEQVQK
FT                   LTDEYSSKVDSAIKQKEQEIMTV"
FT   gene            complement(320085..320804)
FT                   /gene="pyrH"
FT                   /locus_tag="A1I_01650"
FT   CDS_pept        complement(320085..320804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="A1I_01650"
FT                   /product="uridylate kinase"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78720"
FT                   /db_xref="GOA:A8GV49"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV49"
FT                   /protein_id="ABV78720.1"
FT                   /translation="MTSNLKYKRVLLKVSGEALMGDKQFGHDYDTIKKIAGDIKELIDS
FT                   GVEVAIVVGGGNIYRGINAALVGMDRASADYIGMLATVINALTLQNVMESLNIYTRVLS
FT                   AIPMMSVCEPYIRRRAKRHMEKGRVVIFAGGTGNPFCTTDSAAVLRAIEMNCDVLLKAT
FT                   QVDGVYDSDPKKNPNAKKYFTINYKDVITNNLQVMDLAAIAVARENKLPIRVFSIKEQG
FT                   NIAKVVQDQGEYTTIEE"
FT   gene            complement(320801..321115)
FT                   /locus_tag="A1I_01655"
FT   CDS_pept        complement(320801..321115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01655"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   E"
FT                   /note="COG1863 Multisubunit Na+/H+ antiporter, MnhE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78721"
FT                   /protein_id="ABV78721.1"
FT                   /translation="MPTKISIILYFPWLFWEICKSAFSVIKIIWQRNIVVEPVFEWVDA
FT                   EGLKDIGEIIYGNSITLTPGTVTLDINNNMLLVHALDKSSIDDLHNGKMIKKIKRILRI
FT                   "
FT   gene            complement(321105..322343)
FT                   /locus_tag="A1I_01660"
FT   CDS_pept        complement(321105..322343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01660"
FT                   /product="MFS-type multidrug resistance protein B"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78722"
FT                   /protein_id="ABV78722.1"
FT                   /translation="MIIFRALQGFFGGAMIPTVFSTVFIIFPPSQRPKITILIGLVVTV
FT                   APTLGPTLGGYITEILSWHFMFLLNVIPGIFVCSVVFLYGHFDKPNYNLLKNFDFLGIA
FT                   IMALTLGLLQYVLEEGNKKGWLEDNVILFLSIAVALGFILLIIRELTFINPILDLKTFL
FT                   HKDFTFGCLYSFVMGIGLYGAVYILPLFLFTIAGYDTLQIGATMMVTGIAQFLSAPLAG
FT                   RMLGAGVDLRLMLIIGLGGFALGCHLNSFLTPDSKFAEFVLPQFVRGLSLMFCFIPTNN
FT                   IALGNMPREKVGNASGLYNLTRNLGGAVGLAVISTILTNDTKIFMQYLSENIPSTSIMA
FT                   MEQLDSYTALLSGKVFNPEKASYLLLANKINTDAFVIAINNIFNMIALLFILIMLLIPF
FT                   TSNIKLSGNTNAH"
FT   gene            322279..322413
FT                   /locus_tag="A1I_01665"
FT   CDS_pept        322279..322413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78723"
FT                   /protein_id="ABV78723.1"
FT                   /translation="MLKTVGIIAPPKNPCNALKMIIDSMFVASEHNTLIIVKPRAAIK"
FT   gene            complement(322506..322667)
FT                   /locus_tag="A1I_01670"
FT   CDS_pept        complement(322506..322667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01670"
FT                   /product="Multidrug resistance protein B"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78724"
FT                   /protein_id="ABV78724.1"
FT                   /translation="MSNDNSQATPPLSKQQLFAFFGMVVGMFMSVLDIQIVASSLSVIA
FT                   AGLAASSD"
FT   gene            complement(322806..323012)
FT                   /locus_tag="A1I_01675"
FT   CDS_pept        complement(322806..323012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78725"
FT                   /protein_id="ABV78725.1"
FT                   /translation="MNFIRKNFLGVGKNIDINLKNIFRQVNETTEIFNTFLIDKNFTDE
FT                   WDDEDDFDDGVWIEVPLIESKEI"
FT   gene            323531..323968
FT                   /locus_tag="A1I_01680"
FT   CDS_pept        323531..323968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01680"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78726"
FT                   /protein_id="ABV78726.1"
FT                   /translation="MSDTVLQKNLYKFIKERNIQITELERKAELKKNSVYNIIKGISRK
FT                   PSAEILQTIADTLGVSIKDLYNPNIKVNDYLGQDDYILFQKILPEIIKTIKKLNLVVSE
FT                   TEFSQTLNEVFNYYRPTPDESIDNKIIEWILHQRIQEKYSI"
FT   gene            complement(323972..325300)
FT                   /locus_tag="A1I_01685"
FT   CDS_pept        complement(323972..325300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78727"
FT                   /protein_id="ABV78727.1"
FT                   /translation="MKHTIIKIVSCIIAFLIFLIFNISVYYCLIYYQKKEYKGLLKAYA
FT                   SSISSLLTQDLENALNSSIPNKEFFLFKGFEVIPKSKTTVNLITVSANSIRVRNKKEEY
FT                   IFNLHNLKEIINKIFPPFIIYKLSLNNHDIFSERINIDQYLTESKLVEANGILNLKLGI
FT                   KKDSQFYLDGAYLLRRNMLIYSISSFLTLSILVSIYFKIYNTIQQNFRILHQEIYEETE
FT                   INTALINNNKADYDLRKLFIKKLTEIYLKQELGDTYNPNDFPFKNQLFPINLTDLSLTK
FT                   INIENLIKLLQGYFAPYFAKIGIRTTNNIKESEINCSLEVFYQLIFSLVFNLVKFIDRQ
FT                   SNIPQIIKIDFNQDKITITNDCFSLDEKKMIKLSDIIIEEYTDLFILNCYKIFKSLNEH
FT                   KFKYNIFSHDGSHLIEIVYPPLNNSNLNTGKILDFTKYLNNKN"
FT   gene            329125..329331
FT                   /locus_tag="A1I_01700"
FT   CDS_pept        329125..329331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01700"
FT                   /product="hypothetical protein"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78728"
FT                   /protein_id="ABV78728.1"
FT                   /translation="MENPTQKFISFSEHKADIERIKQAIEEGWAIVKLVPNKGRFIGLL
FT                   EKISHAEDDETVYIPPRKKILVN"
FT   gene            329427..329867
FT                   /locus_tag="A1I_01705"
FT   CDS_pept        329427..329867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01705"
FT                   /product="Oligoketide cyclase/lipid transport protein"
FT                   /note="COG2867 Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78729"
FT                   /protein_id="ABV78729.1"
FT                   /translation="MPSFEQTKILPYKPQELFNLVWDIKSYPKFLPWCVASRVISENSE
FT                   EIVADLVIQLKGFSESYRSHVTNKIIDDKEYFINTLAISGPFKYLKSTWQFTSHPVGTE
FT                   LKFFIDFEMKSKIFEKLVGSYFIKITEKMIAAFEERARGIIK"
FT   gene            complement(329911..330402)
FT                   /locus_tag="A1I_01710"
FT   CDS_pept        complement(329911..330402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78730"
FT                   /protein_id="ABV78730.1"
FT                   /translation="MFSKMFNYFASSSKTHLDNTQESAINCGQHSAEAASYAVKTLPQI
FT                   LLGLITFKEISGSVMTGYAFGFALPEFAKVIVKSLASTIFFHPTASMVGTVAVTVAANS
FT                   ENVVECIKNTAHALYDAGSTVYEGTLCAVNGAAAAATFVYDNVYSTDVQLSGNAIEAVL
FT                   "
FT   gene            complement(330522..331205)
FT                   /locus_tag="A1I_01715"
FT   CDS_pept        complement(330522..331205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01715"
FT                   /product="Ribosomal RNA large subunit methyltransferase J"
FT                   /note="COG0293 23S rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78731"
FT                   /db_xref="GOA:A8GV60"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV60"
FT                   /protein_id="ABV78731.1"
FT                   /translation="MTNNLSGYRNKFVRVKTSKKRTVSSSNWLRRQLNDPYVAKARIEG
FT                   FRSRAAYKLLEIHEKFKIFTPNMKVVDLGAAPGGWSQVASKLIKATDGNLKNKIISVDL
FT                   LEIEPIPGVESFQKDFFEKDTEELIIQALKGKADIVLSDMASNTIGHKATDHIRTLLLC
FT                   EQAFEFALKVLNPSGHFIAKIFRGGAENELLNKVKREFSTVKHFKPSSSRKESTEIYLV
FT                   ALNRK"
FT   gene            complement(331195..331665)
FT                   /gene="nusB"
FT                   /locus_tag="A1I_01720"
FT   CDS_pept        complement(331195..331665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="A1I_01720"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78732"
FT                   /db_xref="GOA:A8GV61"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV61"
FT                   /protein_id="ABV78732.1"
FT                   /translation="MSSNKINKKSIARIAAIQAIYQHMLRNNDNIDDIIENVLSFYRND
FT                   TSMTDSPIKISLTISHFKMLVKLVFENIDKIDEIISNHLVNDKNQNHIPILLQALLRSG
FT                   ICELLFFPDIPTKVIINEYTDIANDMLNDHEIGFVNSILDKIAHENKRFYDK"
FT   gene            331871..332929
FT                   /locus_tag="A1I_01725"
FT   CDS_pept        331871..332929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01725"
FT                   /product="Putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="COG0750 Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78733"
FT                   /protein_id="ABV78733.1"
FT                   /translation="MLSIVGFIITISILVFIHELGHYAVARFFNVKIEEFSIGFGKELI
FT                   GITDSKGVRWKICLLPLGGYVKIYGYDRNIMDKTQEINEKVAFYAKSCFERFLIVAAGP
FT                   LINYFLAIIIFAGFYFCLGKVEIQPVIGEVIAESPAEKANLREGDRIVKVNNKLVKDFS
FT                   DVQKEILINGLNSSTLLIERKGEEFTVSIMPEEVVVEKARKILRIGIMAKNEPVHTKIG
FT                   ILSSLSEAICNTIDVSVVTLKAASQMIVGKRSVSEIGGPVAIAKESGRTLEHSIEMYLL
FT                   FIAMLSVNLGLLNLLPIPVLDGGHLLFILYEAVTGKLPNIKARNILLQIGIMIIIFLTV
FT                   ISFSNDIKNLFS"
FT   gene            333021..335327
FT                   /locus_tag="A1I_01730"
FT   CDS_pept        333021..335327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01730"
FT                   /product="Outer membrane protein omp1"
FT                   /note="COG4775 Outer membrane protein/protective antigen
FT                   OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78734"
FT                   /protein_id="ABV78734.1"
FT                   /translation="MIIRSIIKLAILTLTIFYYNISLADSVIRKITIEGNHRIERSTIE
FT                   SYLKLKPGESYNSLKEDEAIKRLYATSLFRNIKMDMSSDGNLIVSVTETPFISSVVFRG
FT                   NSKIKANMLSKEIYTMAGESLSQAKIELDVKKISEIYKRSGRFATIVTPKIEDLENNRV
FT                   KVIFDIAEGPKTGIKYIYFSGNENYSDSELKSIVLTKESRWFRFLDSNDTYEPDRIEYD
FT                   KELLKEFYQSVGFADFRVISVSAELNNTKEYFVLTYSLEEGEKYNFDNVTIENKLTNID
FT                   ITPVNKIVNIKQGSVFNMKTVENIADKIGEYFTAVGYPAVNVYPDIVKNPDHTINIKFI
FT                   IEKADKVYINKINIINNLKTEDHVIRREFKSEEDDILNRSYIEKGERNLRNLDYFEKIG
FT                   ITFAQAKTKDKYDLNVEVDEKSTSSVGFDLGYNTTGGVFGRFSFLEHNLVGTGKILNAR
FT                   VQVSKNTTSYYGGITDPHFLDRDLSLGVSGFINKSGRGQSVLSNTDQNYRQHSVGGKTS
FT                   LGYEIKEDLSHEIDYLIKRDTLSAPSPSSSIFLQEQMGKFITSAIGHTIAYDQRDSKII
FT                   AKNGYLVSVSQEYAGIGGDNKYLKHEVDGKYYKSFIQNKLTLKLSASGGDIAALGGRVI
FT                   RISDRFNLGDYSLRGFASGGVGPREKVTNEGLGGKRYYTFSTELNFPTPVPEEFNLTGA
FT                   VFMDLGSLWGVGLNKAKYQSPNGIYNDKSLRASVGFGFIWVTRFAPIRMDWGFAVKKKK
FT                   YDDTQHFHLRFSTHL"
FT   gene            335984..336059
FT                   /locus_tag="A1I_t07965"
FT   tRNA            335984..336059
FT                   /locus_tag="A1I_t07965"
FT                   /product="tRNA-Thr"
FT   gene            complement(336356..336715)
FT                   /locus_tag="A1I_01735"
FT   CDS_pept        complement(336356..336715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78735"
FT                   /protein_id="ABV78735.1"
FT                   /translation="MFLRSMYIYSKIDYMLNYQYTDKIQKIYNYFTQSDQSNIIHANDS
FT                   KDNLVLLEDFKKQKKTYTNQKFADSLTNYLENLLLQEHYKAFDKINIDDNLNNICNLFE
FT                   INAIMELISSIKSSN"
FT   gene            complement(336687..337052)
FT                   /locus_tag="A1I_01740"
FT   CDS_pept        complement(336687..337052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78736"
FT                   /protein_id="ABV78736.1"
FT                   /translation="MQRKKEEYSKLIYNSSLIFKIKKVALPTLKVFQQEVTKKYPNISI
FT                   KIDTQTIIKEMVDSFSKALSSLFEEDDIKFNNLHYAGGYVLVFFSSNLWTYWKGEYLYP
FT                   KIPGISKSNVFKINVYL"
FT   gene            complement(337108..337335)
FT                   /locus_tag="A1I_01745"
FT   CDS_pept        complement(337108..337335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01745"
FT                   /product="Cation transport regulator ChaB"
FT                   /note="COG4572 Putative cation transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78737"
FT                   /protein_id="ABV78737.1"
FT                   /translation="MPYKNNTDLPDSVKNHLPKHAQDIYREAFNHAFEQYKSPKKRRDN
FT                   DSRETVAHKVAWSAVEKKYHKNDKGDWVSH"
FT   gene            complement(337775..338905)
FT                   /locus_tag="A1I_01750"
FT   CDS_pept        complement(337775..338905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01750"
FT                   /product="DnaJ"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78738"
FT                   /db_xref="GOA:A8GV67"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV67"
FT                   /protein_id="ABV78738.1"
FT                   /translation="MSQDYYQILGVSKTANSADLKKAYHKLAKQYHPDNAAAGDTNAEK
FT                   KFKEINAAYEVLKDEQKRAAYDRFGHDAFQNQQARGGAGSQGGHPFGADINDIFGDFFS
FT                   DFMGGGGRRKPTSSKVRGSDLKYNLTINLEEAFHGVEKNISFSSEVKCDTCHGSGSEKG
FT                   ETTTTCDACGGVGATRVQQGFFMIEQTCHKCQGNGQIIKNPCKKCHGLGRYHKQRNLSV
FT                   NIPAGVENGTRIRHPGEGEAGIRGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVN
FT                   AALGGEVAVPVIEGGKVNLTIPAGTQNGDQLRLCGKGMSKIRSTIRGDMLAHVHVEVPK
FT                   NLSKRQRELLEELRGESANEKENDGSFFNKMKSLWS"
FT   gene            complement(339049..340944)
FT                   /gene="dnaK"
FT                   /locus_tag="A1I_01755"
FT   CDS_pept        complement(339049..340944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="A1I_01755"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78739"
FT                   /protein_id="ABV78739.1"
FT                   /translation="MGKVIGIDLGTTNSCIAVMEGKEPKVIENSEGERTTPSIIAFANG
FT                   EKLVGQSAKRQAVTNPRNTVYAVKRLIGRNFTDPMVKKDQEIVPYNIVKADNGDAWVEV
FT                   EGKKHSPSQISAFILQKMKETAENYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFDKSASKTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFLG
FT                   GEDFDTRILEHLINTFKKESGIDLRNDPLALQRLKEAAEKAKKELSSALTTDINLPYIT
FT                   ADNSGPKHLNIKFTRAELEKLVDDLIEKTIEPCRKALKDAGLKASDIQEVVLVGGMTRM
FT                   PKVQEAVEKFFGRAPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKMLGQFNLEGIPP
FT                   APRGVPQIEVTFDIDANGIVHVSAKDKASGKEQRVTIQASGGLSDAEIEQMVKDAEKNA
FT                   DEDKKHKELIEAKNAADSLIYSTEKTLTDYSDKLSSEDKGGVEEALSALKAVLDSEDAS
FT                   LIKEKTESLTAASMKIGEAMYKAQSDAGAAGSASEENTTSNEKVVDADFEDVEKK"
FT   gene            342638..342958
FT                   /locus_tag="A1I_01770"
FT   CDS_pept        342638..342958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78740"
FT                   /protein_id="ABV78740.1"
FT                   /translation="MTQLLPAPNNNIYNSLTSEDIDMIIECLISEKVSSKLDLAFFKII
FT                   NPRALKHYVNGCNKELIKNIFCHAFENGEKELVANMSEIEPKLKNFLPELLGSDQSSLD
FT                   EV"
FT   gene            343067..344143
FT                   /locus_tag="A1I_01775"
FT   CDS_pept        343067..344143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01775"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78741"
FT                   /protein_id="ABV78741.1"
FT                   /translation="MLQKKSKSEDLLPPPNSEEDRITTPTSAPILSDCKELDLKDCENL
FT                   KKNELKKYFRSITEHNKSIFCQAVEQNKKELVKNILAINTDLIDVKTKLEGHNILHKAL
FT                   AGIVDVEMVKILLENEPYLVARIDNQSLNPYMFGERYGFGIEAQNEQNSKIKKVIEHYE
FT                   KKVASGKVPIRESKSLFIKDTKETPDSLKFLQYLYDKGNEENLKLYIAVNLKQNKDVFY
FT                   QAVMSNKKKLVKKILSYNPKCIDYTNSEGHNVLHIALKNKAKADAEMIEILLQCKPKLI
FT                   TEKNKENLTPLMFGEKYGFSEVLSKKEIDKIKAILKDYERDAIRYDSYLPDPPNEKMVD
FT                   FEDELLGNNLGGVNGTEL"
FT   gene            344127..344453
FT                   /locus_tag="A1I_01780"
FT   CDS_pept        344127..344453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78742"
FT                   /protein_id="ABV78742.1"
FT                   /translation="MGQNYNINNNDEGITPENTLQFFKDKLYLCENNICSMTKNSRDKL
FT                   KYSEKLILDKVLNLAIKNEEYVLLNEMIKLVPVLKNYMYEKGFMDDNNYYVLPMGVDVE
FT                   VLPS"
FT   gene            complement(344507..344800)
FT                   /locus_tag="A1I_01785"
FT   CDS_pept        complement(344507..344800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78743"
FT                   /protein_id="ABV78743.1"
FT                   /translation="MININLKGAKNFFKLIKNFAKPKMDNARNTAINNITKQDLEKSFK
FT                   LYEKKLIELSQKFSLQAATNNDNYYPKTEWHNVEVMGADGNIVVKTIPVTEL"
FT   gene            345274..345765
FT                   /locus_tag="A1I_01790"
FT   CDS_pept        345274..345765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78744"
FT                   /protein_id="ABV78744.1"
FT                   /translation="MRYLFIVFLLLFVNGCNLKPVYNTEYSNSEVVKNLESIEVEPIKT
FT                   IEGSEFYHRLTSILPQKTKAKYILKAELAGATTPATIEKNSNVLREYINQSVKYQLVDI
FT                   ESQKVLIKEKFYQSTSYNSIFTPYASSVERDETGIDLAYAAAEEIRSRIILYFTRNNNL
FT                   "
FT   gene            345762..346754
FT                   /gene="holA"
FT                   /locus_tag="A1I_01795"
FT   CDS_pept        345762..346754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="A1I_01795"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78745"
FT                   /protein_id="ABV78745.1"
FT                   /translation="MKFYFSQINRLFELIANGKVKALLLYGPDKGYIDKICRHLVKKFN
FT                   MLQTSIEYSDLNISSLEILLNSPNFFNQKELIRIKGVGNSIDKNLKVILNDNYINFPVF
FT                   IGEDITSSSSFRKFFETEESLASLACYHDDEAKIEKIVLEKLAKCNKIIDREALIYLKN
FT                   HLKGDHELVSNEINKLIYFVHDKQEVTLNDIKEVLSSEIIANGSDLAMYFSQKNYVSFL
FT                   KELDILKKQNINEVLMIRALIRHYLNLYIVLAKVKNGERVDSAIKSLSPPIFYQYINDF
FT                   TKIANSLNLAECLKTLRILQQAEVDYKLNPAGFDLLQKIVDVIPAFSYE"
FT   gene            346775..347314
FT                   /locus_tag="A1I_01800"
FT   CDS_pept        346775..347314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01800"
FT                   /product="Ubiquinone biosynthesis protein coq7"
FT                   /note="COG2941 Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78746"
FT                   /protein_id="ABV78746.1"
FT                   /translation="MPRPDFSDPDKQIQEIIRVNHAGEYGARRIYQGQLKYTKSQNDYV
FT                   LIKEMLEQEEVHLDYFEKKLLEKKVRPTALLSFWHHYGFLLGAVSSKIGTKTAMLVTES
FT                   VEEVIEKHYAQQINYLENKGIEPELLDNIVKFRLDEIEHKDTAIINDSEQAIFAKATSS
FT                   VVKAICRIAIKLSKKI"
FT   gene            347761..348594
FT                   /locus_tag="A1I_01805"
FT   CDS_pept        347761..348594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01805"
FT                   /product="Cytochrome c oxidase subunit III"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78747"
FT                   /protein_id="ABV78747.1"
FT                   /translation="MNNSHPTTKSHLFHIVDPSPWPILTSFALLILVAGGVSFMHSYKF
FT                   NHYILAFGVISVAYCLYSWWRDVIKEGIIDHSHTEPVRHGLRIGMALFILTEIMFFGVF
FT                   FASFFKSSLSPVGLLDGVWVIKQGVWPPPNIKVFDPFDIPFINTLILLLSGTTVTWAHY
FT                   ALEERNQKDCVTALGLTIILGIFFTCMQAYEYYHAAFKFTDGIYPSNFYLATGFHGAHV
FT                   IIGTIFLIVCYFRARRGDFAIKNNGHLGFEFAAWYWHFVDVVWLFLFTFVYIFGS"
FT   gene            348760..349128
FT                   /locus_tag="A1I_01810"
FT   CDS_pept        348760..349128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01810"
FT                   /product="VirB2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78748"
FT                   /protein_id="ABV78748.1"
FT                   /translation="MNLRKLNEELIDYNMSLRLLFMVLGLAIITMSMDSLAAASIGDPV
FT                   GAALCNVILVFRGNTARGIAVVGIIVLGIQTLRGKLQWEVALVIVAAIIILFKAPDIVS
FT                   MVSDSTGNANCGTTSVTS"
FT   gene            349375..350136
FT                   /locus_tag="A1I_01815"
FT   CDS_pept        349375..350136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01815"
FT                   /product="DNA uptake lipoprotein"
FT                   /note="COG4105 DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78749"
FT                   /protein_id="ABV78749.1"
FT                   /translation="MKLAKILSALLCLGLILNGCKSKKSNDDLVTPISTLYNEGVTLLE
FT                   KKKYKNAAEEFEKIFYQHPGNEFTPQAELMQAYSLFLAAQYEEAVDVLDIFINLHPANV
FT                   DIAYAYYLKALSYYMLISDVNHDQSRTFLAKDSFEDLITKFPNTKYAIDSSLKIDLVND
FT                   HLAGKELTIGRFYLKKKNPMAAINRFEEVVENYQTTSHCVEALYRLTESYMMLGLSDEA
FT                   MKYASVLGHNYPDSKWYSYAYKLIKGYNIGK"
FT   gene            350272..351924
FT                   /locus_tag="A1I_01820"
FT   CDS_pept        350272..351924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01820"
FT                   /product="DNA repair protein RecN"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78750"
FT                   /protein_id="ABV78750.1"
FT                   /translation="MFHSLSVKNFILIDELEIEFTNGLCVITGETGAGKSILLDAILFC
FT                   LGYKTSSAGIIKHGKDYAAVNIVFSLNDEIKNFLTQNFIELEESLLIKCVQKAEGRKNF
FT                   FINNQVVNKAIMQQLATYLFELHGQNNNISLLEINTQRDILDSFGDLLELRMQLAKCYQ
FT                   AWQNIRNEIAEIALKQNSIEQEIDYLNFVTEELIKLNVQTGEEEQLTNIRKDLQNKDKD
FT                   LQLIKDIFEQVNNPEINSSISKAEKLLAKQSQNEEFANISTNLEEAYNNLEEARQNLSN
FT                   LLENFNKLDYNLEEIEERLFAIKAISRKYNVSADALKTFLEESLNRLNSLKGKIANQAE
FT                   LQVQEAKLSTEYYKLGKDLSGKRLAAAKRLEEVLHHELKQLKMEKATFHVNIAERKEAA
FT                   AYGIDDIVFKASTNPGMSPEAINKIASGGELSRFMLALKTSLFNKMVKPAIIFDEIDVG
FT                   IGGEVADKVGERLKKLSSATQVIVITHQPQVAGKADLHIKIEKTQLEKETKVTVKALNL
FT                   AERQQELARMISGKAITEASLKAAKELLCHPVA"
FT   gene            351989..353476
FT                   /locus_tag="A1I_01825"
FT   CDS_pept        351989..353476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01825"
FT                   /product="Thermostable carboxypeptidase"
FT                   /note="COG2317 Zn-dependent carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78751"
FT                   /protein_id="ABV78751.1"
FT                   /translation="MNNYKKLENELSTISNFENILSILYWDIAVNMPIGSGESRTNEMV
FT                   SLTSLVHSLVKSPLLKELVSRAKEEAKNLDEWQNANIREIEQKILDANCIDEELQKRIV
FT                   AATTKAELVWRKARKTNDYNLFKPHLQKVLDYTREVAKVRAGVFNCSPYDALIDMYDPS
FT                   RTSSEIKKVFSYVKENLSELIGKVLEKQKSQKELVKSTELSPEIQKNIGKRIMEIMQFD
FT                   TTKGRLDESTHPFCGGTPNDIRLTTRYDKDNFISGLMGIIHETGHALYEQNLPEMYKGQ
FT                   PVGRAKGMAFHESQSLFMEMQVGRSREFTEFLAKLLRDEFNLKSEEYSADNLYRAITKV
FT                   EPDFIRVNADEVTYPMHVILRFEIEELLISGELNLDELPNFWDSKMQEYLGIKPRSFSE
FT                   GCLQDIHWSSGWFGYFPAYTNGAIIASMVMKKVKEINKSVKDDILKGDFSNLNNYLNKN
FT                   FRNFGSLKNSPDLLKSASGEENINPEVFIKYLEEKYL"
FT   gene            353742..356525
FT                   /gene="kgd"
FT                   /locus_tag="A1I_01830"
FT   CDS_pept        353742..356525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgd"
FT                   /locus_tag="A1I_01830"
FT                   /product="alpha-ketoglutarate decarboxylase"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG0567 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78752"
FT                   /protein_id="ABV78752.1"
FT                   /translation="MEENLKKTGFLFGGNAVFIEELYKQYLENPASVDQTWQEFFSSVK
FT                   DSNQLLNKSTAKIILKAAATEESKTSENPVSTTNNFNVGAMIKNYRKYAHYLAKLDPLG
FT                   LEVTKTKEDLKLSIENFGFTNDHLSKVIEHKFLEKTYNLGELVNFLDKTYAGSIGVEFE
FT                   QVENAEEKNWLYSKLESGVISFSSEEKKNILNDLVEVEGFEQYLHTKFPGAKRFSVEGG
FT                   DASIVAMNKAIDLSLHQGVEEIVIGMAHRGRLNTLTKVVGKPYRAVIAGFISGSVFPDE
FT                   LNVSGDVKYHLGYSSDRVVGDKKIHLSLADNPSHLEAVNPIFAGKVRAKQDMLKDNKRS
FT                   KVKAILVHGDAAFCGQGVVAESLSMSPLAAYNIGGVLHFVINNQLGFTANAADTRASRY
FT                   STEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVIVEIICYRKYGHNEGDEP
FT                   MYTQGKMYNIIKSKLTPGNIYANELVKSGVIDNNYFAKLKEQFKAKLDKEYEQAKNYKQ
FT                   EAHFLGGLWQGITRTRTQVAVTGVDKKTLQSLGTKLCEMPKDFAVNPKLVKLFDARKAA
FT                   LTADQPIDWATAEQLAFASLLTSGTNIRLTGQDCGRGTFSHRHSVLHNQVDDTTYIPLN
FT                   NLSKEQATYEVADSNLSEYAVLGFEYGYSLANPKNLVLWEAQFGDFANGAQIIFDQFIS
FT                   SSETKWLRMSGLVVLLPHGFEGQGPEHSSARLERFLQLAAEDNMYVTYPTTPASIFHLL
FT                   RRQIIDNVRKPLIVMSPKSLLRHKNVVSKLDELGSNTTFLPVLDEVNKLEASNITKVIL
FT                   CSGKVYYDLFEMRGSNSSIAIIRLEQLYPFEKKVVVELLKKYNKASEFIWCQEEPMNMG
FT                   AWRYITSHLNNALKEAGINNEFKYIGREESASPAVGSLQAHNKQQEKLLKEALGVK"
FT   gene            356527..357729
FT                   /locus_tag="A1I_01835"
FT   CDS_pept        356527..357729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01835"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78753"
FT                   /protein_id="ABV78753.1"
FT                   /translation="MGVKIIVPSLGESVTEATIAKWYKKEGDAVKTDELLLEIETEKVT
FT                   LEVNSPCNGTIGKIIKADGANVAVGEEIGDINEGEAVATNSNEAAKPQTASQPVPEKVP
FT                   EKPAVANNTLAPSVQKLVTENKLDPNNIKGTGKDGRITKGDVLETMNAPTPAATSTTSS
FT                   AKASEERVERVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRGKYKDEFEKK
FT                   HGVKLGFMSFFVRATIEALKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRD
FT                   ADKMGFADIEKTIGGLAKKARDGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGI
FT                   LGLHKTEERVVAIDGKIEIRPMMYIALSYDHRIIDGKEAVSFLVKIKELIESPEKLLLN
FT                   L"
FT   gene            357750..358166
FT                   /locus_tag="A1I_01840"
FT   CDS_pept        357750..358166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01840"
FT                   /product="Putative 6-pyruvoyl tetrahydropterin synthase"
FT                   /note="COG0720 6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78754"
FT                   /protein_id="ABV78754.1"
FT                   /translation="MIKCTRRIEFDAGHRIIGHQNKCQYLHGHRYVLEITIAAKNTDEL
FT                   GMVVDFGLIKDLAKGWVDENFDHSLILHQGDKEIGQKIESHTGQKVYYLKNNPTAENIA
FT                   LHLKNEIFPKLFESQKFFVTNIKLFETPNCFVEV"
FT   gene            358169..358483
FT                   /locus_tag="A1I_01845"
FT   CDS_pept        358169..358483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01845"
FT                   /product="Periplasmic divalent cation tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78755"
FT                   /protein_id="ABV78755.1"
FT                   /translation="MQEFCLVLTTTNDLQIAEKIASLLLELDLAACIQIDDVKSYFKWE
FT                   GKVNFEKEYRIIIKTRSSNYKEIENKILEVHNYELPQIIKINIDCGFQKYLEWINQNCK
FT                   "
FT   gene            358533..359738
FT                   /locus_tag="A1I_01850"
FT   CDS_pept        358533..359738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01850"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /note="COG1301 Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78756"
FT                   /protein_id="ABV78756.1"
FT                   /translation="MKLWQKVTLGLIFGIIFGIYLPQYVDYIKPVGDIFLRLIKMIIAP
FT                   LIFFSLVSGITSMNDTSALGRVGMKAVVAFLGTTFFATVFGLAVAAILKPGVGMHIDFS
FT                   PSGSSKVERTSFNIIDFFVNIVPDNAVGAFANGDVLQVVFFAVFVGITLNKMKAAAEPI
FT                   TDLIHLMSKLVLKMISFVIQLSPYGAFALTAWIIGTQGIEVMISLSKLVIAVVVAMTFQ
FT                   YLVFGLLIYIFCRVSPIPFYKKSFEYQILAFSTSSSKATLSTTMQVCREKLGISESSTS
FT                   FVLPIGASINMDGFAINLSLTTIFFAQMMGVTLAPHDYLVIILTSTLGSIGGAGIPGAS
FT                   LIMLPMVLSSVHLPIEGVAIIAGIDRILDMLRTTINITGDATITMLVDNSEGTLDKEVY
FT                   LS"
FT   gene            complement(359741..361726)
FT                   /locus_tag="A1I_01855"
FT   CDS_pept        complement(359741..361726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01855"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="COG0556 Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78757"
FT                   /db_xref="GOA:A8GV86"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GV86"
FT                   /protein_id="ABV78757.1"
FT                   /translation="MSNFSIISDYKPAGDQPKAIDEIIKGLNNKKRSQMLLGITGSGKT
FT                   FTMANIIERTNRPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYYDYYQPEAYIPKT
FT                   DVFIEKDSSINEQIDLMRHSATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMTVNLEPG
FT                   KSYPRDKLLNDLVNLQYERNDIGFERGCFRVKGDNVDVFPSHYSDKAWRLSFFGNELEY
FT                   IHEFDPLTGEKLVKLDKAIIYGNSHFVMPKETVNKAISEIEEELQKRIAFLKSQDKLLE
FT                   TQRINQRTQYDLEMLTETGSCKGVENYSRFFTGRKAGEPPPTLFEYLPKDALLFVDESH
FT                   VSVPQIRAMYNGDRARKEVLVEHGFRLPSALDNRPLKFEEWDNFRPQTVFVSATPSLFE
FT                   LNETGGEVVELIIRPTGLLDPECIIKPATNQVEDLVGEIQSTIAKGFCVLVTTLTKKMA
FT                   EDLTNYLQELKYKTSYLHSNVHTLERIEILRDLRQGTIDILVGINLLREGLDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSEGRVILYADKMTKSIDKAISETMRRRTIQQE
FT                   HNEKYGIIPKTINRTIHALAELEKVDSKLDKKQTHNLFENPAKLKAHIDKLRKEMLKAA
FT                   SNLEFEQAAKLRDQLKTLEEAALELS"
FT   gene            361797..362093
FT                   /locus_tag="A1I_01860"
FT   CDS_pept        361797..362093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01860"
FT                   /product="Glutaredoxin GrxC"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78758"
FT                   /protein_id="ABV78758.1"
FT                   /translation="MNKAILHAIIIYTLAGCPYCMKAKALLDKKEVAYEEIEVQNSQDP
FT                   NVAVLRKKLNNPDRLTFPQIFIDNMHIGGCDDLYDLDKEGRLDKLLEGQPKKD"
FT   gene            364142..364645
FT                   /locus_tag="A1I_01875"
FT   CDS_pept        364142..364645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78759"
FT                   /protein_id="ABV78759.1"
FT                   /translation="MKGKNSDNFCKDLVFSGSGTITGVISGAETFSNSSTELKVKSLGG
FT                   DNTTIISGTIDFANPILENSWSGATITGNVGTTTSFAGVIIQADPEAKHVEKARYMDVN
FT                   EINFDEIAPSEHSAHIKYIEQNLGVKVFYPAGPEGDQAVRIEGMKVIGLTSEGKYLVDG
FT                   NIEN"
FT   gene            365136..365315
FT                   /locus_tag="A1I_01880"
FT   CDS_pept        365136..365315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78760"
FT                   /protein_id="ABV78760.1"
FT                   /translation="MSNQNTKTISNITLDFVEKEINTLKDEVAHLLENPATEKNIERIE
FT                   QRLEELEKMLYNVV"
FT   gene            365588..367954
FT                   /locus_tag="A1I_01885"
FT   CDS_pept        365588..367954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01885"
FT                   /product="Bifunctional penicillin-binding protein 1C"
FT                   /note="COG4953 Membrane carboxypeptidase/penicillin-binding
FT                   protein PbpC"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78761"
FT                   /protein_id="ABV78761.1"
FT                   /translation="MSLKIKLFLITIISGIILYFVIPPTPLLEKVSFSQRVFDRNGELM
FT                   RISLSKDDKYRIFTPLDEVPQSFIEAVLLYEDKHFYKHFGINPSSLIKAFYSTYLKNDR
FT                   KIGGSTITMQVARLKYRINSATIFGKIHQIIKAIHIELHYSKDEILTAYLNLVPYGSNI
FT                   EGISASSYIYFNRDLKSLNLIDILSLAVIPQNPLKRGGNNINILDMRKYLFTKWLETHP
FT                   QDIIYKELINLPIKFSQSKNLPFIAPHFTLDILADNNSLVIYTTIDKSLQTILEKQVQL
FT                   YVNDQKKYGINNAAVMLVDFTTMEVLASVGSSNFFNNDICGQINGVKSSRSPGSSLKPF
FT                   VYALSFDQSLIHPLTLLKDTPTYYDNYKPENFDSRFAGGLSAKESLIKSRNVPVIFLAS
FT                   KLKNPNFYEFLQQTKISNLRKPESYGLSIVLGTAEVTLEELTTLYAMLANLGVYEPVRK
FT                   VLDLSFPQKRESSAIILQFDNDMTKLLDSRFCGNDIPETHLNLLSPEASYLTLDIIKDT
FT                   TRPLNYNTKINIPVYWKTGTSSSFRDGVSVGIFGKYVLAVWVGDFKGQTHGSFTGNGSA
FT                   APLFFNIIESIIDPNKDKDLIAAKINDLNITKVKVCADTGDLDNDMCPVKTKTLFIKGK
FT                   SPIKQSGIYRKMLIDLKTGMPACNFIEGQTEYKIVNLWPTDMLSVYQKAGIHILPKPIP
FT                   ANYCNSLINWYHQKPKITHPLKNSIYSIKNSDNIILNAIGDNKTNNIFWFVNNELIAVA
FT                   KPNEAVKWKAKIGEFVIRAINDSGQSDSVKIYIKY"
FT   gene            367955..368929
FT                   /locus_tag="A1I_01890"
FT   CDS_pept        367955..368929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01890"
FT                   /product="hypothetical protein"
FT                   /note="COG1163 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78762"
FT                   /protein_id="ABV78762.1"
FT                   /translation="MVTSMSKTIEVIIESESEDEEEYFEPLSDDVHNFNFLKEQALKLL
FT                   PEVNYLLKKAGKENVIVIGPSDSGRVDVLKTLTNENSEQFSSQYASNINLPKGLKVNDK
FT                   VLWECSNKIKTNTTDKESILQALVNRFFLKNILQNSDKVGFIVVAPQKTTVNETVENFI
FT                   AIIDYFIDIFPEANRENLKENVTFVVTKFNKNTQEPFVQLLKNQEVILEYFPQLFEDLY
FT                   YLYASNTPNEEVTLKLENINTSEKKINIKKLNSLFSIDHYNAAHLELVQSLYDSRESNI
FT                   SKIYDVIRLIFTEKALIYIQRLIAQNFVICLIIIILFNHFPKN"
FT   gene            368941..369477
FT                   /locus_tag="A1I_01895"
FT   CDS_pept        368941..369477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01895"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78763"
FT                   /protein_id="ABV78763.1"
FT                   /translation="METNPSHFPGLQQLFELEEVLKQQDNDKLPTGLKVLSILKKFVND
FT                   KAIHDKMEDYYYVLDQQIREVLFFKEALNSNKSYKLEICKSFIKDNYLSSIKNIQPQDN
FT                   KPIEYYREAIKWLNIYNEPKEIEKTKSACYLKIANLLSKAENYEEALANYHYALKYNEN
FT                   CKTIYIMKWLIYYID"
FT   gene            369453..369821
FT                   /locus_tag="A1I_01900"
FT   CDS_pept        369453..369821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78764"
FT                   /protein_id="ABV78764.1"
FT                   /translation="MADILYRLGKKQAAVEFYKPNNKFFHILKTLDSISNDDIDNVTPY
FT                   RQKGDYLISQKQDEEAAYQYILAMSVESTPCKKQNILFEIISALEGTLSVEPNPTCISV
FT                   DMREKYMPEVIGKYPEII"
FT   gene            complement(369886..370080)
FT                   /locus_tag="A1I_01905"
FT   CDS_pept        complement(369886..370080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78765"
FT                   /protein_id="ABV78765.1"
FT                   /translation="MKRKKKRLRSQNSKKELKLILLTFAIILTSFLTFCYFFFSYVEEK
FT                   AAEYKLQQEAEFKEANNKI"
FT   gene            complement(370204..370659)
FT                   /locus_tag="A1I_01910"
FT   CDS_pept        complement(370204..370659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01910"
FT                   /product="Lysozyme"
FT                   /note="COG3772 Phage-related lysozyme (muraminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78766"
FT                   /protein_id="ABV78766.1"
FT                   /translation="MLALQLAKVLIKQFESLQLTPYYCPAGLKTIGYGHVIKPHEMLHL
FT                   ANKITEEDAEKLLDADIAEVNCVLYKYCHSSLNINQQVALISFIFNCGSTAFKNSTLLK
FT                   KLNQNKYLEAADEFLKWIYVKGKKLKGLVKRRQIERAIFLGKNTTEN"
FT   gene            370889..371482
FT                   /locus_tag="A1I_01915"
FT   CDS_pept        370889..371482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01915"
FT                   /product="Tellurite resistance protein-related protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78767"
FT                   /protein_id="ABV78767.1"
FT                   /translation="MITKSIQYYDNNAQSFYDKTINLDLSDSYKEFISYLPEKAHILDA
FT                   GCGAGRDTKYFLSQNYQVTAFDGSSEMVKLASKATGIDILHLSFQDMDFENIFDGVLAQ
FT                   ASLLHVPYSETKDVYKKIHRALKPDGIFYACYTHGDDLVQADDRDFYNMNEDIVKPYFD
FT                   GLFDVIKMWTSEDGRISASKDKLWFNFIVKKIYL"
FT   gene            complement(371500..371838)
FT                   /locus_tag="A1I_01920"
FT   CDS_pept        complement(371500..371838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01920"
FT                   /product="hypothetical protein"
FT                   /note="COG2337 Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78768"
FT                   /protein_id="ABV78768.1"
FT                   /translation="MDFLMEKGDIIICVLSGDYGKPRPAVIVQSDLFNETHASITICPI
FT                   ITYLLEAPLFRLSLIPSKLTGLISESQIMIDKIITIKSEKIDRKIGKLSSNEMIKLDNA
FT                   LKLWLNLS"
FT   gene            complement(371826..372077)
FT                   /locus_tag="A1I_01925"
FT   CDS_pept        complement(371826..372077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01925"
FT                   /product="hypothetical protein"
FT                   /note="COG0506 Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78769"
FT                   /protein_id="ABV78769.1"
FT                   /translation="MAKSITTSIRLELSLNKKLEKAAHDLHRGKNWLITEAILMYLKQL
FT                   ENSSLAEEAKQQSLLVSKMEKSDNDLWETNSDQTNWIF"
FT   gene            complement(372148..372546)
FT                   /locus_tag="A1I_01930"
FT   CDS_pept        complement(372148..372546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78770"
FT                   /protein_id="ABV78770.1"
FT                   /translation="MFRKYFSGLFILLILSAAMYGTEGNLKLKELLDVMPQIANATSSS
FT                   SAHPEICSSKVTINGVNYEVRYFSFEDTSKNLPPNMTFKEYAEKQNLLDMKSSYSNPLP
FT                   GIDFESFDFRNVNLGDGVYFSMALRKTE"
FT   gene            372667..372885
FT                   /locus_tag="A1I_01935"
FT   CDS_pept        372667..372885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01935"
FT                   /product="hypothetical protein"
FT                   /note="COG3657 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78771"
FT                   /protein_id="ABV78771.1"
FT                   /translation="MLQKSLLIYRLSCHYKNIQGKLYELRFFFSRGYRIYFTEKNNEII
FT                   LLLNAGDKDTQSKDIKKALEIMEEIYK"
FT   gene            372895..373194
FT                   /locus_tag="A1I_01940"
FT   CDS_pept        372895..373194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01940"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG3636 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78772"
FT                   /protein_id="ABV78772.1"
FT                   /translation="MEKFTDYLKEKLQNEETLIAYINEALEQYSLDHNKELFLVTLKEA
FT                   IIAKGGVTKISREAHINRQHLYKMLSSKGNPSFDNVRTLLSVLGLQLKVEVCTL"
FT   gene            complement(373290..373784)
FT                   /locus_tag="A1I_01945"
FT   CDS_pept        complement(373290..373784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01945"
FT                   /product="Leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78773"
FT                   /protein_id="ABV78773.1"
FT                   /translation="MDNLIKFLEEKDFTEEAVNLKNGSDILNLSKKRLTDKDVKEISKL
FT                   LASDNNIIQLDLFGNNISTNGAIELAKLLKLNKTLIGLDLGNNDIDKIGASEIEKALKA
FT                   NTTLIFLNLTWNSVESAKYKNIKKYLVRNANLTNEQELVKMAKKFNEIDEEKLLMKLDI
FT                   I"
FT   gene            complement(374077..374162)
FT                   /locus_tag="A1I_t07967"
FT   tRNA            complement(374077..374162)
FT                   /locus_tag="A1I_t07967"
FT                   /product="tRNA-Leu"
FT   gene            374381..374683
FT                   /locus_tag="A1I_01950"
FT   CDS_pept        374381..374683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01950"
FT                   /product="Cold shock-like protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78774"
FT                   /protein_id="ABV78774.1"
FT                   /translation="MPQGKIVLHSEFFIKHNLNSNKQFLSKKVFMTTNIVGKVKWFNPT
FT                   KNFGFIEQENGGKDVFVHRSAVDAAGLAGLNEGQDVIFDLEDKNGKISAVNLRIK"
FT   gene            375104..376339
FT                   /locus_tag="A1I_01955"
FT   CDS_pept        375104..376339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01955"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78775"
FT                   /protein_id="ABV78775.1"
FT                   /translation="MKNFNLPEELTTTLEAMKITEPTEIQKQSIPVAIAGSDILASSQT
FT                   GSGKTLAYLLPVINAFIKDKTTTLILVPTRELATQICSTLNKVTTSFKINNAVLIGGEP
FT                   MPKQFTQLKKNPKVIIGTPGRIIDHLNRGSLKIDRIGITVLDEMDRMLDMGMKEQLEEI
FT                   NKFLPEKRQVLMFSATMPKHIISLSQKYLNNPVRITVGATNKAAAEIKQESVHITDKEK
FT                   FTELNKQLGDREGSVIIFVKTKRSADQLAKMLRYENHKAEAIHGDLSQRQRDRVILSFR
FT                   KSNHRIMVATDVAARGLDIPHTQHVINYDLPMCPEDYLHRIGRTGRAGAKGNALSFISP
FT                   DDVIRWRAIDRLINQGESTPRESFRSNKNNRKRSFGNNRRGDNSNKRFGSSNKRSSEGD
FT                   SNNYGQRRSKVS"
FT   gene            complement(376825..376968)
FT                   /locus_tag="A1I_01960"
FT   CDS_pept        complement(376825..376968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78776"
FT                   /protein_id="ABV78776.1"
FT                   /translation="MGLKPVKIYTQQIQLSSEKIKQYLYPRLFEGIKLIFSSSGPHRNL
FT                   NM"
FT   gene            377033..377866
FT                   /locus_tag="A1I_01965"
FT   CDS_pept        377033..377866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01965"
FT                   /product="AmpG"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78777"
FT                   /protein_id="ABV78777.1"
FT                   /translation="MLLQSSQMLLINNKNWGISEAACTSGFRIGILISGSGALYLSTII
FT                   SWQEVYRTMAILCVPSLLLIIFYPLKFKEKIAVNDFDRFWHAFYDFIKKPKWLIIVGFM
FT                   LLYRLQDNFLAVMPNMFYLDIGYTKKDLALGYKAFGMCATIAGGFIGGFLCRKYEYTYI
FT                   FKRVLVYHALSSITFLLLYSYSQTITTLYIAVFLQEFTKGLTMSPFFSYQLRCCSSKYC
FT                   ITQIALITSIAYISTVLFGSISGYAATYLGWGYFFAIASFCFIPAYILIRYLPRV"
FT   gene            complement(378133..378300)
FT                   /locus_tag="A1I_01970"
FT   CDS_pept        complement(378133..378300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78778"
FT                   /protein_id="ABV78778.1"
FT                   /translation="MNIKLDSYEQDIEDNFEKHQEIDDPALITLFQKATKAHIDKKIYI
FT                   LKILQKLVSQ"
FT   gene            378398..378955
FT                   /locus_tag="A1I_01975"
FT   CDS_pept        378398..378955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01975"
FT                   /product="NifU-like protein"
FT                   /note="COG0694 Thioredoxin-like proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78779"
FT                   /protein_id="ABV78779.1"
FT                   /translation="MFIQTEDTPNPDAIKFFPGQEISTQPIFFSERAEVKGKSKLAESL
FT                   FNINNVKSIFFGSDFITVTKKTESDWQVIKPEVLMVVMDHFVAGFPVFEVSSKVDDVNL
FT                   EGFSDIEKQIIEIIETRVRPSVAQDGGDIIYKGFENGVVKLALRGACLGCPSSTITLKN
FT                   GIESMLKHFVPEVIEVEAVEEE"
FT   gene            complement(379066..379359)
FT                   /locus_tag="A1I_01980"
FT   CDS_pept        complement(379066..379359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01980"
FT                   /product="Ecotin precursor"
FT                   /note="COG4574 Serine protease inhibitor ecotin"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78780"
FT                   /protein_id="ABV78780.1"
FT                   /translation="MKDCNNMRFGGKLEEKTLDGWGYNYYVIDQVGDHPITTLMGCPGV
FT                   KATMQPVNVYLGDKAFIRYNSKLPIVVYAPKDVKLQYVIWNQDDTINDAKEE"
FT   gene            complement(379644..381023)
FT                   /locus_tag="A1I_01985"
FT   CDS_pept        complement(379644..381023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01985"
FT                   /product="cell division protein FtsZ"
FT                   /note="COG0206 Cell division GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78781"
FT                   /protein_id="ABV78781.1"
FT                   /translation="MALINIKAPENIILKPHITVFGVGGAGSNAVNNMIGANLQGANFV
FT                   VANTDAQSLEYSRCENKIQLGVSTTRGLGAGAAPEVGAAAAQESENEIRNYLENSNMVF
FT                   ITAGMGGGTGTGSAPVIARIAKELGILTVGVVTKPFHFEGGHRMKTADKGIIDLQQFVD
FT                   TLIVIPNQNLFRIANEQTTFADAFKMADDVLHAGVRGVTDLMIMPGLINLDFADIKAVM
FT                   SEMGKAMMGTGEASGEDRATKAAESAISNPLLDHSSMCGARGVLINITGGPDMTLFEVD
FT                   NAANRIREEVNNKDANIIFGSTFNPELKGIIRVSVVATGIDADKIPLYKPVNSSVTDLS
FT                   IEEDEDTKLRAQSTQGDQPVHIEEIPNFNSYSNDEAEIADSLDQAPNSTNDDMEPRVSL
FT                   TNDAGETPKSSFFVRMWGSLRTQNNNQIPERKNVVVGMPDEETKESDIHDIPAFLRKKR
FT                   D"
FT   gene            complement(381313..381858)
FT                   /locus_tag="A1I_01990"
FT   CDS_pept        complement(381313..381858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78782"
FT                   /protein_id="ABV78782.1"
FT                   /translation="MTDPYVEYAIAILPSSEVAQQFTDINTKLAKQLVPQGLEHKHNKC
FT                   HVTLYHGVYNFLDLPKISAKLADIAYNTKNITLNFKNEIIVTGPNRWIDINIKRFDEND
FT                   KVKKDYEAICDLHNKIVDTFNEYHKRPLERASNTLETLKPKIEAQDENALKIAKQIEKY
FT                   GVSGVKELYNPHTTIWYQ"
FT   gene            complement(382169..382930)
FT                   /locus_tag="A1I_01995"
FT   CDS_pept        complement(382169..382930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_01995"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78783"
FT                   /protein_id="ABV78783.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(382936..383124)
FT                   /locus_tag="A1I_02000"
FT   CDS_pept        complement(382936..383124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02000"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78784"
FT                   /protein_id="ABV78784.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            complement(383536..383790)
FT                   /locus_tag="A1I_02005"
FT   CDS_pept        complement(383536..383790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02005"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system Phd"
FT                   /note="COG4118 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78785"
FT                   /protein_id="ABV78785.1"
FT                   /translation="MKQNLSNQINLLEAKTHFSNLIQRVQDGEQITICKHNTPFAVLSP
FT                   ITQKPKIKTEDIVEQIMEFNKDKTLAPYTIKELRDESRR"
FT   gene            complement(383887..385278)
FT                   /gene="fumC"
FT                   /locus_tag="A1I_02010"
FT   CDS_pept        complement(383887..385278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="A1I_02010"
FT                   /product="fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /note="COG0114 Fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78786"
FT                   /protein_id="ABV78786.1"
FT                   /translation="MTNYRTESDSFGEIQIEDKFYWGAQTQRSLENFKIGKQKMPEILI
FT                   RSLAILKKCAAKVNLEFGDLEPKIAESIDKATSRILNAEFSDNFPLVVWQTGSGTQTNM
FT                   NMNEVIASIANEELTGMKGGKSPVHPNDHVNKGQSSNDSFPTAMHIATVLATREKLIPA
FT                   LNNLLTALQNKSKDWDSIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKV
FT                   YLLAQGGTAVGTGINSRKGFDIKFAEEVAEFTKQPFKTAPNKFESLAAHDALVEFSGTL
FT                   NTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCTQV
FT                   MGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIDLLSDAANSFVTHCVDGIEPNITHIN
FT                   DLRDKSLMLVTALNPHIGYDNAAKIAKEAHKHGITLKEAAKKLNLLSEEEFNKIVVPEK
FT                   MVRQS"
FT   gene            complement(385275..385733)
FT                   /locus_tag="A1I_02015"
FT   CDS_pept        complement(385275..385733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78787"
FT                   /protein_id="ABV78787.1"
FT                   /translation="MSQNILQNKQIIKSFEKQLNIFLDEYKEREITNIVLSNFLDKVIN
FT                   NLKHEKLISDTLFEVYQGKAVIAKPLHTDYPQSPEQARDENWQKFYSFNHDIMIENTIG
FT                   FIAKNLKKASIKDKLYYSFAKLSEQLDLNAISDHFMNKINNYITFNDL"
FT   gene            complement(385934..386659)
FT                   /locus_tag="A1I_02020"
FT   CDS_pept        complement(385934..386659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02020"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78788"
FT                   /protein_id="ABV78788.1"
FT                   /translation="MQNKKLDSKNYYYIYGKHPVFSALNNPKRQIEDILCTQMIFDANK
FT                   KLISSKPYKIVNNDVLSKLLENQTHQGIAAKVKPIFSHNIEDINIKNPKCKIAILDQIT
FT                   DPQNIGAIIRSAAAFNIDAIILPLDNSPNENGTIAKAACGTLELIKIIKVTNLNSCINY
FT                   LKKHGFWVIGLTGEANDYFTDKLISDKIALIFGSEDKGMRRLVQENCDYLAKIPISDKV
FT                   ESLNVSNAASIIFHSLWDH"
FT   gene            386848..386933
FT                   /locus_tag="A1I_t07969"
FT   tRNA            386848..386933
FT                   /locus_tag="A1I_t07969"
FT                   /product="tRNA-Tyr"
FT   gene            387053..387126
FT                   /locus_tag="A1I_t07971"
FT   tRNA            387053..387126
FT                   /locus_tag="A1I_t07971"
FT                   /product="tRNA-Gly"
FT   gene            387216..388403
FT                   /locus_tag="A1I_02025"
FT   CDS_pept        387216..388403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02025"
FT                   /product="elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /note="COG0050 GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78789"
FT                   /db_xref="GOA:A8GVB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB2"
FT                   /protein_id="ABV78789.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITMVLGKDNKDIKV
FT                   KKYDEIDAAPEEKERGITISTAHVEYETKSRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLAKQVGVPKMVVFLNKVDMVDDPDLLELVEMEVRELLSKYD
FT                   FPGDEIPIIRGSALQALEGKPEGEKAIHELMDAVDSYIPQPIRETEKPFLMPIEDVFSI
FT                   SGRGTVVTGRIEAGKVKVGEAVEIVGIKATQTSTCTGVEMFRKLLDSGEAGDNVGILLR
FT                   GIDREAVQRGQVLAKPGSITPHDEFEAEVYVLSKDEGGRHTPFTNNYRPQFYFRTTDVT
FT                   GTIELPADKQMVMPGDNATFKVKLISPIAMQQGLKFSIREGGRTVGAGVVSKVIN"
FT   gene            388497..388814
FT                   /gene="rpsJ"
FT                   /locus_tag="A1I_02030"
FT   CDS_pept        388497..388814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="A1I_02030"
FT                   /product="30S ribosomal protein S10"
FT                   /note="COG0051 Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78790"
FT                   /db_xref="GOA:A8GVB3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB3"
FT                   /protein_id="ABV78790.1"
FT                   /translation="MKNKIKIRLKSFDHRSLDQATKEIVSAVKRTFANISGPIPLPRKI
FT                   QRFTVNRSPHVHIKSREQYEIRTQKRLLVIDDPNPVVVDALSKVDLAAGVDVVIELESG
FT                   E"
FT   gene            388814..389461
FT                   /gene="rplC"
FT                   /locus_tag="A1I_02035"
FT   CDS_pept        388814..389461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="A1I_02035"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087 Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78791"
FT                   /db_xref="GOA:A8GVB4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB4"
FT                   /protein_id="ABV78791.1"
FT                   /translation="MRTGIIAQKVGMTSVFNNNGKRVPLTLVKVDDCQVVGHKIAEKHG
FT                   YNALVIGIKDKKISRVTKPMKQVFANAKVSPKTKLKEFRISEDNFIDIAASLEVDHFTA
FT                   GQFIDVTATTIGKGFAGSMKRHNFRGLEASHGVSISHRSHGSTGQRQDPGKVFKGKKMA
FT                   GHMGCSQVTIQNLKIFAIDKEQGLIMIQGSIPGHKGSYISIKDAIKKISITA"
FT   gene            389516..390139
FT                   /gene="rplD"
FT                   /locus_tag="A1I_02040"
FT   CDS_pept        389516..390139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="A1I_02040"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088 Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78792"
FT                   /db_xref="GOA:A8GVB5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB5"
FT                   /protein_id="ABV78792.1"
FT                   /translation="MKTKILNLANEEIGEISLNEDIFAVEFIRDDIIKQVVDWQRAKAM
FT                   AGTHKTKTVSEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVIHGPVVRSHATKLPKK
FT                   VRKLGLIHALSEKFSEGKLLVIDSLKLETPKTSNLVNILNKFQGKSFFVIDGNEVDVNF
FT                   SLAAQNIYNTVVVPQIGANVYDIIRHEYVLLSQEAVNVLEERLK"
FT   gene            390136..390432
FT                   /gene="rplW"
FT                   /locus_tag="A1I_02045"
FT   CDS_pept        390136..390432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="A1I_02045"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089 Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78793"
FT                   /db_xref="GOA:A8GVB6"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB6"
FT                   /protein_id="ABV78793.1"
FT                   /translation="MSSYKYYDLIRRPVITEKTTLLSEQNKYTFYVDKLAEKLAVKKAI
FT                   EEIFKVKVKKVNILNVKGKKKRFKGVIGRQVDRKKAVVTLEKDHNIDFAGGIK"
FT   gene            390433..391254
FT                   /gene="rplB"
FT                   /locus_tag="A1I_02050"
FT   CDS_pept        390433..391254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="A1I_02050"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG0090 Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78794"
FT                   /db_xref="GOA:A8GVB7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB7"
FT                   /protein_id="ABV78794.1"
FT                   /translation="MALKSFNPITPSLRELVQVDRTSLWKGRPFKALTKGISKTGGRNN
FT                   QGRITSWQRGGGHKRLYRVIDFKRNKLDISAIVERIEYDPNRTAFIALIKYEDGEHAYI
FT                   LAPQKLVVGDKIISSKDADIKIGNCLPLRYIPIGTTLHNVEMKVGKGGQIARSAGTSVD
FT                   LVGKDSGYAQIKLKSGEFRLVPLDCMATIGTVSNPDQKNINLGKAGRNRWLGWRPHVRG
FT                   VAMNPVDHPHGGGEGKTSGGRHPVTPWGFPTKGKKTRKNKRTSKFIIKKRK"
FT   gene            391281..391559
FT                   /gene="rpsS"
FT                   /locus_tag="A1I_02055"
FT   CDS_pept        391281..391559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="A1I_02055"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG0185 Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78795"
FT                   /db_xref="GOA:A8GVB8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB8"
FT                   /protein_id="ABV78795.1"
FT                   /translation="MARSVWKGPFVDGYLIKKVQKLMESGKSEMIKTWSRRSTILPIFV
FT                   GFTFSVHNGNKFIPVSVNEEMVGRKLGEFSPTRTFHGHGADKKVKRK"
FT   gene            391566..391925
FT                   /gene="rplV"
FT                   /locus_tag="A1I_02060"
FT   CDS_pept        391566..391925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="A1I_02060"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78796"
FT                   /db_xref="GOA:A8GVB9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVB9"
FT                   /protein_id="ABV78796.1"
FT                   /translation="MVQENKNFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFS
FT                   PKRISKVVKACLQSAVANAENNLGLDIDRLVITNATVGKALVMKRVMPRAKGRATRINK
FT                   FFSNLYITVTEKEDN"
FT   gene            391927..392580
FT                   /gene="rpsC"
FT                   /locus_tag="A1I_02065"
FT   CDS_pept        391927..392580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="A1I_02065"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78797"
FT                   /db_xref="GOA:A8GVC0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC0"
FT                   /protein_id="ABV78797.1"
FT                   /translation="MGQKVCAHGFRVGPTLIKGWDSVFYAEKQYKTLFIQDLKIRELVN
FT                   KSFTQAQVSRILIERPSNKSIIININAKKPNIIIGKNGSEIDKLKKAIEKMTSLSEVYI
FT                   NIHEVRKFNIDAAIVAQTIASQLEKRVSFRKAMKTAIQASFKQGGQGIRVSCSGRLGGA
FT                   EIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGVIGVKVWIYKGEYTENKRYN"
FT   gene            392596..393006
FT                   /gene="rplP"
FT                   /locus_tag="A1I_02070"
FT   CDS_pept        392596..393006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="A1I_02070"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG0197 Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78798"
FT                   /db_xref="GOA:A8GVC1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC1"
FT                   /protein_id="ABV78798.1"
FT                   /translation="MLAPKKQKFRKAHKGRVVSKSKAGTTLAFGSFGLKSIDGWRVTAR
FT                   QIEAGRKAATRCMKRQGRLWIRIFPDLPVSKKPAEVRMGKGKGNPEFFAVRVSPGRIMF
FT                   EIEGVEEDVAVKALELASAKLPVRTRIVRHYE"
FT   gene            392999..393211
FT                   /gene="rpmC"
FT                   /locus_tag="A1I_02075"
FT   CDS_pept        392999..393211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="A1I_02075"
FT                   /product="50S ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78799"
FT                   /db_xref="GOA:A8GVC2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC2"
FT                   /protein_id="ABV78799.1"
FT                   /translation="MNDLKSLKSELTSKTVEELFKHLNLLKKELFNLRFQQTLGELKNT
FT                   SRFSLVKKSIARIKTELTKRSSSGE"
FT   gene            393217..393450
FT                   /gene="rpsQ"
FT                   /locus_tag="A1I_02080"
FT   CDS_pept        393217..393450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="A1I_02080"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78800"
FT                   /db_xref="GOA:A8GVC3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC3"
FT                   /protein_id="ABV78800.1"
FT                   /translation="MPKRVLQGVVISSKTDKTVTVKVERRFKHPIYKKFIKVSKKYAAH
FT                   DPNNKFQEGDKVNIIESRPISKTKTWVVINEE"
FT   gene            393522..393890
FT                   /gene="rplN"
FT                   /locus_tag="A1I_02085"
FT   CDS_pept        393522..393890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="A1I_02085"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78801"
FT                   /db_xref="GOA:A8GVC4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC4"
FT                   /protein_id="ABV78801.1"
FT                   /translation="MIQMQSILEVADNSGAKKVMCIKVLGGSHHMVAKLGDVIVVSIKE
FT                   AIPGGKVKKGDVYKGVIVRTKTGVVRADGSTIKFDKNALVLLNKQDEPIGTRVFGPVTR
FT                   ELRAKKYVRIMSLAEEVL"
FT   gene            393891..393989
FT                   /gene="rplE"
FT                   /locus_tag="A1I_02090"
FT   CDS_pept        393891..393989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="A1I_02090"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78802"
FT                   /protein_id="ABV78802.1"
FT                   /translation="MIKLKVKKGDEVIVITGKYKGKKGKILKVFSE"
FT   gene            394220..394759
FT                   /locus_tag="A1I_02095"
FT   CDS_pept        394220..394759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02095"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094 Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78803"
FT                   /db_xref="GOA:A8GVC6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC6"
FT                   /protein_id="ABV78803.1"
FT                   /translation="MLRFKELYQKEIISNLQKEFSYKNKHEIPAIEKIVINMGVGEAIA
FT                   DSKVIDKAVNDLTLISGQKPFVTSARKSIATFKLRDGMKIGCKVTLRKDRMYDFLERLV
FT                   IVALPRVKEFRGFSYKSFDGKGNFTFGLKEQIVFPEINYDKIDSIRGMDITIVTSAKTD
FT                   KEGKSLLSGFNLPFYN"
FT   gene            394774..395079
FT                   /gene="rpsN"
FT                   /locus_tag="A1I_02100"
FT   CDS_pept        394774..395079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="A1I_02100"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78804"
FT                   /db_xref="GOA:A8GVC7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC7"
FT                   /protein_id="ABV78804.1"
FT                   /translation="MAKVSSIKKNEKRKKLSQSLHNKREKLKNKIYDKNISLEERFSLV
FT                   MSLAQLSRNSSATRIRNRCELTGRPRGVIRKFGISRNKLRELSGRGLVPGIIKSSW"
FT   gene            395099..395497
FT                   /gene="rpsH"
FT                   /locus_tag="A1I_02105"
FT   CDS_pept        395099..395497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="A1I_02105"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096 Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78805"
FT                   /db_xref="GOA:A8GVC8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC8"
FT                   /protein_id="ABV78805.1"
FT                   /translation="MSMTDNVADMLTRIRNAYKSKLINVSFPSSKIKTSILEVLQKEGY
FT                   IKNYTSTPKDNISYTEVTLKYSANGDASICEIHRVSKPGKRVYSAIKDLKGYYNNMGIY
FT                   ILSTPYGVMSDREAHIKNVGGEVICKVF"
FT   gene            395507..396040
FT                   /gene="rplF"
FT                   /locus_tag="A1I_02110"
FT   CDS_pept        395507..396040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="A1I_02110"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78806"
FT                   /db_xref="GOA:A8GVC9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVC9"
FT                   /protein_id="ABV78806.1"
FT                   /translation="MSCVGKLPIIIPEGVKVGLNDLEVKISGPKGELSKSFKGSIGISL
FT                   AENKLLVKPLSSSKSARAMWGTARSIISNMVTGVKEGFKLKLEINGVGYRAMMKGKYLN
FT                   LMLAKSHNTKIEIPSHIKVEVPKQNIIILEGTDKEKLGQFASIIIKQRPPEPYKGKGIK
FT                   FEDQFIPCKEGKKN"
FT   gene            396055..396411
FT                   /gene="rplR"
FT                   /locus_tag="A1I_02115"
FT   CDS_pept        396055..396411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="A1I_02115"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG0256 Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78807"
FT                   /db_xref="GOA:A8GVD0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD0"
FT                   /protein_id="ABV78807.1"
FT                   /translation="MRSAKLKFEKRRSRIRHKIAKTANRARLSIFKSGRHIYAQIIDDT
FT                   KSVTIASASTLDEKIKKLKKSHCNVENATKIGELIAEKAVSCGVEEVVFDRSGYKYHGV
FT                   VKALADAARKKIRF"
FT   gene            396545..396958
FT                   /gene="rpsE"
FT                   /locus_tag="A1I_02120"
FT   CDS_pept        396545..396958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="A1I_02120"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78808"
FT                   /protein_id="ABV78808.1"
FT                   /translation="MIKAGRVGAGHGKAKEVNEAREKAKQAAKKKMKKVSLYQNRTIHH
FT                   DVIGRSGAAKVVLRRAKAGTGVIAGGAMRAIFDSLGVHDIVAKSIGSTNVYTMIAATFD
FT                   ALKKLSSPKSIAARRDKKMNEIFIKSSDIQVNE"
FT   gene            396984..397181
FT                   /gene="rpmD"
FT                   /locus_tag="A1I_02125"
FT   CDS_pept        396984..397181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="A1I_02125"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG1841 Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78809"
FT                   /db_xref="GOA:A8GVD2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD2"
FT                   /protein_id="ABV78809.1"
FT                   /translation="MNNKNLINDVKVTQVKSSIGRKYDQKLTLIGLGLNKINKSVVLKN
FT                   TDSVQGMLKKVEHLLKIENV"
FT   gene            397195..397653
FT                   /gene="rplO"
FT                   /locus_tag="A1I_02130"
FT   CDS_pept        397195..397653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="A1I_02130"
FT                   /product="50S ribosomal protein L15"
FT                   /note="COG0200 Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78810"
FT                   /db_xref="GOA:A8GVD3"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD3"
FT                   /protein_id="ABV78810.1"
FT                   /translation="MKLNELYNNIGAKKNKKRVARGIGSGKGKTAGRGVKGQKSRAGVA
FT                   IKGFEGGQTPMIKRLPKRGFNCISSKKYNVINIYNIEAAIAEERLNANDVITKEKLIEI
FT                   GLINKSNKKLVKLLSICSDDFNYPLSFKLDSYSSKAKEIVEKAGGKLL"
FT   gene            397657..398958
FT                   /gene="secY"
FT                   /locus_tag="A1I_02135"
FT   CDS_pept        397657..398958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="A1I_02135"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="COG0201 Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78811"
FT                   /protein_id="ABV78811.1"
FT                   /translation="MNQNFSKKSSNDLINRIIFTIFVLIICRFGSFIPIAGIDAIALGS
FT                   IAEKNQSGILGMFNMLSGGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGE
FT                   AGKRKINQLSRYLTVLLASLQAYGVAVSLESIVTNTGPVVIIPGLFFKITTVITLVVGT
FT                   MLLMWLGEQITQRGIGNGTSLIIFIGIISGVPSAIISMFELSRKGALSPLVAIAVCAGV
FT                   VILISIIIFFEKAQRKLLVQYPKRQVGNKIYGGDSTYMPLKLNTSGVIPPIFASSILLF
FT                   PATLANFSSSNSEIMNMLTYYLGHGKPIYILLYVALIMFFSFFYTAIVFNSEETANNLR
FT                   KYGAYIPGKRPGKNTSEYFDYILTRLTVVGGIYLSVICIIPELLMNKYVISLSLGGTSF
FT                   LIVVNVVLDTLTQIQTYLFSSKYESLMKKVKLKN"
FT   gene            399670..400047
FT                   /gene="rpsM"
FT                   /locus_tag="A1I_02150"
FT   CDS_pept        399670..400047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="A1I_02150"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78812"
FT                   /db_xref="GOA:A8GVD5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD5"
FT                   /protein_id="ABV78812.1"
FT                   /translation="MARIASVNIPDNKRLVVSLTYIYGLGTTMAKTICKKAKILEDKKV
FT                   KDLTDQELISLRNIIENEYKVEGDLRREVTLNIKKKKDIRSYQGLRHIRKLPVRGQNTH
FT                   SNARTRKGKAVAIAGKKKAVK"
FT   gene            400072..400455
FT                   /locus_tag="A1I_02155"
FT   CDS_pept        400072..400455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02155"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100 Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78813"
FT                   /db_xref="GOA:A8GVD6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD6"
FT                   /protein_id="ABV78813.1"
FT                   /translation="MNQTVKAKKKKKTITLGVVHIRASFNNTIVTFTDVQGNAISSASA
FT                   GANGFKGAKKATPYAAQITIDKAAEKAKEYGLKTISIRIGGPGAQRESAMRALFGQNFV
FT                   VTSILDVSSIAHNGVKAPKRRRV"
FT   gene            400472..401497
FT                   /locus_tag="A1I_02160"
FT   CDS_pept        400472..401497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02160"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78814"
FT                   /db_xref="GOA:A8GVD7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD7"
FT                   /protein_id="ABV78814.1"
FT                   /translation="MLSLSKNWNALIKTDKVSYESFHETNNKSKIIVEPLERGFGLTLG
FT                   NAMRRVLLSSLQGAAVTSIKIPGIEHEFSSIPGVKEDISEIILNVKGIEIKMHVAEKRV
FT                   IRLKATGPGAITAGMIEAGHDVEILNPDHVICNLAKNKQFEMELTCKVGKGYTLSTNNN
FT                   EDNNLPIGEIAIDALFNPVKSVTYKVENTRIGQVTDYDKLIMFVETNGDILPEMAVGLA
FT                   ARILQEQLQLFISFEEQEEDKQVKTDALPFSPYLLKRVDELELSVRSANCLKNDNIIYI
FT                   GDLVKRTEADMLRTPNFGRKSLNEIKEILAKFSLRFGMDVPDWPPENIHELSKRYEDSY
FT                   N"
FT   gene            401509..401937
FT                   /gene="rplQ"
FT                   /locus_tag="A1I_02165"
FT   CDS_pept        401509..401937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="A1I_02165"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG0203 Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78815"
FT                   /db_xref="GOA:A8GVD8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD8"
FT                   /protein_id="ABV78815.1"
FT                   /translation="MRHKIKGRKLNVTSSHRKAMLANMAVSLVTHEQIKTTLPKAKELR
FT                   PYIEVLVTKAKDNNLAARRNILSKIKDKKAIEKLIDVLGVRYKDRPGGYTRIVKAGFRY
FT                   GDLAPIAYIEFVDRDINAKGNIPQDNSKEDIKSNKGTK"
FT   gene            401937..402200
FT                   /gene="rpsT"
FT                   /locus_tag="A1I_02170"
FT   CDS_pept        401937..402200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="A1I_02170"
FT                   /product="30S ribosomal protein S20"
FT                   /note="COG0268 Ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78816"
FT                   /db_xref="GOA:A8GVD9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVD9"
FT                   /protein_id="ABV78816.1"
FT                   /translation="MANHSSAKKAARQTVKKTLVNKRRASAIKTFVKKVLHEINQGNKE
FT                   EANSALVIAQSKIMQGVKKNIIKLNTASRKISKLSKKIKTMN"
FT   gene            402305..402380
FT                   /locus_tag="A1I_t07973"
FT   tRNA            402305..402380
FT                   /locus_tag="A1I_t07973"
FT                   /product="tRNA-Val"
FT   gene            404366..404938
FT                   /locus_tag="A1I_02185"
FT   CDS_pept        404366..404938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02185"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78817"
FT                   /protein_id="ABV78817.1"
FT                   /translation="MRKSGDPYYSHPIEVAIMLAEFTAMEVPKLYNAVMIQAALLHDTI
FT                   EDTELTEEMIAKIFGEEVARHVEGLTHIKSYGKISAEESLNLLAKQKRYDTVLIKLFDR
FT                   IHNIQTLGAKLPEKARKIIEETLSCFLVTAVYFETKTIENYLFNICYNFINNNFSPNSN
FT                   KINISYSFLNSQSDATTPNNSLSLLVS"
FT   gene            complement(404859..406049)
FT                   /locus_tag="A1I_02190"
FT   CDS_pept        complement(404859..406049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02190"
FT                   /product="MFS-type transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78818"
FT                   /protein_id="ABV78818.1"
FT                   /translation="MAVLLNKIFFSPDNSYSIKVLSAFAYCSTFIFRPFGTLLFGWIGD
FT                   NIWRKPVILIATFLMACTCIGIAVLPSYDEIGFTATVLITLFRAIQGISSATEVTGAQL
FT                   YITEMVKPPLQYPAVASTTIFSTLGTLAALGIAAIVTSGNFNWRYAFLFGAFVAVTGLM
FT                   ARTTLKETRDFIDAKRRIKLSLEKTGIDPKKIESNSIIKEKTNFKTFISYFAIQCTWPV
FT                   WSYFGYFYCGNILTENFGYSPAEVIHHNFFISMIELTGTILLVYLSYKIYPLKILRATF
FT                   YILIVFFCFSPVIMQNLTPSYIMLIQVYFLVFAPGYFPATAIFYKHFPVFKRFMHTSFI
FT                   FAMSRALMYIITSFGLAYLTEYFGYWGILMIMIPVTIGYYLGLLRHFENLEKNMIY"
FT   gene            406353..408029
FT                   /locus_tag="A1I_02195"
FT   CDS_pept        406353..408029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02195"
FT                   /product="hypothetical protein"
FT                   /note="COG4886 Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78819"
FT                   /protein_id="ABV78819.1"
FT                   /translation="MECKLLSMLPAPYNVPVKNKYKLSDNILNSKNPNVWKSVLESKYL
FT                   NELQRQADFLVNKLATLPEAEELLNKLSDFRRDIGETIESTTDAYNKLHKENIDSLTDS
FT                   LEKITTKTATACSSKQKRSTDPCTKFKPLYQPLPDNEHIINQYLDYAFMVEPKQSHNLK
FT                   YITNLSKLLDETKENHSKVEQRKLDLLSRKASNFRKKYIDENSLKAISKKDFPKQLPAL
FT                   YSNGEHTILLFKENNQYKLYSKSINYNEIFTLKADLTYPEFSSFIKQFFSANGINLHHN
FT                   CYVLANPLPKKAVNQLNLNPNQISTDYQELLKGKVPGIKNFSEKEILDLSGYNFQNKDI
FT                   KKLTKINLNKVKTLILDNNNIGMNGLEAILYSGNFPNLKELSIRNNKLDIKDALSLINL
FT                   NKLPILDISQNKFSLQAIEQFSLLENSKIQIVTGKDYDQLKYQIGQQYGGYDKYLESVH
FT                   IQEIMPNIHSKQYGKALGNKLLNAAGHIQLINSLHSISQTCVQDDATKECMLGLAGFSY
FT                   SFLSQPIENIAVKYTIKSLNNAGNIASKLTRFKFIKTGIYN"
FT   gene            complement(407988..408200)
FT                   /locus_tag="A1I_02200"
FT   CDS_pept        complement(407988..408200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78820"
FT                   /protein_id="ABV78820.1"
FT                   /translation="MEAIESLISLSLHLVSIADRHSFNFTDAKVISTISNAPAIAPAAP
FT                   FANFTAYFPAPTLIINSGFYKFETG"
FT   gene            complement(412190..412381)
FT                   /locus_tag="A1I_02215"
FT   CDS_pept        complement(412190..412381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78821"
FT                   /protein_id="ABV78821.1"
FT                   /translation="MYKDLRYGNTTLQVFKAVETNCKLLSPLFISTISLLTSTMKDISL
FT                   YIIATAPPLAIVSFVLES"
FT   gene            412374..412625
FT                   /locus_tag="A1I_02220"
FT   CDS_pept        412374..412625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78822"
FT                   /protein_id="ABV78822.1"
FT                   /translation="MYNKITKTNNVSENLWANGLCNLIKNIQKFPLSSQDQNSLNEISK
FT                   NLPTELPEIKTTWTELLEIKDRYEKAQHDELEVLGEVM"
FT   gene            complement(412715..413680)
FT                   /locus_tag="A1I_02225"
FT   CDS_pept        complement(412715..413680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02225"
FT                   /product="Leucine-rich repeat protein"
FT                   /note="COG4886 Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78823"
FT                   /protein_id="ABV78823.1"
FT                   /translation="MGKERAISNAFFLKSNTSLTELNIASNKIGKEWTTVIFDALKFNK
FT                   SLRVLNLSNNTLEREKTIIVTKWITAIFYALKSNNSLTTLDISNNLIGREEAIVIFNAL
FT                   KFNKSLTELNISYNLIEKEWIEAAFNALKFNNSLRVLNLSNNKIGEKEIVITDTLKSGS
FT                   PLNELDITNNSLQYFTKIEEKIQYNNIQYNEQLTRFILFLKKAFPDKNEQINTIRNDSY
FT                   DIFKIASAIKFYKKVPKKLLKECLQEQKIDNFKFTIEAMNNFKKAYPFFIAGICIKMEI
FT                   IVSVDYSIIIPNDITFHIASYLEKEKWGIDVEVLGKSIYP"
FT   gene            complement(413707..414132)
FT                   /locus_tag="A1I_02230"
FT   CDS_pept        complement(413707..414132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02230"
FT                   /product="Leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78824"
FT                   /protein_id="ABV78824.1"
FT                   /translation="MKELIELLEKKGLKEKADSLKNGSTKLNIIGNKVGTWGAKEIIYI
FT                   FKFDNLTKLNITYSEIGKRWLILIFSLLKFHDSLRVLNLSDNIIKNEKVIVEKTWLPMI
FT                   FNGLKFNISLTKLNISNNLIGQEETRVIFDALNFTTL"
FT   gene            complement(414425..414868)
FT                   /locus_tag="A1I_02235"
FT   CDS_pept        complement(414425..414868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78825"
FT                   /protein_id="ABV78825.1"
FT                   /translation="MQVLKPKINTRYCSICAGLLFILYFVIFTQLGISLNGLIVLYLAI
FT                   TTFTILGVKIFFHWIEYSIDEYKVSKINNFITYERVDIRYQDIKEVNLKIGLLQRFCNL
FT                   GTISMLSNATIEKAGITFFNVENPLEIYQEIQNRIDQCKKVNN"
FT   gene            414994..415953
FT                   /locus_tag="A1I_02240"
FT   CDS_pept        414994..415953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02240"
FT                   /product="Magnesium and cobalt transport protein CorA"
FT                   /note="COG0598 Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78826"
FT                   /protein_id="ABV78826.1"
FT                   /translation="MITTYLKENNAIVKKEEYLVNESTLWIDLFNITNEEREEIKNSLN
FT                   IDIPTLKDISQIEISERLYTENDALYLTITELINKEKKFPETHSIVFILHKSYLITVRY
FT                   VGLTSFNDCINKFAKQLTYKYTAEHMLFMLLRNMVTGLSNVVQSVSMDIDDYGRLILDN
FT                   NLNDLRIDHKRILKKIGQKGDLLSKSRECLFSLTMVIQYILKSPQISQNKASKDLLDTL
FT                   LRDVDSIINFSQFISSEIARTLDAALGMIAIEQNNMVKLFSLVTIFFLPPTLIASIYGM
FT                   NFTMMPELQSPYGYPIALFLMVISIAVTYKYFKKKKWL"
FT   gene            complement(416009..417115)
FT                   /locus_tag="A1I_02245"
FT   CDS_pept        complement(416009..417115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02245"
FT                   /product="Rod shape-determining protein rodA"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78827"
FT                   /protein_id="ABV78827.1"
FT                   /translation="MHKNYFDQIKRLPLTLILLISLICSIGFIVLYSAANSNLQPWALK
FT                   QIVNFCIFMPIAIIIALIDLRIIFRLSYIFYFCVLALLVAVELFGSTAMGGKRWIDIGI
FT                   VKLQPSEPIKIAIVLMLARYFHSLTVDDLSKLHKVIIPIIGVLVPAFLIIREPDLGTGM
FT                   ITLIVSSIIFFAVGFRIKYFIILGVTALVSLPIAWNMMYDYQKKRVMVFLDPEQDPLGA
FT                   SYNIIQSKIAIGSGGFFGLGLNQGSQSHLDFLPEHQTDFIFATFAEEFGFLGGMFLLVL
FT                   YFSLITLSLLIGVNCRTVFSKLMVIGITATLFSHVFINMAMVMGLVPVVGVPLPFISYG
FT                   GTMMASMLMGFGLVMNAQVNGHTNLTNI"
FT   gene            complement(417108..417785)
FT                   /locus_tag="A1I_02250"
FT   CDS_pept        complement(417108..417785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02250"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78828"
FT                   /protein_id="ABV78828.1"
FT                   /translation="MFDDKLSKDLLLSARANNNLAVIRILQDTTSAINPNLQDENGKTA
FT                   LHWAVINLNPLITCYILKIEKVNVNIQDNTGFTVLHYLAKTISNLKFTTINGSFYKSNN
FT                   YSILKTLFEYGIDVNIQDNKGNTALHYAICKNNFFFIEELLSNNASPFILNKAGFSILY
FT                   KLNTKNCNFKDEIIESLHSKYPESIELGLVDNKIIIYDIHKLLYNLPYFMYEHNILILG
FT                   NDA"
FT   gene            complement(418012..420036)
FT                   /locus_tag="A1I_02255"
FT   CDS_pept        complement(418012..420036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02255"
FT                   /product="Protease II"
FT                   /note="COG1770 Protease II"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78829"
FT                   /protein_id="ABV78829.1"
FT                   /translation="MKPPIADKQKNNNDDYHWLRDPKWPDVQDNKILDHLKAENKYTEH
FT                   FFTDLQDDKEKIFEELKGRIKLDDTSTYTKKKDYYYYHRVEADKNYLIYCRKYKNINAP
FT                   EEIILDVNLLNTGFTDVGEVAMSPDQNLMAYSVDFTGNEKYDIKIYDLKEQKYLADIVK
FT                   EVAPTIIWHEKLNGFFYITINENQCWDKVMFHRLGEDATNDKLIFEVKNSAHFVSSEKS
FT                   SSRKYLFINSGDYNGNEIYTISMHDESFTPKLIRPLESHIFYDVAHHENYFYIKTNYKA
FT                   KNFRIVKVPVDNFQNDDWHNDYIKEEQDKYLKDFDITENYFILNYRDNGLPLVKIKRFR
FT                   DSLEKIVSFPDESFQANGYSTNFDEDDIRLNYSSLARPNTTYSYDFDSDKLIILKEQEI
FT                   PSGFNPDEYKVERIFADNQGVKVPITLFYKKSLFKKDGSNPLFLMGYGAYGIAMPVNFR
FT                   NMAVSLADRGFIYAVAHIRGGDDLGHDWYKAAKFLNKKRTFEDFIACSETLIQEKYTSI
FT                   NNIVIMGGSAGGMLIGYVLNEKPELYKVSVAHVPFVDVLNTMLDETLPLTLLEYNEWGN
FT                   PKEKEYFDYIKSYSPYDNVKPQNYPALFVTCGISDPRVGYWEPAKWVAKLREYKTDNNL
FT                   LLLKTNMDTGHKGSAGRFDYLKETAEELVFIFKMFDVRV"
FT   gene            complement(421640..422044)
FT                   /locus_tag="A1I_02270"
FT   CDS_pept        complement(421640..422044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02270"
FT                   /product="Toxin of toxin-antitoxin (TA) system VapC"
FT                   /note="COG1487 Predicted nucleic acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78830"
FT                   /protein_id="ABV78830.1"
FT                   /translation="MGLIVDTSIIIALERGKISTKAWSNYDQAYINPIVLTELLIGIDR
FT                   VKDENKRGQCLTFIEYVKSLFTLLPFGIEEAYVYAKIIDNLYKERITIGVHDLLIAATA
FT                   ITYNYPILTLNTKDFKRIPELEVLTVPLKD"
FT   gene            complement(422035..422322)
FT                   /locus_tag="A1I_02275"
FT   CDS_pept        complement(422035..422322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02275"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system VapB"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78831"
FT                   /protein_id="ABV78831.1"
FT                   /translation="MAQIVKATEAVRSFSDIINRVYYKGESFDIQKGNNIVAQITPVEN
FT                   KSSVKVKNLDELFKNGPHLDPEDAEQFMKDVDDVRRSTRINIEELYRKWD"
FT   gene            complement(422420..423829)
FT                   /locus_tag="A1I_02280"
FT   CDS_pept        complement(422420..423829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02280"
FT                   /product="Guanosine pentaphosphate phosphohydrolase"
FT                   /note="COG0248 Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78832"
FT                   /protein_id="ABV78832.1"
FT                   /translation="MRSAIIDIGSNALRAVVYETDELGAPEIFNYKFKNYLTNLLNLDN
FT                   LDIKHQTYLSLQYLTHIFTKLSVTNIRCVATAILRGHPKAEEFKAIIEKKFNIEVEIIS
FT                   GEREAYLTAAGLISGISDASGIVADLGGGSLELAKIADKKVGKLKSLPLGTRIIANNNF
FT                   DNLGLITELIEKEFGLEHYPNLYLIGGALRLMSRIYMESINYPLKNLHNFEISRVEFEL
FT                   YLEKLSQIDKLKLSYYEQKAINYNAVLVIKAMIKVFSPEKIIISNYGLKEGVRFDSLPD
FT                   NEKEKDIIYERVKRLVKFDRNICKIDQYIEAVEYLLINPDTTTLITVELAIMLAQYNKN
FT                   IDKTLRANFVSEFILSSDIPFSHRQRLMLGIALTVTYTAKTDMNINKIAKKMISKSDYY
FT                   NSHIIGYYIKIAREIDGPEFQEPSFSIKLKDDEFLQINTSILPKQVFGKVHERLKDIRS
FT                   ARKNINQSFSD"
FT   gene            complement(423890..425668)
FT                   /locus_tag="A1I_02285"
FT   CDS_pept        complement(423890..425668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02285"
FT                   /product="VirD4"
FT                   /note="COG3505 Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78833"
FT                   /protein_id="ABV78833.1"
FT                   /translation="MGWHNILKVTRNIFGHAIIHPVVIFSTLWISGAFVAIFTNEIGTL
FT                   GVDVTAINIAYKWSYWLVSVWGQLKISDYNYLKLKLLASLLGPALVVIIFYIKNFERIK
FT                   SLQFFEQPEKVYGDARWASPADVESAGLRAKKGMLIGVDSGGYFVADGFQHALLFAPTG
FT                   SGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWEPSNPDGITHCYN
FT                   PIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPVKTKSFGEVV
FT                   RTMRSDDVVYNLAVVLDTLGGIIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANP
FT                   LIDSATASSDFNVQEFKKIKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKE
FT                   EPYGVMFLLDEFPTLGKMDTFKAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLS
FT                   NSTYRITFAANNYETANLISQLVGNKTVEQRSFSKPIFFDLNISTRTQNVSQVQRALLL
FT                   PQEVIQLPRDEQIVLIESFPPIKSRKIKYFEDKFFTSRLLPPTFVPTQVPFDPRANNNE
FT                   TSNETEEAAVAPENSE"
FT   gene            complement(425801..426805)
FT                   /locus_tag="A1I_02290"
FT   CDS_pept        complement(425801..426805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02290"
FT                   /product="VirB11"
FT                   /note="COG0630 Type IV secretory pathway, VirB11
FT                   components, and related ATPases involved in archaeal
FT                   flagella biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78834"
FT                   /protein_id="ABV78834.1"
FT                   /translation="MSDAFAALETFLLPFKELFAEDGINEIMVNKPGEAWVEKKGDIYS
FT                   KQLPELDAEHLLSLGRLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYS
FT                   IRKPSGMNLTLDEYAKMGAFDETATESLVDQDEIILNGYLAEKKIKEFIKHAVISKKNI
FT                   IISGGTSTGKTTFTNAALTEIPQLERLITVEDAREVVLSSHPNRVHLLASKGGQGRANV
FT                   TTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKL
FT                   MVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV"
FT   gene            complement(426802..428235)
FT                   /locus_tag="A1I_02295"
FT   CDS_pept        complement(426802..428235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02295"
FT                   /product="VirB10"
FT                   /note="COG2948 Type IV secretory pathway, VirB10
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78835"
FT                   /protein_id="ABV78835.1"
FT                   /translation="MAEEQNNNSSLSGADTPEVQKELSKVSVSFNKSIAIVVVICGILI
FT                   YIFYSIFFAPKKEEIQNTNIPSNIVKPVEDNSDNVPEIPKLPDPPKLETPTAPPPPPTV
FT                   EVPPVLPPTTPVETDKSKTLPAPPISLPSTNGPLVESDEEKKRKQAKRTSSIVLVSGVE
FT                   PKKTAEQVAADAVFKDRGDMSLILGRGKLIEAVLETAINSDLGGEIRAIISRDVYSEKD
FT                   KIILIPKGSKVFGKYATSTSADSYGRVSVIWDRIDLTNGYTIAFDSPAVDNFGRPGVQG
FT                   RVDNKYKELFANSVLQSAFNIGIAKVLDKLVPPPINSQAAATNSAIATQLLNTAQTISQ
FT                   NTSLDPNTRIVTICTNVLAAITDKTSTAYTTMTQACTTAQDASSANTPEQRLATLVQAV
FT                   NTAASSLLTSTSIASNPTQAQQASTQAFTDITNTVQNMITQQQFKPTTTINQGTPIKIY
FT                   VNKDYKFPATVLTKSKVVK"
FT   gene            complement(428342..428827)
FT                   /locus_tag="A1I_02300"
FT   CDS_pept        complement(428342..428827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02300"
FT                   /product="VirB9"
FT                   /note="COG3504 Type IV secretory pathway, VirB9 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78836"
FT                   /protein_id="ABV78836.1"
FT                   /translation="MIIVRFCFLIFIYLSGLIANADCPLLENDPCSNISNNYLDDLSIT
FT                   RDNRIQTYIYNPNEVYLLTLHFGFQAHIEFAKNEEVQNIILGDAYAWKLTPIGNRLFIK
FT                   PLEKYIRTNMTIITNKRTYEFDISSVELMEGHEKELVYVIKFDYSKNRTSNNYMARY"
FT   gene            complement(428814..429533)
FT                   /locus_tag="A1I_02305"
FT   CDS_pept        complement(428814..429533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02305"
FT                   /product="VirB8"
FT                   /note="COG3736 Type IV secretory pathway, component VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78837"
FT                   /protein_id="ABV78837.1"
FT                   /translation="MLDNIFGFFKSSDKAQNDAKSEQNQANPLKITQNWYEERADKLIV
FT                   QRNLLIILLIILLIFMIISTLVIAFVVKSKQFDPFVIQLDDTTGRASVVEPISSPVLTA
FT                   DESLTRYFIKKYINARETYNFVDFTTLARTTIRLLSTSNLFYGYLGYIRDKNNDPSLKY
FT                   QENNTTYLVVKSWSKIASDKYIVRFSVNEATGNQTVYNKIAVVSYAYVPMQLTDSELDI
FT                   NPVGFQVNGYRVDDDNS"
FT   gene            complement(429587..429769)
FT                   /locus_tag="A1I_02310"
FT   CDS_pept        complement(429587..429769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78838"
FT                   /protein_id="ABV78838.1"
FT                   /translation="MLKLFKFGVLLIMLSQLLSCTPSAPYEIKSPCVAPEINDEAELNM
FT                   NPCVRRPVNSIIDIA"
FT   gene            430935..431585
FT                   /locus_tag="A1I_02325"
FT   CDS_pept        430935..431585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02325"
FT                   /product="VirB9"
FT                   /note="COG3504 Type IV secretory pathway, VirB9 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78839"
FT                   /protein_id="ABV78839.1"
FT                   /translation="MVYNPDDVFKFTGYYGYQASIELARDEEIVSISMGDTTSWQIVPA
FT                   GHRIFIKPMEQDATTNMTLITNKRTYFFELYAAETLDMRDPEMVFNVKFLYPDDENDNA
FT                   GGHMQTYIASSATPDLNHPEKYNFNYYISGSEEIAPIKIFDDGEFTYLQFRDKNSEIPG
FT                   IFAVDDSLRESLVNYRLAPDNPNLVILEQVFPKLAVRKGKKITCIFNESFRAY"
FT   gene            431677..432012
FT                   /locus_tag="A1I_02330"
FT   CDS_pept        431677..432012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02330"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   C"
FT                   /note="COG1006 Multisubunit Na+/H+ antiporter, MnhC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78840"
FT                   /protein_id="ABV78840.1"
FT                   /translation="MSHLIYFFALILLTSGLFIMLTSHNYIHKVIGLGVFQSSVLVFYL
FT                   ALGKVKTGIVPIMQEGVTTYTSPLPHVLMLTAIVVGFATLSVALSLIYQIYKHFGTISE
FT                   NEISFDK"
FT   gene            complement(432090..432293)
FT                   /locus_tag="A1I_02335"
FT   CDS_pept        complement(432090..432293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02335"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78841"
FT                   /protein_id="ABV78841.1"
FT                   /translation="MKLVKIEQIVMIRVNKIKRKNIVASNAPANGNKICKIGKCLAKIM
FT                   GFYSNRCHPVAWELDPENNKKY"
FT   gene            432346..433458
FT                   /locus_tag="A1I_02340"
FT   CDS_pept        432346..433458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02340"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 2 (chain
FT                   N)"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78842"
FT                   /protein_id="ABV78842.1"
FT                   /translation="MGGWASSIGIEYYLTSLNQAIIVYLNSVLLFFLIFCYNITNQTIL
FT                   KYINHNRRALFFAILLFAHMGYLGMVSTNDFFNLYVFIEISALSSYVLIASGGNPKSLI
FT                   GALDYLIMGSIGATLILIAIGFLLSITGSLNMLDVAGFLQKYSNSRIVTLSIGFFLIGG
FT                   ILKTAFFPMHFWMMRAYSTTASVILVYLAGISTIIGVYIIYKFTYLIINYETIKLAINN
FT                   FIRPIALLTLIIAPYFAYKAENFKKIIVYSCITQIGYVFLLYVTNSGMKILPCLLIIDS
FT                   VNKIALFLIAAYKEAYQKKPNQVLVIIAVICSSGLPISPLFFVKVSILELFLKQNLLLD
FT                   FIIILLSSVGSLFYHYKMVKLLFLQKQEST"
FT   gene            433955..434779
FT                   /locus_tag="A1I_02345"
FT   CDS_pept        433955..434779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02345"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78843"
FT                   /protein_id="ABV78843.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSFGIFEFINDNK
FT                   DILANSLTVVETTGGYELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKA
FT                   LGLYGKERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSC
FT                   INMIDVLSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKL
FT                   TRRQIASLAGLAPKANDSGKYQGYRKVGHGRAGVKLYYSLLLCQPVIARLLV"
FT   gene            434746..434910
FT                   /locus_tag="A1I_02350"
FT   CDS_pept        434746..434910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02350"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78844"
FT                   /protein_id="ABV78844.1"
FT                   /translation="MSARNSKTSGLRLFYERLINNGKKKMVALTALMRKIIVIANAKLK
FT                   SLLFNLKHS"
FT   gene            435050..436513
FT                   /locus_tag="A1I_02355"
FT   CDS_pept        435050..436513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02355"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /note="COG0651 Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78845"
FT                   /protein_id="ABV78845.1"
FT                   /translation="MLAQFTTPNLLILSTLLVGMLNLTSPFVTKENSFTRNFLLIAIGI
FT                   FFFSNVLIIDWVFLKGVRAGFKFHIFGNYFIGFHLEPLGLIFLSLISFLWICSLLYTPQ
FT                   YLAINNIENSSRFLFFFNLTILIGSLIALSSNLFTMFICYELLTISTAFLIGHTKNNIV
FT                   LTGLYKYLKILMITGIMLFLPAIIIIYAKIGNGDFVSKGLMLEHFSKNQSILLLLMFIF
FT                   GIAKTAIFPVHSWLPAAMVAHYPVSSLLHAVIVVKTGLFCIYKILVYIFGLSYLQEIFG
FT                   AFNWLIFIPIVSIFYSTFKAFGTDNIKKILAYSTMNQLGIALLSAFMLTPKSLAAATLH
FT                   LVSHSFTKICLFYSMGSIYSLKKANQVQDLTGTSKEFSLISFMILISSLSLIGIPVLSG
FT                   FISKFSILLAAAEQNQFIVMAVIIISSIFSSLYLIKILGFIYKPSSTETSNITKQLPQL
FT                   MQISIMICCAAVIFFYFIQILIKKFLGYI"
FT   gene            complement(436516..437577)
FT                   /locus_tag="A1I_02360"
FT   CDS_pept        complement(436516..437577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02360"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78846"
FT                   /db_xref="GOA:A8GVG9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVG9"
FT                   /protein_id="ABV78846.1"
FT                   /translation="MKLSDFDFDLPLELIAQNPISKRDESNLLIASTQQYVKTKFYNII
FT                   DYLKEGDLLVFNNSKVIKAKLSLDKNITINLNQRLKDNRRATNDDAGRLKSIDYWSAFA
FT                   KPARKLKVGDEFYFDNHKIIITEKLEMGEIKIKFELANISVFEFLDKYGEMPLPLYIKR
FT                   PERQKSDDERYQTVYSNIQGSVAAPTAGLHFTNDIINKLKAKGVQVAFVTLHVGAGTFM
FT                   PVKTENINEHKMHTEYCSITPETAAIINKAKKEKRRIIAVGTTSLRTLESSGINGNVNS
FT                   GDFETDIFITPGFKFQIVDMLLTNFHFPKSTLFMLVCAFAGFKEMHELYKYAIEEQMRF
FT                   FSYGDATLLYKKV"
FT   gene            complement(437784..438686)
FT                   /locus_tag="A1I_02365"
FT   CDS_pept        complement(437784..438686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02365"
FT                   /product="hypothetical protein"
FT                   /note="COG4465 Pleiotropic transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78847"
FT                   /protein_id="ABV78847.1"
FT                   /translation="MSLTGGAHIQNENLIKIDASMHPADIISVLLFELFNSVNSEPKQI
FT                   LEENYDNSDDYANAMEFSEYKTYINYKKLILNFLQINKEKVEKLLIQSGYPEPYTRVVH
FT                   NIKERITDNISSEDIKFIIKHREMYVQDWERWNKIFTFKEISKVIKEQDSQKLAKLLSS
FT                   SHIIVEQNHINEAIDVGNVENLKLLLNKYTNNIFDSQLIKAIDKPELLKLLLPYLSDID
FT                   ASYCIAGTIGHFSKTGNISAVQSLLNEYKGKIRDYDLPAIRNKTILDMVKNYPNFVSDI
FT                   NTDQDLIGIAPKDNFDLLV"
FT   gene            complement(438652..438867)
FT                   /locus_tag="A1I_02370"
FT   CDS_pept        complement(438652..438867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78848"
FT                   /protein_id="ABV78848.1"
FT                   /translation="MKGIKDLTVIFRDTVGKEAAKNTWQLMEELFANYHPVNSLIDQAI
FT                   TEGLTTVEFTHNKDRDVPYRWCSYTK"
FT   gene            complement(439342..440478)
FT                   /locus_tag="A1I_02375"
FT   CDS_pept        complement(439342..440478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02375"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78849"
FT                   /protein_id="ABV78849.1"
FT                   /translation="MDTAELSKVINDDWTALTFAAAYGLEKVCELLIPKMTDQAINQVN
FT                   KDGNTALIAAASSHLEKICEALIPKMSDQAINQVNKDGNTALIAAASSHLEKICEALIP
FT                   KMSDQAINHINNYGNTALIAAASSGLEKVCETLIPKMTEQAINQANHQRDTALIFAVRN
FT                   SLKKVCEVLIPKMSYEAINCWITNSFWFGFTAFTWVTLNGDKKICELLIPKTSPEVIID
FT                   ILKLTKEKQFIIEAINSCNKTSPEVIINILKLAKEKQFMIEAINNYNNKLVKELNLILD
FT                   ENNPNNAIKMIRAVKIYKKLFKEYLTVEKTENFKPLQNTIEDFIKNNFFTAAGVCKNLI
FT                   PKIDNNEIHISCLTTEIIAHIVEYLENEKWGLEVETLG"
FT   gene            complement(440487..440591)
FT                   /locus_tag="A1I_02380"
FT   CDS_pept        complement(440487..440591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78850"
FT                   /protein_id="ABV78850.1"
FT                   /translation="MFSWLFSWFQTPKTSHEKLIEAIEARNEAEAQNL"
FT   gene            441025..441195
FT                   /locus_tag="A1I_02385"
FT   CDS_pept        441025..441195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78851"
FT                   /protein_id="ABV78851.1"
FT                   /translation="MDHFPLSSRNGIVAWFRCHSVDRRNPVIKKLKYVKPLALKAQFIS
FT                   LFSGSRGQATG"
FT   gene            441349..441513
FT                   /locus_tag="A1I_02390"
FT   CDS_pept        441349..441513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02390"
FT                   /product="Cassette chromosome recombinase B"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78852"
FT                   /protein_id="ABV78852.1"
FT                   /translation="MQCRQWHIAILIDSVFANLTLKPEKLDYTLRPPFDVFVKIPETKE
FT                   WWRQRESNP"
FT   gene            complement(441624..441836)
FT                   /locus_tag="A1I_02395"
FT   CDS_pept        complement(441624..441836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78853"
FT                   /protein_id="ABV78853.1"
FT                   /translation="MSKAKTASKNNPTARESAKVHFYKGEEIIPSKYIPQQGSSFLAAE
FT                   IKSSGDLVLGNNGQVLPWNLVKNLA"
FT   gene            complement(442019..442873)
FT                   /locus_tag="A1I_02400"
FT   CDS_pept        complement(442019..442873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02400"
FT                   /product="Protein export protein prsA precursor"
FT                   /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78854"
FT                   /protein_id="ABV78854.1"
FT                   /translation="MKKLSIVLLSVSMLSSIAFADNSDRVVATYTGGEVRESQIMKEFK
FT                   PQLNLPSGETIKNFDDFPPQDQDKLIRIYVNNILLKKEVEKSNITSSKEFQEKLENAKN
FT                   QLAQKELLENYVKSNLTDKMFDDEYNKYVTSLKGKEQIKVAHILVKSEKEANDLKNKLN
FT                   KGADFAKLAGESSLDKASATNGGVIGYILLNQPGQLVPEFENKAFALKVNEVSTPVKTD
FT                   YGWHIIKVLEKKPVPIPTKEEAKMTIDNVLAAEILKKYISDLEAKADLKIMLPPAANNE
FT                   AKK"
FT   gene            443091..445823
FT                   /locus_tag="A1I_02405"
FT   CDS_pept        443091..445823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02405"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="COG0653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78855"
FT                   /db_xref="GOA:A8GVH8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVH8"
FT                   /protein_id="ABV78855.1"
FT                   /translation="MFSILKKIFGTANDRTIKKLFSDIAKINSLEPAIQKLSDEELKNK
FT                   TVEFKKKLKNGATLDDIAYEAFAVVREASRRVYGMRHFDVQLIGGLVLHRGMITEMRTG
FT                   EGKTLVATLPAYLNALAEKGVYVVTVNDYLVSRDSASMGKIYNFLGLSVGCIVAGMTDE
FT                   AKREAYNSDITYATNNELGFDYLRDNMKYSLQERVLRPFNFAIIDEVDSILIDEARTPL
FT                   VISGPVNDNSELYGKVDKLVRMLNVSDFEKDEKLKTINLTESGISHVESLLSQADIIKP
FT                   NSGLYDFENLSLVHYVNQALRAHNMFMIDVDYLVRDGKVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYPKLSGMTGTAMTEAPELKDIYNLDVVAV
FT                   PTHNKVTRRDLDDEIYGSKKEKYDAILKLIKDCYDRGQPVLVGTVSIEKSEEISNVLNK
FT                   NKIPHKVLNAKFHEQEAFIIAQAGRFKAVTIATNMAGRGTDIMLGGNPEMLIEQIDRKS
FT                   LTNAAYKEKVNEIKAQTAEEKKQVIAAGGLFVIGTERHESRRIDNQLRGRSGRQGDPGN
FT                   TKFFLSLDDDLMRIFASERISGVLRTLGLKDGEAIHHPMISRSLEKAQQKVEGHNYEIR
FT                   KNLLRFDDVMNDQRKIIYEQRTEIIKSKDSYDFLSSTTEELAKKIVLTFMPAGSYREDW
FT                   DIENLSVELHRTFAIKLDQNLISKNDVTEEEVTKIVIQTADSIYKSKEEAYSPDLMHNA
FT                   VKYILLTTLDQVWKDHLHSLDHLRQGISLRAYAQKDPLSEYKREAFNLFEHMLNNLKEL
FT                   FIQTVYHFHIDLKHIQKEDISLENKKLQNNMHESREDPAFSKYNAGSNLETDLRPVISR
FT                   INPEDRDPKNPTSWGKVSRNELCPCGSGKKYKYCHGLNE"
FT   gene            complement(446542..447051)
FT                   /locus_tag="A1I_02410"
FT   CDS_pept        complement(446542..447051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78856"
FT                   /protein_id="ABV78856.1"
FT                   /translation="MLNQINHTSKAILFLLPPYNTKSEKISYDTNLSCKKSNLTLIKII
FT                   KAKNYYDYKAFVTLIYTVIKHPDKPIIVIIDEDILNTVENTIMWAVLGTLITAKLIIVA
FT                   TYERDQSNIKLIELTKDENRFLEFSAYCFKTYYYINWEKKIKKIKANARKNNNSIIRAK
FT                   ELKLSE"
FT   gene            448086..449411
FT                   /locus_tag="A1I_02415"
FT   CDS_pept        448086..449411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02415"
FT                   /product="Leucine-rich repeats (LRRs), ribonuclease
FT                   inhibitor (RI)-like subfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78857"
FT                   /protein_id="ABV78857.1"
FT                   /translation="MFRGQFQTPQEISAAKTSHENLIEFVEKRGLKQRADNLRHHGTML
FT                   NLHENQIDDAGAKELAAALKANNHLTMLFLQGNNIGNTGAKYIAEALKANNHLTELYFS
FT                   NNNINNNGAKFIAKALKDNDSLTHLDLSGNNINKAILETINEYLQRNKTIAEKKAQNLN
FT                   TEKEVEKKYEEQQKQILSENNEFAETVNKFFHDPTSVSLCYQIITDDFAQLVADKLKIN
FT                   KTITAIDFMGSTISDQGIKIITEALKASTQLKKLDFSGCDLGNQKISVLAEVLQLNTLT
FT                   HLCLNTNYIGTVGIKAIIEALKENTTITHIDLEQNNIDQQSQIIIEKYLQRNKNIEKTD
FT                   DKFQKLTDDLNDKISNNATINVNDKTKIAEQLKNIACKAKLLINKVDIEQVTNNLQDLL
FT                   SKNKITKGNIIDLEDEINAIIDHQNIADDISISGSSGDSSFI"
FT   gene            complement(449554..450303)
FT                   /locus_tag="A1I_02420"
FT   CDS_pept        complement(449554..450303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02420"
FT                   /product="Putative glutamine amidotransferase"
FT                   /note="COG2071 Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78858"
FT                   /protein_id="ABV78858.1"
FT                   /translation="MNRKPIIGITPDLAQNCEKYSYAAFPWYALRKNYTDAIIEAGGVP
FT                   MLLPYQAETIDHLMDFIDGVILPGGDEDIHPKFYEPEYAEDVVISNEERDNFEILILKK
FT                   SLEKNIPVLGICRGMQLINVVLGGTLIKHIPDYIEETKQPIIINHTQPHPKDIVSHAIS
FT                   IKPNTKLARMANNKLDTMVNSTHHQAIKQIGNNLIISAKAEDGIIEAIESTSHKFLIGV
FT                   QWHPEYVNDNGIDLTLFKELIKASTIQ"
FT   gene            complement(450309..450830)
FT                   /locus_tag="A1I_02425"
FT   CDS_pept        complement(450309..450830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02425"
FT                   /product="5-Formyltetrahydrofolate cyclo-ligase"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78859"
FT                   /protein_id="ABV78859.1"
FT                   /translation="MTKQELRLYFKEFLTKNIDKINSDLIKTSLLNQVSNLLKQLKVKH
FT                   VGIYYPLKYEINLLEILNIHHEIKFFLPKIINNEINYCAYNYNDELVLGSFKTLEPINN
FT                   DFYKPELIIVPGLAFSKDGYRLGYGKGHFDRYLNNNKDILTVGVCLKEQVIDNFPVELH
FT                   DQKLNFIISI"
FT   gene            complement(450830..451204)
FT                   /locus_tag="A1I_02430"
FT   CDS_pept        complement(450830..451204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02430"
FT                   /product="RDD family protein"
FT                   /note="COG1714 Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78860"
FT                   /protein_id="ABV78860.1"
FT                   /translation="MILRRLFAFLIDKIIIGMLLSLTIAFARDTIIEIALFFIISGVYF
FT                   SYLESSKIQASIGKKLLDLKVVHQDGTTLKGSEAFIRFIAFYVINLTGILFVISIIMMI
FT                   MREDNKMLHDLVFNTQVVKS"
FT   gene            complement(451208..452806)
FT                   /locus_tag="A1I_02435"
FT   CDS_pept        complement(451208..452806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02435"
FT                   /product="Cytochrome c oxidase polypeptide I"
FT                   /note="COG0843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78861"
FT                   /protein_id="ABV78861.1"
FT                   /translation="MDITTNDLNHDDHHTPHGWKRWLFSTNHKDIGIMYIIFAIFAGIV
FT                   GGLFSLLFRLELAMPGGTFLNHDFQLYNVLITAHAVIMVFFMIMPALFGGFGNYFVPLL
FT                   IGAPDMAFPRLNNISFWLLVPAFILLMGSAFVDGGPGTGWTLYPPLSSISGHPGAAVDM
FT                   AIFSLHLTGLSSILGSINLIVTIFNMRAPGMGLFKMPLFVWSILVTAFLIILAMPVLGG
FT                   AITMLLTDRNFGTTFFKTDGGGDPVLFQHLFWFFGHPEVYIVILPGFGIVSQVISTFSR
FT                   KPIFGYQGMVGAMVIIGFVGFIVWAHHMFTVGLSYNALIYFTAGTMIIAIPTGIKIFSW
FT                   IATMWGGSITFPTPMLFSIGFIILFTIGGVTGIILSNSALDRVLHDTYYVVAHFHYTMS
FT                   LGALFTAFAGFYYWFGKISGKQYPEILGKIHFWITFVGVNLTFFPQHFLGLAGMPRRIP
FT                   DYPESFAGWNMVSSIGAGISMAAALYFVFIVFYTLKYGKDCPNNPWGDGADTLEWTLTS
FT                   PPPFHTFETPPHIEE"
FT   gene            complement(452857..453759)
FT                   /locus_tag="A1I_02440"
FT   CDS_pept        complement(452857..453759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78862"
FT                   /protein_id="ABV78862.1"
FT                   /translation="MVMSEEEFKKRPNMAKYPEEEKIFFYIIEIGHYENYDDAMDYMAK
FT                   NLKASEEFRQIAASQALQILVHRFYNIKDELILPLLFKHLKSDSKYKYFLSEIMNTLGD
FT                   IAHLVPRLRRKIYLTCFNNDIDFVTYKKLKKFTDKNLLYSLNNEEEKIEFILSFCQNSS
FT                   SYQEALEVCLYFLRKNESEKINIAAFQGLTYIVFRFRKINFKAILPFIGRFSRYSTERC
FT                   EWIYTESLLEDIAIVIPKLRIKAITFLKKYSYSHLRTSSFINYIITKNKPKDQIKLEKI
FT                   LKLNVNNLKKVKLKYNLNF"
FT   gene            complement(453753..453887)
FT                   /locus_tag="A1I_02445"
FT   CDS_pept        complement(453753..453887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78863"
FT                   /protein_id="ABV78863.1"
FT                   /translation="MKIHNPKIIDTKISELNKLLNDITDSNKHQEILNSDDAVGNESW"
FT   gene            complement(454167..454967)
FT                   /locus_tag="A1I_02450"
FT   CDS_pept        complement(454167..454967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02450"
FT                   /product="Cytochrome c oxidase polypeptide II"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78864"
FT                   /protein_id="ABV78864.1"
FT                   /translation="MKNVITLIGLVLFSSFCFASEPLPWQMGFQPPASPIMEELHKFHD
FT                   FLLYISTAIVLFVAGLLVFVCIKFNARNNPVPAKFSHNILIEIIWTVIPIIILVIIAVP
FT                   SFRILRHAEKIPEADLTIKVVGYQWYWHYIYPDHNDIEFDSVMISDENLKPDQKRLLDV
FT                   DNRIVIPENATVRFLITAGDVIHSFAVPSLGFKIDAVPGRVNETWTRVAKKGVYYGQCS
FT                   ELCGINHGFMPIAIEVVSKEDFDNWVASKNKVAANGENSKLAAN"
FT   gene            complement(455053..455607)
FT                   /locus_tag="A1I_02455"
FT   CDS_pept        complement(455053..455607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02455"
FT                   /product="Glycerol-3-phosphate cytidyltransferase TagD"
FT                   /note="COG0615 Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78865"
FT                   /protein_id="ABV78865.1"
FT                   /translation="MFRLFLFLLILTNFTSCSFNNQDVKSLKIEYYENISSNKKCLPNS
FT                   KIVLVGGCFDVLHYGHLEFLHEAKKQGKYLIIALEPDETIIKYKKRKPIHNQMQRAKIL
FT                   SSLTFVDKVLMLPELKGFNDYALLVQNICPSVIAVTKHDPQLANKQTQAKLINAQVIEV
FT                   IDLIQHPDIGTFSTSNIINSI"
FT   gene            455760..457127
FT                   /locus_tag="A1I_02460"
FT   CDS_pept        455760..457127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02460"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78866"
FT                   /protein_id="ABV78866.1"
FT                   /translation="MKNDTLSYDFDDVLSVPYLSARFKKGLTSVSLLLFIALVIFVSFA
FT                   VNNYVNDTLSITLVHPEAEEVQEAISFKEVTVKKGDTINSILSGQNIPRNDIEKILSLV
FT                   KENKLLPSLKIGQQITFEYETKITENDNEDLTSETVFLNKIILAIDKLKTIEIIRKNDN
FT                   FKITEIIVPLTKTVAKSSVNIESNFMSALKKLGLSNNNIIELINAYAYQIDFQRQIKSG
FT                   DTATVITEKYVTEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNVNNHAFFSEDGKSV
FT                   KRSLLRTPLKVIKVSSQYGIRKHPILGYTKMHKGVDFAAPTGTPIYSAGNGVITEIGWK
FT                   SGYGKFIQIKHSGTLSTAYAHASNFAKGLKVGSLVKQGDIIAYVGSTGRATGPHLHYEV
FT                   KIDGKHVNPMSVKTTPGVELSGKKLEKFKQFKKEVKTLNVKLDKDLQANKVAEVSV"
FT   gene            457418..458008
FT                   /gene="lspA"
FT                   /locus_tag="A1I_02465"
FT   CDS_pept        457418..458008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="A1I_02465"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="COG0597 Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78867"
FT                   /db_xref="GOA:A8GVJ0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVJ0"
FT                   /protein_id="ABV78867.1"
FT                   /translation="MILSFKKLYLTFARSSRIIITLVIIDQLTKWWFINNLRWKPGLTL
FT                   KVTSFLNMVYTWNYGISFGLMRDYYQYSNIVFLITNTIIVCYLYYLMMSSKTIGGFAGY
FT                   SFVIGGAIGNLIDRSFRGAVFDFIHFYYQDYSFPVFNLADCFITLGVIILVEDYYSAKK
FT                   NIEEKAKENYDKAQIEAMAEKIRNAPQGDNDKI"
FT   gene            458034..458282
FT                   /locus_tag="A1I_02470"
FT   CDS_pept        458034..458282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78868"
FT                   /protein_id="ABV78868.1"
FT                   /translation="MRKVFLLFTVLLITSACNKKLKETVGISTAGPNEYQVQRSKALEV
FT                   PPHYYLPVPTNNQAVYNNVNDQVNLNEGEQALMQDMN"
FT   gene            458319..459443
FT                   /locus_tag="A1I_02475"
FT   CDS_pept        458319..459443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02475"
FT                   /product="Cytosine-C5 specific DNA methylase"
FT                   /note="COG0270 Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78869"
FT                   /protein_id="ABV78869.1"
FT                   /translation="MKQKTVKIEDSYNFKKTIVELVTQKALFEKIKVISLFSGCGGLDL
FT                   GFEGNFNIHESCIKDDDFIKSKNGNTVILKDNPFEIVFCNDIMQEAKVAWEANFSNKLE
FT                   YSTKSIRELKGYLLPKADLVIGGFPCQDFSLAGKRAGFSSERGRLYQEMARIIREVRPK
FT                   AFVAENVYGLLSINGAIETIKKEFENGGYKVFHYPVEAQQYGVPQTRKRVFFIGIKESD
FT                   LKRKIDEKEFLPKPSHFDKAVTLNQVFKNLPEPNESSDPDQKSYSKAKFYGLNCQGNKS
FT                   VDINKPAPTIRAEHHGNIEFRRLENNGNGNDRRLTVREAAIIQTFPTSFSFIEKNGKKL
FT                   LSQSASYKVIGNAVPPLLAYHFARKLGKLWHDIF"
FT   gene            459430..460038
FT                   /locus_tag="A1I_02480"
FT   CDS_pept        459430..460038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78870"
FT                   /protein_id="ABV78870.1"
FT                   /translation="MIFFKVMVYNIFELLVESAISTLLETVNRIENALETNRRLEKEFE
FT                   HHVLLAFKGAGKEKGFDCIPSSTHGFPDIICKHKESGLKFGVEVKTGKTWQTNGNSIFT
FT                   QIGEQDLDEIIVLFCKTTKPIEISWKKYEDAVNSIAITHSPRYVIKMDTENDNTFFKKM
FT                   NITYKEFKKMQVEEKMQLIKSYYLLKEKGGRQWWMSKDK"
FT   gene            460056..461408
FT                   /gene="murD"
FT                   /locus_tag="A1I_02485"
FT   CDS_pept        460056..461408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="A1I_02485"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COG0771 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78871"
FT                   /protein_id="ABV78871.1"
FT                   /translation="MTIHKKQNIGVFGLGKTGISVYEELQSKCNIIAYDDLEVNRNKFE
FT                   ELFSKNYIIPISDIKWQNLDKIVLSPGIPLTHEIVKIAKNFNIPITSDIDLFFEKSKGL
FT                   NLLAVTGTNGKSTTTALISHILSDNGLDYPIAGNIGVPVLQAKASKGGYVLELSSFQLD
FT                   LVKTFAAKIAVLLNITPDHLDRHENMEGYITAKSKIFDRMDKDSYGIINIDNDYCHEIF
FT                   TNLQQKHHIKLIPFSVTKILEKGISIVNDIITDNFFEHISFKLISNKSLQGIHNSENIA
FT                   ASYAVARIIGLEPVKIIESISSFQGLPHRMQYLGNIDDINFYNDSKATNAIAAVQSIKA
FT                   LDNIYWLAGGIAKEGGIEEIKPYFSKIKKAYFYGQAKEMFANTAKDIIDFVICDDLKQA
FT                   FELAYKDACKDNEKEKNILLAPCCSSYDQFKNFEERGELFIRLYNTLNLCL"
FT   gene            461563..461976
FT                   /locus_tag="A1I_02490"
FT   CDS_pept        461563..461976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78872"
FT                   /protein_id="ABV78872.1"
FT                   /translation="MLGFITAFFTIESSNTKNDKLIKGKIKNDEAIVDTFLNMSLESIE
FT                   KTFPKPFSSSTHVEKKVNVDENDNGIFSTFYNTAVKYVLDLVAPVVQSVVQYARDYIEG
FT                   DYNKYTLKIIVCKDIINKIMTLKTILVKTIMLN"
FT   gene            462231..463364
FT                   /locus_tag="A1I_02495"
FT   CDS_pept        462231..463364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02495"
FT                   /product="Cell division protein ftsW"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78873"
FT                   /protein_id="ABV78873.1"
FT                   /translation="MNNEISNNFIKLWWRSTDRQIVISLVILFAFSLMLVTTSGSAVAS
FT                   RIGLEENYFASRQVFYLTAASALILLFSCFNKKWLKRFAILGFIASVILLIAVKFFGYE
FT                   VKGATRWINIAGLSIQPSEFIKPFFAVVTGWILSLKFNDDFPSFTVCSILYFIVAILLI
FT                   IQPDFGMLVMITAVFGIQLFIAGMPIFWIVLAGFLGMIGVTIAYFWLPHVTQRINSFLD
FT                   PDSSENYQVSKSLKAFEHGGLYGKGPGEGAVKQVLPDSHTDFIFAVAGEEFGAIICLIV
FT                   IGIFAFIVLRSLAKLLNEQDKFVQFAASGIVVQLGLQAIINMGVTLHLLPTKGMTLPFI
FT                   SYGGSSTLAIAIATGMLLGFTKYRTPLDSYKINKIEI"
FT   gene            463361..464431
FT                   /gene="murG"
FT                   /locus_tag="A1I_02500"
FT   CDS_pept        463361..464431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="A1I_02500"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78874"
FT                   /db_xref="GOA:A8GVJ7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVJ7"
FT                   /protein_id="ABV78874.1"
FT                   /translation="MKKIVLVAGGTGGHFFPAVALGEELIKRKYEVHFITDLRCEKYIN
FT                   HDAGLIFHVIDLKRPKNILLFLPLLSLAIFKAIKLLFSLSPSAVVGFGGYPVVASMFAA
FT                   IFLRVPIVIHEQNSYLGKVNRFFANFAKKIAISYKNTKNLPVVVKNRTVVTGGIVRKNI
FT                   RGLDSVVKRRNDKDRTFKIFIFGGSQGAKLFSELIPESIKALMQKQPNLKLHITQQAAL
FT                   DDQVKIKNIYSNLNINYELAEFFDNMANQYKNTDLVISRAGASTIEELTYIGLPAIFIP
FT                   LPSAADNHQYHNAKLLEDEKCGWCMKQDDISSEKLAEKIFELISNPKILENTSKNLLKR
FT                   RKEGHKLLSNLIEELI"
FT   gene            464569..465213
FT                   /locus_tag="A1I_02505"
FT   CDS_pept        464569..465213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78875"
FT                   /protein_id="ABV78875.1"
FT                   /translation="MLKKIIILFLGVFVLSGCTDSFRGYFQKSANNRLVDSKGFKGGKR
FT                   KPLYNNKYISLAKKNIVEDNLDDPEDDDDDYDNPLRGEQIDPVKRNREIYLKMIRRDME
FT                   KYKAESGESSDDDDMTLSKANKKVRKDNTDKERKMQEELDQIKAMLRETKRDISKYTCP
FT                   NATANQNYVPPVSNYEPVAPVKNNKPYNNNSKVKQKFIREDDDYSSNACSI"
FT   gene            complement(465464..466210)
FT                   /locus_tag="A1I_02510"
FT   CDS_pept        complement(465464..466210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02510"
FT                   /product="hypothetical protein"
FT                   /note="COG3022 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78876"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVJ9"
FT                   /protein_id="ABV78876.1"
FT                   /translation="MLTIISSAKTLNFELIAFKGELTSPAFPKITNQLLAIVKNYSEVQ
FT                   LSKTMDISEKLAHLNKERFQNFEKQDSKAAIFAYAGDVFNNIQSKNLSEDAVNFLQSHL
FT                   LIISGLYGALKPLDAIKPYRLEMAAKLNEINDLSKFWQDEITNYINHTLEHHKHKYLLN
FT                   LASQEYSSVLNQDKLKYPIINIHFKENRNGKLATIGINAKKARGNMVNFIANNLIDSPD
FT                   LLKEFSYLGYKYSSKDSLNNDLVFVK"
FT   gene            complement(466210..466401)
FT                   /locus_tag="A1I_02515"
FT   CDS_pept        complement(466210..466401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78877"
FT                   /protein_id="ABV78877.1"
FT                   /translation="MKYLVILFAALTLIGCSNQKNTKSKEVMQADGDPSYAIMRTVNDT
FT                   NRNIASTVSTVPNPPASR"
FT   gene            466619..467584
FT                   /locus_tag="A1I_02520"
FT   CDS_pept        466619..467584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02520"
FT                   /product="ABC-type transport system, periplasmic component"
FT                   /note="COG2984 ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78878"
FT                   /protein_id="ABV78878.1"
FT                   /translation="MPTAQLLNYNLIQDIKMSSLNLFLRAFSLLFSLFFTLSIYATQKN
FT                   IAVIVPLEHAAMTQIVAGIEESLKAIDAKIIVKNAHADSNILLAIIKQLKDQDIDVIIP
FT                   IGTSACQTVISHIPNKPIVCAAAEIDNKNLPLVTGVNDEIKITSIISKLAFLRNITLIY
FT                   SSSEKVISEVEATKSYAKKNNISLNFKMVQNLNDLSVAVKNTPENTQCFVILKDHLIVS
FT                   GINILKQEAFKRNIPIIASDEGSVISGATIAVGVQEKDIGFKVGNQAKQILESIAPKDI
FT                   PFQNMDELTLFVNLKSFIKQKILTKENLAALPFNRKELEE"
FT   gene            467589..468428
FT                   /locus_tag="A1I_02525"
FT   CDS_pept        467589..468428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02525"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG4120 ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78879"
FT                   /protein_id="ABV78879.1"
FT                   /translation="MNLLVTALEQSLIMLPLILGMYISYRILKITDLTVDGTYVLGAAV
FT                   FAKFLSFGLFPALILAVIAGGVIGVIVSFMQKNNRVNSLIAGILASFMLYSVNLQIMQR
FT                   PNISTLGMPSLLTIFNTENWLLPLMITNIIVIFAVVILLKGRLGLMLRAFGFNKDLLAI
FT                   LGKPAEFYRTLGLSISNALAALTGTISAQVNGFADINMGFGVALVGIGAIVIGRHILIR
FT                   NNSFNAFKEIFSCFIGILFYFINLSILLRVGIDPINLKLILGIVLFISLRSVKRENV"
FT   gene            468425..469153
FT                   /locus_tag="A1I_02530"
FT   CDS_pept        468425..469153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02530"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1101 ABC-type uncharacterized transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78880"
FT                   /protein_id="ABV78880.1"
FT                   /translation="MKPYLYAEKVQFKVKERNEPIISETTLNIAEEEFVVVLGTNGSGK
FT                   STLTKILAGYLKPTSGQVFLDQMRIDKLPQSQKANMLLTITQKAEDRLFSELTLEENIT
FT                   LWESRFPANERKTDVEVLELIGLSKSKHFLSRLTQPLSNFSGGEKQLILLALAISHPPK
FT                   ILFLDEHTASLDPKVSHEVMKKTAEIIDEHKITAVMITHNLEDAVNYGKRLIVLDNGKV
FT                   AQDYLKPPAFSMKELKKILG"
FT   gene            complement(469305..469487)
FT                   /locus_tag="A1I_02535"
FT   CDS_pept        complement(469305..469487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78881"
FT                   /protein_id="ABV78881.1"
FT                   /translation="MNQNPSSQLTYSLAENAVLTTQLALADIELKKADERLREVEAKEK
FT                   QLAIEREALKDELEA"
FT   gene            complement(469568..470041)
FT                   /locus_tag="A1I_02540"
FT   CDS_pept        complement(469568..470041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02540"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /note="COG1495 Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78882"
FT                   /protein_id="ABV78882.1"
FT                   /translation="MLHIGLIAISITALATAYFAEYILRYAPCPLCVYERFPYLTLIKI
FT                   CLTALIIRQLSKYTLVFIFLTLLSSCILSTYHSMVERGIVQPSSLCSSMIRFPKGLSIE
FT                   HIRQMLYSQPITSCTKPAIKLLGISMTEYNLLLNLGLLIGLLIVWLYPKESSL"
FT   gene            470337..471905
FT                   /gene="lysK"
FT                   /locus_tag="A1I_02545"
FT   CDS_pept        470337..471905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysK"
FT                   /locus_tag="A1I_02545"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG1384 Lysyl-tRNA synthetase (class I)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78883"
FT                   /db_xref="GOA:A8GVK6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVK6"
FT                   /protein_id="ABV78883.1"
FT                   /translation="MSEILEDAIKSKAWPFEEAKKILDSLNGKTPEKGYVLFETGYGPS
FT                   GLPHIGTFGENARMVMVQKAFEQLSNIKTKLICFSDDMDGLRKVPSNIPNPEMVAGYMD
FT                   MPLTSIPDPFGECESYGHYMNAKLRSFLDKFGFEYEFYSSTEMYKAGMFDEMLIRVLEK
FT                   YDEIMELMLPTFREERKATYSPFMPICPKTGKVLQVPIHKWDAKLGTITYKDENGETIE
FT                   VPVTKGHCKLQWKPDFSMRWAALKVDYEMYGKDHLANGRLYSEICRILGGKPPVQLCYE
FT                   LFLDENGEKISKSKGNSISVDDWLKYAPVESMALFMYQNPTRAKRLFFDVIPKNVDEYI
FT                   TFNQKYHLEEDRTKRFANPVYHIHHGNVPKIETFGITYSLLLNLTSVCNPSDKSVLWGF
FT                   ISRYEPKAMPNNSPYLDHLAEFAIRYYNDFVKAHKSYLAPSEKHKAILQDILDMLKGLP
FT                   EQIEAESIQKGIYDIGMKAGYENLRDYFKDLYQILLGQSDGPRLGTFIKLYGISETMKL
FT                   IEEKL"
FT   gene            472109..473041
FT                   /locus_tag="A1I_02550"
FT   CDS_pept        472109..473041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02550"
FT                   /product="Putative permease"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78884"
FT                   /protein_id="ABV78884.1"
FT                   /translation="MNDIFCSTLPIFLITLLGSIIKNKWLTSEEFWRGIEKLSYFVLFP
FT                   AMLFNYISTADLSVTSIIKLVIALIISTLLITLGLIIYQRKYNIDKIEFTSIFQGSIRY
FT                   NSYIFFAAGSPLFGSRGLSIVAVISSYMIIFTNILSVMIFAYYVPDKSVTTTIRTSIVL
FT                   MIKLIVRNPLIIASLVGFVFNYSNLELHLGLKKTLDSLSNAALAIGMLNVGAGLNFTIR
FT                   QELLHSIIFTSFVKLIAFPLVSVVVLWMMSISGIDKSVGILYSSLPCASTAYVLSRQLG
FT                   GDPDSMASIITFTTFFSVVTISIIMYVMG"
FT   gene            473174..475471
FT                   /locus_tag="A1I_02555"
FT   CDS_pept        473174..475471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02555"
FT                   /product="malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78885"
FT                   /protein_id="ABV78885.1"
FT                   /translation="MDEMNKINYTEALEYHQKDKPGKIAISATKPLVTQHDLSLAYSPG
FT                   VAAPCLEIAKDTDEMYKYTARGNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEVDTKDPEEFINAVKYLGYSFGGINLEDIKAPECFVIEEKLKSLMDIPVFH
FT                   DDQHGTAIITAAGLINAAHITNRRLENLKIVVNGAGAAAIACIDLLIALGADKSKIILC
FT                   DTKGVIYQGRTEGMNKWKEAYANSTQLRTLEEALKDADVFIGLSVKGAVTKEMVSKMAN
FT                   NPIIFAMANPDPEITPEEIKQIRNDAIIATGRSDYNNQINNVMGFPYIFRGALDVRAKT
FT                   INTEMKIAAAKAIADLARKPVPEEVYKAYAGRKMIFGNKYIIPVPFDPRLITVVPVAVA
FT                   KAAIDSDVAKISDFNLNKYKKELESRLNPTSNYMNFLSEKIHNAPLKRIIFAEGEEEEI
FT                   IVAAIMMRDEKYGNPILIGRMERIEAKLKQLGQDISLDGITIMNAALTDKLEIYIDYLY
FT                   KRLQRKGYLYRDCAKLVKTDKNIFAACMLACGDGDALLTGITKSYVDSLEDILKVISRK
FT                   PNRRILGYSIVIAKDNNIIISDNCITEYPNSRELAEIAAQTAEIAKDMGIVPRVALLSF
FT                   SSFGNSSKEKTARIREAVNILDNFSEDKSKLNDMEVDFEYDGEMSVKVALDSNLRKLYK
FT                   FCRLSGPANVLIMPGLNSAAISTELLQEFSSNSFIGPITNGFEKPVQILQATASASEIL
FT                   KIATFACVKDIK"
FT   gene            475507..477483
FT                   /locus_tag="A1I_02560"
FT   CDS_pept        475507..477483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02560"
FT                   /product="Sec7 domain containing protein"
FT                   /note="COG5307 SEC7 domain proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78886"
FT                   /protein_id="ABV78886.1"
FT                   /translation="MDPLIKREVISSFNDKPKDGINKIKEWCASNNKDFAEETAKFFRE
FT                   EKNNLDLVAVGDYLGTDGEDNKKVLDHFVKQFDFKDKNYLKSLREFLKAFKLPGEAQKI
FT                   DRLVESFASKYYEQNTTTDINHADAAFISAYATVGLNTNLHNPSVKDKWTIDQFKDQLK
FT                   GLNAESKLQGIKSGKNFSNEFLENIYNGIKAEPFELNFIQTATGYEIAGISSQNDKTFK
FT                   KLDDFLTAKTDINNVFSNLGNNVTAQHKQPKTWLNKFTGYEGSVSVKAGNAEVEIQVYK
FT                   PNILSKWFLGEKSKLVIQPKGGSEQSLKLAAQIAASFETKVTSIKATYDYLKQDLENYY
FT                   NNPEQELRKANLVVDLHNKIKETTAKVQQADPEIPDTKSIPLASETNFQDLKEAEVGIQ
FT                   PAKTQPVEKPKFNTLVEELAWRNAQKKQAIDTPVTKNEEPKAQIDNHKKRLEELKQKQE
FT                   DLENKKKELEEKKANSNITKEEKWRIVAELEGVTKHLESIKKEHNTINTAEEREKQFNK
FT                   SSQSSALKGEPTAADKQQQAAMELIRLRKQRLQEEAASKAIIANNPATQPLKPGVIPPP
FT                   PPPPPGKGVPIPPPPPPPMPGQGVPIPPPPPPPPPPMPAIPPKLQETLKTIQTTQDGNK
FT                   QQGNNNFQDDLRKTLARRNSPTR"
FT   gene            complement(478231..478593)
FT                   /gene="rnpA"
FT                   /locus_tag="A1I_02565"
FT   CDS_pept        complement(478231..478593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="A1I_02565"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78887"
FT                   /db_xref="GOA:A8GVL0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL0"
FT                   /protein_id="ABV78887.1"
FT                   /translation="MFITSLKNQKEFELINKLGKKFHEKYFILVIAKNIPKIFLESKYN
FT                   IFLGIKVSKKLNKKAVVRNKIKRRIKHLIRLICNNSNLKKLAMIIIPRKGFDTADFSVL
FT                   NHELSKAILDFYNPKK"
FT   gene            complement(478615..478749)
FT                   /gene="rplT"
FT                   /locus_tag="A1I_02570"
FT   CDS_pept        complement(478615..478749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="A1I_02570"
FT                   /product="50S ribosomal protein L20"
FT                   /note="COG0230 Ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78888"
FT                   /db_xref="GOA:A8GVL1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL1"
FT                   /protein_id="ABV78888.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRARMATASGRAILRNRRAKGRKKLSA"
FT   gene            complement(478897..479250)
FT                   /locus_tag="A1I_02575"
FT   CDS_pept        complement(478897..479250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02575"
FT                   /product="50S ribosomal protein L20"
FT                   /note="COG0292 Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78889"
FT                   /db_xref="GOA:A8GVL2"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL2"
FT                   /protein_id="ABV78889.1"
FT                   /translation="MTRAKSGKISKNRHKKILKLAKGYRGRASTCFRVAIEKVEKGLQY
FT                   AYRDRRNRKRDFRGLWIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNNE
FT                   EFASIVEQAKAHI"
FT   gene            complement(479266..479472)
FT                   /gene="rpmI"
FT                   /locus_tag="A1I_02580"
FT   CDS_pept        complement(479266..479472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="A1I_02580"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG0291 Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78890"
FT                   /db_xref="GOA:A8GVL3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL3"
FT                   /protein_id="ABV78890.1"
FT                   /translation="MPKLKTKSAVKKRFKLTASGKVVASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCDQDGYNIKKYFLPYGTN"
FT   gene            479651..480328
FT                   /locus_tag="A1I_02585"
FT   CDS_pept        479651..480328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02585"
FT                   /product="Organic radical activating enzymes"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78891"
FT                   /protein_id="ABV78891.1"
FT                   /translation="MFGQNPKRGVLKGDGTQLQVQFIFKTIQGEGIFVGVPAIFIRLGG
FT                   CNLACDFCDTEFENFETIKIDDILSKVNLLALNSKNEQSVKLVVITGGEPMRQPIELLC
FT                   QKLLEQDFKVQIETNGTLYRSLPDEVSIICSPKAGKKGYSKIREDLLPKISAVKFIIAK
FT                   NILEYSLIPEIGQTAYNIPVFVQPMDQNDQKLNKENNELAVKLALESGARLSVQTHKFI
FT                   GIE"
FT   gene            480403..481011
FT                   /locus_tag="A1I_02590"
FT   CDS_pept        480403..481011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02590"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /note="COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78892"
FT                   /db_xref="GOA:A8GVL5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL5"
FT                   /protein_id="ABV78892.1"
FT                   /translation="MSEILELEAKSRNEFGTGAARALRREGRVPAIIYGAKKTPVSISL
FT                   EEKEITKYYRKPAFISQLINLTIEGTQYKVLPKAVELHPVTDIVRHVDFVFLEDKTQKM
FT                   EVPVVYEGKERALGVKRGGYFNIVKRRVTLLCDVNNIPRNVTIDVTNMPIATSLKSSKV
FT                   KLPEGCSFTTKKEFVLATIIGRRGAKTEAEGEQTAEAAK"
FT   gene            481486..482043
FT                   /locus_tag="A1I_02595"
FT   CDS_pept        481486..482043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02595"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78893"
FT                   /db_xref="GOA:A8GVL6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVL6"
FT                   /protein_id="ABV78893.1"
FT                   /translation="MMLIIGLGNPGKEYEHTRHNIGFIALENIAKQYETSFSVKKKFHC
FT                   EIAESTNNGQKLIFVKPTTYMNLSGKSVIAVKTYYNIPLEKIFVIHDDIDLELGKIKFK
FT                   TGGGNGGHNGLKSIDGIIENNYHRIRIGVGRPQNSQDVADYVLNNFSKTEYVIAEQAID
FT                   KITDNFNLILENKLEEFKSKMV"
FT   gene            482138..482566
FT                   /locus_tag="A1I_02600"
FT   CDS_pept        482138..482566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02600"
FT                   /product="Acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78894"
FT                   /protein_id="ABV78894.1"
FT                   /translation="MTQDFEIIYAEEMDKAYSAIIWDAFNKDAREKKGLTGDLKSFSFS
FT                   CLDQDKNFIAGMQGISLWGGVYITSLFVDENHRNKKYGRMLMEKAEELARERGCNFVAL
FT                   STMDFQAKPFYEKLGYKLEFTRHGYEKDSVSYHLRKDL"
FT   gene            485205..486302
FT                   /locus_tag="A1I_02620"
FT   CDS_pept        485205..486302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02620"
FT                   /product="translation-associated GTPase"
FT                   /note="COG0012 Predicted GTPase, probable translation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78895"
FT                   /protein_id="ABV78895.1"
FT                   /translation="MTLKLGIVGLPNVGKSTLFNALTASVAAEAANYPFCTIEPNSAVV
FT                   SVPDERLHKLAALVGSKKIIPSYIEFVDIAGLVKGASKGEGLGNKFLSNIREVDAILHV
FT                   LRCFEDEDVTHVHNKVDPIHDLEIIEMELILADIESVEKRLATSEKRLKSGDKTLAEQI
FT                   ELLKEVHKVLADGKPARVLNKTLGTDNLKQLQLLTSKPVLYVCNVLEKDAASGNEFTKL
FT                   VAEQAKKEEAKSVVISSKIEADIALLEDEEEKKEFLNSIDLEETGLSQVIKEGYNLLNL
FT                   KSFFTIGPKEAHSWTFKDGTLAPGAAGIIHTDFEKGFIRAEVIGYADYINLGSEAKAKE
FT                   VGKMRLEGKEYKMQDGDIVHFRFNV"
FT   gene            486775..487989
FT                   /locus_tag="A1I_02625"
FT   CDS_pept        486775..487989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02625"
FT                   /product="MFS-type bicyclomycin resistance protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78896"
FT                   /protein_id="ABV78896.1"
FT                   /translation="MKIIAKIPAWMLLCLFTLSPITETIYTSGLPSITEYFNTDGSTTQ
FT                   ITSSLYYLGFALGILTLGRLSDIYGRRPVVLFGLCIYAISSIISIFAPNIETLMLARFV
FT                   QAFGVSVGSVIGQAMARDSYQGSELSYVYASLSPWLLFIPSLGSSIGGYIIEYSSWHYT
FT                   FVFFSLTGTVLLTLYCKILPETNPYINFSQTSKYFEVLKVVIRDKSLWLYAFIIGAFNG
FT                   IYYGFYIEAPFIFIDKMKVAPSFYGKLAFLLSFAGIFGGFLGGYLIKKRHIHDQKVMIL
FT                   GLVFSVIGCSLLAIDALILQDKEVGQNIAVIMIFAPMMLHMVGHNLLIPMTLRYALEDY
FT                   AKVTGTAGSVFGAIYYVLIAAVTFLVSKLHSDTIGNFALLFLVLSVSSAAAFYYILILY
FT                   KKKLT"
FT   gene            487986..488132
FT                   /locus_tag="A1I_02630"
FT   CDS_pept        487986..488132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78897"
FT                   /protein_id="ABV78897.1"
FT                   /translation="MSTINIKVPNKETLKAFEETDNGKCTTRTLEEFEKYLDEIMKGEE
FT                   SKK"
FT   gene            complement(488827..489054)
FT                   /locus_tag="A1I_02635"
FT   CDS_pept        complement(488827..489054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02635"
FT                   /product="Actin polymerization protein RickA"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78898"
FT                   /protein_id="ABV78898.1"
FT                   /translation="MSKAEATEHKNVETAASNVPPPPPPPMPTGNVPPPPPVGDNTVTS
FT                   TPQKAKETNQPRPAVDTTNLMKQIQGGFNL"
FT   gene            complement(489227..489727)
FT                   /locus_tag="A1I_02640"
FT   CDS_pept        complement(489227..489727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02640"
FT                   /product="Actin polymerization protein RickA"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78899"
FT                   /protein_id="ABV78899.1"
FT                   /translation="MNNEYAANPQKFAQLPMSKPLHFPNAEELENQHNDLKVIQQNVLN
FT                   LLTENSNIEELKKIQKQVAEIREEVPFTKLEKLNNFWQKIKNIFVNNSEQVLAKNKENN
FT                   TKTIINIEEKLHKANNKFFELVSNKKQDIENIISNLPDSKRLEAIKEKLQKHINVKDTN
FT                   KII"
FT   gene            complement(489958..490146)
FT                   /locus_tag="A1I_02645"
FT   CDS_pept        complement(489958..490146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02645"
FT                   /product="Actin polymerization protein RickA"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78900"
FT                   /protein_id="ABV78900.1"
FT                   /translation="MAKITELDHHLNQEKEALDKVVSNLNELCEHNQKLQGFIEIQKEV
FT                   KELKKSILNLFLGLKNL"
FT   gene            complement(490241..491326)
FT                   /gene="mraY"
FT                   /locus_tag="A1I_02650"
FT   CDS_pept        complement(490241..491326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="A1I_02650"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78901"
FT                   /db_xref="GOA:A8GVM4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVM4"
FT                   /protein_id="ABV78901.1"
FT                   /translation="MLYNLLLPYIHNSHIANLFHYITFRSGLAVLVTLSLSFLIGPRLI
FT                   KFLQTLQKYGQPIRLDGPESHQAKAGTPTMGGIMIILSSCFSTLLLADLTNKYIWITLF
FT                   GFVSFSIIGFLDDYAKVTKNNHYGVKGKSKLLLQGIISLIVCILLEYTIDSPSHMLNVP
FT                   FFKSLSMDLGYLYIFFAIFVIVGASNAVNLTDGLDGLATVPIALTAGSFALISYLVGNL
FT                   IYSNYLQLTYLPNTGELTIFCASIVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIIS
FT                   VITKHEIVLGIVGGLFVIETISVIMQVYYFKATKGKRIFKMAPLHHHFEKSGWTESKVV
FT                   IRFWIISLIFVLIGLSSLKLR"
FT   gene            complement(491359..492711)
FT                   /locus_tag="A1I_02655"
FT   CDS_pept        complement(491359..492711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02655"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl
FT                   ligase"
FT                   /note="COG0770 UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78902"
FT                   /protein_id="ABV78902.1"
FT                   /translation="MIWNSKTLSDALGLLISQSIITNEIQFNSKDIKKGDLFIALQGNK
FT                   DGHDYIQDAINQGASAVIVSKQVDIADKNKIILVDDCLKALEQLALYKRKNSNAKFIAI
FT                   TGSVGKTSTKEALKTLLQHEALTFASRGNFNNHLGLLINLASMPDDTEFAIFELGMNHK
FT                   GEIRELVQILKPNIAMITNISEAHLEFFNSLEDIAEAKCEIFESFDKDGIAVINSDSNC
FT                   YDRILSILKKLSIENIHNFGKSSSAELILYEISGEQVHLKYKIYDAIIETTIPFIPKHF
FT                   AENYASILLIIFLLNQDLNKAAGYLKNIPMTKGRGKIINIGNSRIICDYYNASPTSMKA
FT                   ALEYLKQMPATNKTAIIGEMLELGQNSERLHKELVPYILDSGCSKVFLVGANTKYIYDA
FT                   LPEKITKAYFKNIDELIASTNDLFKNDELILIKGSRGIKLDKIIDYYTKVN"
FT   gene            complement(492870..494294)
FT                   /gene="murE"
FT                   /locus_tag="A1I_02660"
FT   CDS_pept        complement(492870..494294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="A1I_02660"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG0769 UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78903"
FT                   /protein_id="ABV78903.1"
FT                   /translation="MTPTLKQLFEKHNVKGLSNNSKTIKANDAFFAIKNGNDFIADALE
FT                   KGAALVITDDKKNTTNKVIFVEDIKETLHEAIELFYPKKPKTMIAVTGTNGKSSVVSYI
FT                   AQIYSLIGQKAASIGTIGVEVFGIDNFNESIGGLTTTDYLSFRKIAHKLAKNGIDYLAF
FT                   EASSHGLDQQRLGDLKVNVACFTSFSQDHLDYHHTKENYLLAKLKLFTDHLAKDGIAIL
FT                   NSDIEEIKFIKDYLDKHKIKYLCVGANGNCKITKTNSSLKGQNINFIFDNKNYDFDTPI
FT                   IGSFQASNLLIAGLSVYYTSFDFSKVINALTKVKAVKGRMERVNRTNIFIDYAHTPDAL
FT                   EKALTELKNIKAKGGKLSVIFGCGGNRDTTKRKLMGKIAASIADNVIVTDDNPRHEDPK
FT                   AIRQEIISGIVTTNYIEIADRKEAIKYGINNLKKDDILLIAGKGHENYQIIGDEKIRFD
FT                   DAEVASMSFLATAGIQ"
FT   gene            complement(494417..497779)
FT                   /locus_tag="A1I_02665"
FT   CDS_pept        complement(494417..497779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02665"
FT                   /product="Transcription-repair coupling factor"
FT                   /note="COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78904"
FT                   /protein_id="ABV78904.1"
FT                   /translation="MLQQKFPQAAKSFFTIDSFIKNSKQDFVLVTSNEEEALQLYKQAL
FT                   FFLPSENIYYFPSYDTIPYDHTSPNCNILSKRAETLSKLTTNKGNKLVITHATNLLNKL
FT                   PPKDFFAKYYLKLFPKMKLSANELSKFLVENSFTRNASTVDVGEFAVRGEIVDLILPES
FT                   KGYRINFSWDYVESIKQFDIDTQISTRSCNELIISPANEIVLNPETISNFKDNYLRNFG
FT                   VNHTDNPLYEAITGGRKFSGYEQLLPLFYDSYSGLTDYLNNLVIIFDNLTKQAILEFEH
FT                   SYNDFYKARLDANKLKFNSFYPTLSPSQLYFTSLEAIELLEQENNILISYENSEQASIV
FT                   ENIAAASFVEKKTIFDKLFEVIKANSRKKIIIGSSVLSSFERVKSIIENYEYSYNEIEY
FT                   LEEAKTNTINIAILPLNQSFSTPEYLFIAASELLEEKVTPTNTNKKLKNILLELDHLAE
FT                   GELIVHKDHGIGQFLKLEALEIKGKLHDFLKILYAGNDKLYIPVENIEVIKKYGSDVAQ
FT                   LDKLGSVSWQKNKAKLKNRIKEIALHLMQIAAKRKLNTTAAIEFDLEEYDKFCAKFPFT
FT                   ETEDQLNAINDIREDLSNGMLMDRLICGDVGFGKTEVAMRASFMVAKSLNENSPQVAVV
FT                   VPTTILCSQHFARFTERFKDSDLNIKQLSSVVSSKEAKIVRSELESGKINIIIGTHSLL
FT                   HKVTKFCNLKLLIIDEEQHFGVGQKEFLKSLKSSTHVLAMSATPIPRTLQMSMTDLKEL
FT                   SIIATPPLNRLEVRTSVMPFDPVIIRDALLREHFRGGKSFFVVPRINDIEDIEKQLKQI
FT                   VPELSYKVAHGKMSPNKIDEIMSEFYAGKFDILISTTIIESGIDIQDANTMIIHKADML
FT                   GLSQLYQLRGRIGRGKMRGYAYLTLPSHKKMTPHSLRRLEIIQNSCALGSGFTIASHDM
FT                   DLRGFGNLIGEEQSGQIREVGTELYQEMLEEQIAIFKDEPISGEQPFIPTINLGLSVFI
FT                   PDNYVSDSVLKLGLYRRIGNLNDDLEVEKFKDEMIDRFGSLPTEFNNLLDIVKIKLLCF
FT                   KLNIENLDSGDNGFVIKFYKNADMADKILKFVSTYTANAKIKPDNKLVFIKKLVGKNII
FT                   TEANQLLWNLSEI"
FT   gene            complement(497793..498056)
FT                   /locus_tag="A1I_02670"
FT   CDS_pept        complement(497793..498056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02670"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG2938 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78905"
FT                   /protein_id="ABV78905.1"
FT                   /translation="MNKLNKNSLQKKLFYRSKNRGCKEMDYILGNFASLYLPFMAEEKL
FT                   LSYALILYQNDNDLYNWITNKSSVPSNLDAEIMEQLRKIIKI"
FT   gene            498243..498512
FT                   /locus_tag="A1I_02675"
FT   CDS_pept        498243..498512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02675"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78906"
FT                   /protein_id="ABV78906.1"
FT                   /translation="MLVQNICSKEAYNMLVSNNNTFLVDVRTEEEWKNVGVPSLSNKNN
FT                   VIFLSWQLSPFMELNKDFEDRFLSIIDDKMSNIIFFYVDQGIDH"
FT   gene            498512..498631
FT                   /locus_tag="A1I_02680"
FT   CDS_pept        498512..498631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02680"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78907"
FT                   /protein_id="ABV78907.1"
FT                   /translation="MAANFMANIGYKNCYNIIDGFEGNLQNKGWKQSNLPWQF"
FT   gene            498632..500023
FT                   /gene="dnaA"
FT                   /locus_tag="A1I_02685"
FT   CDS_pept        498632..500023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="A1I_02685"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78908"
FT                   /db_xref="GOA:A8GVN1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVN1"
FT                   /protein_id="ABV78908.1"
FT                   /translation="MNTNQIILTNQNDNSVNVWSNVTQDLYNYYGEALYNSWFSKVNFI
FT                   ESSLNTVILCAPTNFIRDWIKSKYSVVILQLFQHYNNAIKTVEIITKELPASNQATLEL
FT                   PTKTFADIGSSELNSENIFSTFDIRFTFDNFVVGAPNELAYAAARAVAESSSAVSESNP
FT                   LFLYGGVGLGKTHLMHAIGWYIKQNNPSRKVIYMSAEKFMYQFVKALRNKEVMSFKEKF
FT                   RSVDVLMIDDIQFICGKDSTQEEFFHTFNTLIDNNRQMVISCDRSPSDLDDIEDRIKSR
FT                   LGWGLVADVHSTTYELRLGILESKIEQMNVKVPKDAIDFLASKIVSNVRELEGALNKVI
FT                   AHSNFTAKEITLENTQNILRDLLRSNERIITVEDIQKKVANRYNIKLSDMSSPRRMRTI
FT                   ARPRQIAMYLSKILTPKSLVDIGKKFGKKDHTTVMHAIKKVEELLESDLELREEINLMM
FT                   KILQN"
FT   gene            500470..500772
FT                   /locus_tag="A1I_02690"
FT   CDS_pept        500470..500772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78909"
FT                   /protein_id="ABV78909.1"
FT                   /translation="MFYQLDFINNIYSNDLDNWNVKQGSSTHSLYLIGEHVSSSKFCRA
FT                   NSSKQKSITATGRHLCGKDHYNATYIFLDPNSFTLNYHILGPEKNYNINSSFTRI"
FT   gene            complement(500759..502060)
FT                   /locus_tag="A1I_02695"
FT   CDS_pept        complement(500759..502060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78910"
FT                   /protein_id="ABV78910.1"
FT                   /translation="MTIKEAKNHSSSTSYELSNSELPAFTDSHVIHYETGNVQTEIFGF
FT                   GTYKDIFQRMLRNEAHRENIVERIFELVQNKKIANTEKLSQELNNFAEQLTHLLFIVEM
FT                   QRNNATLFTAPMFLELIIKDTKYLKEEIFFPLSIQTAISKSRGIVNNNCFELPNTHFMD
FT                   YDINNIKEDFLLLRNEGHILVEWFSKFVNIKLEHINQLFNIITSVQATKIKINENINLI
FT                   NLKELQDFVKLVNSTNFSNGLVKSLEENLYNLIPHFGSRPEQYLLLFKEALLKKTIFSK
FT                   KVKDLIENTFFEFQKILPKLDSFLVKVQADLKKDIKKIIPEILQILCAKIKEWYNIDAP
FT                   EYITSVKTVEEFKNKEVLKDITAKINNSNSIFSQSGDKLKFSIPPIKRKIVSTENINNK
FT                   LLKTHNEETYDSSLDDAIKEYYKIMGEDSSSISL"
FT   gene            complement(502041..502658)
FT                   /locus_tag="A1I_02700"
FT   CDS_pept        complement(502041..502658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78911"
FT                   /protein_id="ABV78911.1"
FT                   /translation="MKKKYYIDSSDEEKENQIINKIISINYNNYLFNNIINIKNIHNAD
FT                   EFKAKLGLILHNLADRFFRSSIINNAYQKIKERKLSLKDTNRNKLLDNIKLSFNIKLDQ
FT                   LFINNKENPITDEDYIQLFNFLFDKHVNLPNVFITKNEITNNKIKSSLIEEIQKNREIN
FT                   LKLLFQNNLNIEIKSNNSAKILACSKVTNRNNKNKIFDDKGS"
FT   gene            complement(502672..502986)
FT                   /locus_tag="A1I_02705"
FT   CDS_pept        complement(502672..502986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78912"
FT                   /protein_id="ABV78912.1"
FT                   /translation="MIEYDPKDIGLKVVEIYPDVQKVLSLFIIPEQKQYLINYVQSKIL
FT                   ECMPKKDVITAIATVNCVLGTVEISPQEFNLSFIESIAQQNDYTDFAVSFLGLCDAFTK
FT                   "
FT   gene            503170..504684
FT                   /locus_tag="A1I_02710"
FT   CDS_pept        503170..504684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02710"
FT                   /product="Patatin-like phospholipase"
FT                   /note="COG3621 Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78913"
FT                   /protein_id="ABV78913.1"
FT                   /translation="MAEIIDGVKTNDNGINLLLLEGGGVKGDIEVVILNNIEQLTGKPT
FT                   CELFPVRGGTSVGGLIAILSGIPDPNDSHKPLLTMQEVVDLFEKMAQDIFPQELTFRKV
FT                   WSLNGLLSNKFSPEPLIKLLKEYCKDYTLKDLIGDVVVTGYDLDNKENPLITFSTIDAR
FT                   KSDDNNYLLSDIIQGITAAPGFFPSKSLSNVTNTKHHTIIDGGVYANDPALMTWKLLEE
FT                   NNYKIDNAMYLSLKEESNDEYQTICCGGGIIELLKNNITGKILDATQLSDEMITQKIFG
FT                   DKLIEIATYIPEEHSGMSNSSSENLQVLKELANKSIHESSNFKNINYNENFKEIVDRVV
FT                   VNYNKNNPDNKIVENDYYKELFSNVFDRNNIVDEGFEEDKNIEVVKAKPEKQVLDLEDE
FT                   GFEDDIEYEKAELLTGVKKFFEEFSEKNPDLKEDIEQFLQKAKSCTLEEVKERVVNFEQ
FT                   ASLKWQEEQAKDDMLSSCAIEALKEDIELEGEEHTDDALGYNEIMV"
FT   gene            complement(505392..506009)
FT                   /gene="rpsD"
FT                   /locus_tag="A1I_02715"
FT   CDS_pept        complement(505392..506009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="A1I_02715"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG0522 Ribosomal protein S4 and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78914"
FT                   /db_xref="GOA:A8GVN7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVN7"
FT                   /protein_id="ABV78914.1"
FT                   /translation="MTKIVRSKYKASRRLGVSLWGDGKDAFNTRNYRPGQHGRNTMVKT
FT                   SDYGLHLKAKQRIKCHYGRITEKQFRNIFGFAQKMKGNTGENFIGLLESRLDSIVYRMN
FT                   IAPTIFSSRQLISHGHIKVNGKKADIASMRLKEGDVIEIKEASRQMGIIQESVSKQGQT
FT                   TPDYVSFDVDSLSGKYLRVPTISDVRYPFTPEVHLVVELYSR"
FT   gene            506127..507029
FT                   /locus_tag="A1I_02720"
FT   CDS_pept        506127..507029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02720"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="COG0109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78915"
FT                   /db_xref="GOA:A8GVN8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVN8"
FT                   /protein_id="ABV78915.1"
FT                   /translation="MNSLTKSINLDKVSYPQSTVKDYILLMKPRVMSLVVFTGFSGMWL
FT                   APNSLHPFISVIALICIAIGAGSAGAINMWYDRDIDALMKRTQKRPIVRGAIEADEALS
FT                   FGLIMAFFSVFFMALCVNFLSALLLLFTIFYYICIYTMWLKRSSIQNIVIGGAAGALPP
FT                   VIGYASVSGSVSLDSVILFLIIFIWTPPHSWALALFCNDDYKNCKVPMMPVIKGALYTK
FT                   KQILIYSVLLFLTSLMPFFVGMSNIIYLVIAAVLGLVFLYYSISLFYDNADNKQAKRFF
FT                   AYSIFYLFFIFLLLDFCRV"
FT   gene            507127..507879
FT                   /locus_tag="A1I_02725"
FT   CDS_pept        507127..507879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78916"
FT                   /protein_id="ABV78916.1"
FT                   /translation="MVNTRKFTNEEQKILENFVKSNQVIELINDKIYDTEKCRQWVNEN
FT                   SKINDALSKYLNFKTKYSLDYKDKFLWILSDIINCQSDEKASPYHKQINNSANLKNLLI
FT                   LLGICAEINEIQNIINDDLIKNNKYLERIAKMCLDYYSLEKKNFIPSNRLNSILKEINK
FT                   YKNNFTSNLYNDSEIEEDIDDLISYIEEKKIPYDFIELEEEKFGNRGIKRKYEEDIDKN
FT                   NNDNDEYPTKKLVKDEKYVILLKYYLSI"
FT   gene            complement(507933..510458)
FT                   /locus_tag="A1I_02730"
FT   CDS_pept        complement(507933..510458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02730"
FT                   /product="Outer membrane assembly protein"
FT                   /note="COG2982 Uncharacterized protein involved in outer
FT                   membrane biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78917"
FT                   /protein_id="ABV78917.1"
FT                   /translation="MNKTLKYSLIIFISIILLLIIIPFFIPLNNYKGIIINKVKETINR
FT                   DLTINGDIKLSLLPNPAISLPEVKLSSIDKTKEPYLVSVENAKASLKLLPLFRGAIEVA
FT                   SVELQKPVINFEVLNNGQKNWEFSTPKNKAEINQDAPIPTASSNKNEIELPILINHFKI
FT                   SDGKIIYRENGNEKIFNNINLDTHVKSTKGPIDFTLVLEALEQKIYIDGNIEEIGKVIP
FT                   LSANINIADEKIKIEGKLDSENNSFIGLANIKGNTKTLGLPSDLQNDYELTASIIADSK
FT                   NLNLKDARLNYTNIELLANVNYDIEHSSLKANIIANPGNIIGDISSNLDKASIFNGNIK
FT                   IAADNLQPLLNALKIKTDKLPPIINQKISLISNVVYNSQALILHNINLIAGNSNLSGDV
FT                   TLKNLKQDISAIHNLKINNFESFMALLGVNNLSHIGVLQLNGEVQKTKDTLQINDKISA
FT                   FNTNIAIKGDVNLASQKTNFNLNIYSPLINLEKITSGSPAPAPTSASNPVANNTGQASA
FT                   NAPKSSTPWSNSPIDLSFLNTIEGQLSANIDKLTNDSLVINNFKAKLAITGGKLNITSV
FT                   SANIYGGDLNANGYVSSGKDQNAAIKIDLKNAYVKSLTPQSGKIKITDGRLNFTTELNS
FT                   TGNSVYTYVNNLNGQFNVNSSNGKISGFDLNRIVDAINNAKNTEGVLRLINGSFSGGTT
FT                   SFSNLVATGNIERGMVRLTECHLDASPAKANAHGQINLPQYMLDVGASVTINNFPPLGV
FT                   KLYGSINNPQHKLDIEALQTYLIKNVFSSVIKDLKSGEKKPENIIKDALGLRKKKEDSS
FT                   NEQNNTEQPQNQPTDPVNKLLQKGLKKLF"
FT   gene            complement(510486..510989)
FT                   /locus_tag="A1I_02735"
FT   CDS_pept        complement(510486..510989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02735"
FT                   /product="Small heat shock protein"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78918"
FT                   /protein_id="ABV78918.1"
FT                   /translation="MKIKAYIPAIAAVILSSNATLANQNQAYNSNHTTSLHQAIELLDN
FT                   QITNIDNLFKNKLPFYESNSIKSKFITKDKQYIIIMEVPGFDKDHIKIKVNGNKLFVKG
FT                   NIEDENKADDSNNYMNKNFNYVISLYEDVDQKNISSSLKNGILTITLPRIEVKEQDAKE
FT                   IPIN"
FT   gene            complement(511296..512867)
FT                   /locus_tag="A1I_02740"
FT   CDS_pept        complement(511296..512867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78919"
FT                   /protein_id="ABV78919.1"
FT                   /translation="MNKVIMYGPGITDIPNTTHLASIRSSAIDQYLNNLNTPVELFIRA
FT                   HGLEYFQENLPSQLSLNLFRPDNDFDSSERLAHNVLTEIAKNTIGNTPNIVHIFSCHSG
FT                   AAQHNLKDVEGNIVLCTYTKPENELNNRTSRLVFNRKETLIDFIVENLPLLIATYFTIS
FT                   YKLDDNIHTLMFDHTSIKKMDLVTFSEFLQIQYKNVVKFYTELQQQYSNKYQELIPEYD
FT                   FPKIISYLPEKLKSTFNIVLNEHYHSLTKSEMKHLLKIDNSYISIILDKAIKEFDLNTV
FT                   ELILDSIEINNLHILSAISASNTLPSNQSIQIFEMVYAKIKNADYNILLLFAINAENLS
FT                   VAEFLLDKIQIQTFHLISAIQKANPNIVKILLNKVENIDNLVLNEANKLGSPLIFKLVL
FT                   NKMVENNSLVLADIIKTATPYFIKLALDKIKKVNQEDLVEAIKLGDQNILKLILNKIEN
FT                   PHTEIFTNDRGIIKQMEEVINSPFSDNAISIIKTAYSIENQEIIDLGFNNTPELLGEDF
FT                   CAPTAE"
FT   gene            complement(512972..513430)
FT                   /locus_tag="A1I_02745"
FT   CDS_pept        complement(512972..513430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78920"
FT                   /protein_id="ABV78920.1"
FT                   /translation="MITLLAAITGFISSIIPEILKIYKDINDKRHEIDILDRQITNNKL
FT                   NQSKTFTELTISQEMAEQHALYSTYKSGVSWVDALNGSVRPVLAYSFFAMYGIVKYVQY
FT                   KSLKSSALLVQYLDILWTIDDQTIFAGIISFYFGQRTFKKLYKYNINR"
FT   gene            513951..514910
FT                   /locus_tag="A1I_02750"
FT   CDS_pept        513951..514910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02750"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78921"
FT                   /protein_id="ABV78921.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETTGGYELELLYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKA
FT                   LGLYGKERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSC
FT                   INMIDVLSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKL
FT                   TRRQIASLAGLAPKANDSGKYQGYRKVGHGRAGVKPIILFLAAMSARNSKTSGLRLFYE
FT                   RLINNGKKKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            514983..515588
FT                   /locus_tag="A1I_02755"
FT   CDS_pept        514983..515588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78922"
FT                   /protein_id="ABV78922.1"
FT                   /translation="MLEIQKLVENTADLYTHPISESIKEVINRDQITNDMLINLAGKLD
FT                   KVLEEQTIINNHSCKERLVLFSKIAMDITAKLDDDNTISSNNKAIMQNVMNKIIDRIAN
FT                   LTNISLIEKITTSITELKTGKITKGKLLDIEDEIEGFILEQTDKEANMMLTWSVREIVY
FT                   DKPLLNHPKLLELALSKFSLQEIAELSNKLNSDLGSYY"
FT   gene            complement(515749..517851)
FT                   /locus_tag="A1I_02760"
FT   CDS_pept        complement(515749..517851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02760"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78923"
FT                   /protein_id="ABV78923.1"
FT                   /translation="MYKTNKIKEIYSSNVKIISEKSKANIAEYAHLLLNFETCCNDILY
FT                   VENADAAVEIVNFVINHNKGDVTTTKNIMTKLFDSYKYHKYSKNALLKKYNIERNKTTH
FT                   LKYKIGDKTQIYKINNSNKDINVDAFSKAMAYFSAIHAATMNNNLAMADELIKYLLQNT
FT                   AKFLDKLQTTNKLQYEKCTQAITAIITMFLEPKFQIEIIMDLKKYWLHDFNTLSNFSKI
FT                   LVDNNHCNKTIELLTEKPLPNDKSDHDLTNCYSNLALAYYKLGNYTEAKKYYLKAFENC
FT                   KDDDVICNLISIFTLQNEIDKIDEFIGKLSNGYLKKILLMSFNPSLITDEELKSINPDA
FT                   LSPYCKEKYEALKYIAYINKHNRITDLKVKNDFIKFLHNCSDYKNAFTLAIHANEYETA
FT                   RIIFNKIPAEQVNNSKVLKYCNFLFNNYFNLKKILKFIEESKFSDKEAIEVLNTSSTCL
FT                   LADKKPSEAAETIKKALEYNPHNEETLEIGVATSLLNKDTETAKEYANKLSQEKQEEII
FT                   VSYSLDENPAEDIEQLVEQHDPKKIHEHYQLLKKEAFYKASQNIIKNDVIIWYIDKDII
FT                   KSTDTTFIGKYKGLDCYAKISKNLQLDNNIDSYENALKKGILHHSKGGTGVKFIRNNAI
FT                   ELKGSEGDRLFTNILHANDNGKLLIDFDHKGNHNEADRFFRSHHLEYSNDKYLELSGNH
FT                   PELYSE"
FT   gene            518040..518795
FT                   /locus_tag="A1I_02765"
FT   CDS_pept        518040..518795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02765"
FT                   /product="Cephalosporin hydroxylase"
FT                   /note="COG3510 Cephalosporin hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78924"
FT                   /protein_id="ABV78924.1"
FT                   /translation="MLSLLNGATNQKEKKRFVSINNRIIKSDLDESFWHSIAANSCDTS
FT                   WKNIPMQKSPFQIVTTQNLIQELKPKTIIEFGSFKGASALWLADIQSLSVEERKVISID
FT                   IDFDNIDSSVKFDDRIEFLQGDSNKVEEIFPGEKISEIIHPLLLIEDAHINTTGILDYF
FT                   HNNIFKTGDYFIVEDTNIDYNNACYDIWRKTLEEKACIEKLENLNNKIVKLTNWLREKK
FT                   DLYLVDTKYVDPFGITNASKNWNSVIRKF"
FT   gene            518804..519757
FT                   /locus_tag="A1I_02770"
FT   CDS_pept        518804..519757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02770"
FT                   /product="Cephalosporin hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78925"
FT                   /protein_id="ABV78925.1"
FT                   /translation="MRKEIYLKNFDINDNYILNNLSDNPHQASMFFKDFLEKTYPDYIK
FT                   EIKDAINSGAEIIHIKNASKQNYNVLTPYNGEVEVTGIEDLICHMYGIIGAIDSLPILY
FT                   KDEDKNIIRAVAPRYNSHNERSSQSPFNDLDWHVDAAYRPMLEKANNLSPIVDYLIFGV
FT                   VHKGHENLPIVYISLKDILNRLSYDDILVGLSKEFTIMSADSFLHKISVDNMPLLVEYS
FT                   TGYYSRIKMDVIAETQKAQGFLNKIREIVDQKSIQNHIYVNPGDIVILNNKMILHKRDK
FT                   YTPKWDGKDRYFTRIYAVKDIKQGVLADPDKPWIWI"
FT   gene            complement(520268..520702)
FT                   /locus_tag="A1I_02775"
FT   CDS_pept        complement(520268..520702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78926"
FT                   /protein_id="ABV78926.1"
FT                   /translation="MINNPIFALLEYDGFKKIPEFAWEIIRKIRDNIFEFISCEHRNNY
FT                   VLTDVLSEIERDHKLFKQVENMALQRDSLFVPVKLLISKEENKIRVANPERALRYKSLR
FT                   IEEGIELINISHSNLLELDVSNLSASAATEKILKHVLKLK"
FT   gene            complement(520813..521145)
FT                   /locus_tag="A1I_02780"
FT   CDS_pept        complement(520813..521145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78927"
FT                   /protein_id="ABV78927.1"
FT                   /translation="MLTTAKALLDKNFNIVIDTALDGPDAQELAKFYLEYLNGYKITFL
FT                   GIFCPVEERLKRLKTRTDNLFLTEDFIRLQSGQYDVFESCKHFYNIWFDSSKLGATEIA
FT                   SKTLFI"
FT   gene            complement(521419..522249)
FT                   /locus_tag="A1I_02785"
FT   CDS_pept        complement(521419..522249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78928"
FT                   /protein_id="ABV78928.1"
FT                   /translation="MNKMKPLNFILLSLFCLSANCFGDIIPTNDFKVIEEYVNKADKDT
FT                   LVIFDVDDVLAMPTDEFAFNAPVRVELTQKLRERYTKDELKYLYSCIFERRTAQPVDPN
FT                   MRGLIKGLEQRNIPAIALTGWWTGKYGKIAKMENLRFDALKDVDISFINTSPFKEDATF
FT                   PEFENENGIPMLISGVILTASVDKGLVLKAALEKYNLHFKKIIFIDDSLKYLESVEKAC
FT                   LDMNIEFQGIHYGTAKIAPLPILDKEKEQLRYEILEKEHIWLLDKELEERIRNK"
FT   gene            complement(522242..522502)
FT                   /locus_tag="A1I_02790"
FT   CDS_pept        complement(522242..522502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02790"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system Phd"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78929"
FT                   /protein_id="ABV78929.1"
FT                   /translation="MEQLNATEAKREFGELLIKAQIEPISIIKNGKPVAVIISNNEFKE
FT                   LEAFKEQFLKIAIAEGINDISQGKIHSHKSVFDSLKMKINE"
FT   gene            complement(522547..522912)
FT                   /locus_tag="A1I_02795"
FT   CDS_pept        complement(522547..522912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02795"
FT                   /product="Alkylated DNA repair protein"
FT                   /note="COG0028 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78930"
FT                   /protein_id="ABV78930.1"
FT                   /translation="MNQLSLSDDQIIIPGLTYISEYITIEEENKLIKLIDNSKWNNELK
FT                   RRVQHYGYKYDYKSRSINQSYFLGMLPQWLQTLCDSLHKQNIFHEIPDQVIINEYMPGQ
FT                   GIAPHTDCISCFSDTID"
FT   gene            complement(522909..523556)
FT                   /locus_tag="A1I_02800"
FT   CDS_pept        complement(522909..523556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02800"
FT                   /product="transferase hexapeptide repeat protein"
FT                   /note="COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78931"
FT                   /protein_id="ABV78931.1"
FT                   /translation="MKIFNSYRDSVYIKDHVKSKHIIAGEYSYYSGYYHGVVFDECVMY
FT                   LDVENNNCDADEIDKLIIGKFCSIATGVKFMMGGTQGHNYNWIASYPLDSFDEDFDNYE
FT                   TVPPKAYKLKGDTVLGNDVWIGTESLIMSGIKIADGAIVGARSLVTKNIRAYEIWGGNP
FT                   ARLIKKRFSDEDIEKLLQIKWWDWSDDKIKQNLHLLRDSDVESLWESGKKYL"
FT   gene            complement(523543..524043)
FT                   /locus_tag="A1I_02805"
FT   CDS_pept        complement(523543..524043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02805"
FT                   /product="Putative transcription activator"
FT                   /note="COG3708 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78932"
FT                   /protein_id="ABV78932.1"
FT                   /translation="MNKIITQLPEIKLVGITTRTSNAAEFNPDTAKIKSMLQRFFADNL
FT                   QDKILNRKNPGKIFAVYTNYDSDENGEYTYFLGEEVTTFENVSQGFEELTIPVQNYAKF
FT                   TSNPGQIPTVVIDMWQKIWQMDNTTLGGKRAYIADFEIYDERSHDHNEAVLDIYIGIKN
FT                   ENI"
FT   gene            524116..524562
FT                   /locus_tag="A1I_02810"
FT   CDS_pept        524116..524562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02810"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78933"
FT                   /protein_id="ABV78933.1"
FT                   /translation="MFENAKIYLARCTHAKEWQEYHRIRAEQIFDPINVEYDHNHPTIT
FT                   ANNHYHFVLYNDIEIVATAHIEFLNKNKAALRSFAVDKLSQNKGFGKYMMQFLEKWLRD
FT                   QNIKVLKMHSRISAEAFYRKLGYIDMEFNDISIQKNYIDLGKML"
FT   gene            524567..525052
FT                   /locus_tag="A1I_02815"
FT   CDS_pept        524567..525052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02815"
FT                   /product="MazG-like protein"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78934"
FT                   /protein_id="ABV78934.1"
FT                   /translation="MSALKDLITLEKDARDYGFDWSDYEMILEQVIDECREIKEAIENG
FT                   EAIVNSVKLEYKERGAKPINNRRATSDDVGEFKSIDYKERVQEEIGDLLHTAISLCRFL
FT                   EFDVEETLNKTSTKFAKRMEAVKTLTRKHNLPNLQGQSTEFLLKLWKEAKEMAKEKY"
FT   gene            525114..525305
FT                   /locus_tag="A1I_02820"
FT   CDS_pept        525114..525305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78935"
FT                   /protein_id="ABV78935.1"
FT                   /translation="MKKYKLTEEEQEILDYFEKDELLELPKKELENQINIAKTVAANFF
FT                   KKWIPNIHKLQTVMRLAI"
FT   gene            complement(525676..526377)
FT                   /locus_tag="A1I_02825"
FT   CDS_pept        complement(525676..526377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02825"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78936"
FT                   /protein_id="ABV78936.1"
FT                   /translation="MVHTKKHHKHKKIPKLISSRNLFKAVEKNNIAGTKFLLEHGISPN
FT                   ATHPNDSIEYKSLHWIISKNGELIEIEVGIDTPLHIAANNGYTTVVKILLENGAFINAR
FT                   DSFGFTPLHSAIISSYKLSSIKLLLEYGTSLTLEIIDGYYRGKTPVGLLKKIGSKKDKK
FT                   VVALRALLEPEKLYRNKELDKIVKKTYIKEPHIKDFIKWKIEAEIPKFIKSNISFLNKH
FT                   IKKNYLLLISF"
FT   gene            complement(526364..526783)
FT                   /locus_tag="A1I_02830"
FT   CDS_pept        complement(526364..526783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02830"
FT                   /product="ADP-ribose pyrophosphatase MutT"
FT                   /note="COG1051 ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78937"
FT                   /protein_id="ABV78937.1"
FT                   /translation="MTNHPRIGVGIILFNSKNEILLGKRINSHGEFTYGNPGGHLEFGE
FT                   TFEECIIREVLEETNLIIKDPKFLAVTNDVFEKEQKHYISIFLKAHCLNEHELQNLEPH
FT                   KVESWQWFALDKLPDNLFPPLKKLLNGKGYRSGSY"
FT   gene            complement(526798..526938)
FT                   /locus_tag="A1I_02835"
FT   CDS_pept        complement(526798..526938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78938"
FT                   /protein_id="ABV78938.1"
FT                   /translation="MTGGTYLEQIENIAKKTEEEHVYYAAVLFGKWDTVSQITKKFSLY
FT                   R"
FT   gene            complement(526935..527210)
FT                   /locus_tag="A1I_02840"
FT   CDS_pept        complement(526935..527210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78939"
FT                   /protein_id="ABV78939.1"
FT                   /translation="MSFENKLVIIVNKDIEIGVAMNAVAHSSLAAGALLGKPTCFLQPN
FT                   IDASGNNWQISGMPYIILRGKSSEIKKAIHLMRKNLKLCIWHLQIV"
FT   gene            complement(527295..529022)
FT                   /locus_tag="A1I_02845"
FT   CDS_pept        complement(527295..529022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02845"
FT                   /product="Multidrug resistance protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78940"
FT                   /protein_id="ABV78940.1"
FT                   /translation="MNTKLLYRLARNLRFYKKDLIIVIISLLSVSLALLLIGNVFRNLV
FT                   DQGLVLDRTAAVDKSILYICLLIIILSIASFFRSYFINNVAEKVSSQIRKEAYSNLINY
FT                   EITEFEELKIGDIISRLTSDIDQISKLIVNFLSFFIRNSVMLVGSIILMFFESFKLASI
FT                   VIITIPLLLIPIIKFGKHVKALSKKTLESQSLLASDINESFSNIKTIHAFGGQAAKITE
FT                   FNNLLQDYLTYSAARLKIRALFFAFSMAFIFLGVTLVIWIGALDIVKGNLSSGQIISFI
FT                   YYAIIAGFSSGGIFELLSEMHLPLAALERIVTIIDKSPIVHNNYSDLKPVNSISLEFKN
FT                   VNFSYPSRPNLKILNNISFKIDSTQFIGIVGRSGSGKSTLMQLLLRFYVQESGIILVNN
FT                   QDIALLNPNEIRKLIAYVPQEASIFSGTIKSNIMFGNDSSEEEITEIIKITGIADFTDK
FT                   IPDGINAKIGEKGVRLSGGQKQRIALARALLRKPQILLLDEAMNALDSQSEQKLLSSIR
FT                   DIMKGKIVISIAHRISSIESADNILIIDKGAVEAEGTHAHLLKTSDLYRTIYKEVDLL"
FT   gene            complement(529235..529311)
FT                   /locus_tag="A1I_t07977"
FT   tRNA            complement(529235..529311)
FT                   /locus_tag="A1I_t07977"
FT                   /product="tRNA-His"
FT   gene            complement(529445..529762)
FT                   /locus_tag="A1I_02850"
FT   CDS_pept        complement(529445..529762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78941"
FT                   /protein_id="ABV78941.1"
FT                   /translation="MILVDSNIILDILTFDPNWYEWSSNKIKLLSQSHELIINDIIYTE
FT                   ISIGFKRIEELEVIIDDFRLTPMSKEVLFLAGKAFQKYKLNGGIKNSILPDFLSVLMQV
FT                   Y"
FT   gene            complement(529759..529989)
FT                   /locus_tag="A1I_02855"
FT   CDS_pept        complement(529759..529989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02855"
FT                   /product="hypothetical protein"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78942"
FT                   /protein_id="ABV78942.1"
FT                   /translation="MIMKISTKGQVTIPIDIRSKLGMLPNTEIAFVLHKDGVLIKKENN
FT                   HNHRGIKLIQQLSGKSTSNMSTDEIMKLTRS"
FT   gene            530123..530476
FT                   /locus_tag="A1I_02860"
FT   CDS_pept        530123..530476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02860"
FT                   /product="HicB-like protein"
FT                   /note="COG1598 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78943"
FT                   /protein_id="ABV78943.1"
FT                   /translation="MDKMKTKDIFDGFTIELFKDIDGDWLAKFEELPNVSAFGDSPEKA
FT                   LQELQEAWFLMKESYVSHNQPVPLAPSRKEYSGQFNIRVDKRIHRALALEAFRAKISLN
FT                   ALVAQKLTLSVRQ"
FT   gene            530473..531150
FT                   /locus_tag="A1I_02865"
FT   CDS_pept        530473..531150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02865"
FT                   /product="Trans-regulatory protein ExsB"
FT                   /note="COG0603 Predicted PP-loop superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78944"
FT                   /db_xref="GOA:A8GVR7"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVR7"
FT                   /protein_id="ABV78944.1"
FT                   /translation="MKKAVILVSGGADSATVLAIMREQGYEIHAISFNYGQRNNAELRK
FT                   VTELVKEYNVKQHKIVNIDLRAFGGSALTDDDIKVPHYHDTKELPEDVPVTYVPARNTI
FT                   FLSYALGFAEIIGAKDIFIGVHTSDSANYPDCRPEYIKSFEAMANLATNIGGVTIHTPL
FT                   INMTKDQIIKTGLRLGVDYKNTISCYDPSEDDLSCGTCLACTIRLDAFKKNNVQDPINY
FT                   ILF"
FT   gene            531300..531851
FT                   /locus_tag="A1I_02870"
FT   CDS_pept        531300..531851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02870"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78945"
FT                   /protein_id="ABV78945.1"
FT                   /translation="MIDRKYLYSPFPTLDLDDIILRELTDTDAEDYFNYMNKPEMAIYI
FT                   TESNRPKTLEEAKEEIRYWSSLYKNHRSFYWGITLKSDNKLIGTAGFNIINLEHHKAEI
FT                   SYDLDYSYWGQGIMLKSIKNILKIADHIGIIRVQATVITDNLRSINLLERCGFAREGIL
FT                   KKYEIVANEHKDYYMYGRVL"
FT   gene            532179..533462
FT                   /gene="clpX"
FT                   /locus_tag="A1I_02875"
FT   CDS_pept        532179..533462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="A1I_02875"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /note="COG1219 ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78946"
FT                   /db_xref="GOA:A8GVR9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVR9"
FT                   /protein_id="ABV78946.1"
FT                   /translation="MVVEANKKELICSFCSKKQHEVKKLIAGPAVFICDECINLCMDIM
FT                   EEESKIALKQITSTIPTPQKICSVLNDYVVGQEQAKKVLAVAVYNHYKRLEYVQSGNND
FT                   VELNKSNILLIGPTGSGKTLLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLL
FT                   QAAEFNVAKAQKGIIYIDEVDKIARKSENPSITRDVSGEGVQQALLKIMEGTVASVPPQ
FT                   GGRKHPQQDFVQLDTSNILFICGGAFMGIDSIITSRTNNSSIGFAANVNIDKEKINREI
FT                   LKSLEIEDLTKFGLIPEFIGRLPIVTTLDDLDKEALVTILTKPKNAIVKQFKKQFELDE
FT                   AELIVEDSALEAIAEKALAKKTGARGLRSIIEHLLLDSMYKVAELKKQRVTITEDVVKG
FT                   LIEPIITSIITPTAKTSKKQAAVEDIPA"
FT   gene            complement(533601..534893)
FT                   /locus_tag="A1I_02880"
FT   CDS_pept        complement(533601..534893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78947"
FT                   /protein_id="ABV78947.1"
FT                   /translation="MVYGDVVAEHIKKHNSIKGLANFLNELGIERVINFGLKELVDIAF
FT                   GKLKDDHHNNLLTELIQSRGVESVKIFRFRELADKDFEKLKEVYIDNLLTKLIERQDIK
FT                   SFITLLEHSKKISAKNIISIAENWSKDNIKIIFEHPVVQDLNKNYLLQYLKSTYLNKES
FT                   NYIKAATKYTKDLNKFEELKHLLKKFGIKEVASFNSLELIKLGFKDLSFDLIEPYIKGF
FT                   DQVKKNTISRILEEYFTNPNTNTLKDQENFKLEELFYIVSENENIHTLEQLFNPHVNLK
FT                   PKNSGFGKNKYKHLIPKNPKDFSKEQINYFVQKAINKNDIKIIKLLFEYCTNNEIFIED
FT                   TQMKNFIQKAVSNKFFEITRTLIKSRDIIKSKGVEIDNKEFIKEIAKNITAPENLELFE
FT                   VALKYEGYPINFETTINSQGIIEDCNILGDI"
FT   gene            complement(534922..535212)
FT                   /locus_tag="A1I_02885"
FT   CDS_pept        complement(534922..535212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78948"
FT                   /protein_id="ABV78948.1"
FT                   /translation="MIIESNSVNAAKLLGYKNFINTFAVSYPIFLNMITKNGNEDFIKE
FT                   VFRHLKIHPEDFLLDIERNRLSNASINAIAKYNENIRQDKEIKSLLHKQRF"
FT   gene            535595..536881
FT                   /locus_tag="A1I_02890"
FT   CDS_pept        535595..536881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02890"
FT                   /product="RmuC family protein"
FT                   /note="COG1322 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78949"
FT                   /protein_id="ABV78949.1"
FT                   /translation="MNYLLPSAAIVLLVLVSLNIWFYIKVRTLKTELQFLTDQNLEITN
FT                   NNQLLNQEKIAYLQKIEQLKCRVEYQEQSIKDSEKIRNESFSSAKAALFDLGKDLSKQL
FT                   IEIHKMENTAARELAEKNIATASGKFNSEFERLITMVGTLNKDIEQSKSTVDLIKQSLL
FT                   SPIGAGLLAEITLENILKSSGLRSNLDFIMQYGLTTSDSTKLRPDALIFLPSGNLMVID
FT                   SKASKFLVDEQDNSGNLSKTMNYHLKSLANKDYAENILADLNKKEQNYNNVITLMFLPT
FT                   EQAVEKVIAADPNFLQKAWGCSIFPVGPSGLMNMLSFAKFQITDHRRSENYKIIIEEVR
FT                   KLLSSIGTIADYSQKIGNNLHNMVTNYDKFAASFNRNFMSRVKNIQKLGIDSGNKTLPA
FT                   SLERYQIVSSKSEIIEVETENSQPQQIEE"
FT   gene            537015..537845
FT                   /locus_tag="A1I_02895"
FT   CDS_pept        537015..537845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02895"
FT                   /product="Alpha-(1,3)-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78950"
FT                   /protein_id="ABV78950.1"
FT                   /translation="MWSGFTIDELPMIKEVIEESGRKIVIDHKNYDLIIESVFGQKKIS
FT                   NKNSIKIFFTGESIRPNPDNYDIAIGFDYIDHPHYIRIPLYYMYFTNEISTNYKRPKCN
FT                   PHKPHFACFLVSAHIDDTEKFDGCVARDKFFHKLSSYKRIRSGGKYLNNESRVVPKENT
FT                   REWLSECKFVIAYENKTYEGYVTEKPFQAYLAGAVPIYYADKSYVKDVNPRAVIFAKDF
FT                   ASEEDLYNYIISIDQNDEKYCEIYNNSIVPDSLNNYPIIKEKLKEKLLPLLNEK"
FT   gene            537835..538707
FT                   /locus_tag="A1I_02900"
FT   CDS_pept        537835..538707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02900"
FT                   /product="Glycosyltransferase"
FT                   /note="COG3306 Glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78951"
FT                   /protein_id="ABV78951.1"
FT                   /translation="MKNKIYHIKKYFFILFIIISCLLIFCKFGSNEISLFYITYQLKNN
FT                   PISEKDIKIFVINLDHSTNRYNNINKQFIDINLSYERFSAVDGYELSIANQKGEKFTGL
FT                   DLKNNSSLLSLDNNYTIFCPSENINYYALNRTLTAGEFGCYCSHREIWLKMVEENIPYA
FT                   LILEDDAILKENFYKKFSTIIKSLPSDWDLVYLFLMYLPRQKFYKIYNNPYLKKINTQR
FT                   YFYTSTGYLINLKAATKLLKYSKSFSEPIDDSIAQEVADSRIQAYITTPFLINTDFKDS
FT                   TIIEMGRPD"
FT   gene            complement(538794..540071)
FT                   /locus_tag="A1I_02905"
FT   CDS_pept        complement(538794..540071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02905"
FT                   /product="Poly-beta-hydroxyalkanoate depolymerase"
FT                   /note="COG4553 Poly-beta-hydroxyalkanoate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78952"
FT                   /protein_id="ABV78952.1"
FT                   /translation="MINYDLNTNYTYYMLEGLRAQIAPMHLGIKILKEAYERESLEENG
FT                   FARIMHSYLTLCERMTRKYEKPEFNILETTIDNKTYKINEKVILKKPFCELRHFEKVGF
FT                   KSVLPKLLIVAPMAGHHATLLRSTVQELLPYTDVYITDWTEANYVPLEAGSFDMDDYID
FT                   YVMEFINFLGPNVHTMAVCQPTVPLLAAISLMSKDNSPNVPSSMILMGGPIDARKNPTA
FT                   VNEFALSKSLEWFCKMVTMQVPPNYPGHGRKVYPGFLQLAGFVSLNLFRHIDSHLELWQ
FT                   NLLNCDYQKADHTIKFYDEYLAAMDMPAEFYLQTIDEVFQQFSLARGKLVSEQRPIDLK
FT                   NITKCALLGIEGELDDIAAVGQTKAALKLCSNIPESMKKYHLQKGAGHYGVFSGSKFKQ
FT                   FIVPVIKSFIYDFDQANFKQPKAKMV"
FT   gene            complement(542352..543098)
FT                   /locus_tag="A1I_02920"
FT   CDS_pept        complement(542352..543098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02920"
FT                   /product="LPS biosynthesis protein"
FT                   /note="COG3475 LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78953"
FT                   /protein_id="ABV78953.1"
FT                   /translation="MKLKSVFSPKNILGSILLLFAGIFFYTHVLEHDWRYKVPTDEEVK
FT                   KYRISENTALSLYQIMKDTHELLTKHNINYWIDGGTLLGAIRHQGIIPYDDDLDIGIMQ
FT                   EDEIRLQQIFPEFQKLGYSISHDLAYKICQKGCIDIFTFQKEKNEFIHANLKTRTQYPN
FT                   DFFYDHELLPLKKYKFGDIEVYGPYNPKENLNRQYPEWDKYAVIHHPHNFHLFFLSNIE
FT                   RKTKFILTPELLKPATATKPLENRGN"
FT   gene            complement(543070..545508)
FT                   /gene="valS"
FT                   /locus_tag="A1I_02925"
FT   CDS_pept        complement(543070..545508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="A1I_02925"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="COG0525 Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78954"
FT                   /db_xref="GOA:A8GVS7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVS7"
FT                   /protein_id="ABV78954.1"
FT                   /translation="MKEFPKNYNFIESEKKWQKIWQEKQIYAYDENIAKDETFVVDTPP
FT                   PTVSGQLHIGHVYSYTQTDFIVRFQRMMGKNIFYPMGFDDNGLPTERLVEKQRQVKAYN
FT                   MGREELINICNEVVASEEEKFRSLFNQIALSVDWNLEYQTISPLSRKISQMSFLDLVKK
FT                   GEVYRNNQPILWDPVDGTALAQADIEDKEKTSFMNYITFKTEANDEFTIATTRPELLPA
FT                   CVAVFYHPDDKRYQHLAGKFAVTPLFNVKVPLLADPLVQQDKGTGLVMCCTFGDQTDIT
FT                   WWKTHNLPLNTIITKKGTIDFPHEIGIDGLKIKEARAKIIDILKEQELFVKQEEITQTV
FT                   KCAERSGAPLEVLTVPQWFVKTISHKDELLKRANELNWHPKNMKIRLDNWINAISWDWC
FT                   ISRQRYFGVPFPVWYSKRIGEEGKILYADISQLPVDPLKDLPIGYSKYEVEPDLDVMDT
FT                   WATSSVSPQLSTWGISDEFAVNKDRHGKLFPMDLRPQAHEIIRTWAFYTILKAHLHQNT
FT                   LPWKNIMVSGWCLAEDRSKMSKSKGNVLVPEKLLEQYGSDVIRYWSANSKLGADTAYSE
FT                   DVMKNGKRLVNKLWNAAKFVSQHFDKLSDEDKKTNLIDVKEKITHEFDQWIINKLVELV
FT                   NNATNELQNYEYANAMHLTEKFFWSVFCDNYLEISKTRAYDEENKNPSGQYSSVLTLYH
FT                   VMQTLLKLFAPFMPHITEELYQILYSENSIHIKGNWINYGNLNYKIDAKQPERLLEILD
FT                   HVRKFKAEKNLSIKAEVQLLEVSGIELSKELTSDLKNVTSAKEVKFKPTNDEIKVSILT
FT                   "
FT   gene            complement(545875..546750)
FT                   /locus_tag="A1I_02930"
FT   CDS_pept        complement(545875..546750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02930"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG5464 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78955"
FT                   /protein_id="ABV78955.1"
FT                   /translation="MTDKIAAQEFLEYYLPEDFKKLIDLSKITVEQESYIEESLSKKYS
FT                   DIVYGIETKEYGKGFVYILIEAQSTVDYWTALRLWKYTLLLCERHKEKRNKLPLVYNLV
FT                   IYNGKQVYNAPRNLWDLFTNSVMAKKLMMEDYQLVDLQAMSDNEIVKKKHIGMLDYILK
FT                   HIHERDMIQLWEQFLANFNHVIMLDKEKGYIYLKSFLWYTDAKISKKQQPRLVQVFDKY
FT                   LSPQHKDNIMKTIADVYIDEGKQEGKREGEYNKAVMIAKKMFSQGFKIPVIAELTGLKE
FT                   TLIRSIIESS"
FT   gene            complement(546894..547484)
FT                   /gene="rnhB"
FT                   /locus_tag="A1I_02935"
FT   CDS_pept        complement(546894..547484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="A1I_02935"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78956"
FT                   /db_xref="GOA:A8GVS9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVS9"
FT                   /protein_id="ABV78956.1"
FT                   /translation="MEIDILHFEKKYPNFILAGIDEAGRGPLAGPVVAAAVIVDQNNII
FT                   AGIKDSKKLSKKKRELLYEQITANYIWATGIISHTEIDKINILEATKKACILAAENLST
FT                   KPEIVLVDGNMQFSDKRFISIINGDNLSLSIAAASIIAKVTRDRLMLELSNEFPQYLWH
FT                   KNSGYGTKEHAQAIKEYGLSPYHRLSFTKALYK"
FT   gene            547542..548042
FT                   /gene="hscB"
FT                   /locus_tag="A1I_02940"
FT   CDS_pept        547542..548042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="A1I_02940"
FT                   /product="co-chaperone HscB"
FT                   /note="COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78957"
FT                   /db_xref="GOA:A8GVT0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVT0"
FT                   /protein_id="ABV78957.1"
FT                   /translation="MQNYFELLGLEQIYNIDLKILEKQYFAMQIKYHPDKAKNLQEKEQ
FT                   NLIIASNLNKAYSTLKDSLKRAEYMLLLYGVNLNDEKVRSKLSALELSIFWDEMELIEN
FT                   TSSYKSLEEIKSKYELMEKAEVNFLAESFKKQDLSDATIKTSKLKYIHTLLSKLQEKMK
FT                   LCK"
FT   gene            549837..550172
FT                   /locus_tag="A1I_02955"
FT   CDS_pept        549837..550172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02955"
FT                   /product="Ferredoxin"
FT                   /note="COG0633 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78958"
FT                   /protein_id="ABV78958.1"
FT                   /translation="MSKTIKVTFVINNGEEKIIEAPLGLSILEVAHSNSIDLEGACEGS
FT                   LACATCHVILEEEFYNKLEKPKEEEEDMLDLAFGLTDTSRLGCQIILTEKLDGIKVRLP
FT                   SATRNIK"
FT   gene            550185..551255
FT                   /locus_tag="A1I_02960"
FT   CDS_pept        550185..551255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78959"
FT                   /protein_id="ABV78959.1"
FT                   /translation="MIRKILIFVFLAFTIVWFAAAYTLKNNVINLIKNSESDNLKISYN
FT                   TVKFSGYPFHWKITITDPKVKLIDHVNSKELSSENIVLNIKFSTKKATLNFGPFIKEVD
FT                   NYGDKTFTYDMRSKEDIKGIGKFNKPLYKISKDDDLKEVIKSIQLNNKSLLIFKDDEEI
FT                   FKINDLAFFISKKNLADSEDISLILNMNYDSEKNIANFKNATLDIAALLKFTPDGENSA
FT                   ILQNFNIEKFVFSCDHNSKINLNGALQFFANKLPQGKLSFELENYHSIIDKLLPNNIMF
FT                   SKKFIKTVIAKAVNKASDEAVVKESDNLNPDYSNIEKAKFDVEFSEKGINIGSINLLEL
FT                   KLGDSKEEQQPENHAN"
FT   gene            551245..552216
FT                   /locus_tag="A1I_02965"
FT   CDS_pept        551245..552216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02965"
FT                   /product="TRAP-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /note="COG2358 TRAP-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78960"
FT                   /protein_id="ABV78960.1"
FT                   /translation="MRINYMNNLKLILYSFVFSIILTCSNIYADQKQKVFKIGTGSILQ
FT                   GYYSIGLDLCKTIIGDEKNNENIVCEVVATNGSIENLKLLQQGKIDLALVQANIAVEAY
FT                   DGIGYYSDKGKMQNLRQLLNLHDEFFTVIVKDEDKIKFFADIDGKRITSGPEYSSSNIT
FT                   YDAMCSLYKFAKEPINTDINYEDSIDKFCQKEIDAIIMMVGHPNPLVNLIANRCEIDFV
FT                   SIENDKIAELIQQNRAFRKAELHKGLYPGITDDQTTVKVSAILVTRNDVDSNMLDKFIG
FT                   AFHRNVASFKLSNYLLNNININYFADTQNFVLPKHDSVRNRE"
FT   gene            552247..552678
FT                   /locus_tag="A1I_02970"
FT   CDS_pept        552247..552678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02970"
FT                   /product="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78961"
FT                   /protein_id="ABV78961.1"
FT                   /translation="MFKNILIPIDLADKKSVKALLSKALMFATASQAKLHFIYVISDFG
FT                   MKMVEDYLPKNWIAEKKAKYQTQVKELIKQYVPDEIEADYYIGSGAVYDEIIKRSNDIK
FT                   ADLIIISAVRPQLRDYMLGPNASKIFRHSSISVLVVRDE"
FT   gene            553565..554425
FT                   /locus_tag="A1I_02975"
FT   CDS_pept        553565..554425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78962"
FT                   /protein_id="ABV78962.1"
FT                   /translation="MYKVNPRVDLAFKKIFGVEENKDLLISLINSIVSEKDQIVEVTLL
FT                   NPYNPKNFAADKLSILDVKAKSEAGKMFNIEIQVTDEADYDKRALYYWSKLYAEQLKAG
FT                   DDYSKLNKTIGIHILNFTSIPNTANYHSAFELRDRVTGLVYFEDIELHTIELNKFTNAK
FT                   EELTDIVKKVKDSLDIWLAFLTRHDLLNKDKLPKKLDNKVLKKALTVLEVMNFNEEERN
FT                   TYEDRLKWLMIEANTLKKTEMKKAAEIAKEMLIYNEPIEKIIKYTKLSTEEIEKLKRVI
FT                   EESNK"
FT   gene            complement(554554..555915)
FT                   /locus_tag="A1I_02980"
FT   CDS_pept        complement(554554..555915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02980"
FT                   /product="Cytochrome d ubiquinol oxidase subunit I"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78963"
FT                   /protein_id="ABV78963.1"
FT                   /translation="MEFDQVLLSRIQFAFTISFHIIFPAFTIGLASFLAVIEGLWLKTG
FT                   KTVYQEIYKFWVKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVLGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVSKKVHFISTLIVAIGTVISAFWILSAISWMHTPTSFEIRDD
FT                   GLFYPLNWLEIIFNPSFPYRFLHMLTAAYLTTSFVIGGVGSFYLLNNRYKEHAKIMLFM
FT                   AVLMALFVAPVQVFIGDQHGLNTLKYQPVKVSAMEGIWDTEKGAALNIIGFPDKEEEKT
FT                   KYALQIPYASSLILTHSLDGEIKGLKEWSRDERPPVATVFYSFRIMVGIGFLMVFTGIA
FT                   GLYLYLKKRLYNTKWFQYWYMLMSPSGFIAVLAGWFVTEVGRQPYIVYNILRTADMASP
FT                   VLGKYVFISLMAFIVVYMIVFGAGMYYILRLIKQGIKAIDNSETYGKLGLNNPF"
FT   gene            complement(555959..556231)
FT                   /locus_tag="A1I_02985"
FT   CDS_pept        complement(555959..556231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78964"
FT                   /protein_id="ABV78964.1"
FT                   /translation="MQEKELSNNFLEEQEDMKDDNSPFFDVKYICQASLLITDSIRKGY
FT                   DVTQLPNGDVNVTEIRIVNVHYNWNSEKGKFVKTNQIEFDNSKGG"
FT   gene            556384..558153
FT                   /locus_tag="A1I_02990"
FT   CDS_pept        556384..558153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02990"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78965"
FT                   /protein_id="ABV78965.1"
FT                   /translation="MIKYPTLSKSTLSLGIYFLKFDKVKILLLTASCIIFGMIPAVDSI
FT                   LLQKIIDLIESFSDDNAHNLLSSMIYWAVFYALWWEGINIAYRSYDYLYLKTMPVIKGK
FT                   ILNELYNYTQYHSHKFFQDNLAGHISNRITETARSFEMIISIFGEKILRKLAIIAFALV
FT                   ALYSVHYIFATIFIIWITVFLGLSVLFSGNINRYSLNYARSQSLVVGSIVDAISNINAV
FT                   RMFTSHKFERQHLETRVENAVADEQTMQFFMFKLRYALGTSCSIMIFVMIYYLSTLRSE
FT                   LAITIGDCVLVLTLCINVSDNIWDLTQEIGDMFEQVGAFNQGLSLMGPHIITDIENASP
FT                   LDIKDGIIEFKNVTFNYHHNNNLFRNKSVLIPSKQKVGLVGFSGSGKTTFISLITRLHD
FT                   IEDGMILIDGQNIKNVTQDSLRKAISLIPQEPILFHRTILENIRYGRKEASFEEVVEAA
FT                   KAAHIHEVISKLPEGYDTMCGERGNNLSGGQRQRVIIARAILKNAPILILDEATSSLDS
FT                   ETESLIQESMEYLMQNKTVIVIAHRLSTLLNMDRILVFDKGSITEDGSHSELLKNSKLY
FT                   QKLWNSQVKGLIT"
FT   gene            complement(558465..559703)
FT                   /locus_tag="A1I_02995"
FT   CDS_pept        complement(558465..559703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_02995"
FT                   /product="protease"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78966"
FT                   /protein_id="ABV78966.1"
FT                   /translation="MKENFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGNRYENPEEE
FT                   GIAHFLEHMAFKGTKTRTAKQIAEEFDSIGGHFNAYTGHEKTVYYSRVLSENCNKALAI
FT                   IADIVQNSAFAEEEIAKEYQVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGKPILGTS
FT                   KTLETFNRDHFLKFTGKHYNAENFYLSIAGNVDHEEIVKEAERLFSSLTQGEKSNFSPA
FT                   KYIGGHSFINKDLEQTTLILGFEGTSYINLEMLYQTQLLAIIFGGGMSSRLFQHIREKL
FT                   GLAYAVGSYNSPYFDSGVFTIYASTAHDKLELLAAELKNEIKRMAEQVKQEEIERARTQ
FT                   IRSNLQMAQEKVAYKSEEIGKNYAVFGKYISPEEIMEIIMNIKAADIIQTANRIFSSSA
FT                   TSAVIGPNNLSGF"
FT   gene            complement(559729..560613)
FT                   /locus_tag="A1I_03000"
FT   CDS_pept        complement(559729..560613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03000"
FT                   /product="Beta 1,4 glucosyltransferase"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78967"
FT                   /protein_id="ABV78967.1"
FT                   /translation="MSELLTKKISAFIITKNEAARIERAINSVKNIADEVIVVDSESTD
FT                   KTVIIAESLGAKVVVKPWLGYVGQKSFAETICKNDWILNIDADEELSKELQDEIEYIFA
FT                   SQNQDRYLAYQIKLLIMHRNDTRPRIFAPYNKCTRLYNKKFASFANTINSTTHDSVVFN
FT                   KDVDFANKIYTLNEAAYHYSGTSIEQLVAKANFYSGEQAKDLIKQGKKPSNIRIATEMI
FT                   WWFFKAFFIRRYFVFGFDGFVDSMIFAFARFLRLAKLRELSLQCNPATRSQDLKTQFVI
FT                   QDPVDKPRDDNIV"
FT   gene            complement(560616..560876)
FT                   /locus_tag="A1I_03005"
FT   CDS_pept        complement(560616..560876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03005"
FT                   /product="Putative toxin of toxin-antitoxin (TA) system"
FT                   /note="COG4115 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78968"
FT                   /protein_id="ABV78968.1"
FT                   /translation="MYVISYTKQAQKDAKKIARAGLKNNVELLLNIISTDPWKAYPPYE
FT                   KLIGDLSGCYSRRINIQHRLVYEVYKEEKIVKVFRMWTHYE"
FT   gene            complement(560887..561129)
FT                   /locus_tag="A1I_03010"
FT   CDS_pept        complement(560887..561129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03010"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system StbD"
FT                   /note="COG2161 Antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78969"
FT                   /protein_id="ABV78969.1"
FT                   /translation="MEVFNTSEAKNKLYELMNYVSEVHKPIYIKGRKSKVVLISEEDYR
FT                   NMEETLYLLSIPNMHKSIVEGRKEPIEKCSDKLDW"
FT   gene            562125..562667
FT                   /locus_tag="A1I_03025"
FT   CDS_pept        562125..562667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03025"
FT                   /product="cytochrome C oxidase assembly protein"
FT                   /note="COG3175 Cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78970"
FT                   /protein_id="ABV78970.1"
FT                   /translation="MSKKSNKSLAFSLLGLIVSMVLLSFAAVPLYNLFCKVTGYGGTTN
FT                   RETVSIYSKVKGTRPIIIEFDANVDKNLPWRFIPRQQRVQIVPGQNTLVFYETENLSDN
FT                   DIIGTSIYNVTPNKAGKYFVKIHCFCFEEQLLKAGEKVLMPVTFYIDKDFENDPEMRDV
FT                   KVLTLSYSFFKVRDVKK"
FT   gene            562747..562989
FT                   /locus_tag="A1I_03030"
FT   CDS_pept        562747..562989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03030"
FT                   /product="Transcriptional regulator"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78971"
FT                   /protein_id="ABV78971.1"
FT                   /translation="MIVQKSYIDNNGRLAIPIKVRKKLKLKTGDEVTIKYNDSELIVST
FT                   FHSNIEKARNILDKYKNIDLNKELKLMRKEDAAKE"
FT   gene            562973..563176
FT                   /locus_tag="A1I_03035"
FT   CDS_pept        562973..563176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78972"
FT                   /protein_id="ABV78972.1"
FT                   /translation="MQQKNKSLLKSEHILLDTSAVITLLKKETGYKLIEEIIANSSISS
FT                   VNLSELVSVLVRTNIPMHEMIK"
FT   gene            complement(563385..564383)
FT                   /locus_tag="A1I_03040"
FT   CDS_pept        complement(563385..564383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78973"
FT                   /protein_id="ABV78973.1"
FT                   /translation="MSLQYKKSLKTLCKIVTALIFIYLVLVILEYAHQGFINDLSMQKV
FT                   DLSVQNSMKEPVYLVSYADGAEHIYRNQNATSHYAINKGIDFILNYKKKHIDQTFIEKH
FT                   QEIFNEKAGAGLWLWKPYIILETMKNAPEGAIIVYLDSAFIIKQHISNLTNLLGNNDVL
FT                   LVHDRDRKNGSFVKGESFALMNCLNEECRNDDHIWSAVIVVRNTELARSFIEKWLKSCE
FT                   DIRVLSGKDYNIHPNYDEYKWHHSDQSVLSLVYHQNPQSVKVIEYEETMPILSWFHRKN
FT                   SNSSPLKAWYSIYGIDPVINFNTNGKALPSTALINTSPIVKLRKWISENFY"
FT   gene            564547..565650
FT                   /gene="trmU"
FT                   /locus_tag="A1I_03045"
FT   CDS_pept        564547..565650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="A1I_03045"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COG0482 Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78974"
FT                   /db_xref="GOA:A8GVU7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVU7"
FT                   /protein_id="ABV78974.1"
FT                   /translation="MINSNDRQSTLVVAMSGGVDSSVVAGILCEQGYNVIGITLQLYDH
FT                   GMATAKKNACCAGQDIYDAKMVANKLGMPHYVLDYESKFKESVIDNFVDSYLRGETPLP
FT                   CVQCNKSVKFRDLIKTAKELGADKLVTGHYVRKINGDNGPELHMGLDPLKDQSYFLFAT
FT                   TKEQLEYLDFPLGALTKDETRKLASKFGLEVADKPDSQDICFVPDGNYKNVINKIRPNA
FT                   SESGKILHINGFELGTHSGIINYTIGQRRGLGISYHEPLYVIKIDPNSNIVYVGPESAL
FT                   NVQEFVIKDVNWLAGSLKDGEKLEVSVKVRSTRPPRLAEISKLEGDRMKVKFLSEEKAV
FT                   APGQACVIYDGTRVLGGGWITRDVIPA"
FT   gene            565821..567215
FT                   /locus_tag="A1I_03050"
FT   CDS_pept        565821..567215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03050"
FT                   /product="Cationic amino acid transporter-1"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78975"
FT                   /protein_id="ABV78975.1"
FT                   /translation="MSFLRKKSFESVKEIGSSSGLSKTLGAFDLILLGLGAMIGTGVFV
FT                   VTGIIAAKYAGPAVMISYAIAGITCIFVAFVYTELAAMLPTSGSIYTYSYVAFGEVFAW
FT                   MIGSVIILELGVASGIVAAGWSGYVQGILAAGGIELPKALTTVPTNGGIVNLPAFLISV
FT                   CIGFILFLGTKDSKKLNAILVFIKMAAIFVFIIAAAPHFDATNWSNFMPFGFSNVLVGA
FT                   SILFLAFTGFGTIATAAEECKNPKRDIMIGIIGSLVLTTIVYVGMAGLVTGIAPFDQLN
FT                   NDQPLAYALTINNSKIGSAIVATGAVCGMMTVLMMNIYGTSRIFYAIARDGLLPKSFAK
FT                   LHPKYDSPYITIIIFASLAAILGGFCSTELLTQLTSMGAIIDYITVATIVLLFRTRLPN
FT                   AQRPFKCPLVYIIAPFIICACVYLLFIQVFDGEFNLHTAGRALLIWFVTIFVLYIVRSF
FT                   FMKKEI"
FT   gene            567369..568616
FT                   /gene="hisS"
FT                   /locus_tag="A1I_03055"
FT   CDS_pept        567369..568616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="A1I_03055"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COG0124 Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78976"
FT                   /db_xref="GOA:A8GVU9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVU9"
FT                   /protein_id="ABV78976.1"
FT                   /translation="MTDKLQPLRGMKDLLPDDYKVHDYIIKKAKEVGELYGYKQMSTPI
FT                   LEYTKVFNRSMGESSDVISKEIYSFLDKSDESVALRPEFTAGIVRAFISNGLQHKLPLK
FT                   LFSTGPVFRYDRPQAGRQRQFHQLNYEYLGAKGAISDAETLKLAVDILQSLEVLADTTL
FT                   ELNSLGCSQSRSTYQQKLVEYLNDFKDELSEDSKIRLTKNPMRILDSKSEVDQKIVANA
FT                   PVLSEYYTEESKKYFEELLKYLDILGVKYTINARLVRGLDYYCHTAFEFTTTKLGSQST
FT                   ILAGGRYDGLSRIMGNNDEIPAIGFAAGIERIALMREYNIDSVTPIFVLPIGENNISHS
FT                   LKIADQLRLHNIPVLIEVSGKMAKRMQRALNENAKFIVFIGDEEQANNNLKIKDLEKQE
FT                   EYILDFSKTIELLKKS"
FT   gene            568860..569570
FT                   /locus_tag="A1I_03060"
FT   CDS_pept        568860..569570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03060"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78977"
FT                   /db_xref="GOA:A8GVV0"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVV0"
FT                   /protein_id="ABV78977.1"
FT                   /translation="MKKKLYEGSSKTLYSSEEEFLLVMAFSDKATLENGEIIDVSGKGV
FT                   LNNNISSFVMNKLEMIGIENHFIEKLNMREQLIQYVEMFPLQVVVSSVACGRFVKEFGM
FT                   DEGFVFDKPIIDFKVKSREFKYPIVNEHQILNFGWLTKDEINTVKKQALRIYDFLSGLF
FT                   IGIGIRLVECNLEFGRVFTGEESLVMLTDEISPDTCKLWHINSNERLGFELLEKDPAKA
FT                   YESYKLIADRLKEK"
FT   gene            569584..571485
FT                   /gene="thrS"
FT                   /locus_tag="A1I_03065"
FT   CDS_pept        569584..571485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="A1I_03065"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="COG0441 Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78978"
FT                   /db_xref="GOA:A8GVV1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVV1"
FT                   /protein_id="ABV78978.1"
FT                   /translation="MINISFPDGSVKQFEKNITAFEIAVVISTSLAKAAMIAEINGDLK
FT                   DLSTQIDNDCRLRILTAKDPECLEVIRHDAAHLTAEAVKELFPETQVTIGPAIENGYYY
FT                   DFARDKPFTTDDLAVIEAKMHELAKKNEKVTRELWDREKAVEFFKSIGEHYKAEIIASI
FT                   PSNEPISLYRQGNFIDLCRGPHAPSTGFVKHFKLMKVAGAYWRGDSRNEVLQRIYGTAW
FT                   ATKEQLESYLFMLEEAEKRDHRKLGKELDLFHFQEEAQGMVFWHDKGWSVYNTIEQYIR
FT                   RKIRKNGYIEVKTPVLVDKSLWELSGHWEKFRDDMFALETDDKTLALKPMNCPCHVQIF
FT                   KQGIKSYRDLPLRMSEFGLCHRNEASGALHGLMRVRSLVQDDAHIFCAEEQITDETVSF
FT                   CKLLTEVYKDFGFTDIKVKFSDRPEVRAGSSETWDKAENALKEAVEKAGYSYTLNPGEG
FT                   AFYGPKLEFVLTDAIGRQWQCGTLQMDFVLPERLDASYVAASGEKKRPVMLHRAILGSL
FT                   ERFIGILIEEYAGRFPLWLAPVQVAIATITSDLNDYALEVQKALIESGVRVDINISPDK
FT                   INYKIREFSNQKVPMIAVIGKQEKENKQVTIRRLGTTEQEVLSIEQLIEYIREENSK"
FT   gene            571810..572472
FT                   /locus_tag="A1I_03070"
FT   CDS_pept        571810..572472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03070"
FT                   /product="hypothetical protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78979"
FT                   /protein_id="ABV78979.1"
FT                   /translation="MQYIFPFNNSSKYHPEEFIVSESNALVYNALQNWQNSFGVNPYKL
FT                   TLLIKGPASSGKTYLTKIWQNLSNAYIIKDIFFDDKILANHTAFIIEDIENWQETALLH
FT                   LFNLINEKQKYLLLTSNNKGKNFTLPDLSSRINSILNVLLYPPDDELIKILIFKHFATS
FT                   SVTISQIVIDFLLVNLPREYNRILEILEYINNFALTSKRKITIPLVKEALSFVNISY"
FT   gene            572548..572787
FT                   /locus_tag="A1I_03075"
FT   CDS_pept        572548..572787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03075"
FT                   /product="MFS-type sugar transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78980"
FT                   /protein_id="ABV78980.1"
FT                   /translation="MLGYQKEQTSLSRKQKQAISLLSIGNFLEYFDLMLYVHMAVLLNK
FT                   IFFSPDNLYSVKVLSAFAYCSTFVFRPFGALLFG"
FT   gene            572839..573861
FT                   /locus_tag="A1I_03080"
FT   CDS_pept        572839..573861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03080"
FT                   /product="MFS-type sugar transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78981"
FT                   /protein_id="ABV78981.1"
FT                   /translation="MACTCIGMAILLSYDEIGFAATIMVTLFRAIQGISSSTEVVGAQL
FT                   YITEMVKPPMQYPAVASVTIFSTLGTLAALGVATIVTSGNLNWRYAFVFGALVAITGTM
FT                   ARTTLKETPDFIDAKRRIKSSLEKTGLDPKQIDNNDILKQKTNLKTFISYFVIQCTGPV
FT                   WLYFAYFYCGNILTENFGYSPAEVIKHNFFISIGDVIGGILLTYLSYKIYPLKILRTTF
FT                   YIFVIFLCFSPIIMQNLAPNYLMLIQLYFLIFAPGYFPAMAIFYKHFPVFKRFTHTSFI
FT                   FAISRALMYIITSFGLAYLTEIFGYIGILMIMVPVTIFYYLGLRHFEKLEKQVNNFNIA
FT                   "
FT   gene            574238..574690
FT                   /locus_tag="A1I_03085"
FT   CDS_pept        574238..574690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03085"
FT                   /product="hypothetical protein"
FT                   /note="COG2001 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78982"
FT                   /db_xref="GOA:A8GVV5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVV5"
FT                   /protein_id="ABV78982.1"
FT                   /translation="MNIFLSKFINNNIDKKGRVSVPANYRAVLGKEAFNGIIAYPSIRN
FT                   NCIEACGISHIEKLRQMIESLDPYSEERDAFETIIFGEAVQLSFDGEGRVILPASLMQH
FT                   AGIEDQVCFVGKGVIFEIWQPQNFKDYLASAQKLAHEKRLTLRNTN"
FT   gene            574690..575607
FT                   /gene="mraW"
FT                   /locus_tag="A1I_03090"
FT   CDS_pept        574690..575607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="A1I_03090"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="COG0275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78983"
FT                   /db_xref="GOA:A8GVV6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVV6"
FT                   /protein_id="ABV78983.1"
FT                   /translation="MQQPHIPVMLNEMLKFLAPKAGESYLDCTFGAGGYSKALLENCDC
FT                   YVTALDRDPNVIKKAEEIKHNYKDRFDFVETNFGNCFAKLESKKFDGIVLDLGVSSMQL
FT                   DIPDRGFSFLHDGPLDMRMSGQGLSAEEFINTAEEKDLADVIYKYGDETFSRRIAKKIV
FT                   EVRKAARIDSTGKLADIVHSCIGFRKGKIDPATKTFQAIRIYINNELGELEQFLANVKN
FT                   ILKKDGRLVVVSFHSLEDRIVKNFFKENSEKPVARSKYAKEDIMLNPDKWLKIITNKAE
FT                   IPSDKEISLNVRARSAKLRAAKKI"
FT   gene            575610..576005
FT                   /locus_tag="A1I_03095"
FT   CDS_pept        575610..576005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03095"
FT                   /product="Cell division protein FtsL"
FT                   /note="COG5462 Predicted secreted (periplasmic) protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78984"
FT                   /protein_id="ABV78984.1"
FT                   /translation="MSIKKFHYLVLLVIIIAVCSLFTIKERVSTIDYQLSSVLKQINSE
FT                   NNNIHILKAEKAYLISPARLKNLATAYLELQTVKPCQMVRDPLSPITASNIRFDQDINI
FT                   FKSNNNRRHKRITNNKYIQTVSSREKP"
FT   gene            576136..577821
FT                   /locus_tag="A1I_03100"
FT   CDS_pept        576136..577821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03100"
FT                   /product="Penicillin-binding protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78985"
FT                   /protein_id="ABV78985.1"
FT                   /translation="MKQILEKWKPDIKSLIFWNVCSKNTKIRLLIVIGAFSVLFCTLSY
FT                   RLIIVATNVYDKNLHALKKSSQFRKEIVDRNDNLLAVNLPSASLFANPQIVIDPENSVK
FT                   KIAEILPDINKAKLLADLKSNKSFIWVKRDLLPSQQERIMSLGLLGFDFEEEQKRIYTF
FT                   SNLSSHIVGYVGRDMAGLSGLELAYDKYLTNSDLDLNKPGKQKEPLKLSIDIRLQSILS
FT                   EEIDKTLKQFSAIGAVGIIANPNNGEILALVSKPDFDPHYPSAAKPQQLFNMASLGIYE
FT                   IGSVFKSLTMAVGFDTGAINMNDAYDISYMKVGGFQIKDYTPRQGWHSVPDIFLHSSNI
FT                   GVSQIMLEVGKNNFRKYLKKLGLLDQVQIELPERGTPLFPSEKRWNELTSATMSYGYGI
FT                   SISPLHFVRAMLPVVNGGILYDLTLLKRDDEKVEGTRVFSENTSKQMRQLFRTVVKDGT
FT                   GKRAEVKGYLIGGKTGTAEKLSSNAGKKKYLKNSRTTSFLGLLPASKPEYVIYIMIDEP
FT                   KPTKETFGFATAGWTAAPTAGRVLERMISLYGLEPIEQIGEVVE"
FT   gene            578076..578579
FT                   /locus_tag="A1I_03105"
FT   CDS_pept        578076..578579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78986"
FT                   /protein_id="ABV78986.1"
FT                   /translation="MQNQNTDYSPVIEELNKAYKNYIIAKDALIEVGTLTITVGALGLL
FT                   LFFGPAVSGSLMFCSALAIGKTKEAYRKELLNALSIGELGDVTEIEKCYKQLPKKLRED
FT                   WVDDNFYPKLANHLKEKFFEDKIFGVDENPNPICQVELQDFNQEIDNEWIDLSGKSENV
FT                   VFLQ"
FT   gene            578689..579573
FT                   /locus_tag="A1I_03110"
FT   CDS_pept        578689..579573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78987"
FT                   /protein_id="ABV78987.1"
FT                   /translation="MADDGDNKKDVPDKKDDTQVKNDNLSKSDDNQTQNKKDDAQVKNE
FT                   LNAIRAQVTATNNPAELARLASAAAGLAASTNNRELLDQIKNLQSSISKREENAEQIIY
FT                   SEASEKGLNMEGQGNQYDHEAAREQELHDRHERLKAGHDQFMKEADEFIESKRQEKEKW
FT                   QALLNDMKAGKEIDPERLKALDKTEAQLKDDQNKRNALKEYHKKATEHSQQLKAEEDRL
FT                   KKQQAQDIKAAEEQRNANSKLAVNSKELEQGQIKLASINARIEQTGAKLSALSPKIAEA
FT                   TKIQADAYKQVEK"
FT   gene            579763..580074
FT                   /locus_tag="A1I_03115"
FT   CDS_pept        579763..580074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78988"
FT                   /protein_id="ABV78988.1"
FT                   /translation="MRFPSKPSSDVILPGKDEILPTSQKSTSAEAVTATKKLSQGEEAL
FT                   KLSEERPVSSDKINKFTNKIKSSLEKQQSSVSSNKETQVNKLARTNQQNKKNDKGHSR"
FT   gene            580741..581331
FT                   /locus_tag="A1I_03130"
FT   CDS_pept        580741..581331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78989"
FT                   /protein_id="ABV78989.1"
FT                   /translation="MKSFFKGMFSKAPEASTAPKAALVPVVAPKVTSSNISYRDILLRD
FT                   QEHPEIALKLQEATINTNLTIRVNGQHIFEVKQYRAVKIPNALENIKTPTIKFVFSYLN
FT                   GVKLSDEFATHTKGTAHLKLDYNANGRLEKLTLPNQPIYFKDKPGYPAFCIFKKIMCSL
FT                   PVDSGQLGHLMQIAPKVEFNNVDEYTYKVELLG"
FT   gene            complement(583147..583803)
FT                   /locus_tag="A1I_03145"
FT   CDS_pept        complement(583147..583803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03145"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78990"
FT                   /protein_id="ABV78990.1"
FT                   /translation="MEDLSRWKEKFEECIYTKKLLDKLKYLNTKVANTIDLEEIKKAIY
FT                   YARKYHGLQMRKSGDPYYSHPIEVAIMVAEFTAMEVPKLYTSVMMQAALLHDTIEDTAL
FT                   TEEMITEIFGEEVAKHVEGLTRIKPYGKITAEESLNILIKQKRYDTALIKLFDRIHNVQ
FT                   TLGAKSPEKAKKIIEESLISFLLVAANIDYNLEQEFTALCLRASDIEFEKKSNIF"
FT   gene            584008..584763
FT                   /locus_tag="A1I_03150"
FT   CDS_pept        584008..584763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03150"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78991"
FT                   /protein_id="ABV78991.1"
FT                   /translation="MLGYTKEQVSLTRNQKEAIGLLSIGTFLEYFDLMLYVHMAVVLNE
FT                   LFFPKANPKVAFIYSVSAFCSTYLLRPFGALIFGWIGDTIGRKTTIIITTFLMSMSCLI
FT                   MAVLPPYSEIGIKAVWLVTACRVIQGMASMGEAVGAELYLSETIQLPTRYMAVSIIVVF
FT                   GTLGGTAALGLGALVTSYGFNWRLAFFFGAVVAFIGSIARTNLRETTEFVDAKRRIKKT
FT                   FDKAKIDIKALNSSPVLQQKVSKKTTNLK"
FT   gene            584763..585221
FT                   /locus_tag="A1I_03155"
FT   CDS_pept        584763..585221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03155"
FT                   /product="Proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78992"
FT                   /protein_id="ABV78992.1"
FT                   /translation="MQQNLGVGILELISTIVFTYLVLKIHPLRLLKIRLFIFSLFALII
FT                   PIILSNITTPFQLFLLQVFIGICAPTGFTAFAIFCMNFPVFKRFLYTGVIFATSRAIMY
FT                   ALASFGIVFLTDYFSYWGLLIIILPVLIGYGFGINHFKKLEVNAGNYY"
FT   gene            complement(585184..585888)
FT                   /locus_tag="A1I_03160"
FT   CDS_pept        complement(585184..585888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03160"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78993"
FT                   /protein_id="ABV78993.1"
FT                   /translation="MEDLSRWKEKFEECIYAKKFLDKLKYLNTKVANPVDFEEVKKAIY
FT                   YARKYHGSQMRKSGDPYYSHPIEVAIMVAEFTVFKETKFFTTDNIITSLLHDTIEDTQL
FT                   TQEMIAYIFNENIAVNVKALTRIKIDTKISAADAINILYRSAKMELIIIKLFDRLHNLQ
FT                   TIGAKPLEKQINTIRETLISFLPVAVTVSYQLENKIVQLCLNILNELDNKYEEDNYSFR
FT                   SNNSSQHLPLIF"
FT   gene            586025..588286
FT                   /locus_tag="A1I_03165"
FT   CDS_pept        586025..588286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03165"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78994"
FT                   /protein_id="ABV78994.1"
FT                   /translation="MKKFLLLFIISIIPLNLFAQAKVNNIVAPVSYFINHIQQLNQIKT
FT                   NLEKYRQTSIVGISGMGKTQLARMYAYGNKDNYNLIWFIDCNLNINDELLKLAKAINKA
FT                   EGKTVIAEEAANVKKELMEYLGQSDKWLLVFDNLKVGENKKVQDFINWEHNGNIIFCSQ
FT                   DSDMMPYIVKAVPFKKQETIELANNILLDKDNNLVEFLVQEFKCYPVLIVQGAQILNNV
FT                   PGLDKEKYKHQIQKSNDKIDYNISLVINQLSTSAKQLLSKIALLNNQSFSKDFLGIITD
FT                   NKDNLNDDIFELSKFALITNIDASEDNPVFEMHDVIAQKILEKNGANNSKYLEEAVTKF
FT                   INGTPKSVIKAFLYRNAKTVPDNIEVMTQNAEKYNIGTYKLLELKLKQIVQCDNSYDLA
FT                   GGKKLVDWFDTNDRDGKYKLWLMNNEEKRVYAEYLNLIGWYYLKASNYKMSIEYFKKAN
FT                   KIFEDVKGYEEMKANVISGLTNTYIVIGDIQNAQENIKILEQKLADSSDRTSIYANKAR
FT                   LLYVEGKYPEALEQINQSIQAAISSGLDPNALFLTGDYLVKSGVLSKLGKYQEALNQVE
FT                   QVYNMQKRVKKETNVIFGRIFTQKAIALFGLGEKDKALEYADKAIEIFKNNDKSFMSRR
FT                   MPDVFNPAIAITCTIRGDILFASGKLEEALDSYMDARGIYFNVYRRNYKNVAQVSEVNL
FT                   KGAKVACKRKDTLNYKFFAKPQIIDFGAEHPDSIEMLEYCKTYGMGLISNKAYIDKSKK
FT                   "
FT   gene            complement(588339..589034)
FT                   /locus_tag="A1I_03170"
FT   CDS_pept        complement(588339..589034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03170"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78995"
FT                   /protein_id="ABV78995.1"
FT                   /translation="MHPTHIKVLTPNSKDLDILCVALSIVKTLDQINDFKILVKQALNQ
FT                   GFDINMKDGDHCTLLYYSCTLKLYEIAQFLLENGADPNIRNTVYDQITPLSVVRTQPKT
FT                   EQSIYLTKLLLQDSLLKLCQNNDFKIIDNSITVKDIEEFIDWRMSISSKNNEFISYHLK
FT                   ELHNLQNHLVRNTKFSNSEIIQKLDSILITAEDYNKSFEQLPEQLIDKTEAIEPELTGK
FT                   VAEVISETA"
FT   gene            complement(589281..589637)
FT                   /locus_tag="A1I_03175"
FT   CDS_pept        complement(589281..589637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78996"
FT                   /protein_id="ABV78996.1"
FT                   /translation="MNNNDELNKLVIFKDKNIRRILYNNEWWFSVIDVVGALTDSANPR
FT                   DYWSEIKTRVSSEDRVELSTICLQLKLKAPDGKMRLTDCVNTESLLRIIQSRKNNKKCY
FT                   KLAFFNWIASSITS"
FT   gene            590060..590239
FT                   /locus_tag="A1I_03180"
FT   CDS_pept        590060..590239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78997"
FT                   /protein_id="ABV78997.1"
FT                   /translation="MSNQNKKIIHNINLDFIEREVNILKDEVAHLLETPVTDKDIERIE
FT                   QRLEELEKMFYNLN"
FT   gene            complement(590478..590912)
FT                   /locus_tag="A1I_03185"
FT   CDS_pept        complement(590478..590912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03185"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78998"
FT                   /protein_id="ABV78998.1"
FT                   /translation="MSNLKTKINELMTQRKMSAKDIENLTGLSRNTVNSIIFGSSKNPG
FT                   IYTIKQLANALNVKVESLISDDKEIQFDILKPEQIKLFGEVVSLTTNIISDKNIDFSMH
FT                   KITSIIQEVYQCALKGKSEEVQKHLAEYLMDMHIDSANKI"
FT   gene            591321..591530
FT                   /locus_tag="A1I_03190"
FT   CDS_pept        591321..591530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV78999"
FT                   /protein_id="ABV78999.1"
FT                   /translation="MNNIETRILDYGRKIDMNLQTISEQINQIQKLIGEIPLDARFVKD
FT                   YDDEDDEDDFDDGVWIEFPFRETT"
FT   gene            591619..591804
FT                   /locus_tag="A1I_03195"
FT   CDS_pept        591619..591804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79000"
FT                   /protein_id="ABV79000.1"
FT                   /translation="MMWLLIALCLTGLVLIIGVVSMAIGGKFDKKFSSKLMTMRVFFQA
FT                   VAVLLLFIIYFYKVNP"
FT   gene            complement(591829..592041)
FT                   /locus_tag="A1I_03200"
FT   CDS_pept        complement(591829..592041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03200"
FT                   /product="hypothetical protein"
FT                   /note="COG2975 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79001"
FT                   /protein_id="ABV79001.1"
FT                   /translation="MHWDDIEEIAEHLEDNYSDDYRPNMAQTLLKEMITSLEDFEDQEV
FT                   EVSKERLEEILAEWKKIRGEMQENE"
FT   gene            592394..592921
FT                   /gene="def"
FT                   /locus_tag="A1I_03205"
FT   CDS_pept        592394..592921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="A1I_03205"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79002"
FT                   /protein_id="ABV79002.1"
FT                   /translation="MSILPIVTVPDERLKQKSQAVLEVNNQIRKFMDDMVETMYHEDGG
FT                   GLAAVQVGVLKRIMVIDIKDHDPIKRPKDFYPLFIVNPEIIEKSEELVIANEGCISVPE
FT                   QRYEIARSESIKIRYLDYHNKPQELEANDWLARVIQHEYDHLEGKLMIDYLSSMKRNIA
FT                   LRKLRKLKKNIV"
FT   gene            592997..593833
FT                   /gene="fmt"
FT                   /locus_tag="A1I_03210"
FT   CDS_pept        592997..593833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="A1I_03210"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79003"
FT                   /protein_id="ABV79003.1"
FT                   /translation="MQLLRNRLKPKGRGLSETKSPIHQLADEAQIPVYTPTTLRNEEAA
FT                   NLINNIDADIIVVIAYGFIIPQNILDAKKYGCLNIHPSDLPRHRGAAPLQRTIIEGDKT
FT                   SSVCIMQMDAGLDTGDILMKEDFDLPKKITLQELHDKCANLGAELLIKTLANIDKIVPK
FT                   PQSNEGVTYAHKLTKEEGRVNWQDSAFSINCKVRGMNPWPGVYFKYNDKTIKILEAEYS
FT                   DEEHNFTPGTIINKNLEIACGKGILMIKKLQQEGKKVLNIEEFLRGFKTPVINKVQ"
FT   gene            593839..594909
FT                   /locus_tag="A1I_03215"
FT   CDS_pept        593839..594909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03215"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /note="COG4820 Ethanolamine utilization protein, possible
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79004"
FT                   /protein_id="ABV79004.1"
FT                   /translation="MLNFTKYFIFIVFYFFYTSNIYAINNNHQFIAVKSLESSNIKIKK
FT                   LLEEKNTSQFILELPNGVVINEGGVLTEEGYILQDTQTSTGDQHRLVNKKRDINEENPL
FT                   YFKGKLAVISSPGSENWYHWLLQVLPRLIILKESNFEYDRIYVNNLKYQWQIKSLEVVL
FT                   NYLNISEDKLLVVNSDCIIQASNLIVPSVPFIPVKGTALPFWLKKDLRNIFLKNNKDDI
FT                   KTYDKIYISRKYASSRKIINEEKLIEEIEKIGFKVIYLELLSPHEQAQIFNKAKIIIGI
FT                   HGSGFANLIFATPKCKVVEIDHGTNPPRSFYKRMANYMSCDYYPYYVDQTTEEHLEDDI
FT                   KIDINKFMKFFNDLDK"
FT   gene            complement(594921..595958)
FT                   /locus_tag="A1I_03220"
FT   CDS_pept        complement(594921..595958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03220"
FT                   /product="Putative ATPase n2B"
FT                   /note="COG1485 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79005"
FT                   /protein_id="ABV79005.1"
FT                   /translation="MTITLDTKQTNLLEELSQIAIELNKPKSLLKFFNKTNLKSGIYLF
FT                   GPVGTGKTMLMNSFFEKLNVPKIIIHYQNFMQDIHKTMHKLQLENQKDIVPKIAKDYAK
FT                   KTKVLGIDEFEIKDITDAMIIGRLFDELIKQNVFIFITSNSQPNNLYKDGLQRNSFLPF
FT                   IDKINNEFYVKYLDNHHDYRFDKALNVKGDRIIYPLTLKNQDKFQKIIADISDNNFIPQ
FT                   TIEVLGREISFQKVHKRILITDFNELFTRNLSYIDYVNICQKFNIIIVQNMQIIPPDNT
FT                   NLAVRFINFIDNAYFYKILLFMSLEDNPNKIYQGSARTEEFKRTVSRLNEMNSEAYLLN
FT                   NDFRN"
FT   gene            596351..597112
FT                   /locus_tag="A1I_03225"
FT   CDS_pept        596351..597112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03225"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79006"
FT                   /protein_id="ABV79006.1"
FT                   /translation="MEDLSSWKERFEECIYAKKLLDKLHYLNTKVVNPINLEEIKKGIY
FT                   YARKYHGLQMRKSGDPYYSHPIEVAIMVAEFTAAEVPKLYTSVMIQAALLHDTIEDTAL
FT                   TEEMIAKIFGEEVAKHVEGLTRVKPYGKITAEESLNILVKQKRYDTVLIKLFDRIHNVQ
FT                   TLGAKSPEKQIKILTETLKNFIVLASYLELFEIEAKLMKYCLKLNSLKSNLQTAQNLQN
FT                   SCHNYSFQTFSSLAFQNDLFLKQNLYWLKSL"
FT   gene            complement(597699..598334)
FT                   /locus_tag="A1I_03230"
FT   CDS_pept        complement(597699..598334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03230"
FT                   /product="MFS-type transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79007"
FT                   /protein_id="ABV79007.1"
FT                   /translation="MLGYAKEQRSLTREQKKAVGLLSIGTFLEYVDFMLYIHMGVLLNE
FT                   IFFAPTYSPYSAALLGAFSFSAPFIVRPIGALIFGWIGDRIGRKSTVIITTSIMATSCL
FT                   IIANLQSYAQIGITASIIVIICRILQGMSSIGEIIGVELYFTETIKPPKSYQVVGLIGI
FT                   FSVLGGTAALGLASLVTSYGFNWRLAFWVGAGIAFIGMAARTTLRETP"
FT   gene            complement(598589..598676)
FT                   /locus_tag="A1I_t07979"
FT   tRNA            complement(598589..598676)
FT                   /locus_tag="A1I_t07979"
FT                   /product="tRNA-Ser"
FT   gene            complement(598736..599458)
FT                   /locus_tag="A1I_03235"
FT   CDS_pept        complement(598736..599458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03235"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79008"
FT                   /protein_id="ABV79008.1"
FT                   /translation="MQIIILAAGKGSRMESDLPKVMHEVGGVPMLETVLNNSLKVTDDV
FT                   VIVYSEDLKKYLTPYENMCRFALQKEPKGTAHATHAAIDLIDENKTILVLYGDHPLITP
FT                   ELMNELVEYLNFSNASLVTLCFERDDPAFYGRISIDQNGEFLEIIEYKNATEEQKKIKL
FT                   CNSGIMAFNPGILNEYLPLFANDSRDNKEVYLTELVKLCKDNGKKVSYLLSDNHDLIVG
FT                   VNTKNELLEANNIFSNNK"
FT   gene            complement(599449..600219)
FT                   /locus_tag="A1I_03240"
FT   CDS_pept        complement(599449..600219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03240"
FT                   /product="hypothetical protein"
FT                   /note="COG0217 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79009"
FT                   /db_xref="GOA:A8GVY2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVY2"
FT                   /protein_id="ABV79009.1"
FT                   /translation="MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKAGSTNPDN
FT                   NPRLRTALATARSQNLPKERIDKAINSANDSANNENYTEIRYEGYAPGGIAIIVEALTD
FT                   NKNRTAAEVRSSFTKYGGNLGETGSVNFLFKHCGVIQYPLEISSAENILETAIEAGADD
FT                   IVSDEVLHTIYTDIENFSKVLEFLTDKYGTAEEAYIGWVPLNTIIIDDKEKAEKLLKLV
FT                   DLLEESDDVQRVFGNYELSDEIYEILQGSEIICK"
FT   gene            complement(600242..600367)
FT                   /locus_tag="A1I_03245"
FT   CDS_pept        complement(600242..600367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79010"
FT                   /db_xref="GOA:A8GVY3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GVY3"
FT                   /protein_id="ABV79010.1"
FT                   /translation="MKVVSSLKSLKKRDKDCQIVKRRGKIFVINKKNKRFKAKQG"
FT   gene            complement(600448..602700)
FT                   /locus_tag="A1I_03250"
FT   CDS_pept        complement(600448..602700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79011"
FT                   /protein_id="ABV79011.1"
FT                   /translation="MAENETEQLSSKFFNILKDTDLTKNANIQASSDNLANSIININKE
FT                   LNSETATAYLNEIEKINKEIPDFKEKKLAQMLTVIKDTLPSIQNPDVKEILDIPLIEYL
FT                   AEKQSKEYNQEKENFEKRGKVAPKAVSDLIRDRRVANVQEFKKEADKSEGVSGGYIADE
FT                   QATHNTFMLKRFYKKGAEVETTQQWMDRNDAVRELIGGNMYEQLLYNRAPKEELVTGYA
FT                   NSKLPDFVSKILYVRSKFLENSEHLGEILKETNVPKLAGFEKAIAASHILGESDYHTQN
FT                   LMVQNNNTVVKIDHGRSFMNFNKDFTSMLQDANEKFERFGYNENIEKGQLTFNVKEYSK
FT                   SLNQMLNQLDNNQIDNIIDQKVDELVKNGFDAKGICPGKLDIKGLDTSVIFNNEQELRK
FT                   YYKDNIKENLSNMKEIAKKVDIVAKYSNPSPDFENGKWLKDMANSPMQDPVAYAAHNDI
FT                   QIEGKNALQWAHENNYKIEIPTSEVKTEKVTENQWSKNANGKWEETPIEVEKKQKEYRS
FT                   IDPLKYILSRNQVAISKSEKEFLNQAINLGIKNNFDESYKENTRFKDNSIVKNLNKEDK
FT                   TITNEIEKLAQKFVKNNSKNTITTEAMEKLYDDTLQIMKDKKLLTDQDIATIKNDKRFK
FT                   ERIKNTTEFINNENKFDISRTDKVYYKLARFYKKIGFKGIANDLKAKIDPETLNKINKF
FT                   ENVQNITSDIREVLMNNRSGKEGIQTARLNKMNIKLDIQPKLNTKPKNRKQESTQR"
FT   gene            602835..603536
FT                   /locus_tag="A1I_03255"
FT   CDS_pept        602835..603536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03255"
FT                   /product="hypothetical protein"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79012"
FT                   /protein_id="ABV79012.1"
FT                   /translation="MFYGFFLTYVNKLKYCTFTKINKTIFYGFVTKFNYKHKEYLNMQQ
FT                   YSIHDLEKNLDKIVRDDKEWSLNDFGGFEALQKLPEIVKNSPLFAKAVKNFNPTVEGTG
FT                   FSIFNSVNSTIPYTLPIKFAEAGLELEAVGKNANHVWETLSIILEKAQGKGVTYLSLGR
FT                   GWDGKQDILGGKKILDLMSQNLQATRNDPLKSKIFNMLLEEADKKEEGLFAIPDSHKKY
FT                   PTVMKAYNESI"
FT   gene            603523..604095
FT                   /locus_tag="A1I_03260"
FT   CDS_pept        603523..604095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79013"
FT                   /protein_id="ABV79013.1"
FT                   /translation="MKAYEEYEALVEDSEFVVLGVQFNTLEVQEQENTPELSSDDEEVE
FT                   SINGDEEAGATSMESDILGMPIDQLATLINWGVQISGGNADHQGRTAMDFLTQAMNLVD
FT                   ASGGNLEGLANIAPDVIGDPRNTNSQPNVQSEANTDLPTRAQSLAATVDYNIETLFDIA
FT                   PHITGDLSDADANELIGLACDIISNHS"
FT   gene            604307..604558
FT                   /locus_tag="A1I_03265"
FT   CDS_pept        604307..604558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79014"
FT                   /protein_id="ABV79014.1"
FT                   /translation="MRESLISILKKATANNKKPKFTNYLDIINEIIDLTSNKNNIDNRE
FT                   EKFQDIQISLEQIKEKSKEDIIEVKGNIRIFCSRFIHN"
FT   gene            604635..604850
FT                   /locus_tag="A1I_03270"
FT   CDS_pept        604635..604850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79015"
FT                   /protein_id="ABV79015.1"
FT                   /translation="MGLEFKVRFDIVKPTESGEEIFYKQPELTLSNNTKILEVELTNPF
FT                   SELEQLEQVLKTLGEVESNTGVNNLE"
FT   gene            604944..605645
FT                   /locus_tag="A1I_03275"
FT   CDS_pept        604944..605645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03275"
FT                   /product="Soluble lytic murein transglycosylase and related
FT                   regulatory proteins"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79016"
FT                   /protein_id="ABV79016.1"
FT                   /translation="MFVKLLIFTIPYIFFSSIAIADPEIAESLKCSKLFPYFEKKFNIP
FT                   SNTLHSIALKESGKKHKTRNLRVVWPWTVNVEGKGYYFNTKREAVNFVRKEIIRGRESI
FT                   DVGCMQINLRHHLGAFNSLDQAFEPNNNIRYGAEFLRSKYDQLKNWHKAIAHYHSATHS
FT                   LGFKYKQDVVKIASNMALYKASLHGYLNNSEDILVNKAVVSNNKVQKKPFFTSNKRYKS
FT                   SIMVPIPVKIN"
FT   gene            605650..606153
FT                   /locus_tag="A1I_03280"
FT   CDS_pept        605650..606153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79017"
FT                   /protein_id="ABV79017.1"
FT                   /translation="MNIKSIICFVILVSAVKINADFNDIQVTETTQDIVIEQETIKLPW
FT                   SDCTEIHKLFERKFSFSEKQVKKENKIYEEYRKFYLDHNNPSNFSMQFSERKTDAQRVE
FT                   TLISGFLKFCEDNFQTSNIKPNSLNYQIKKQQEQLYNNIRSENYRIYYKQRYYNNAVLP
FT                   SHNK"
FT   gene            606228..606407
FT                   /locus_tag="A1I_03285"
FT   CDS_pept        606228..606407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79018"
FT                   /protein_id="ABV79018.1"
FT                   /translation="MFRKFILVALVCLNSYKTLAEDKKSESVLTKILINISENYNCSDS
FT                   DLVEKRKQHIKEKN"
FT   gene            606533..606733
FT                   /locus_tag="A1I_03290"
FT   CDS_pept        606533..606733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79019"
FT                   /protein_id="ABV79019.1"
FT                   /translation="MQKKLLEDMQLRLPKQSIKNKEKFLKDMQLRHLNPNIIRNQENFL
FT                   QNNRNDISSFNYLIGKPNYMN"
FT   gene            606937..607326
FT                   /locus_tag="A1I_03295"
FT   CDS_pept        606937..607326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79020"
FT                   /protein_id="ABV79020.1"
FT                   /translation="MFRKFILASLLCLSSYKVLAEDKKLEDIPNKILVNISENYDYSNS
FT                   LVKNKKQSIEKKELEVSLPNDQIQIKGIKENFEIIERISGDDIHTARKRKRVQDLINGE
FT                   LPIINWMVEEKAILEKKMKEKYKID"
FT   gene            607399..608124
FT                   /locus_tag="A1I_03300"
FT   CDS_pept        607399..608124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03300"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79021"
FT                   /protein_id="ABV79021.1"
FT                   /translation="MFINQAADDLIDRLKMIDKKFSDILEISAKCGHLTKLLKTVYRGT
FT                   KITAVDMSPLLLDSFEHDNKLCIDEEHLELPENSFDLIVYSLGLHSINDVQRFLFNIRK
FT                   FLKNDGVFIGNFIGGSSLQNLRKSLIEFEIESSSQHSPHISPFIHFDHVPILLSQAGFN
FT                   EVIVDYENIELKFDNPLELMREIKNIGESNSLILRQNYAISKKMYSLLQNYKNGFEDNI
FT                   TLISFIASPSKNSIRLKLL"
FT   gene            608332..609711
FT                   /locus_tag="A1I_03305"
FT   CDS_pept        608332..609711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03305"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79022"
FT                   /protein_id="ABV79022.1"
FT                   /translation="MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKNDTLGGTCLNI
FT                   GCIPSKALLNSSEKYEEALKHFENIGINAEVKLDLQKMLANKDKVVSDLTKGIDGLFAK
FT                   NKITRIKGEAKIISSNIVEVNGEQISAKNILIATGSSVIEIPNIKIDEEFIVSSTGALK
FT                   LSKVPENLIVVGGGYIGLELGSVWRRLGSKVTVVEYAESIVPMLDKEVASQFMKLQLKQ
FT                   GIEFKLKTKVLSAEVKSGKVNLTIEEEGKSSVITSDVVLMAVGRKAYTQNLGLEAVGIA
FT                   TDKQGRIEINEHFQTVVPNIYAVGDAVKGAMLAHKAEEEAIAAAEIMAGQAGHVNYNLI
FT                   PSVIYTSPEVASVGETEEQLKEKGVSYKVGKFPFLANSRARAVGKTEGMVKILADSKTD
FT                   KVLGAHIIGADAGTLIAELTAYMEFGAAAEDIARTCHAHPTLSEAIREAALGVDKRTIN
FT                   I"
FT   gene            610011..611972
FT                   /locus_tag="A1I_03310"
FT   CDS_pept        610011..611972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03310"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79023"
FT                   /protein_id="ABV79023.1"
FT                   /translation="MKIIKKLSIVILLLLVASFKVFAEPDNNIEQVFLYMDQKNWSQAE
FT                   QLAKELNNKALTKIVVSQRFLDSDYPNNSFEQVIKFLCDNPNWSQGRLLEEKAERYLNN
FT                   NTNKKTIFEWFSKHPPLTGKGYKYYALAASSLVNDQKILLPIIKDAWIYADFSPEEESA
FT                   YYSRWKKYLTTNDHLERIEEHLWKSDIRSAEQSLKYVDRNYQNSFRTQIAIINKSPNAE
FT                   KLFRKVPEKYYTSGLLYRYLDSKKKQKPTGEIITLFKKAKNNRKHFAKWCRLQLYYARE
FT                   FINYKDFANSYKIASLPFATCPETIREQEWMAGWLSLSFLKKPDQALAHFNKFIKIVKT
FT                   PISLARGYYWLGRSYEAKGNKQTAKQFYEQAAKYSFTFYGQVANIELNKTNLVLPPVPI
FT                   VSNEERKSIENKGIIKAIRLLVKYDKNKLAVIYSKAAIKETKNPAEILVILDTIKACNN
FT                   THYMVDVAKVAAQNNIFIPNCAFPTPYNLAGLPIDPHLAYGIIRQESVFDHKAVSSANA
FT                   KGLMQLIDKTACETAKSISLKCSIADLTRNPAYNIKLGTHHFKQLLGDHRGSYILSIAS
FT                   YNAGSHNVAKWIDRFGDPRNIKDMRKVIDWMELIPYRETRDYVQRVLENIQIYRTILNK
FT                   NNTFKFKQDLHACDISKS"
FT   gene            612054..612248
FT                   /locus_tag="A1I_03315"
FT   CDS_pept        612054..612248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79024"
FT                   /protein_id="ABV79024.1"
FT                   /translation="MPKFFKKIEREVKRVRDQAIEVVKETRNELSKDIAFYKGKLSAIG
FT                   IGYDDEHANLKVPSSGEST"
FT   gene            612267..612788
FT                   /locus_tag="A1I_03320"
FT   CDS_pept        612267..612788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79025"
FT                   /protein_id="ABV79025.1"
FT                   /translation="MTSTTGSNSDQVEAFKKIIEVLEAKNNPDLYQKLVSELNANTKNA
FT                   LDDNIKQYNITVPTQQTNDRKVTLINGKEVEFKKFLELLYKENTKEFDLLLKMLPSETS
FT                   EIMKKEVTLKLAYDYFKGSKNFDDINTISERIGTSDIFEEYLGFNIDQFKSEEMNIMGG
FT                   DQYSYLDFSA"
FT   gene            613026..613985
FT                   /locus_tag="A1I_03325"
FT   CDS_pept        613026..613985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03325"
FT                   /product="Microcin C7 self-immunity protein"
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79026"
FT                   /protein_id="ABV79026.1"
FT                   /translation="MKLKNLISLILLFSSLSVFSQATIPQPLKNIPINVVAPASGADNK
FT                   TLSDLKNIKTLNLNMPTKCLSKGDLPFLASTDEIRFNCLKDALYNESSNIVWSLRGGYG
FT                   SARLIPDLLKLSKPNKEKFFIGYSDITALHLFLSQEWGWKTIHGTNVAGLLKPEQDQGN
FT                   FIKLAEILQGKVKQAVINDLAALNNVAKPTELVSGKLTGGNLTMVLSSIGTRWQIKTAG
FT                   KILFLEDINVAPYQLDRALIQLKQAGLLENIKAVIFGTFDKDSKLTMLVLRNFANNLKV
FT                   PVFKTDRFGHEKINDPIIYNTDSKIIGNGEKFKLIMDL"
FT   gene            614087..614359
FT                   /locus_tag="A1I_03330"
FT   CDS_pept        614087..614359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79027"
FT                   /protein_id="ABV79027.1"
FT                   /translation="MIAESHIETIKQVGANGQVSLGKKYAGKQIQVLTLIDGTIIIKPG
FT                   KFIPDNEMWLYNKNNNEIIDRAIKWAETNKRHENFDEIVDLVQND"
FT   gene            614352..614651
FT                   /locus_tag="A1I_03335"
FT   CDS_pept        614352..614651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79028"
FT                   /protein_id="ABV79028.1"
FT                   /translation="MTKILLDMNYPVFQEQLFSIEKQEQRALLITLKKIKQLEWEELYK
FT                   DKGIRWELITSKTTSKGNNVYSFRFSQKYRGTAYRDGNYLVLLALFPDHDGAYI"
FT   gene            complement(614915..617455)
FT                   /locus_tag="A1I_03340"
FT   CDS_pept        complement(614915..617455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03340"
FT                   /product="RecB family exonuclease"
FT                   /note="COG2887 RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79029"
FT                   /protein_id="ABV79029.1"
FT                   /translation="MDFKYAIFNIKTIFMISDISFLQDFAEFIVSKFGKENLRKELKII
FT                   LPNSLSCTKLKGLLTDNYNVQNLPIIIPFNAIISKKDSSEDYMSKMEELFTLSKIITEY
FT                   KKLDFTPEEALKAAGILNKLFADLVNNNVDIKLIETYNNSEYWQNIYKFLEYSFLKWQK
FT                   NEKQSSNNYKLKLLLEEIARTKNSCKQVILAGIFKPDSFLKKYEEELQIIKYNEIKLAH
FT                   NNIYYYEPTDIYEEAEQIAHICKQNADKKIAIVINNNKLKRIYCNYLDKYELVFEDLIG
FT                   NDLKLTNVSSLLIAIINILCNNFDLKLLFLLLKNPLINCTNIQELELLLSGKNRFISSP
FT                   KYLLQLQFDNEELKIYCYNLVDILFTTKPYNIKDILVLSKEIFEKILPDIWEKEGGAEL
FT                   SEFLNNLKEFSGSINVSKKDFPKIFALLLSNVKYYKNIESKIIIGSPEELALSRFDLVI
FT                   LPHFNSDNWSNTTTTHPYLSKEAKQILNIDYDEITPKLYSNYFDLLLQNEEVIILNAKK
FT                   YAGKLSTPCNLFLKLSNKNVIPNKSVIPQLDCGISGVIFLDSTTSTQDDIEQAAHSTFF
FT                   PNILSVTDIETLIRNPYGFYAKKILKLRTQDKIWEEPKISDFGNFIHKVLEEYSKNYDQ
FT                   QNMLDQQQALLNIGNNILHSTILPTYTKKTWQTKLTLLSKAFILFDMERRKNCQKIYFE
FT                   IKGELNLNIAGQNIKIIGIADRIEISKSNCITILDYKTGTIPTKKEIELGLSPQLIIES
FT                   LMILENGFNISHSYAPLCHSCESGNPIENITIAYVKITSTEPYVQTTEISLSMETLEKH
FT                   KQGLIRLLEYYVKNKSFVYDLDMSKYNDYLHLRG"
FT   gene            617528..618628
FT                   /locus_tag="A1I_03345"
FT   CDS_pept        617528..618628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03345"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79030"
FT                   /protein_id="ABV79030.1"
FT                   /translation="MTKIPDNIRQDAFKYVMENKPNELFELIAMNPGLINERSQGNQDT
FT                   LFMRACRYLHKDIIEILLNEQANPTDINNHGNNAIMCLFYREDQHKKPKDINEHDEKAV
FT                   AILKLFEEKNIPINCFTGQDADKDTPLIEAARAALPQSISFMLDYLEKKSLLRDQLLHT
FT                   NKDKKNVLQIALKAKFFNHELIQKTLVLLKPEEIIKIFIDVITKINSPTLEEKKELLSV
FT                   VEEYLPKLDTKQVKSLAKKIFQKNLYNVSCGSDSTFHQENLQKEYASGNFGVKIFNSID
FT                   VELIELLYVAGGINLNEYKEFIESLYSTQDPYKNGFCSAVTLESNKQKMLKVINGSHTL
FT                   STLVQNPQKLEYEARSVVDIKDLALA"
FT   gene            complement(619349..619960)
FT                   /locus_tag="A1I_03350"
FT   CDS_pept        complement(619349..619960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79031"
FT                   /protein_id="ABV79031.1"
FT                   /translation="MKSKFSASILSLNSYTQNPVINEIKKLAEELKVRSEVRSAYKIAP
FT                   TKFSMDETYNQILYALQTVKFAKAHIKEPNLGINETQELCKKLNDYGIIVTCLLAESVN
FT                   KSILSFLSFKKGNKILDFLSSYLLDNASEALKETMPKEFIDKYNMTNAVKLLSNEEIKS
FT                   YLKEYAGSNQQPISACRDTTTAIYEEENVETMGGDVAPAT"
FT   gene            complement(620107..622275)
FT                   /locus_tag="A1I_03355"
FT   CDS_pept        complement(620107..622275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79032"
FT                   /protein_id="ABV79032.1"
FT                   /translation="MKKSKSPTELKFNFITLDKDKVLKFVPALPIILQDNAWSKLSNMK
FT                   GSIEAGAEIIINILNFLSGNSSAVKKIPINTNKNMKFFVLKSLFNNYEYKNIQEHKALR
FT                   EVLRKYHPEQQSNGDITFLVNNAIYTEKFSKSIKTETDNFIESIFSQLEIMKMALECSI
FT                   ENNHYEVAEKLFTDIFSNARTNLDSIFSQQEYVNHKKYTTILFELVNKFMSVEYQIKTI
FT                   IDLTPHLKHYFNITAESTDILINNNHSNEAEELLTAALYNITIDDKPKNQDIGWCYYKL
FT                   GYLNHRNGQREYAVECYKNALDKLPATDKYIIQTINYNLWGIYSYYDADDNIEVLLNQM
FT                   PESSLKDLLKLGRNLTNITTSQLDNINRSDLQPEHTQMFDLYKYSALSIDQKSSKKTRF
FT                   TKDLNTIIKKNSDIDKLLALSVAIYTEQFDIARNILNTVPENEIEKCKKLNLSLLRSYL
FT                   DPDSIIYDADELKKEEKVEVLNAANTSLMAEDKSELVSKNVQKVLQNVEKVLEFHPQNE
FT                   ETLEIGINAALLNNDLEKAKKYANQLSKEKQEEIFIGDSEEAPEIHYLDRLLAQYDAKK
FT                   IHQYYQDKKEQQLHILSQKITHYTTSWNIPGKGQIKSTEATYIGKYKGQDCYSIIDDKV
FT                   KKSIGSLLPRFEKAMEKGIIHHQYGINGVKFIEEKVVEIKVRADKRLLASEIYENSGKE
FT                   LLINFDHEANHKEAEIFINGHHLEIYHE"
FT   gene            622554..623606
FT                   /locus_tag="A1I_03360"
FT   CDS_pept        622554..623606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03360"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79033"
FT                   /protein_id="ABV79033.1"
FT                   /translation="MFNQLSDEQKMLKKLALLSGIKPCTASSMLFSFPYSQQKLIDAST
FT                   QKLFDLFGKLRNTDRLKFLIEEAIDRGIDIDVQDKDGFTLLHKSINERDYNIAGFLLER
FT                   KANPNIHDRDIVTPLNRIAGKPLSKTEEDFHMAKLLLQKGALTEPTDFSGWTPIQYAVF
FT                   NEKIGIVELLIDYGANLDIIVPKGFYKGKNLIELVRAISSIFSDQSLNKQLQTLLKLAT
FT                   ACQNNDFGLVDYSVKKENSDTEDDSVTKEDIEKFINHKISIKPSVKLLPKYLKELIRLK
FT                   GFLETKEEFIKDNTIKRLEDNINSKSSLKYLLLSKIVESPSLYKFDVGMPEVLKESLEE
FT                   HGLKLVGDID"
FT   gene            complement(623876..625528)
FT                   /gene="groEL"
FT                   /locus_tag="A1I_03365"
FT   CDS_pept        complement(623876..625528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="A1I_03365"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459 Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79034"
FT                   /db_xref="GOA:A8GW07"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW07"
FT                   /protein_id="ABV79034.1"
FT                   /translation="MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFG
FT                   APKITKDGVTVAKSIELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGN
FT                   KLVAAGYNPMDLKRGMDLAVNTVLEEVKKASKKIDSQEEIAQVGTISSNGDKEIGEKIA
FT                   KAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPYILL
FT                   FEKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGF
FT                   GDRRKAMMEDIAILTNGELITEDLGMKLENVSLKSLGHAKRVTISKENTVIVDGSGDKK
FT                   NIEERVLQIKSHIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDA
FT                   LAATRAAVEEGVVAGGGVTLLHASQALKNLKVDNKDQQAGIELVIEALKDPIKQIVENA
FT                   GENGGVVVGKLLEHKDKNFGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIIT
FT                   TETLIVDEPEDKENPMPMRGGMGGMGGMGGMDF"
FT   gene            complement(625555..625842)
FT                   /gene="groES"
FT                   /locus_tag="A1I_03370"
FT   CDS_pept        complement(625555..625842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="A1I_03370"
FT                   /product="co-chaperonin GroES"
FT                   /note="COG0234 Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79035"
FT                   /db_xref="GOA:A8GW08"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW08"
FT                   /protein_id="ABV79035.1"
FT                   /translation="MSFKPLYDRIAIKPIEHEEKTKGGIIIPDTAKEKPMQGEVVAVGK
FT                   GVRNEKGEVHPLELKVGDKVLYGKWAGTEIKVKGEDLIVMKESDVFGIIN"
FT   gene            626204..626626
FT                   /locus_tag="A1I_03375"
FT   CDS_pept        626204..626626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03375"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79036"
FT                   /protein_id="ABV79036.1"
FT                   /translation="MFQKVIKHLSHNLSKHDITAKITGRIKHPVSILYKLYRKGIKIEQ
FT                   LTDIFAIRIVVLDEEKCYKTLKIVHNLYEYEKDKLKNYIDNPKPNGYQSLHTVIITEDQ
FT                   YRIEIQIRNENMHYHAESGGAAHWRYKSDLINALKF"
FT   gene            complement(626902..627345)
FT                   /locus_tag="A1I_03380"
FT   CDS_pept        complement(626902..627345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03380"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79037"
FT                   /protein_id="ABV79037.1"
FT                   /translation="MEDIDIWQNKFEACDYGKKLIDKIKELNITAKNPINIEEIEKGLY
FT                   YARKYHEGQMSQSGEPYYTHPIEVAIMLAEFAAHEAPKLYKSYMIIVALDTIEDTHLTH
FT                   EDISKIFDKDIADNVERLTRIKPHGKISSGEMLNLLIQEKNMI"
FT   gene            627881..628129
FT                   /locus_tag="A1I_03385"
FT   CDS_pept        627881..628129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79038"
FT                   /protein_id="ABV79038.1"
FT                   /translation="MPLHYMITAKWGKDQADWFVPLDITVRNNTELDVNSPAISFDISK
FT                   IANISGEVRAYTGFAQQTFTGPVIKGSLSEHMALLKA"
FT   gene            628723..629559
FT                   /locus_tag="A1I_03390"
FT   CDS_pept        628723..629559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03390"
FT                   /product="Putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79039"
FT                   /protein_id="ABV79039.1"
FT                   /translation="MYDGIDSQEYDGDVTISNYYKTYINNIRKNGGDVILSFGGASNEP
FT                   IEAPISDVKKIVDIYLKAIANYGLTLIDFEGGFLGHIDALDRHIAAITEVIKAKPDIKI
FT                   SYTLPVDVAPGLMGFNGNGTTFLKKLHDAGITPSLVNGMSMEFGQGSNANLFECARLSL
FT                   EGDAANDTDGSKKGAIKQLSEIWTNLTPKELYAMTGLCTMFGKHLNGKVNTVADQREIN
FT                   KYFVGDKGLGNVSGWDASIDSDPAKGGGGYNVGDYSKAVADYNPELLGSHVVADVH"
FT   gene            630066..630374
FT                   /locus_tag="A1I_03395"
FT   CDS_pept        630066..630374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79040"
FT                   /protein_id="ABV79040.1"
FT                   /translation="MSKKKELDNIETTAKDEIARDVRADENKSEEVVAPALRPETIAVI
FT                   EKELNSLTESEQVDDKPEAEKLADASIVIPSETGEEISSLQASDEVEALGCDVGVTE"
FT   gene            630574..630732
FT                   /locus_tag="A1I_03400"
FT   CDS_pept        630574..630732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79041"
FT                   /protein_id="ABV79041.1"
FT                   /translation="MSKYVPNKYNIKEKQDDENILGQLKDLEEETNEKYEVNIVGDIRV
FT                   RFPYPYQ"
FT   gene            complement(631865..632722)
FT                   /gene="prfB"
FT                   /locus_tag="A1I_03415"
FT   CDS_pept        complement(631865..632722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="A1I_03415"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79042"
FT                   /protein_id="ABV79042.1"
FT                   /translation="MAEAENDLEIMQQVEKDLQSLSTIAAKFETECLFSGEADSNNCFL
FT                   EINAGAGGTESHDWASIMMRMYLRFAERLGFKTEIINMINGEEAGIKSCTIRIIGRRAY
FT                   GWLKTEAGVHRLVRISPFNAAGKRMTSFASSWVYPEIDDNIAITIEDKDLRIDTFRASG
FT                   AGGQHVNTTDSAVRITHIPTGTVTQCQSDRSQHKNKAQAMKMLQAKLYELEMQKRTDSV
FT                   NEQNAAKTDNSWGHQIRSYVLQPYQMVKDLRTDYETSDTKGVLDGDLEEFVSASLAMNA
FT                   GSKK"
FT   gene            633232..635034
FT                   /locus_tag="A1I_03420"
FT   CDS_pept        633232..635034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03420"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79043"
FT                   /db_xref="GOA:A8GW16"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW16"
FT                   /protein_id="ABV79043.1"
FT                   /translation="MNNQKYIRNFSIIAHIDHGKSTLADRLIEYCGGLQAREMSQQVLD
FT                   SMDIEKERGITIKAQTVRLVYKAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYQAIENDHEIVPVLNKIDLPASEPDQVKQQIEDIIGIDASEAVL
FT                   ISAKSGIGIDLVLEAIVNKLPPPKESSTDILKALLVDSWYDPYLGVVILVRVIDGSLRK
FT                   NMKVKMMATNSVYTIENVGYFTPKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEK
FT                   KPCKQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMREGEVLEIHNPADLPDLQKI
FT                   DSMEEPWIKATIMVPDEFLGAVLSLCTEKRGIQLDHNYIANRAKVVYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDTYEPSELVKLGILVNSEVVDALSTIVHRSRAEQRGRALCVR
FT                   LKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDITRKRKLLEKQKAGKK
FT                   RMRQYGNIEIPQSAFIAALKIGDE"
FT   gene            complement(635246..636346)
FT                   /locus_tag="A1I_03425"
FT   CDS_pept        complement(635246..636346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03425"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79044"
FT                   /protein_id="ABV79044.1"
FT                   /translation="MKKSSSLALGNFFKTKKQILKADIQKLIKTNQINYVDPKHGTALN
FT                   RAIKLKDEKIITELLAKKVDINEAIYFAIGHEYTLEEIKTLISLSSSELPDEYLYKAVH
FT                   QGRLDLVQYFIEEKNFDVNTTINNPLHGGAILSIATMGEHIDVINYLLKNGAIASQGII
FT                   SAILKGNIEILEKLFEYGATAHDGYSEDLVALLVNAAIPANDPTYCKSSNSETKEDLSN
FT                   YVETLKFLLEHGGNPNAEFLERGTVILIALSALMDEPKNDTYKDICKLLIQYGADTSKF
FT                   KSYTETINNLKKEIIEDMKVVDKSDFKDEGYVSDSAEADQLSKKGSKLVDTSSKSVFFS
FT                   LEEIIEKNPTTLGGETDIVKSEFFNS"
FT   gene            complement(636444..639770)
FT                   /gene="ileS"
FT                   /locus_tag="A1I_03430"
FT   CDS_pept        complement(636444..639770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="A1I_03430"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG0060 Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79045"
FT                   /db_xref="GOA:A8GW18"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW18"
FT                   /protein_id="ABV79045.1"
FT                   /translation="MTNTKYYPEVSSNADFATIEKEILKFWQDNNIFQKSIDIREGDAE
FT                   FIFYDGPPFANGLPHYGHLLTGFIKDVYARYQTVRGKKVERRFGWDCHGLPAEMQSEKE
FT                   LGISGHLAITNFGIEKFNAHCRDSVMKYAGEWEQYVTRQARWVDFKNSYKTMDKNFMES
FT                   VLWAFKELYNKGLLYESMRVMPYSWACETPLSNFETRLDNSYRERADKAVTVSFVLCHP
FT                   VSKSTLDVIPWLDHGIQKTINNDSANCSMDPVDKPRYDTENFLGITANYKEYRILAWTT
FT                   TTWTLPSNLALAVGSDIDYALVPKGDVCYIIAASSVSKYAKELELKGDEQFTIIKGSEL
FT                   QGLSYKPLFDYFKNHPNSFKIFAGDFVVEGDGTGVVHMAPGFGEDDQILCESKGIKLVC
FT                   PVDNSGKFTKEIPDLEGLQVFDANDKIIIKLKEQGNWLKTEQYIHNYPHCWRTDTPLIY
FT                   KAVPSWYVKVTEFKDRMVELNQQINWIPTHVKDNLFGKWLENARDWSISRNRFWGTPLP
FT                   VWKSDDPKYPRIDVYGSIEELEKDFGVKITDLHRPFIDELTRANPDDPTGKSTMRRIED
FT                   VFDCWFESGSMPYGQAHYPFENKQWFEEHFPADFIVEYSAQTRGWFYTLMVLSTALFDR
FT                   PPFLNCICHGVILDATGQKLSKRLNNYADPLELFDKYGSDALRVTMLSSNVVKGQELLI
FT                   DKDGKMVFDTLRLFIKPIWNAYHFFTMYANADHIKGELNFTSENVLDVYILSKLKIAVE
FT                   KIKESLDSFDTGTAYHAVSEFFEVLNNWYIRRSRARFWKSEKDADKQSAYNTLYTCLET
FT                   MAIAMSSLVPLISEAIYLGLYCHPRKSGDPEKPECLDSRLCGNDNLSVHLCDYPDLSKF
FT                   KINSELVDTMDTVLDICNHSLFIRSSENARVRQPLSSITIISKNNDKLKSFEDLIKDEI
FT                   NVKSVIYRDDLENYAVKKLSINFPLLGKRLPAKMKDIIAASKKNEWEVTSGSLIICNET
FT                   LNSDEYKLILEPHSHIKGASSFAHNSSLLILDLELTPELIDEGIARDIVRFIQQARKNA
FT                   DFAITDRILIDINLPKITDIYGEFIKEQTLGKFAKDFIPDHISEIELDNHKLQLKIKKV
FT                   N"
FT   gene            640048..640713
FT                   /locus_tag="A1I_03435"
FT   CDS_pept        640048..640713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03435"
FT                   /product="Putative integral membrane protein"
FT                   /note="COG1738 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79046"
FT                   /protein_id="ABV79046.1"
FT                   /translation="MTNSEKIYIGLCIIFSTLIILGNLIYQKFVMLQIPFYKFELSAGA
FT                   ILYPLTFLITDIITELYGKEKANFCIRLAICMNVLVTIIIMFVSYLPATDWSKINDETF
FT                   NKVFSYYSVAFLASIIACYIAQAIDVNLYLWIRKLTEGKYLWLRSNVSTCISLFIDTTI
FT                   VISFMAMFSIFPVEQIWKLIINSYSWKLFFTICCTPLVYLSLFILKYFIKFDMSTWKK"
FT   gene            640861..641091
FT                   /locus_tag="A1I_03440"
FT   CDS_pept        640861..641091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79047"
FT                   /protein_id="ABV79047.1"
FT                   /translation="MYINTLTITSKGQIVLPKKARDILNSTVIAVEVNDNHQVILSPVL
FT                   DVGGVFAKYKKNTEASFEEIRDKAWRENVRK"
FT   gene            641093..641485
FT                   /locus_tag="A1I_03445"
FT   CDS_pept        641093..641485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03445"
FT                   /product="hypothetical protein"
FT                   /note="COG5611 Predicted nucleic-acid-binding protein,
FT                   contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79048"
FT                   /protein_id="ABV79048.1"
FT                   /translation="MKYICDTNFIVRYLVANDQNMFDKAKEIFEKVKTGQIILILEQTT
FT                   FTEIVFVLSSVYKVSRSEIFTNLSGLLAYKGIHCGKEYYLAALEYYSRHNIHIVDCILL
FT                   AKAKFLNIPLLTFDQKLLNLFNKNDN"
FT   gene            complement(641491..642546)
FT                   /locus_tag="A1I_03450"
FT   CDS_pept        complement(641491..642546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03450"
FT                   /product="Permease PerM-like protein"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79049"
FT                   /protein_id="ABV79049.1"
FT                   /translation="MNKTAIFWLLFIGIFISGFMLISEAIRPFFIAFIISYLLQPAIEF
FT                   VASKFKLSNKISSIVVYLIFLSIFFTALTLLVPVIYGQVSTFVNNIPKYKDYFQAEILP
FT                   PIMTKIYAVEPNIADKIRDSLSNFINSIFTILGSLANNFWHYTLITINIFVLFLLIPII
FT                   LFYFLRDWTRIIENMKSLLPLKSRHKILGILSSINSLLAAYIRGQLNICLLLSIYYSIS
FT                   FSIIGIDLALLLGILTGFLVIIPFIGTFISCFLTLTIGYLTFGATTQLFYIMVVYIIGN
FT                   ICESYILTPKIIGDKIGLHPLWIIFSIFACGSLFGFIGIFFAIPIAGVTKILLFNIIKF
FT                   YKSSRFYRLEG"
FT   gene            complement(642543..642686)
FT                   /locus_tag="A1I_03455"
FT   CDS_pept        complement(642543..642686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79050"
FT                   /protein_id="ABV79050.1"
FT                   /translation="MNLKNWHRRLCKSSDAYVLSIRCALRLTVRLLFSKLIFVYRYFGV
FT                   KI"
FT   gene            complement(642696..643226)
FT                   /locus_tag="A1I_03460"
FT   CDS_pept        complement(642696..643226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03460"
FT                   /product="GrpE protein"
FT                   /note="COG0576 Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79051"
FT                   /db_xref="GOA:A8GW24"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW24"
FT                   /protein_id="ABV79051.1"
FT                   /translation="MTDNNIENKEEEIINDIAEEVENTEIADLKAQIEELKDKLIRASA
FT                   EIDNTRKRLEKARDEARDYAITTFAKELLNVSDNLSRALEHKPLDASVEVTNIIAGVQM
FT                   TKDELDKVFHKHHIEEIKPEIGSTFDYNLHNAISQIEHPDHEPNSVINIMQVGYRIKDR
FT                   LLRPATVQVTKKT"
FT   gene            643375..644094
FT                   /gene="rph"
FT                   /locus_tag="A1I_03465"
FT   CDS_pept        643375..644094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="A1I_03465"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COG0689 RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79052"
FT                   /db_xref="GOA:A8GW25"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW25"
FT                   /protein_id="ABV79052.1"
FT                   /translation="MRQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSASYDT
FT                   TVPPFLRNQNRGWITAEYSMLPGSTSQRNKREAVQGKQSGRTQEIQRLIGRTMRSIIDL
FT                   QKLGERQITIDCDVINADGGTRTAAITGSYVALHLAIRSLMKERILKVNPLINQVAAVS
FT                   CGIYKDQPILDLDYLEDSDAEVDSNFVFAGNGNLIEIQGTAEKKPFSEEQFLEMLKLAK
FT                   AGVAELFKLQNQVLLNL"
FT   gene            644094..644843
FT                   /locus_tag="A1I_03470"
FT   CDS_pept        644094..644843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03470"
FT                   /product="Hemolysin A"
FT                   /note="COG1189 Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79053"
FT                   /protein_id="ABV79053.1"
FT                   /translation="MTKIRLDEFLLQKGFAPNIQVAQSLIMQGKVHNKHEQLTKAGTQV
FT                   NINDTDIKVKLPKHNYVSRGALKLIKALDHFKINPSGMVCIDLGSSTGGFTEVLLEQGA
FT                   ELVFAVDIGYGELHHRLRDNPQIIVLEKTNARYLTEKQITIQPDLIVCDASFISLTTIL
FT                   PASFALAKKDCLLIALIKPQFEVEKHEVEEGGIIKNPLLHQKVCNKIKAWLEEEHNFEI
FT                   FGIVESPILGAKGNKEFLIVGQRKKTL"
FT   gene            complement(644840..645289)
FT                   /locus_tag="A1I_03475"
FT   CDS_pept        complement(644840..645289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03475"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79054"
FT                   /protein_id="ABV79054.1"
FT                   /translation="MFFCIFKIKNKIFMQLTSFTDYGLRSLIYLASKQGEICSIKEIAE
FT                   YYNISLNHLVKVIHKLAQLGYISSSKGKGGGIRLASPPSSIKLGDIIEKLEPNMDIVEC
FT                   FNKDTNRCRITNSCQFKHFIKEASNAFIKTLNNYTLEDAINNKLI"
FT   gene            645368..646609
FT                   /locus_tag="A1I_03480"
FT   CDS_pept        645368..646609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03480"
FT                   /product="hypothetical protein"
FT                   /note="COG1017 Hemoglobin-like flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79055"
FT                   /protein_id="ABV79055.1"
FT                   /translation="MSQNLISLLKNCPTQYTKKFYDILFSENPELLSVFNKTNQENGMQ
FT                   SEALAEFIRLWANTIENYSEKFMNRMKEVAEKHVSLQIKAEDYPKVGKALIKAIGSVYN
FT                   LTEEETNLLLESYKKLSGLFIEIESNRYNQIQESGGWEDYKEFIIAEKTLANIQGDTIS
FT                   LTLKTVNGEKVLPHKPEQYITMQVNGVQRHFTITDSGEDYYKLLIKVKEVTDNNSFSVT
FT                   QYLRDAEMNTIVGLRPPCGIPFKLDNVIPLVLISGGSGESNSIAVMQAIKESIKNGQSD
FT                   KLPSSIHIIHSTQGENSDTHQLDLPVEQLRDLGLKVSYDKYYTQDSYSKNNTIHIGRIN
FT                   EKSLNSILDNHNNNYEICASLSFSANLQQILKGWGVAEDNIHIEGFGPSQEVFDSYLIG
FT                   QDNPGSSVCSFAHE"
FT   gene            646705..647247
FT                   /locus_tag="A1I_03485"
FT   CDS_pept        646705..647247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03485"
FT                   /product="hypothetical protein"
FT                   /note="COG0779 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79056"
FT                   /db_xref="GOA:A8GW29"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW29"
FT                   /protein_id="ABV79056.1"
FT                   /translation="MGYPAFFVIKLIMQTIEQQITDLIQETLSDMGFELVLVRVKGLSS
FT                   KVVEILIDRLDDQKVTIEDCTKASNTISAILDVEDLIEEAYYLEVSSSGVERPLVKFEN
FT                   YKRFIGREVKIKLKELLNGRSRYQGTIIEAKDDKVYLKWEDQEVIINYDLIKSANLVLT
FT                   EEMFKKLLGSENKSNTR"
FT   gene            647256..648758
FT                   /gene="nusA"
FT                   /locus_tag="A1I_03490"
FT   CDS_pept        647256..648758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="A1I_03490"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79057"
FT                   /protein_id="ABV79057.1"
FT                   /translation="MSNIGNIEILQIIDSVAREKGISKEVLISTVEQAVQVAGRKKYGN
FT                   EYNIKAQINRKTGEINLLRVLKVVENVEDYLTQISITEALQKDPEAKIDGEIYEYLPSI
FT                   DHARVAAQAAKQVITQRIIEAEREKQYHDFKDRKGEVINGVVKRIEYGDIIVDLNRAEA
FT                   IIKREQQIKGENFKVGDRVKAYVQDVRHETKGPQIFLSRADDRMLAKLFELEVTEIYEG
FT                   GIEIKAVARDPGSKAKIAVFASENGIDPIGSCVGIKGNRVRAITNELNGEKIDIILWNR
FT                   DVAQFIINALAPAEILKILIDEDKRKVEVVVSQENQSLAIGRRGQNVRLAAKLTGWNID
FT                   IMTEEQESKRRNEEFVTSTELFMEALDVEEVIGQLLSVSGFNTVEQIVNSDINALMNIE
FT                   GFEEELAVEIRNRAINYVNLRNEKIVKELEELGVEQELIDILEIQPELILKFAEYGIKT
FT                   IEDLGEMSVNEFKNLAPNSNITDENIKLLIKTAKQHSELKEE"
FT   gene            648987..651473
FT                   /gene="infB"
FT                   /locus_tag="A1I_03495"
FT   CDS_pept        648987..651473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="A1I_03495"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79058"
FT                   /db_xref="GOA:A8GW31"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW31"
FT                   /protein_id="ABV79058.1"
FT                   /translation="MTDNQENKPKKLTLSNTKLSLNKSFDSLASTQSFVNAKSKTLVEV
FT                   RKSYSGSTTTLSLNKEKGSLETGSSSGSEEFNRRLSILKKAAEQSKLNDNSQISTLSKL
FT                   ASINQSIASQEDPIEVEQEESSDTNKVKEEPKIEEVKDIEESTLQTPKKKEDIFVKSPL
FT                   VGTRTRYGIESEKTVDKVTENKVIAPKPKVEESRKFKKTDLFNMVGDDENDNRNRTRSL
FT                   ASIKRAREKEKRKSLVQVPEKVYREITLPEVIGVGDFANAMSERVSDVIKELMKLGILA
FT                   NASQTIDADTAELVATHLGHAVKRVQESDVENILITNDKEEDLRSRAPVVTVMGHVDHG
FT                   KTSLLDALKSTDVASGETGGITQHIGAYRVTLADGRAITFIDTPGHEAFSEMRSRGAGV
FT                   TDIVIIVVAADDGIKPQTVEAINHAKAANVPIIVAINKIDKPDIDIERIKNELYMYEII
FT                   GEEAGGDVMVIPISALKKINLDKLEEAILLIAEMQNLKASPFGSASGVVIESKIEKGRG
FT                   ALTTMLVQRGTLKSGDIIIAGTAYGKVKKMTNDKGIEVLEATPSVPIEIQGLSHVPHAG
FT                   DMFNVVQTEKQAKDIAEYRERVAKEKKISIAPRSSLEDLFLKASGSSKIKELPLIIKGD
FT                   VHGSVEAIAGSLLKLPNDEVKLRILHSGVGPITESDVSLAHASSAIIVGFNVRAGANAK
FT                   TAAEKEKVEIRYYSIIYDLLDDVKAIMSGMLDPIIREQYIGSVEIRQIFNITKIGKIAG
FT                   SYVTRGIIKKGAGVRLLRDNIVIHEGKLKTLKRFKEEVKEVREGYECGIAFENYEDIRE
FT                   GDTVEVFELIQEKKQL"
FT   gene            651831..653732
FT                   /gene="uvrC"
FT                   /locus_tag="A1I_03500"
FT   CDS_pept        651831..653732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="A1I_03500"
FT                   /product="excinuclease ABC subunit C"
FT                   /note="COG0322 Nuclease subunit of the excinuclease
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79059"
FT                   /protein_id="ABV79059.1"
FT                   /translation="MELTGNELIKSKLIDIPERSGVYRMFDANKQVIYVGKAKNLKKRL
FT                   TNYIKTDLDTKTLRMVANTCSLEYSITNSEVEALLLEAQLIKKFQPKFNILLKDDKSFP
FT                   FIKLRLDHDFPQLLKYRGRALNDGKFFGPFASATEVNTTLSELQKIFKLRSCTDNYFNS
FT                   RTRPCLQYEIKRCYAPCVGKINKKDYAELVGQVKDFLQGRSKELQENLSKKMEELSEQM
FT                   RFEEAAEIRDRIKALSYVQLKAGITDIVKDADIIAIVEKNGHYCVEVFLYRIGQACGNI
FT                   PYFPTSTENSTKEEVLKHFLLQFYQKQQVPPGIIINHEIDDKDNIIEAIRNINDFAKLS
FT                   ITIPASGGKLKLVQNAQENALFSLEQYLKKFAKNQELMFEVKELFNLPEIPERIEVYDN
FT                   SHIQGKFAVGVMIVAGKSGFDKKEYRVFSLSSRDSITGSSKSTNNDSISCFLDTVDKPR
FT                   YDTKGDDYEMLRQVLTRRLTRLKQEPHRLPSLMIIDGGKGHLGIVKEVMNKLQMDIPFV
FT                   CMSKGPDRNAGLEQFHMVGREVFTLNKNLPLMKYLQILRDEAHNFAIKNHRLSRSRAIK
FT                   VSSLDEIEGIGDTRKKALLHYFGSYKAVSDATLDELSKVKGISKSLAKMIFNALHKN"
FT   gene            complement(653737..653925)
FT                   /locus_tag="A1I_03505"
FT   CDS_pept        complement(653737..653925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79060"
FT                   /protein_id="ABV79060.1"
FT                   /translation="MSKKPNNKDDDFLSPEELAFAEEYDKHHDNTVVDTNDDAQAWAKK
FT                   LLGESNNTTTNNPTDKA"
FT   gene            complement(653930..655450)
FT                   /locus_tag="A1I_03510"
FT   CDS_pept        complement(653930..655450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79061"
FT                   /protein_id="ABV79061.1"
FT                   /translation="MKDKPNEAWEVTGVDTLSKARDLNNTRTDPEIPTIIKNSENHPRT
FT                   TAEHIILTGTTDLTSVASLPATHMAKYASLAIINTNLQIEKEADLKPTFEKLYSYVLDY
FT                   SSSREFKEKVNEVNLNSKSQAEALSSKVINNTDTAILNKEEKEAKNLYEAIKENYHKLP
FT                   ESSRSKTPEQYLEKILFDKIKMKALEDTIISDLEPKLVKESENQGFKKLTEHSKDRTTY
FT                   CFYGAPASGKGTSVAMRRKEAIEQGKNWSDIVKINTDSHRDFIIDDRLTTSKIENKSPL
FT                   NHAEAGFISNMSYRLYEKKVNDNKAPDMLVDTIMPNQYILDMAVKNGGKALIDVISIPA
FT                   EKCVERAYERGKEEGRLVPREYNINANINVPKNFHDIMSKYTGKNIEYKIVDNDVERGK
FT                   KPILIEQGNLKEKKVEIHDKTRLDEFLRKQNLNPKAQNPQELYSEDYSQKTPTYKFNDS
FT                   NLGIKVSYTKVSDEAQMIKEQLRTRSTSDGLTDSNKNVTVKKNNQIGR"
FT   gene            655679..657493
FT                   /locus_tag="A1I_03515"
FT   CDS_pept        655679..657493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03515"
FT                   /product="hypothetical protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79062"
FT                   /protein_id="ABV79062.1"
FT                   /translation="MIIFNFKDKFSYSHLLEVLKENNPNIVGLDIRGNFTPKQFIELFE
FT                   TLKENNTVKKLILRGKAYKCDLDNKDIYSGLSSLLQNNKTIEELTLYHTDIQDNGIKSI
FT                   ASALEENNSLKYLKICGHYLKATGEIALLKMLAKNTSLETFAIDYISETAKLALFAQPK
FT                   YFALKNLDITNNDSGLTFFVDISNYENLVNTSFIKKINPNPIAFAIEQKELQINKLAVL
FT                   LENENFSQAFIKATTDFYYNNFLVKEKELAAKYASLDKQKSNYENATHEVLKEYNNLQL
FT                   SNNKFFTVVEKAISAGEIEAKQTKAEIFVPKPKIEERELVVEEKEPAIEEEIKLEKAVV
FT                   KKLDIDNGLKPAEYITEWTNKIVEMDYDTVILSIGSGKVLNQQIPPFSNGLGQVAILNI
FT                   DTFFSNDEIENVSNSNKISVNYLSAQIENIERYNIRARTEEQKELLIGQEKLADSIYRL
FT                   IDGGKKVILLSHISPLAPRIHFEKVLKNKDIMNGYGDKFLFINSYFDDMPTILCRKGSI
FT                   NSIMSPNMKAKSVMNKYIYTGKAYPKGEELEDVVVYDRITSCYDICKISFSAGNKKIAM
FT                   PEGMVYSGLSEVTAEDVIHLMGHESIVI"
FT   gene            complement(657723..657980)
FT                   /locus_tag="A1I_03520"
FT   CDS_pept        complement(657723..657980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03520"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3328 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79063"
FT                   /protein_id="ABV79063.1"
FT                   /translation="MLFRKRLEGSFILPILPSSVNRQIRKIIKNNGFFPDDKSITKIVF
FT                   LTLKNAAKKWTMPIREWSLALNQFEILCGDFKYQLLENEF"
FT   gene            complement(658019..658480)
FT                   /locus_tag="A1I_03525"
FT   CDS_pept        complement(658019..658480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03525"
FT                   /product="Leucine-rich repeat protein"
FT                   /note="COG2521 Predicted archaeal methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79064"
FT                   /protein_id="ABV79064.1"
FT                   /translation="MKELLEFLEKKFNDENEIDILQHNNFELSLRNKYLDDEFFKELAV
FT                   LLKFAPNIIHLNFEGNNMTHEGLKALLDGVKDHKLTSLNIGWSRGLESNSGKLIAELIQ
FT                   TSKTLTHLNLSCNNSKEAEIKLILEAVKIDNSVLHLVLCGNNIGTTGYI"
FT   gene            complement(658498..658899)
FT                   /locus_tag="A1I_03530"
FT   CDS_pept        complement(658498..658899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79065"
FT                   /protein_id="ABV79065.1"
FT                   /translation="MDNIQLQVEEIKKQTKNFELSQATSDIPNKSITEIKEIIEKNNDI
FT                   KLGDKEIILSQIDNISSKLLILKAETEAQQIIDAMRQYINNKSSMVKRWLLEADEYLDQ
FT                   KLESQAALNEATLIGLTHPNPAGDEIPYN"
FT   gene            complement(658794..659897)
FT                   /locus_tag="A1I_03535"
FT   CDS_pept        complement(658794..659897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03535"
FT                   /product="tetratricopeptide repeat/protein kinase domain
FT                   protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79066"
FT                   /protein_id="ABV79066.1"
FT                   /translation="MKNSSPNQNNNSVINEANYYFQEGNSFYFLGSPEKAIEAYTQVIK
FT                   LNPNCANAYYNRGIVHSSMYSHSQGHALQGYDDFKKVIEINPNDAEAYFHDGNRSLAVL
FT                   GRRPEAYMATLEAYNYAIKLNPNFADAYYNRYKILLTLNNPTEAIIDGKKAVELKSIGV
FT                   NGIPLKDLHTFKAPGQLIYNYNIRLKMEDADIYSSPLEKNQKTLEIYNQNIKDNYYNKG
FT                   KLLNSIGYEEEAFNSFLKGFEINQTINNNEIVQNQEILLKKLTTPHAITKDIQNILDNS
FT                   NQDMPKVKEIIYFLQELKKLKLVLPSKFLKIWKNKRNKTYLVKLILIYLVTRWIIYNCK
FT                   LKKLKNKLRTLSYHKRPRIFQINLLQR"
FT   gene            660232..660879
FT                   /locus_tag="A1I_03540"
FT   CDS_pept        660232..660879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03540"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="COG3177 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79067"
FT                   /protein_id="ABV79067.1"
FT                   /translation="MDIKNSSSGKVVKALTGYYSFIPNPLPPKLEWNNELAVSLSKANH
FT                   VLGMLMRESLQLPNPHLLMRPFIMREAVLSSKIEGTRTTLSEMLAKDIDIYIDRNPDDL
FT                   IEVQNYILALDYGLERIKELPLSLRLIKELHAKLMNSARGEYAIPGEFRKSQNWIGSPG
FT                   CTLNTAKYVPPHPEELMNCLDSFEKFLYDRMMPSLIHIVQYVITNLKLFIHF"
FT   gene            661089..661346
FT                   /locus_tag="A1I_03545"
FT   CDS_pept        661089..661346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03545"
FT                   /product="hypothetical protein"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79068"
FT                   /protein_id="ABV79068.1"
FT                   /translation="MSRAERINALIVKWQIKVGSNRSNSVDQEIIKNLAVTPFCTINNI
FT                   SKKFSVAFTTAQRAINKLEKLGIILQTSTGKTRFRRSVTS"
FT   gene            661333..661479
FT                   /locus_tag="A1I_03550"
FT   CDS_pept        661333..661479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79069"
FT                   /protein_id="ABV79069.1"
FT                   /translation="MSRAERINALIVKWQIKVGSNRSNSVDQEIIKNLAARSLPEVVEA
FT                   MPV"
FT   gene            661712..663652
FT                   /locus_tag="A1I_03555"
FT   CDS_pept        661712..663652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03555"
FT                   /product="hypothetical protein"
FT                   /note="COG1413 FOG: HEAT repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79070"
FT                   /protein_id="ABV79070.1"
FT                   /translation="MPVEEAYKEIVELLKSSDNYVKSAAARSLPEVVEAMPVEEAYKEL
FT                   VELLKSSDSDVKHAAASSLPAVLKAMPVEEAYKELVELLKSSNDNIWYVAAISLPAVLK
FT                   AISVNKTSYKTINELLKIIHLAKIQILNDLHIEAKATLKKITDYITQKYEKSQNCEIIE
FT                   GFNNSFQELPNISETRIFLKEICKSILKSGTINKLENNFILKCIQEYGFTFTVSIYREQ
FT                   QTDTNKIIEGKIIFEDRSYEIFRNDVKQNNNEIVSLEEFSNLLLEQTNDSLAKQYRNNK
FT                   PLFQNTGSALKIAACDFKKNSIANNTELHNDKWQLSLMHLSNHKKELPSKVFILLERKS
FT                   AFGEHVICKIYIEGDKLQKIHYLLYPQSIDTEVCKKIFGEMEYIDSKPRYYSSVFEINM
FT                   ETGKQLIQILENQEVIGKAEYDILRDLLKQIGIDAKQFDYVWKEYIECKNVREVKKDEL
FT                   LKVDEILVRRDSKEIERLEIIHVHSKEIENIKNELNNTVKELEDKIENMSMTTKEARMV
FT                   NAELDSLKSYICDLKKSHDTKIISEITEYMKELLKDREFTTKMLLGLNKKVKNLEAKHD
FT                   TKALILNEIVYDNTMLNYPKLLQKVIDIYGFNQAISLSSKLSQELIQEAISNNNSELIL
FT                   AGVVSLEINLL"
FT   gene            663678..665543
FT                   /locus_tag="A1I_03560"
FT   CDS_pept        663678..665543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03560"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79071"
FT                   /protein_id="ABV79071.1"
FT                   /translation="MKSNNQKELKKLQEELEVSEFGIEMDEEDASAYFKKASVLVKMFR
FT                   LTDNNEYITEARRCYDKSVELAPEDKIYLTDRSKFFVSIGENSLAVDDIRKLKNLPVDS
FT                   NYVLETYIQNTIDDITRLDTIQTTITKLLGEEKIDKDLADALIAHTDITARLVVQVGTH
FT                   SNVLANLSNEIIELKDLIAKLYKGEKDSKKEIKKLKQKTANFEIQLKINTTIIQDHKKI
FT                   LENSDLIDEFQTREDLKKIQNPELQAYCKTFYWSMVNLFNAYKILSNDLIKGNIYKNEP
FT                   IANKLLIGAAEKTLKLGGTIAAHGIPLLGGIVAFTAETTAEIIESIYEAVKSNEFYNEV
FT                   NSINLVIQDKFQLLDNMNLKLVKLALSITQIKEDAILHPQKSNPTKLQARLEWFQDKVG
FT                   SIKNKLLPSTELYNKDNYSVQLALQDVTLLMLYLHKNHKAIIQENTPLEEQLETIVTQG
FT                   GLDKLLIDVQENDKFIEIEQRIGQKVLDSIHIKAGEGNWDSTSHIPFNNKGIKKYLEES
FT                   YIKSHFKVESQGDIENIRICIFKHICIGIAANKSKQNLECAKKFSKTYETLIEKIANLF
FT                   PQLFLDTSIAEICINDDGLKAQVMQVFANSEDFHYTEIGSVSVTF"
FT   gene            complement(665845..666804)
FT                   /locus_tag="A1I_03565"
FT   CDS_pept        complement(665845..666804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03565"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3328 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79072"
FT                   /protein_id="ABV79072.1"
FT                   /translation="MPRDRKADFTPILVPKRVSRIEGIDDKILSFYAKGMSLSDIKLQL
FT                   EELYGAEVSESLISRVTDNVMDEVRSWQNRPLESVYAIVYFDALIVKVRQDKRIINKSV
FT                   YVALDIDLQGKKDILGLWISENEGAKFWLANFTEMKNRGLKDILIACSDNLAGMSEAIS
FT                   AVYPQAEHQLCIVHQIRSSLQYVSYKDRKELATDLKLIYQAINEEEALSALADFDKKWS
FT                   KQYPHIAKSWQNNWHNLVIFLQYPEVIRRIIYTTNAIEGLNSQLRKVTNNKRIFPNDDS
FT                   VFKTLYLTINYITRKWNMPIQNWGEAMAHFLIKFDQRI"
FT   gene            complement(667142..667474)
FT                   /locus_tag="A1I_03570"
FT   CDS_pept        complement(667142..667474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03570"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3328 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79073"
FT                   /protein_id="ABV79073.1"
FT                   /translation="MFQQLKKRLVERILESKLDKELGYSRHSKVPKIDNNRRNGITEKT
FT                   IIDDSGQKITIEVPHDREGEFEPKLIPKGVRRFAGFEDTVISLYARGMTISEIQSTVLR
FT                   VKSKKH"
FT   gene            669140..670528
FT                   /locus_tag="A1I_03585"
FT   CDS_pept        669140..670528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79074"
FT                   /protein_id="ABV79074.1"
FT                   /translation="MSKDSDGKGNILNKEQKEKIILERLEYVEKDIKNLENFAAGQFAN
FT                   KVKANKKPIDVKDEEFQKELNATIETEKNQQSKIGGVNAVISLKATLTDLREYLVEKGV
FT                   LPAVSDGKDFEEFPAIKERINNYGKEFREKFSTNEKVNAAVKNRVEYEIINESLDFKEL
FT                   KNDQYIPLDKEANKMLINQISNEVKIPEELYEKIMKGNEQLRSKLTYQIIRPEVEKAFG
FT                   NPKFNFTQDGYDYEITTLDNSKLTPENITNFKNSLNDKLEKANDKLMATEKLMEKVKTQ
FT                   NPDLTNTQVEQFEKALSKLDTKDLTQHKDTLVNTINEVSKTKLGFAEKIYTMVTGKDQE
FT                   VYLNNKIDGILDKRLSSIISSQTPSVQSPSSQSANIKQVLNSPTSNFAKTKEMQKSVNR
FT                   ESSSQSADIKQVLSNPTRSFVKTKEMQKAINRGSMINTSSSISVPTTPYKSISNKSKQD
FT                   ERSR"
FT   gene            complement(671135..671698)
FT                   /locus_tag="A1I_03590"
FT   CDS_pept        complement(671135..671698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03590"
FT                   /product="Tryptophan repressor binding protein"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79075"
FT                   /protein_id="ABV79075.1"
FT                   /translation="MVKVAIVYYSGYGHTVKVAEEINKSVKEAGAETSLIQISKDKPDN
FT                   VDWSLLDNADAIIFGAPTYMGSLAVPFKTFMDSTSIKWNDKKWKDKIAAGFTNSASYSG
FT                   DKLCSIQQLFHLAMQHCMIWVGQAESAPQFADHEMPDHDKTNRLGSWSGLMTPSNHKSA
FT                   PDIAPYKGDLLTANLFGKRIVEVI"
FT   gene            672190..672378
FT                   /locus_tag="A1I_03595"
FT   CDS_pept        672190..672378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03595"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79076"
FT                   /protein_id="ABV79076.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            672384..673145
FT                   /locus_tag="A1I_03600"
FT   CDS_pept        672384..673145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03600"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79077"
FT                   /protein_id="ABV79077.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(673206..673844)
FT                   /locus_tag="A1I_03605"
FT   CDS_pept        complement(673206..673844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03605"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit B"
FT                   /note="COG2057 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79078"
FT                   /protein_id="ABV79078.1"
FT                   /translation="MAWSKEQIYQITAELELTDGLYVNLGIGMPTNVANYIPKGVTITL
FT                   HSENGMLGMGPFPYVGDEEPDLINAGKQTITALPESSYFDSSFSFGMIRGGHIDLTILG
FT                   AMQVSEKGDLANWTIPGKMVKGMGGAMDLVANTKRVVVIMEHNAKDGGVKLLKECNFPL
FT                   TGAKVVNRVITDLGIFDIDKDKMILSKKAEDVTVEEIKSKTEAEFVVNL"
FT   gene            complement(673845..674543)
FT                   /locus_tag="A1I_03610"
FT   CDS_pept        complement(673845..674543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03610"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase"
FT                   /note="COG1788 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79079"
FT                   /protein_id="ABV79079.1"
FT                   /translation="MNKIYPSAEAALEGLLYDGMTIMSGGFGLCGIPENLINALLKSNV
FT                   QNLTIISNNCGVDNFGLGLLLQTKQIKKMISSYVGENKIFEQQYLDKVLELELNPQGTL
FT                   AERIRAACAGIPAFYTKTGIGTIVEENKETKEFNGEKYIMETALQADLAIIKGYKADKS
FT                   GNVIYNKTARNFNAVMAGAAKVTVCEVEEIVEVGELNPDDIHTPNIFVQRLIVGEKYEK
FT                   RIEQLTTRAK"
FT   gene            674721..674945
FT                   /locus_tag="A1I_03615"
FT   CDS_pept        674721..674945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79080"
FT                   /protein_id="ABV79080.1"
FT                   /translation="MKISKLSLAFATCILSVAANASSIDNTSSKKGYSYVLTYDKDMSS
FT                   ISSSNAAMSLLEGYRALDDAIFSNSDNML"
FT   gene            674942..675772
FT                   /locus_tag="A1I_03620"
FT   CDS_pept        674942..675772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79081"
FT                   /protein_id="ABV79081.1"
FT                   /translation="MNILSYVTRFTAASWVMVANHEIGGHGARMREFDLKVTKYKVNPF
FT                   DGFTQYKAKDFDSLQVHKKAAIDVGGMQASYLLSENIKDRYMSSNKINPTYGIGYFIAR
FT                   LDQATYIFDTNFNETDKKGNDINAYTKLMNSIYGDNYITKSKMRSYAYLDLIDPFLFYS
FT                   AYSFVMNTNLDNIPMINLGRVKYLPATRAILAPYGLERGLVNHFVIDDKYIQLNINYGK
FT                   NQKFKSYGVGIKANNLAKFDFISLGLEAAYWNQPKMLTATPLKEKCKKRWLWSC"
FT   gene            678425..678499
FT                   /locus_tag="A1I_t07981"
FT   tRNA            678425..678499
FT                   /locus_tag="A1I_t07981"
FT                   /product="tRNA-Cys"
FT   gene            678518..679435
FT                   /gene="xerD"
FT                   /locus_tag="A1I_03635"
FT   CDS_pept        678518..679435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="A1I_03635"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /note="COG4974 Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79082"
FT                   /protein_id="ABV79082.1"
FT                   /translation="MEFISQFLEMLLAERALSKNSILSYKRDLLDFHNYLAKQKLSELN
FT                   ITTDNIRNWVEYLAENGLQARSINRKISTIKSYYEFLISENHTNLNPLLNIDLPKYQNK
FT                   LPEILSIDDIKSLLEYCSQDISPEGARLNAMIHLLYASGLRVSELVSLKLSDILSNKVS
FT                   REVKKIFSVLGKGNKERIIVINEPAINSLVKYLVVRDNFVNKTKPKNLIYLFPSSAAAG
FT                   YMTRQNFAILLKSAALYAGLNPEHISPHVLRHSFASHLLEGGADLRVIQELLGHADIST
FT                   TQIYTHLQTNHLKKALLHHPLSKN"
FT   gene            679519..680361
FT                   /locus_tag="A1I_03640"
FT   CDS_pept        679519..680361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79083"
FT                   /protein_id="ABV79083.1"
FT                   /translation="MKFTKFFCITVKSDDNEYEINYIAEHIIYNIKSKKITLEDLQELQ
FT                   KLSNLPKHIKQLFLLNLESKISDEGLHGLNEKIMEHAINLSVSEDLSFFLRKSDDSILR
FT                   NLLYLEAIRNNFTAEFNEEGDLTINFPNSILQLYKLLVNNFYLKKFKDDETQKKIYNLH
FT                   QKNLKDESKDELENHYVKQSLAESTMCLFISKYINEHDLNKVFKLPIFKRKLDNSLELG
FT                   YPDNKDTRVIVVNKVLNDIDGIYISNLASSDILESVMYSKLDDEIITVKVLGTIETEL"
FT   gene            680468..681688
FT                   /locus_tag="A1I_03645"
FT   CDS_pept        680468..681688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79084"
FT                   /protein_id="ABV79084.1"
FT                   /translation="MLKESKKNQNSITNKNLADLVIEELENENFDLKVLEKIQQAFSTA
FT                   SKQKQREAFISIINTNLKNNQLHKLNRAVMERASELMPANDPNFVCRTTDNKIWGELLL
FT                   LEAKRHGMKAELNSKSELQPLNIKNIPQEILNHYFVLKQKFYPQRDSKDSIDSRIAQSI
FT                   NFLLYAPLFREIKEYEKLSDMDKLIAESDIRNPNGKYVQNLVEKKLAAYIEKHANTQEK
FT                   YENKKNEEKEAEISSIIETSIGKLEQNKKIAIEGQQREKIKRRISRFLEEFSIEALTSN
FT                   KKKLIDIIHQELYQKRSIWSKIANYCGIKYYKISKENLKNIKEVIGSKICYFTMKPEVR
FT                   KQLEQLSKELHKSGAIISSVDKDKQKNLEELKENFKELKKLKNPVLPSKIKQTKSKTKA
FT                   NPPLPKI"
FT   gene            complement(681704..683074)
FT                   /locus_tag="A1I_03650"
FT   CDS_pept        complement(681704..683074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03650"
FT                   /product="Magnesium transporter"
FT                   /note="COG2239 Mg/Co/Ni transporter MgtE (contains CBS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79085"
FT                   /protein_id="ABV79085.1"
FT                   /translation="MPNFSMFKSILPDHHDQFAEIFDQINDLLEDHNYNAAASRLAELH
FT                   YADLADFLDNLSPKIYKIIIPLLQDKIKPETLVSLNAYSKPLIIETLGIKKSAELIDKL
FT                   DIEDAIEVVIDLDDDIKDLILNNLSKEKKHQITIGCTYPENTVGRVIERDFVNLQENWT
FT                   VKESLNFIKTVKNDFHAAIVTDNKLRPIGIISLSTLIKHEKNELVKNLMSKDFKLADSF
FT                   TDLNELSFIFKQYALTIVPVVNKNGKLIGSVSIDNIIYIIEEQAEKDILSLSGVHTQDT
FT                   FFNFFYTVKHRFPWLFVNLITACMTSLIINHFNDTIAKLVTLAATMPIVASMGGNAGTQ
FT                   VMTVTVRALANKDIHYSNVSKIILKEIAVSGFNGFVLAIIGAGLSFVMLMDLNLSVIFA
FT                   IAVILNFLVAGLFGSAIPILLHYFDIDPAAGSGVFLTTLTDALGFLTFLSLAHVFLV"
FT   gene            684443..684523
FT                   /locus_tag="A1I_03665"
FT   CDS_pept        684443..684523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79086"
FT                   /protein_id="ABV79086.1"
FT                   /translation="MLVKNKPLDQIIDFTGLTKKEIEKLK"
FT   gene            684703..686547
FT                   /locus_tag="A1I_03670"
FT   CDS_pept        684703..686547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03670"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79087"
FT                   /protein_id="ABV79087.1"
FT                   /translation="MNKDEELLIEAIENDDLKEVQKLLQEGVDPNILDEDDKPCILSAI
FT                   RNKNLDIVSVLLENGANPNAVDADGEPIISAAIRTKRLDIINILLENRADPNLQPPRKN
FT                   TILLKAIQSNNLDIVNAFLNKGANLNALDISGYPIFLKAIKSENLEIINALLEKGANPN
FT                   LVDKDGSPLLFTAINTKNLDIIDALIKMGANVEAKNKDGNTVLNVLLERRGNVNIISLL
FT                   IENSQDKEKIFNLKNNNGETFLHLAAQQGNSKIFDKYLDYYPTVNITDKAGYTPLYWSK
FT                   LLGHTEISNKLIERAEELKETVYTKVTRTKFFENLPSIPKIAVSYNSKVRGETSEATRN
FT                   KLKYQYCNVEDIDYRKIVPESANAEKKINEEIVNEAKRKAKEFLADKDALVIPGNNSSV
FT                   DPKIAEHFGGQVNLEKNKFDFARSLAEMAMLEVAIEKGMPIMGICGGHQIINAYLKGKI
FT                   DEVSKHKHDSIIIEPDSELASIIKRNSPTKDILNQEFWGMHNDKVQEIGGKNRLIDNKD
FT                   LLKVTATNEHREIEATESQFGAPIRTFQFHPEMSKTTYSNAEIIRDKKIFASFVQSAET
FT                   FMNKKSLGADIKFKVPVKKSFTEMVLNRKEQQNNQRGI"
FT   gene            complement(686555..686641)
FT                   /locus_tag="A1I_t07983"
FT   tRNA            complement(686555..686641)
FT                   /locus_tag="A1I_t07983"
FT                   /product="tRNA-Leu"
FT   gene            complement(686879..687739)
FT                   /locus_tag="A1I_03675"
FT   CDS_pept        complement(686879..687739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03675"
FT                   /product="HAD-superfamily subfamily IIA hydrolase"
FT                   /note="COG0647 Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79088"
FT                   /protein_id="ABV79088.1"
FT                   /translation="MDKLKLKNIFDVMDDYDVFLFDLWGVVVEGGHTYPNVVQNINKII
FT                   EQKKVYFVTNAPRNIFSLHQTLKSWGLNAKPEMIINSGEVAVQMILESKERFGIEKPII
FT                   YHLGHLENDIINGIQCPITDDIQKANILLMTIYRDESKNLDLNEFDELFKIVVERKIVN
FT                   ICANPDLGINQHGIYRYCSGYYAQKIIQLGGKVIYSGKPYEEIYSKVLQECPNIPKNRM
FT                   LMIGDTFYTDILAANWLGIDSGLVLTGNSRDYHLEFGNIDDKLSNLRKAAEKQSVMPSF
FT                   VVSLS"
FT   gene            687976..690402
FT                   /gene="gyrB"
FT                   /locus_tag="A1I_03680"
FT   CDS_pept        687976..690402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="A1I_03680"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79089"
FT                   /protein_id="ABV79089.1"
FT                   /translation="MSEFEEKLNESSYGADSIKVLKGLEAVRKRPGMYIGDVGDGSGLH
FT                   HMIYEVVDNAIDEALAGYCDLVRVVLNKNGSVTVSDNGRGIPVEIHEEEGISAAEVIMT
FT                   QLHAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELRIWRNNTEHLIRFNNGITEAPLA
FT                   VVKENVDKKGTEVTFFPSVETFTNIEFDFSIIEHRLRELAFLNSGVKILLTDNRFEEVK
FT                   EVEFYYTGGIEAYVKYLDRAKHAVHSCIVVNADNTESGISLELAMHWNDSYHENILCFT
FT                   NNIRQRDGGTHLSAFKSGLTRVITAYLENTGLNKKAKNAFSGEDTREGICCVLSVKVPD
FT                   PKFSSQTKDKLVSSEVRPIVENAVYTKVLEWFEEHPADAKLIINKIMEAANAREAARKA
FT                   RELTRRKSVLEVSNLPGKLADCHAKDPAVSELFIVEGDSAGGTAKQGRDSKIQAILPLR
FT                   GKILNVERARFDKMLGSDQIGTLITALGTGVDNREFSLEKLRYHKVIIMTDADVDGSHI
FT                   RTLLLTFFYRHMPELINKGYLYIAQPPLYKVKKGASELYLKNEQALQDYLVKSAISDAT
FT                   LTLDNKEQLTNENLEELMSKVIKFNSLLDHASKKFNRSITEILAINDLLNNKIFDNESD
FT                   SRLKKALNALNSLEQSPDKTDWEVLKHENKIEFFRFSRGLKERKILLREQLESFEFINI
FT                   SKLALTIFDVFNKQLKLVVKNQEFDILTPSILLNTIIECGKKGISVQRFKGLGEMNSDQ
FT                   LWDTTLDPKKRTLMQVRVAEVDEAEGIFSTLMGDVVEPRRQFIQSNALNVVNLDV"
FT   gene            690568..691827
FT                   /locus_tag="A1I_03685"
FT   CDS_pept        690568..691827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03685"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79090"
FT                   /db_xref="GOA:A8GW63"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW63"
FT                   /protein_id="ABV79090.1"
FT                   /translation="MQKLIIHGGKPLKGIINISGAKNAVLPIMAASILTDKLHITNVPK
FT                   LTDVSTMKELLKSHGAGIEIIEHENEFELVINAANINNLTADYEIVRKMRASIWVLGPL
FT                   LSRYGKAKVSLPGGCAIGARQVDLHIAVLKAMGAEITIEDGYINASTAGRLKGTHFIFD
FT                   KISVGATINAVLAAVLADGETLLFNCAREPEIVDLCNCLNKMGADISGIGTSEIRINGK
FT                   DSLSEASYRVLPDRIEAGTYMFAAAITKGDLKLYGIDYHIIENIALKLIETGIKVMPID
FT                   NGVQVTYADKLNAVNLETNPYPGFATDLQAQFMSLMTISQGSSIITENIFENRFMHVPE
FT                   LCRMGADITVRGNQAIVQGVKGLKGAEVMASDLRASVSLILAGLSTDSETVLHRIYHLD
FT                   RGFQNLEKKLNNCGADIKRV"
FT   gene            692199..692579
FT                   /gene="rpoZ"
FT                   /locus_tag="A1I_03690"
FT   CDS_pept        692199..692579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="A1I_03690"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG1758 DNA-directed RNA polymerase, subunit
FT                   K/omega"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79091"
FT                   /db_xref="GOA:A8GW64"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW64"
FT                   /protein_id="ABV79091.1"
FT                   /translation="MARITTEDCSKVIPDRFQLVIYATRYAKLLNYKVETNQSKKEKRD
FT                   KPPVIALRRIASGKVSVAQLEQDFINSLRTRSRIEPIVEQDESEDLEEKFEYLPEVYIG
FT                   EDYSDLDDQIFTEETGEDFEDK"
FT   gene            692580..692963
FT                   /gene="acpS"
FT                   /locus_tag="A1I_03695"
FT   CDS_pept        692580..692963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="A1I_03695"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /EC_number="2.7.8.7"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79092"
FT                   /db_xref="GOA:A8GW65"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW65"
FT                   /protein_id="ABV79092.1"
FT                   /translation="MIIGVGTDIVQIPRIEKIIKLYPEIFPKRILNTEELKKFALLKKE
FT                   SHVTFLAKRFAAKEAISKAFGVGIGRGINFKDITLLNDELGKPIVKIDSLYTQKLPPFN
FT                   IHLSLSDDYPICVAFVVVEKIIL"
FT   gene            complement(693255..693473)
FT                   /locus_tag="A1I_03700"
FT   CDS_pept        complement(693255..693473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79093"
FT                   /protein_id="ABV79093.1"
FT                   /translation="MSNFHKEGSTVFWKWYGKKLKGTVQKVYYDPIIKKIKDKEIKRNA
FT                   SEQNPAYYIKGDNDKHVLKLHSELINI"
FT   gene            complement(693838..695361)
FT                   /locus_tag="A1I_03705"
FT   CDS_pept        complement(693838..695361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03705"
FT                   /product="ATP/ADP translocase"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79094"
FT                   /protein_id="ABV79094.1"
FT                   /translation="MDAVNSNFTFWNRARNSKFRHIVWPIRSYELTKFIPMALLMFFIL
FT                   LNQNLVRSIKDSFVITLINTEVLSFIKLWGEMPMGVLFVILYSKLCNLMTTEQVFRIIT
FT                   STFLLFFAFFGFVLFPYREFFHPDPELVKHYITVLPHLKWFIIIWGHWSLVLFYIMGEL
FT                   WPVIVFTLLYWQLANKITKVEEAPRFYSFFTLFGQTNLLISGTVIIYFAKSEHFLLPLF
FT                   SHLSDTNEILLKSFVSIILVSGLICLALHKFIDKTVVESDKNIKLKNQRTDILKLSLIE
FT                   STKIILTSRYLGFICILLISYSMSISLIEGLWMSKVKQLYPDTKDFISYHGKVFFWTGV
FT                   LTLVSAFLGSSLIRLCGWFWGAIITPIMMFGAGVMFFSFTVFENHLKNIIDTLGYSSPL
FT                   IVIVFIGGLWHVLSKSVKYSLFDATKEMVYIPLDSEMKTKGKAAVDVMGTKIGKSIGAI
FT                   IQFISFSIFPNAVHNDIAGLLMFSFIIVCLIWLYGVKVLAEYYNKLVKR"
FT   gene            complement(695467..697089)
FT                   /locus_tag="A1I_03710"
FT   CDS_pept        complement(695467..697089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03710"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="COG0504 CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79095"
FT                   /protein_id="ABV79095.1"
FT                   /translation="MVRFIFITGGVVSSLGKGLTAASLAMLLQAKGFKVCLRKLDPYLN
FT                   VDPGTMNPHQHGEVYVTDDGAETDLDLGHYERFTGVPACKFDNITTGAVYSKLLKEERL
FT                   GNYTGLTVQVIPHVTNIIKDFILSNTKGFDFVLCEIGGTVGDIEGLPFFEAIRQIGNEL
FT                   KSKQCLFIHLTLLPYVKTARELKTKPTQHSVKELRTIGISPNILVCRAERKIAKSEIEK
FT                   IALFCNIDPEYVIPAIDQKNIYLVPLAYHDYGLDNKVLKFFNLTIAPSKLNRWHDIIER
FT                   LKESHSKVRIAIIAKYHKLKDAYKSVIEALDHAGIYHKYKVDLVWINAENVTNENISKK
FT                   LLGVDGILVPGGFGERATEGKILAVNYARTNNIPFFGICLGMQLAAIEIARNLVGLKDA
FT                   VTEEFKTAGTKIIERISKHDEDFNPSDITIENIKKTMRLGSYTCNLVSDSITANAYGEL
FT                   KISERHRHRYKFNNDFQDIFEKNGVKFSGFSEDKKIVEAIELPKLLWFVGVQFHPEFKS
FT                   KPFETHPLFIRFVEAAIKYNKNN"
FT   gene            complement(697093..697827)
FT                   /locus_tag="A1I_03715"
FT   CDS_pept        complement(697093..697827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03715"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="COG1212 CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79096"
FT                   /db_xref="GOA:A8GW69"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW69"
FT                   /protein_id="ABV79096.1"
FT                   /translation="MKHQDVAIIIPSRLSSTRLTRKPLQLIGSSTLIERVFKQVNQTNL
FT                   EHIYVATDSQEIASVIEKLGGKVIFTDSNIPTGTDRTYEAFKLIPNNQNINYIVNVQGD
FT                   MPFIEPESILKVIEDLKNSKYDIVTPVVKVEKDSVEAASNVTVAIDSKGKAIYFSRSLI
FT                   PNGAEEFLYHVGMYGFRKSALERFVALEPTFLEKTERLEQLRLLENGMTIGTCLVNNVP
FT                   ISVDTPEDLSKAVKFYEKSKLV"
FT   gene            698147..698222
FT                   /locus_tag="A1I_t07985"
FT   tRNA            698147..698222
FT                   /locus_tag="A1I_t07985"
FT                   /product="tRNA-Lys"
FT   gene            698380..698456
FT                   /locus_tag="A1I_t07987"
FT   tRNA            698380..698456
FT                   /locus_tag="A1I_t07987"
FT                   /product="tRNA-Ile"
FT   gene            complement(698727..699032)
FT                   /locus_tag="A1I_03720"
FT   CDS_pept        complement(698727..699032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79097"
FT                   /protein_id="ABV79097.1"
FT                   /translation="MQINYLIRLLAMYKQILKNIENKIESNNMTLKTLEGFKIFGFENA
FT                   KREGLSNVLLELYSIHTGLLHKANNKYEQDSEAQLKLSVVDTLIGDINNFLDNHPE"
FT   gene            complement(699109..699624)
FT                   /locus_tag="A1I_03725"
FT   CDS_pept        complement(699109..699624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79098"
FT                   /protein_id="ABV79098.1"
FT                   /translation="MLRIEKAEDAWLFKGAIVAFKPKSFYYGKNRDNIFNNEFVFGLLG
FT                   DRFFPHIMGGKYLCLYLFQIGKTTNENIYLNSDKLELNEAGYLDMRFANLKEIKTLRHL
FT                   VDFNYIILNSFNKTYTIYMLNNILTYDPDINLLDINYNKDTLAITLDWHNYKEKENTKI
FT                   LGFVDISN"
FT   gene            699947..700954
FT                   /locus_tag="A1I_03730"
FT   CDS_pept        699947..700954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03730"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79099"
FT                   /protein_id="ABV79099.1"
FT                   /translation="MVKTLVQTMIELWYGPYENFINTIKEQNEEKALRYINEIDPKEFS
FT                   KANDNGYTILMSVANKGLYTVCERLASKMPYEAINQVNNRGDTALSLAENKKFKDICNL
FT                   LCEINFQKLKDKLNNKIKTITIDQEQIKQAADNIWDAANSINCSEDKREIENLVKPLLN
FT                   NFTKKAIFGVEIKVKRVIEQQKIEHNKLKEQLKAQEVIGKQVLSAKIATFEELINKLNC
FT                   EISNKDSSSIKTMLEGISAKIDKLNNIVTKKTANTEEITDDARNANNNLQALVKDINEI
FT                   TKVIETVNKYLKFLPANEITKYNIATLEETFLKEIEHFKIDNDSKVLGATIEGY"
FT   gene            701384..702658
FT                   /locus_tag="A1I_03735"
FT   CDS_pept        701384..702658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03735"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79100"
FT                   /protein_id="ABV79100.1"
FT                   /translation="MFAFFRSSSNEPDGTLYNKLIEAIKSRNSLEVLALIPKMKNEELA
FT                   KPNIYGNTPLSLALNKKLEAVCEVLVSRMSDKDISIIETYVEHRETYFTLAAIKGFKGV
FT                   CENLAPRMSNEAINVINARKHTALTLAASKGKGWGEICEKLILKMDKKVINTITEANNT
FT                   ALTLAADKNLPQVCIKLIPIMFDEVINVTENRHKDSTLRKAIWNDLDVVCQMLIPVTSK
FT                   ENINYIDVSDRTLLILAAQKGMKVVCKMLISRMIEDNSLDIINHVISKGELKGESALSL
FT                   AEKQKGFEDICELLQKSHEEYKEQKQKENEKKCEESQPKKIISEDINKLLNELKDGAYN
FT                   NKNIIEFSISAKIEKLEKNANDLSEIYTNIQDIINHNKNTKAKLLALEKHLNQIIDAQT
FT                   INTEQQISLEALGDVSVEFSNSRGV"
FT   gene            complement(702856..703707)
FT                   /locus_tag="A1I_03740"
FT   CDS_pept        complement(702856..703707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03740"
FT                   /product="Methylenetetrahydrofolate dehydrogenase"
FT                   /note="COG0190 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79101"
FT                   /db_xref="GOA:A8GW74"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW74"
FT                   /protein_id="ABV79101.1"
FT                   /translation="MNNVIDGKALANEILSELKHEVQRLKDKTGESPKLAIVLVGDNPA
FT                   SIIYVKNKIKHANKIGIDTLLLNLPITIKTEDLIAKISELNLDQNVSGIIVQLPLPDSI
FT                   DKNKILSAISPSKDVDGFHPLNVGYLHSGIDNGFVPCTSLGCLEVIKKHEPNLSGKNAI
FT                   IVGRSNIVGKPLSALLLKENCSVTICHSKSQNLSSITSKADIVVAAIGSPLKLTSGYFK
FT                   PDAIVIDVGINRIGGNKIVGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVQAFKI
FT                   YS"
FT   gene            complement(703954..704952)
FT                   /locus_tag="A1I_03745"
FT   CDS_pept        complement(703954..704952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03745"
FT                   /product="Thioredoxin reductase"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79102"
FT                   /db_xref="GOA:A8GW75"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW75"
FT                   /protein_id="ABV79102.1"
FT                   /translation="MHNTDVLIIGAGPVGLFAIFQAGMLGMKCHVIDAQEVIGGQCITL
FT                   YPEKPIYDIPAYPKIAAADLIKQLELQAAPFNPVYHLNQQAVELKKEGEFFEVKTSKDI
FT                   VIKSKVIVIAAGAGSFGPNKPPLANIEEFENESVFYFINNRSKFTGKNIVIAGGGDSAV
FT                   DWAISLSEIANKIYLVHRRDKFRAANESLRQLKDIAESGKIELVTGYQLDSLEGNNSEL
FT                   QSVIVRDLQNNTRKLNVNILLPFFGLKQELGNLVNWDLDIKLHHIEVDPVYYQTNISGI
FT                   YAIGDVAHYSGKLKLILTGFAEAASSLHHAYGKVFDGNALHFEYSTTKYTQ"
FT   gene            complement(705029..705445)
FT                   /locus_tag="A1I_03750"
FT   CDS_pept        complement(705029..705445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03750"
FT                   /product="Toxin of toxin-antitoxin (TA) system"
FT                   /note="COG3744 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79103"
FT                   /protein_id="ABV79103.1"
FT                   /translation="MNNPLVLDTHVLLWSLLQPKELSEEIKHKINLAQENSQLFLSSIS
FT                   LWEIAMLSFKKRICIYEPIKDFLNSITDINGLAIKDISSEIAAESISLMDDFHGDPADR
FT                   IIVATAKCLGATLLTRDQKILTWAKLGHIKSISI"
FT   gene            complement(705438..705671)
FT                   /locus_tag="A1I_03755"
FT   CDS_pept        complement(705438..705671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03755"
FT                   /product="Antitoxin of toxin-antitoxin (TA) system Phd"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79104"
FT                   /protein_id="ABV79104.1"
FT                   /translation="MSTKIAISYFKSHCLEIIDKLQTDKESIIITKRDKAVAQILPMDT
FT                   KKISLFGMLKDKAEIKGNILEPIEEKWNVEHE"
FT   gene            706063..706566
FT                   /locus_tag="A1I_03760"
FT   CDS_pept        706063..706566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03760"
FT                   /product="Spore coat protein-like protein"
FT                   /note="COG5430 Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79105"
FT                   /protein_id="ABV79105.1"
FT                   /translation="MKNNLKVLRNIIVVSILILNSNKIFATSVNFSVTATVQPYCSISA
FT                   TNLGFDPYTSQNNSDKTSVVTVTCTAGTGYHVKLDSGQNSSSTSTRKMKGAASASNLLQ
FT                   YFLYSDSARTVIWGNNANNSDSPPGAGTGLAQTYTVYGRIPSGQTTVPVDNYSDQIAVS
FT                   ITIP"
FT   gene            706596..706940
FT                   /locus_tag="A1I_03765"
FT   CDS_pept        706596..706940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03765"
FT                   /product="P pilus assembly protein, chaperone PapD"
FT                   /note="COG3121 P pilus assembly protein, chaperone PapD"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79106"
FT                   /protein_id="ABV79106.1"
FT                   /translation="MLKKYFNLVIFSLVLFSNLSSAANFTIMPVKININKNDKIATIKL
FT                   QNNDLMERSFQLTVLKREYENGKEEYKETKDLIATPLMFPVQGGKIQIIRIAVKDKKMF
FT                   PQQKMLIEFL"
FT   gene            707065..709437
FT                   /locus_tag="A1I_03770"
FT   CDS_pept        707065..709437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03770"
FT                   /product="P pilus assembly, fimbrial Usher protein"
FT                   /note="COG3188 P pilus assembly protein, porin PapC"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79107"
FT                   /protein_id="ABV79107.1"
FT                   /translation="MCFLYKIISLFIGIILFNSLSYAEITDDSELIVSLKVNYVETDIF
FT                   PTIMQNKQGNYLIPLEDIEHFNVQEEYLKQGLVTYHDIQYVNLDLLTGTKYSLNHENLD
FT                   LDIIFPTEKMQGQSFNATEMPIKEVDNKLINGAYFNYNLTLTQDDNSNYLAGVEELDYA
FT                   TENGVYSYSFLFQSKAVNSNFSKVRSAQKNYNKFTRLETNWTYENENKMTNWRVGDSFT
FT                   KPAIWSNSTRFAGIQYATNFSVRPNLITYPLLDFRGKSELPSSVELFSNNIPIYNAKAR
FT                   MGDFDISNIPVITGRGDLIVKTQDITGKIKTITIPYYAAPSLLRPGLSDFSYETGFQRQ
FT                   NFTIKSNDYKYLILNTDYMLGINDYLTSGGHFEFLKNNGTVGTTSNFKIGNYGVAGISL
FT                   ANNIKNFEHSQRVNCGYTYESEYFDFNSNLDWNNKNYRDVYNYPNKTYSNLRYQISASY
FT                   GNGDIGNISVNFLTYAIKGTLKNKRSNIISVTYQKNITKRGVLNFTIGTDLKNRHTGNF
FT                   AYLSFNLNLDNNRSVSLIDSYQNNYHIKQLGFSSPISSNMGWGYSANLIKAKSTNYNVQ
FT                   VNRNGEHNDMGLYLYKNDASTTKQFNIQGSVVSIDKNYYMTRPITGGIALVKVSDMKDV
FT                   GVYNNNQLVGYTDDKGKILIPNVTPYIPSEIRLDDEKLPLNAEFSDIALNIAPKTKSAV
FT                   KLDFGIKIVRSVEMTIFDSNKHFMPLDSTVTIEGIDEELFVGYNGKVYINDIKNLEVLN
FT                   GSVCNENVENSKCCHFSIPVNKDLNDPIIDLGEIVCE"
FT   gene            709428..709889
FT                   /locus_tag="A1I_03775"
FT   CDS_pept        709428..709889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03775"
FT                   /product="hypothetical protein"
FT                   /note="COG5430 Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79108"
FT                   /protein_id="ABV79108.1"
FT                   /translation="MRIRYFVAVFLISLALSGQTMATCSVSVPTVGFGNVSTSSSKTTS
FT                   VTASVTCSALISLIVSYTLKFSTGSANIYNPRNMLNGSNKLTYNLYKDAAHSQILGNGT
FT                   SSTVTIQDSYLLALGPVTRNYTIYASLPAQPLANVGNYQDTITVTLTQP"
FT   gene            710085..710930
FT                   /locus_tag="A1I_03780"
FT   CDS_pept        710085..710930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03780"
FT                   /product="Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79109"
FT                   /protein_id="ABV79109.1"
FT                   /translation="MNNNDEINKLVAFKDKNIRRILYNNEWWFSVIDVVGALTDSVDSG
FT                   AYWRKLKQRLSEEKSEVVTFCHELKLKAPDGKMRLTDCANTESLLRIIQSIPSPKAEPF
FT                   KKWLAKVGYERIQEISDPEKSVDRARENWKRHGRSDKWIQQRMMGQETRNKLTDYWKNH
FT                   EVTKENEFAILTNVIYQEWADISVREHKNIKGLKNQNLRDHMNEAELIFTALAELSTRQ
FT                   VAETNNAIGMEENKVAGKIGGGIAKNARISLENKTGKRVISTENYLLPECKKVKSLPES
FT                   "
FT   gene            complement(711316..711801)
FT                   /locus_tag="A1I_03785"
FT   CDS_pept        complement(711316..711801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03785"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79110"
FT                   /db_xref="GOA:A8GW83"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW83"
FT                   /protein_id="ABV79110.1"
FT                   /translation="MNKTSKKHLALPYRPGVGMMILNADNKIFVGKRIDTKISAWQMPQ
FT                   GGIVPGETPSIAAMREMLEEIGSSKGYIIAESKCWYSYDVPSFLIPKLWDGNFRGQKQR
FT                   WFLIRFTGTNEDININTLNPEFDEWRWASLDELLSIIIPFKRKLYQAVVKEFESLIQ"
FT   gene            complement(711804..713177)
FT                   /gene="pleD"
FT                   /locus_tag="A1I_03790"
FT   CDS_pept        complement(711804..713177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="A1I_03790"
FT                   /product="response regulator PleD"
FT                   /note="COG3706 Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79111"
FT                   /protein_id="ABV79111.1"
FT                   /translation="MSANILIVDDIETNIKLLEAKLLNEYYTVFKASSGKEALNILKKE
FT                   KVDIVLLDVMMPEMDGFEVCKKIKSDPETTHIPVVMVTALSDVDDRVKGLEAGADEFLT
FT                   KPINDNALFIRIKSLSRMKSLIDELKIRNSTNALLGGINVEIHDNFADKKILLINDDVV
FT                   QAKNIKQMLLKITSNVKVISNSEETDTINEYKPDLIVISSTLENEDPLRVGAILRGKPE
FT                   ISGVILILQIYEDENGNENQMQLVMKGFELGINDYFVYPIDESELAARIKTQLRRKQYQ
FT                   DNLRNDLEQSVNLAAKDGLTGLFNRRYFDVHIKQIVEKANKEGMKLYLLMCDIDNFKHV
FT                   NDTYGHQAGDKVLITTSRILKNTFRVTDLIARFGGEEFTILLNDINIDQAIYTAERVRV
FT                   KIESMNFQIDEQEEPLKKTVSIGVTEYKKCESIEEFIERSDKAMYEAKTTGKNKVVKL"
FT   gene            713290..713856
FT                   /locus_tag="A1I_03795"
FT   CDS_pept        713290..713856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03795"
FT                   /product="elongation factor P"
FT                   /note="COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79112"
FT                   /db_xref="GOA:A8GW85"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW85"
FT                   /protein_id="ABV79112.1"
FT                   /translation="MKISANSIRTGNILVYNNDLWVVSKQPEHTQPGKGGAYVQVEMKN
FT                   LKTGTKRNERFSSSDHLEKAELEQKDYQFLYFEDNNIVLMDNQTFEQISVNKEILDEKL
FT                   PFLTENMIVKVEFYNEKPLSIELPATVILEIIETDPVIKGATATASYKPATLANGVKVK
FT                   VPQYLEIGEKIVVKTEDLTYVERSK"
FT   gene            714020..714760
FT                   /locus_tag="A1I_03800"
FT   CDS_pept        714020..714760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03800"
FT                   /product="Extragenic suppressor protein suhB"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79113"
FT                   /protein_id="ABV79113.1"
FT                   /translation="MQPITNLLINSLRKAVKFVHRDFLELEMLQKNPIRNEEFCKRSYL
FT                   RLKTLLCEELQKHTKYLFFPEDPFDPNNNYETVFLVNPIDSPNNFARSLPFFAVSITCL
FT                   KQNQDGLTPVSTVIYFPVLNEVYYAEKGRGAWVEKNDLGSNHKGLRLRVSDNANLENCL
FT                   TIIEDLKNSNFQEVNNSRTFGSSCYAAMLLASGKADLIYLPLLNFTLYYSFDLFIKEAG
FT                   GIVVDSSDKFIYSNHYITRELKKS"
FT   gene            714840..715163
FT                   /locus_tag="A1I_03805"
FT   CDS_pept        714840..715163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79114"
FT                   /protein_id="ABV79114.1"
FT                   /translation="MKKFDIDCDFGGQKSKFTIYIGTPQDGHHPLQFQSKWLSDERCGT
FT                   IPDAVMDAVKQLYDLSKKNNVSFEDLCVYALGTAQEAQTTSNDEDETEREDNDDEDNKA
FT                   EQA"
FT   gene            715291..715986
FT                   /locus_tag="A1I_03810"
FT   CDS_pept        715291..715986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03810"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="COG0688 Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79115"
FT                   /db_xref="GOA:A8GW88"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW88"
FT                   /protein_id="ABV79115.1"
FT                   /translation="MKQYNDLFKIIHREGYIFIASFALVSFLLASFNEKLGCMGFIATA
FT                   WCIYFFRNPDRFVPIGNDLVISPADGVIQEIKEALPPAELGLGDVEMIRVSIFLNIFNV
FT                   HVNRIPANGKILALHYNPGKFFNASLDKASVYNERQSVLMETEQGQKIAFVQIAGLIAR
FT                   RIVCDLEESNEVKAGERYGIIRFGSRVDVYLPLKTALLVSKGQTAIGGETIIADFGRKK
FT                   TAELQFERK"
FT   gene            716176..716946
FT                   /locus_tag="A1I_03815"
FT   CDS_pept        716176..716946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03815"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="COG1183 Phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79116"
FT                   /protein_id="ABV79116.1"
FT                   /translation="MLKIRKTIISKPVPIIKLIPNFVTLLGLVTGMSSVKFALDSKWEI
FT                   AVYCIIVAAIIDGIDGRIARMLNATSPFGAELDSLCDFANFGIAPAYLIYLWSFQQYEY
FT                   KVFSSAVMLLFIVCMALRLARFNVGIYQPKQDKKPEHFFTGVPAPCGALLALVPVMIDF
FT                   EIGTLLNINVRIHTITINIYLAIIAFLLASRLPTISTKNLSIKPEYLSLAMILFAVVII
FT                   NLIIYPWYALPFIAVIYILSIPFCYFLKHKFNNN"
FT   gene            717156..718010
FT                   /locus_tag="A1I_03820"
FT   CDS_pept        717156..718010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03820"
FT                   /product="Multidrug resistance protein A"
FT                   /note="COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79117"
FT                   /protein_id="ABV79117.1"
FT                   /translation="MTNNTKVNKGDLIGEIDDRDYKAKLAALEASIGASEKNIEIIDQK
FT                   ISIGQNQLEQSGEKLKLAATSFNIVSTDFTRVQELNKAKFASIKALDDSKNAYQKAKTD
FT                   YKQAQLDIDISKQNLQLLGLEKAAEQEKLKELEANKKIILRSLQNTKLIAVVSGVFGNS
FT                   SLEVGNYITPGRALFSIVQDNSMYIQANFKETQIKKFQPGMKVEIQFDAIPKKTFYGKI
FT                   RNISPATGSKFTLIPPDNATGNFTKIVQRVPVLIDFDAPVANLIPGMSVIVSIRTDQKL
FT                   STR"
FT   gene            complement(718366..718566)
FT                   /locus_tag="A1I_03825"
FT   CDS_pept        complement(718366..718566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79118"
FT                   /protein_id="ABV79118.1"
FT                   /translation="MKTNDILKVATGASSVFHKAVNNIKDKSCDVIEDKILKGNYVTRE
FT                   EFEKLQTLVMKLKKEIAEMKR"
FT   gene            complement(718569..718811)
FT                   /locus_tag="A1I_03830"
FT   CDS_pept        complement(718569..718811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03830"
FT                   /product="BolA-like protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79119"
FT                   /protein_id="ABV79119.1"
FT                   /translation="MSRIDRITKSLSVLKPHFCEIIDESHKHASHYDGIHSHIKIKISA
FT                   KILQGKSLIANHRTINNLLADEFQNGLHALSIEVL"
FT   gene            718877..720082
FT                   /locus_tag="A1I_03835"
FT   CDS_pept        718877..720082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03835"
FT                   /product="EAL domain containing protein"
FT                   /note="COG2200 FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79120"
FT                   /protein_id="ABV79120.1"
FT                   /translation="MAMSELIAEYKVLQAEMDEVGRGVCFACKLLNYDEIVFIEPNKNF
FT                   IIQDLEKIIENVSKELDIPLKFRKTKKDVILFILDITDSDLIKSFARKLYLSSQLYIND
FT                   ERPEIYINCCIASSEFPKVSANAEEIEKILNMLLSQNNNYYYREYNSDDHDLENIKKSN
FT                   LQLNLLRQALAKKTMRFAYQPIIDRKTLKVHYYECLLRIPDENGAYISVGPIIPIAENK
FT                   GLIFVIDQIVLEMSIHELVNNPNLMLSVNISNIGTTDEALWEIAESLLKTYDVRDRLIV
FT                   EITETSFNENYDKINVFINKLRKFGCKFALDDFGSGFTSFKQLQSLPIDIIKIDGKYVR
FT                   SITSDVQSRYFVERLIKISEDLNIETVAEFVENGEIAKFLIDLKVGGLQGNYYSESKFD
FT                   RE"
FT   gene            720155..721591
FT                   /gene="murC"
FT                   /locus_tag="A1I_03840"
FT   CDS_pept        720155..721591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="A1I_03840"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG0773 UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79121"
FT                   /db_xref="GOA:A8GW94"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW94"
FT                   /protein_id="ABV79121.1"
FT                   /translation="MLLLELKKTNQTLETIHFIGIGGVGMSGIAEILHNLGYKVQGSDL
FT                   SENYNTKRLEAYGIKIFVGHTPQNITNVSYVVVSSAINRNNPEVKEALERKIPIIRRAE
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLVACLFEAAGLHPTVINGGIINNRSTNAYLGSSN
FT                   YLIAEADESDATFISIPSTIAIITNIDPEHLDYYKDFDTLINAFRSFITNLPFYGFAVC
FT                   CIDHKIVRELVNNITERKVITYGIDSDDAHITAFNISTDITSSTFDVKISLPNVSGVTI
FT                   IEKITIPTPGRHNILNSLAAISVGVELDFGIKAIKNGFNSFKGVKRRFTKVAEYNQASV
FT                   IDDYAHHPEEIKATLSTAKNIANKQHGKVIAIFQPHRYSRMQHLFDDFMRCFDDADLLY
FT                   ITDVYAAGESHIEGISGQSLIDNIIKLKYHNQANFLAKLDDSLEVIMNKASPGDMIIMM
FT                   GAGNISNFANELPQKFGNLS"
FT   gene            721588..722520
FT                   /gene="murB"
FT                   /locus_tag="A1I_03845"
FT   CDS_pept        721588..722520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="A1I_03845"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG0812 UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79122"
FT                   /db_xref="GOA:A8GW95"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW95"
FT                   /protein_id="ABV79122.1"
FT                   /translation="MNLPIVKGEYRKDYNLKHLTWFKVGGNAEIFFKPVDSEDLASFLV
FT                   QNKQKLPITTFGAGSNIIIRDGGIEGVTIKLGQNFSNIGFTDDGHLIVGSSCLNFSLAK
FT                   FCQVNAISGFEFLVGIPGTIGGGVAMNAGAYGCEFKDILVRIEAIDFAGNFRTFTNEEI
FT                   GFKYRGNNLPKDLIILKAVFKVNKGNSEDILARMNEINAARSSTQPIKERTGGSTFANP
FT                   EGFKSWQLIDKAGLRGYRIGDASISELHCNFMINNGNATAKELEDLGNFVQQKVFEDSG
FT                   IKLNWEIKRIGKVSSRAWLDHGIQRKIIK"
FT   gene            722644..723609
FT                   /gene="ddl"
FT                   /locus_tag="A1I_03850"
FT   CDS_pept        722644..723609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="A1I_03850"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79123"
FT                   /db_xref="GOA:A8GW96"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GW96"
FT                   /protein_id="ABV79123.1"
FT                   /translation="MHKYQTHWVESSEIKILSDKGKKHIALVAGGMSAEREVSLISAEG
FT                   VGKALIEAGYKVTFIDMGADIAVKLHEIKPDIVFNCLHGTYGEDGCLPGLLNIMRIPYT
FT                   HSGVLASSLAFDKVHSRSWFLTNNINMAESIVISKGDNIKTDPIKRPYVIKPFTQGSSI
FT                   GVEVIFEEDDFNFANYDFPYGDEVIIEKYIKGRELQVAILNGKALGALEIKLLKNRFYD
FT                   YETKYTEGFAEHLCPAPLPTDIYDKLLKESEKIYNTMNCKGAARAEFILEDGTNKLYAL
FT                   EINTHPGMTPLSIVPEIAAYHGIDFVNLIEEILKTASFES"
FT   gene            723606..724409
FT                   /locus_tag="A1I_03855"
FT   CDS_pept        723606..724409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03855"
FT                   /product="Cell division protein ftsQ"
FT                   /note="COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79124"
FT                   /protein_id="ABV79124.1"
FT                   /translation="MRKKTSSNKKNTAKKNNNISLHRKLGLIYKKTILILKIVLIIFIC
FT                   LFAFTKYFASLKSYLKTNIYQTTTELGFKLENVIIEGQQNVDEPTILKVLNAKKGSSIF
FT                   ALNLDEIRNNLKNNRWIKEVYVSRRLPSTIYIKLFEREPIAIWQINNQLFLIDEEGYEI
FT                   SKNIEPFPHLLHVVGEGANIYASKLVNELQKYPALINKTSSAIRCGDRRWDLNLKGGIN
FT                   IKLPAKNFEEALKYIDALNKANKLFNQNYKQLDLRDKNKYYIEKY"
FT   gene            complement(724469..725233)
FT                   /locus_tag="A1I_03860"
FT   CDS_pept        complement(724469..725233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03860"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79125"
FT                   /protein_id="ABV79125.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIA
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPIILFLAAMSARNSKTSGLRLFYERLINNG
FT                   KKKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            complement(725239..725427)
FT                   /locus_tag="A1I_03865"
FT   CDS_pept        complement(725239..725427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03865"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79126"
FT                   /protein_id="ABV79126.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            725912..727147
FT                   /locus_tag="A1I_03870"
FT   CDS_pept        725912..727147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03870"
FT                   /product="Cell division protein ftsA"
FT                   /note="COG0849 Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79127"
FT                   /protein_id="ABV79127.1"
FT                   /translation="MKEKISNFVALDFGSSKIAAIAAYISKKGEIKVASQNLHHSKGIK
FT                   SGVITDLKNAESSIVSAIYALEKDCNKNIKKVILSLSGAATKSYYINYTIKISTATITK
FT                   QDIKKLLQKALQEFKFKNQEIIHYFPLEFILDNNRVENPIGMYGRELGCELHIIAAESN
FT                   MLSNIVQCFAKCHIEVTNITLAIYASAISCLTNDEKNLGSLIIDIGDKTTSFGIFFAGK
FT                   LIYTGHVNIGSFHISSDIAKVFGTDLATAEKLKILYGNAILSSFDKDSIINMEDFNVDA
FT                   HHSPAGAVTVYKLAEVIKARAEEILLMVKSEYDKAIKGQISVYRTVITGGGSQLRGLKE
FT                   LSSKVFEKQTRIGKPELIDGFTEDYNPAAYSAVIGMLKIHALKQQKEFSHMKLDENSSW
FT                   INKVFDWLRENI"
FT   gene            complement(727336..727794)
FT                   /locus_tag="A1I_03875"
FT   CDS_pept        complement(727336..727794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03875"
FT                   /product="Membrane protein"
FT                   /note="COG1585 Membrane protein implicated in regulation of
FT                   membrane protease activity"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79128"
FT                   /protein_id="ABV79128.1"
FT                   /translation="MINEYLTEIWLIIGVICIIAEFFAIPNIGFLFFGFGALLNALIIY
FT                   NYPLISLTNQITLFGLISLIWFCILYYPLKKYVYSKTTTNENYSDMIGKEAEVYSDVIS
FT                   EENLGQVKWSGVIMNAYLAPNEKAKSGDKVFITKVKGNILICSKHRPK"
FT   gene            complement(727784..728305)
FT                   /locus_tag="A1I_03880"
FT   CDS_pept        complement(727784..728305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03880"
FT                   /product="Cytochrome c"
FT                   /note="COG3474 Cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79129"
FT                   /protein_id="ABV79129.1"
FT                   /translation="MSGKELNKIVAAILFASLIAMMVGFIANILYKPVLEPKHRGYSIA
FT                   VQEVSEAPTTQAQAPINIPELMKTANADNGREIAKKCLMCHSLDKDGPNKIGPHLWDVA
FT                   GRPKASITDYKYSPALSALGGNWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVI
FT                   LFLKTYVHDK"
FT   gene            728387..729406
FT                   /locus_tag="A1I_03885"
FT   CDS_pept        728387..729406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79130"
FT                   /protein_id="ABV79130.1"
FT                   /translation="MVDLKKSRFRIILDKINNNWNRFTESKVGKILLSNSLNYAISLTG
FT                   AVIAVSGLFTPVSLIVITVAAITAVGVGIQAINETVKIRNLRKLHKENNLLVQNRNAKA
FT                   QQDYILSLEPRLKDSLKNELFTPPKKEKDFNSDKYKVTSKNLKSIGIVLTNNVVGITSA
FT                   ISTAIVQGASGNVLGVLRATGYGILTFVSLITGGLSEKEKNRIRTIFKLNINEECKKHD
FT                   TPDYKNLDQLEKYTKEQILQTAVLKKLITDKNYWKMKDNDKREKFHEIRNTFIGEIRNN
FT                   GFNDFCNKNKVSLNIEKESYAKDIGRVMNPFYEKPNKAQEYSNLANVMNKRRRSAISR"
FT   gene            complement(729393..730259)
FT                   /gene="lpxC"
FT                   /locus_tag="A1I_03890"
FT   CDS_pept        complement(729393..730259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="A1I_03890"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79131"
FT                   /db_xref="GOA:A8GWA4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWA4"
FT                   /protein_id="ABV79131.1"
FT                   /translation="MQQITLSKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISS
FT                   ENNYIEAKYFNVSDTLLSTTISNSNKIQVSTIEHIMAALWGCGIDNAVIKIDGPEVPIM
FT                   DGSSKPFVFMIECAGKKLQNAPKKYLKILKEVTATHKDCELTCTPSDHMKIDLTIDFNS
FT                   KAIGRQNLVFSKQESFNNNIADARTFGFTKDGDYLQSKGLALGVSFENTIAIDDQDKVL
FT                   NPDGLRYQDEFVRHKLLDLFGDLYTSGNNIVSSINGYKTSHALNNELLQRIFSDNTSHK
FT                   FVTASEI"
FT   gene            complement(730345..731604)
FT                   /locus_tag="A1I_03895"
FT   CDS_pept        complement(730345..731604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03895"
FT                   /product="Putative AAA+ superfamily ATPase"
FT                   /note="COG1373 Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79132"
FT                   /protein_id="ABV79132.1"
FT                   /translation="MINRHITSFVKQSLNDFSAVLIIGARQVGKSTLVKQLCDEGIFKS
FT                   YITLDDISQLEAATADPHGFIKNASYPLAIDEIQRAPDLLKAIKKSIDEDKKPGRFLLT
FT                   GSANIFSYPGISESLAGRIDVIHLEGLSLGEILNQNNPSSFISDIFSGSTIHELKDKWT
FT                   EELKHKPEINTQFLNEYIFYGGFPEIALKKQERFRERWFSSYQSAYIERDVRNINKFLD
FT                   VVSFAKLFRLIGLQSSNLLNQKNLGNEIGLDQRTISKYLEILETTFQVNQLTPWFSNTR
FT                   KRLIKTSKIYMNDSGYASYLHGITTPDLLPKSPYYGAIFETWLWAELRKLLTLTTGIEQ
FT                   TFYRTHLGKEVDFLLHKGDIFCGLECKSTETIQSQHFVGLKDLSEALTLRIMRGIILYN
FT                   GDEIISFSDKFLAVPLRCII"
FT   gene            complement(731632..732342)
FT                   /locus_tag="A1I_03900"
FT   CDS_pept        complement(731632..732342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03900"
FT                   /product="hypothetical protein"
FT                   /note="COG0235 Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79133"
FT                   /protein_id="ABV79133.1"
FT                   /translation="MTNVKYNLAAAYKIMAYLSMDDHTYTHLSARPKDADFYYIYPFGL
FT                   RFEEVTEHNLLKVSLDGRILEGEEYQYNKTGYFIHGSIYQTRPDISAIFHYHTPASIAV
FT                   SALKCGLLPISQWALHFYNRISYHEYNSLILDSEKQSDRLVNDLKQNYVMLLRNHGAIT
FT                   CGKTIHEAMFYAYHLEQACKTQCSLNSANKQDLIIPSEEICKQTVKDLLSFEEDLGKCD
FT                   WDAWLRVIKNNYCK"
FT   gene            complement(732426..734048)
FT                   /locus_tag="A1I_03905"
FT   CDS_pept        complement(732426..734048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79134"
FT                   /protein_id="ABV79134.1"
FT                   /translation="MIIIPILSFLGFSCFFSKYFKVKLNHAIPITISILVTILYCCAIL
FT                   NLLMAATYLLYFIGILLVYSFYLKNRHRFSYESLFFTLVIFAFFLYTREASLHAYDDFS
FT                   HWGIFTKELLYSGVFENQTSFTSIISTHAHYPRGAAVYHYFMLMLSGYSDGNVLFAHFL
FT                   LHLMFLAPLASNKKIWQTGLLFSAILCAVVLYTTGLRSIYNDSTIGLMFGATLGIYILE
FT                   EDKKKALKLIIPIAILLPLFREIGAWLASFASIILILHYTFFDKKPKTSHDYITYVILL
FT                   TLPILCNFILMDYFRNTHDFLDRKEHSFSNLIYIVENFNEQHKLLLLNYGKFLLKFLVK
FT                   EGSLVVYTICFIAWYGIRKYKPKLLAEYKFFLIATFICGIIFALWRLYLYFFTFSYEEA
FT                   IRGASLLRYLGCYVLGMGMVAAAYVKSSIFLNEKQSRKELCVLMLLFAVFSFSVIKNIL
FT                   RIKHLSLEQKNFIEQAINIKKSLKQGNEIVFNFSNKKDNLQCYILNYNLAPYLNKKYLR
FT                   ECLQTPKGAVIDIKRENIYVPFL"
FT   gene            733948..734076
FT                   /locus_tag="A1I_03910"
FT   CDS_pept        733948..734076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79135"
FT                   /protein_id="ABV79135.1"
FT                   /translation="MLIVIGIAWFNFTLKYFEKKHEKPRKLNIGIIIILFLALIVI"
FT   gene            734193..736601
FT                   /locus_tag="A1I_03915"
FT   CDS_pept        734193..736601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79136"
FT                   /protein_id="ABV79136.1"
FT                   /translation="MATTDTSKRSDKLRKSLEKTLSSSNAGKLINSAIKDLSSSNGLSF
FT                   KTILLGAKFALTNPVNTYNLVKLARSSDTYLDPEFQKSLLEEKPIWEFLKKNASNLPKI
FT                   GQILAKAGFKEFQEGNFLDQKGLDILKESFKNDKVLDQLKEVAIEVKKEEPDWTKVASN
FT                   TLDMLTKDKNFEKFFNEKGKDIASYIKIGATEILPSDYVKSFDDILQKPESKQSYAEVQ
FT                   KIFDKNPALKQEVAENIHSFTSLKEFNKLSPEKQTVLNSFVADARQQAKPELKEYFESY
FT                   RIDPEVLSTLPSLLNQIPKMKEVFDTLNDPKQGVMIAIEKTLEMTKDNKELRDFFANNK
FT                   EFLPNAALGIIENNPDLQKMTKDYNFDKQMLNIVGEMMSKPEMAHDIMLDVNKGDYMSV
FT                   TNSLISALNDPSFKLKDTLVQQSKDGLFDNLFKGIVDVDAKGSGDIKKQLENYGLQTED
FT                   VIKLSKVMPLLLDKPESLQKVFGSFIKGDYTGIAKELFTLTKDNPEIQQYLNDNKGIFA
FT                   KVGVKVGLDYVTQAVTNMFSGVTQPVEDKITDKNILIDQAVDKIFLQAKSESKQNLPNK
FT                   KEFANEVKTLCKENPELENYIVEKLSSKPISSVGDVSTPKTNQYKHASDYTNSPLQVLN
FT                   SLYENLVNKQDIKAGLLANMLSEQVSQKLFDKGDNRGEDFHMINQTLKQVISEHIKENP
FT                   NIVDHFSKPKNQEKLINNIANTLNAKSKYTWAGLATGGIYLPKEIFNNELKDNLKAEFK
FT                   NNFHSNTLAEAKNMTSNLSEQIVINTSHKLSPSFNTPILHNKNTQEKQR"
FT   gene            736710..737096
FT                   /locus_tag="A1I_03920"
FT   CDS_pept        736710..737096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03920"
FT                   /product="Iron-sulfur cluster assembly transcription factor
FT                   IscR"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79137"
FT                   /protein_id="ABV79137.1"
FT                   /translation="MAILEMASNVGDEPITLNEISLKQNISLNYLEQIFSKLKKANLVK
FT                   AIRGPNGGYILIGKLEEIKISNIMDAVNENFIMTGCYKKSIKNCASNTIKCNSHKLWKG
FT                   LGKHIRDYFENISVKDALNLNLNI"
FT   gene            737093..738211
FT                   /locus_tag="A1I_03925"
FT   CDS_pept        737093..738211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03925"
FT                   /product="NifS-like protein"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79138"
FT                   /protein_id="ABV79138.1"
FT                   /translation="MIYLDHNSTTPIVPKVKEYVISLMDKEFNASSIHRSGVFARNIVE
FT                   EARFQLATALGISLFSREYDITFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYNHIKH
FT                   APNIKIIRVDKQGVVDLEHLEKLLAQSTVSKKLVSVMMANNESGVLQDLAKISEIAKKY
FT                   DARFHSDLVQSFGKIPTNIKELGLDFATISGHKIGGGQGGAALISTSRFPLTPIIIGGG
FT                   QEKSVRSGTENVLAIAGFGLAAELMKENIVENHVKLQSLQEALEKKLKKYQSINIISEG
FT                   VKRLPNTTLFTVSGTDAQTKLIGFDLRYICVSSGSACSSGKISKSHVLTNMGLDEEEVK
FT                   SSIRVSFGHNNTIDDIKAFMRAFKEVYNVIPA"
FT   gene            738430..739662
FT                   /locus_tag="A1I_03930"
FT   CDS_pept        738430..739662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03930"
FT                   /product="Cysteine desulfurase IscS"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79139"
FT                   /db_xref="GOA:A8GWB2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWB2"
FT                   /protein_id="ABV79139.1"
FT                   /translation="MNTQLNNLILPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVEEARGDIAKLIGAEAKEIIFTSGATESNNLAIKGIAKFYGNKKNHIIT
FT                   VVSEHKCVLDACRHLEQEGVKVTYLPIKPNGIIDLEVLKNAITDQTMLVSVMAVNNEIG
FT                   VIQPLKEIGKICREKGVFFHSDIAQGFGKVPIDVNECNIDLASISGHKIYGPKGIGALY
FT                   VRKKPRVRITPLINGGGQERGMRSGTLPTPLIVGLGTAANIAYNEMEKDTKHVNHLFDK
FT                   FLDAINSQISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSMGVDEELAHTSIRFGIGRFTTEQEIDYAVKLICSKINKLRDLSPLWEMMQEG
FT                   IDLKKIKWATH"
FT   gene            739825..740220
FT                   /locus_tag="A1I_03935"
FT   CDS_pept        739825..740220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03935"
FT                   /product="scaffold protein"
FT                   /note="COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79140"
FT                   /protein_id="ABV79140.1"
FT                   /translation="MAYSKKVIDHYENPRNVGSLDKEKKNVGTGLVGAPACGDVMKLQI
FT                   EVDDNGIITDAKFKTFGCGSAIASSSLVTEWVKGRSIDDAEEIKNTEIAKELSLPPVKL
FT                   HCSLLAEDAIKAAIADYKLKKENKKDS"
FT   gene            740224..740559
FT                   /locus_tag="A1I_03940"
FT   CDS_pept        740224..740559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03940"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79141"
FT                   /protein_id="ABV79141.1"
FT                   /translation="MKKSVISLTDSAAKQVQLLIEKRNKPTYGIRVGVKSGGCAGQTYY
FT                   VEYADNKNQFDEVVEEKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCG
FT                   CGKSFSV"
FT   gene            740624..740878
FT                   /locus_tag="A1I_03945"
FT   CDS_pept        740624..740878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79142"
FT                   /protein_id="ABV79142.1"
FT                   /translation="MTQACVLKPDAKGRITLGKLAKGVSSFHVMINSKKGQIILEPYTE
FT                   ISLKESWLFNNKKALEQLNNGIKESAKGQVKYIEDFYTR"
FT   gene            740875..741021
FT                   /locus_tag="A1I_03950"
FT   CDS_pept        740875..741021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79143"
FT                   /protein_id="ABV79143.1"
FT                   /translation="MNLKNWLRRLCKSSDAHVLSIRSALRLTVSLLFSKLIFVYVSFKS
FT                   TSS"
FT   gene            740993..741181
FT                   /locus_tag="A1I_03955"
FT   CDS_pept        740993..741181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79144"
FT                   /protein_id="ABV79144.1"
FT                   /translation="MFLSNPRHPSLNTHKYKSIKGNNGEEIFEAYAENNTPAAYRIFWH
FT                   YGPKKDNITILTITAHP"
FT   gene            741379..741630
FT                   /locus_tag="A1I_03960"
FT   CDS_pept        741379..741630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79145"
FT                   /protein_id="ABV79145.1"
FT                   /translation="MKTKIEKLQKLPVPKHIGIMEENYLSLEFIILQTFNPQKFFVENL
FT                   DSNFAIEKSNNAFNEIALLNEEMPAMGEVPKLLTVEQI"
FT   gene            complement(741700..742923)
FT                   /locus_tag="A1I_03965"
FT   CDS_pept        complement(741700..742923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03965"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79146"
FT                   /protein_id="ABV79146.1"
FT                   /translation="MPSSAFLIAFFVSIIRYYDYALFGLSAHILAQNFLPRSTHETQLL
FT                   GFFALLSAAVVIRPLGSIIFGYIGDRYGRTKSIKISMFISSISTLLIAVTPSFDKIGIL
FT                   ATIMLTFCRMIFLASLAGEVDGIKVYVAEKTKNNRKNLGLGVVASCTQIGALLAAMAYY
FT                   CATNLNIYYLWRINFLIGATFGLFAILMRSYFEESREFLYNKNKQSDNIPIFQSLKNSK
FT                   KSFILALLINGTIGGIYHFLVYFLGVFLAKIAFINPIETEFMNISLIITYGIAAIFAGM
FT                   LADKINPLKQIIFALLLSLVTAFTMQTLLYQQIFTVICPIILIGLAAFYAVPLQIIVQS
FT                   LFKTAIRMRLYSLSHSLGGIILSSSTPFFSMLLWQNFKSLWVTFSFFTFLLIILTIAVL
FT                   VLRKTITR"
FT   gene            743118..744095
FT                   /locus_tag="A1I_03970"
FT   CDS_pept        743118..744095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03970"
FT                   /product="Cell filamentation protein Fic"
FT                   /note="COG3177 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79147"
FT                   /protein_id="ABV79147.1"
FT                   /translation="MNNKPPFQITNKILELLQDISYELGILVGSKLYHAPIKLRKNNQI
FT                   KTLQSSLAIEGNTLSIEQVTDLINGKRVLAPEKDILEVKNAIELYDNLAIFNPFGIDSL
FT                   LKAHKILMQGLITDNGYWRKGNAGIFKGTELVHFAPPPSRIPILMQDLFEFTTQDSNTS
FT                   LIIKACIFHYEFEFIHPFSDGNGRIGRLWQQLLLMQNNRIFEYISVESLIRNNQSKYYS
FT                   VLSKCDKLGESTLFIEFMLDQILAALKLYSNNIIYEANSPLSRIEFTKTALTNKWFTRK
FT                   DYIAVHKNISTATASRDLAYGLEQGILMSKGEKNQTYYKFKEVL"
FT   gene            744097..744462
FT                   /locus_tag="A1I_03975"
FT   CDS_pept        744097..744462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79148"
FT                   /protein_id="ABV79148.1"
FT                   /translation="MVWFLSSLRGDATHRRSNLIKQYDIPKIATLLAVARNDVFKLHNK
FT                   IQTGINMKKFMKYLFFAFLYIAVTIIVAYMVLAQTIPDDGQCHMVDRPLVIHYIVAAVI
FT                   TALPTLVLIYSKKKKKK"
FT   gene            744464..745075
FT                   /gene="ruvA"
FT                   /locus_tag="A1I_03980"
FT   CDS_pept        744464..745075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="A1I_03980"
FT                   /product="Holliday junction DNA helicase motor protein"
FT                   /note="COG0632 Holliday junction resolvasome, DNA-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79149"
FT                   /db_xref="GOA:A8GWC2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWC2"
FT                   /protein_id="ABV79149.1"
FT                   /translation="MIGKLSGRVDSSYDDYVIIDVSGVGYRVFASAKTLSKLSEGESYK
FT                   LFIETHVREDHINLYGFLSLEEKSFFNLLQSVNGIGTRMALSILSALTPTDIQIAINNE
FT                   DKNIFKAISGVGAKLAERIVRELSDKVAKISSSSAAIKDSLNIKGITPVASSEVIKALI
FT                   NMGFSRFEAQNAVQEIITKNPEISIDELIRTALKNRNSNF"
FT   gene            745138..746307
FT                   /locus_tag="A1I_03985"
FT   CDS_pept        745138..746307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79150"
FT                   /protein_id="ABV79150.1"
FT                   /translation="MLSLKEFLQNIKADKALKYLEKNPDTLNIKDTDLLTNQITHLINI
FT                   LKSDRVIKKLVYNLSFMNEQNIVPLAGFLKDQACPVVSVGFVNHNLLRFGQKELNIISK
FT                   EVSEIFKINIFFKEIILCDIHLGDDKLSTLIDGFNKNLSLESLKIICVNIKLATKEIID
FT                   KFNNYISNSNLKELNISRNPIASENIVKILKVIKEKSTISILDIGGMFLNNSSIDAICS
FT                   SFGTRISEFIFSLNPITDASKEKLLVSVKNNKTLINCKIWGYREGSLSVDEKDILQEKI
FT                   NQITNKNKKILEEVIQFLKDFYETPEILHKSTIHNHLKLYKKLNLDYLKVKLEELNTVN
FT                   IEPIIQNAEKYTNEYFFDMVGVAKQTDFGNLPKEPIGHIASYLEFSDIL"
FT   gene            746374..747402
FT                   /gene="ruvB"
FT                   /locus_tag="A1I_03990"
FT   CDS_pept        746374..747402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="A1I_03990"
FT                   /product="Holliday junction DNA helicase B"
FT                   /EC_number="3.1.22.4"
FT                   /note="COG2255 Holliday junction resolvasome, helicase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79151"
FT                   /db_xref="GOA:A8GWC4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWC4"
FT                   /protein_id="ABV79151.1"
FT                   /translation="MTSILSPEKSQNDQELPLRPSYLQEFVGQQQIKENLSVFIRAAKS
FT                   RGEHLDHTLFYGPPGLGKTTLAKIISNEIGGNFKSTSGPAILKAADLAAILTNLEKNDV
FT                   LFIDEIHRLNTSVEEVLYPAMEDFELDIIIGEGPAARSVKINLPQFTLIGATTRLGLLS
FT                   NPLRDRFGIPMRLNFYNTEELKKVLNRASKLLDIDLTDSGSEEIARRSRGTPRIALRLL
FT                   RRIRDFAAVNNQLEIDKEIANFGLNRLEVDIIGLDSNDYRYLKFIADNYNGGPVGIETI
FT                   AAALSEQRDALEETIEPYLIQIGLLQRTPRGRVITATAFEHLKIPLPTSPTHQFNIFND
FT                   NE"
FT   gene            747395..749158
FT                   /locus_tag="A1I_03995"
FT   CDS_pept        747395..749158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_03995"
FT                   /product="Multidrug resistance protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_03995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79152"
FT                   /protein_id="ABV79152.1"
FT                   /translation="MNNNLDNDYQAFYIIKRLIKNHIKPYATKIYVAIFCMAVAAICTA
FT                   IIVHAVRPIIDKIFLTHDRRMLVIMPIVLIVTFFVKGISEYYQNYLIKFVGQRVLNDLQ
FT                   IKMYEHLLFADISFIQKQSSGRLISRFTNDISLMRGAVSNLLVGCAKHFLTVVCLIITM
FT                   FNVEPLLSCVVFLVFPLAVYPVQKMGRRIRRIFARSQEELGHYTSKLDEAFQSIKIIKS
FT                   FVGEKIESKRAVLIINNILEYYKKTSKLDALVSPIMEGLSGLAVGGMVWYGGTLVLDGK
FT                   TTPGALFAFLASFAAAYRPFKSLVSLNINLQEGIAAAKRVFSILDTEPLIKDHSNSKEI
FT                   DLSDAQITFEKLALSFESKLAIKHIDLKLKPNKMIAFVGRSGSGKTSLSNLLARFYDPT
FT                   EGRILINTYDIKDIKLTSLRSQIALVTQDTHLFDTSVAENIAYSQPNATQEEIIKAAQY
FT                   ADAHEFIMQLPNGYDTQIGVQGTTLSGGQRQRLSIARAFLKDAPILIWDEATSSLDQSS
FT                   EQKILESLKKLRKGKTTLIITHRLSSITDLDNIIVMKNGAVCEQGNHKQLLDNKGEYYA
FT                   LYNKELREMLD"
FT   gene            749256..750500
FT                   /locus_tag="A1I_04000"
FT   CDS_pept        749256..750500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04000"
FT                   /product="AmpG"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79153"
FT                   /protein_id="ABV79153.1"
FT                   /translation="MLITRIFKDYRLFEILILGIVSGMPLAIIFTTISVWLKESGVDIA
FT                   VITTFGIAKLSYSLKVFWSPLIDNFKVPFLSRWGHRKGWLILCSSLMALVLIAMGRENP
FT                   AASLTALYFLTIALGFLSSTFDIAVDALRIDKFEEETQGIASATAVFGYRIGMLITGGG
FT                   ALYFAEITNDNWQLTFFVIGIIFAVSTIFIITVKEKELVREKIKFTSIASWIHTVISPF
FT                   KDFFKREFAITILFAVIFFKLGDSMLLSIASPFYIELGYTKSEIAVIVKLYGLIATLVG
FT                   GFVGGIVMYRFNNFKGLIITGILQSITHFAFIWLNGQPPSFGALLITITIENFAAAMGT
FT                   TALVGYISYLCNKKYSATQYALFTAASSLCNNTVTIYAGKLVNMLGWNGFFIFTIILAL
FT                   PALFILMYLNKKVNV"
FT   gene            750615..751538
FT                   /locus_tag="A1I_04005"
FT   CDS_pept        750615..751538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04005"
FT                   /product="Penicillin-binding protein dacF precursor"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79154"
FT                   /protein_id="ABV79154.1"
FT                   /translation="MFRKILLPYIFVIISLLTQVSEAKKAVKNSSKVPIPVQTSLVIDA
FT                   KTGKVLHAHNSQIRIYPASLTKLMTLYVMFELIELGKLSLDKKLLVSAKAAKMPPCKIG
FT                   LRAGDTITTREAINMLIVKSANDAAVTVAENIRLSEKDFAHLMNIKAKQLGMKNTYFKN
FT                   ASGWHDPLQQTTARDMAKLTLAIKQKFPKYYPLFSKTSFVFRGNVINGHNKITKNYAGA
FT                   EGMKTGFHTPAGYNLVTTASRNGKSLIAVVTGGRSAGSRDQKMIGLLDQHFNVASAKPK
FT                   VTLASNNKVKAKPKPKIVIKKGVMRS"
FT   gene            complement(753095..754591)
FT                   /locus_tag="A1I_04020"
FT   CDS_pept        complement(753095..754591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04020"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305 Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79155"
FT                   /protein_id="ABV79155.1"
FT                   /translation="MARNKTNNDKNIANDEASTVLARVLPSNVQAEQMLLGAILTNNEL
FT                   LNYVSEFLRSEHFFEPIHQKIYNGIEVITEKGLIATPITLRSMLANDELFHEMEGAEYL
FT                   AKLVTMSMMVINPIDYGKIIYDLAIKRYLINIGEEVVNDAYNSSLEFEAKEQIERAESK
FT                   LYDLASEGINEKSFTKIAIPISESIASINRAMKNNDHVIGISTGLIDLDSKLFGFHNSD
FT                   LVILAGRPAMGKTAFALNLALNACNNMLIKNKRDNEEVQSVGFFSLEMSSEQLTTRLLS
FT                   MSAGIDSTTLRTGMINEANYNRLRKEAIALSELSFFIDDTPALTISAIRTRARRMKRKH
FT                   NLGILFVDYLQLIRGVSKSDNRVNEVSEITQGLKAIAKELNIPVIALSQLSRAVELRED
FT                   KRPMLSDLRESGSIEQDADIVMFIYREEYYLSRKEPAASDPKHAEKYAEWQDNMSKAHN
FT                   ITDIIIAKHRSGPVGNVQLFYDSQYSKFVNLETKYPVHPR"
FT   gene            complement(754619..755011)
FT                   /locus_tag="A1I_04025"
FT   CDS_pept        complement(754619..755011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04025"
FT                   /product="hypothetical protein"
FT                   /note="COG4374 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79156"
FT                   /protein_id="ABV79156.1"
FT                   /translation="MKQKMSSVIFDASALLALIKNEPTNLKLETFLGNICMSSVNISEV
FT                   ASILLDKISYQECKDIIEPLINSIIAFDQEQSFLAANIKKQTKHLGLSLGDRACIALGL
FT                   ATGYPVYTADKAWAKLQVNCKIILIR"
FT   gene            complement(754992..755237)
FT                   /locus_tag="A1I_04030"
FT   CDS_pept        complement(754992..755237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04030"
FT                   /product="hypothetical protein"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79157"
FT                   /protein_id="ABV79157.1"
FT                   /translation="MVNSAKIAKGGKISIPASYRKQLHLKEGDKVVFILKENEMIISPL
FT                   SIALKKSRNIINKYYSPEESLVDKLITERRNEAKNE"
FT   gene            complement(755306..755866)
FT                   /locus_tag="A1I_04035"
FT   CDS_pept        complement(755306..755866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04035"
FT                   /product="aromatic acid decarboxylase"
FT                   /note="COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79158"
FT                   /protein_id="ABV79158.1"
FT                   /translation="MKKIIIAISGASGAIYGIRLLEVLKEQNIETHLVISDGAALTIKA
FT                   ETEYSIEKVKALANHHYSNKDIGAAIASGSFKTSGMIIAPCSMRTLASVAHAMEDNLIT
FT                   RAAGVVLKDKRKLVLMTRETPLHIGHIENMLKVANYGGIIAPPIPAFYSKPKEIDDIVN
FT                   HSIARVLDLFDIETNLIKRWSGL"
FT   gene            755930..757876
FT                   /locus_tag="A1I_04040"
FT   CDS_pept        755930..757876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04040"
FT                   /product="primosome assembly protein PriA"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79159"
FT                   /protein_id="ABV79159.1"
FT                   /translation="MQIAKILLSAVKLFPLDYLIPEDLSLNIGDLVVVPFRNKELTGIV
FT                   WEFSNVPEVKKLKTIKEKVPLNLTITSEVLDLIKWMSNYYMAELGSIAKLVLPVDIAEK
FT                   PIKVKEQKINNNFTLPDLSEEQKQALQMLNDSNKPILIKGVTGSGKTEVYFHLIAEYLA
FT                   KGKQALVMLPEIALSTQIINRFKERFGFDPIIWNSSVTKAQKKMILRGILEDKVKIVIG
FT                   ARSSLFLPFKNLGLIVIDEEHDDSYKQDDGVLYNARDTAIVRSTFDKAQIVLCSATPSI
FT                   ETMYNANIGKYSVINLSSRYKNAVLPNIEMIDMTKEELPKNCYLSNILIKAIKNNLENK
FT                   EQTLLFLNRRGYAPLMLCKSCGHKFTCKYCSSWMVVHKSSKKLECHHCGYQSKIFNSCP
FT                   ECLEDESLAICGPGIERIEEEAKTLFPNSKIAVISKDHVKNPEKIAQLLHQMENLEIDI
FT                   LIGTQMITKGYHFPNLTLVGVVDADLGSNHADLRSSERAFQLLHQVGGRAGRGNSKGMV
FT                   YLQSYYPDNIIFSYIKDEREDNFFVNELEVRKAAYMPPFSKMASVILSGTNEHKILEVA
FT                   KNMVRIAPEAQVKILGPASSLMSKLAGKYRFRILIIADKKFNLQKYLKFWLELIKIPSF
FT                   CHIKIDIDPKSFY"
FT   gene            complement(757818..758222)
FT                   /locus_tag="A1I_04045"
FT   CDS_pept        complement(757818..758222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79160"
FT                   /protein_id="ABV79160.1"
FT                   /translation="MGIIQDITNIFKTKPKKEQDKAAVDRREKQDALHKAFSDIQQQRL
FT                   HGIISTLKELSTNEEIKANLKQTRHYKEFEEKVTDIIETYNRKLDHIDPSIKESQKLTV
FT                   LPIVEAKLNKEVSKNFLGRYLFLCDKRMGF"
FT   gene            complement(758453..759337)
FT                   /locus_tag="A1I_04050"
FT   CDS_pept        complement(758453..759337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79161"
FT                   /protein_id="ABV79161.1"
FT                   /translation="MKQKIYKLKSNTLSRFLIGIACRNQNDSIAGLFVNTDPYDSIMCR
FT                   ETEFQAKKIELLINQGYENEILKIANIYQQKQNLSIFQSVQEIVKYIQSLKEDEASKFT
FT                   RISGLDKLSPKGWHEGEKHNIMANIQRDFIKNGGKRGKEYAITALALYNLEIAIIESSK
FT                   TDSYWGVKAEYVSKIGKGANELGTIHTIIGKELKEAAKDISTGKFIYNGIELDLELVEK
FT                   KQKEIEKARSDEKLNIMNIKYNHDKFNTIEIFPIKKYRNRTQQQTQHYNTNSTSLAPSL
FT                   TPNYTPKNKAHIR"
FT   gene            complement(759356..759910)
FT                   /locus_tag="A1I_04055"
FT   CDS_pept        complement(759356..759910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79162"
FT                   /protein_id="ABV79162.1"
FT                   /translation="MQSLRSEKDSFPQLENYKSIEDILSKELAEEKRIPSIINNLKELL
FT                   QADIIEMLKQNQNYKEFKEKVNNIINTDSKKELPLLKQKLRDLEEWCDKNINTDKTHIL
FT                   RNFGKVVKHAILAILNAGNKTTFEREKKKINFYLHAIKNSRQNISITVEKIRNVIKHTP
FT                   SDSIRFIPNKNHISREQNKSK"
FT   gene            complement(760298..762382)
FT                   /locus_tag="A1I_04060"
FT   CDS_pept        complement(760298..762382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04060"
FT                   /product="Ankyrin repeat"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79163"
FT                   /protein_id="ABV79163.1"
FT                   /translation="MHKDTKLLDEIKNIKSKLKSGKPAVAPKPTPKQIKAWEETHKSHL
FT                   NLDTKNSSIPVPPPMPDHVLLQTSKTLSVSTLPNIKFNTINQAKFLKAIEDYDLDKIKE
FT                   LISSNTIKIDSFGKRGKLGKTPLQYAIINDKPELAKLLIDAGANINVKTQNGRNLFELA
FT                   MYNSASDQTFELLLKTNININSMDLRALSRLHNKLFSILLKPANDINTTIGKFNRTLLH
FT                   QAAERNNIKKAQISINHNINVEAQDITGETALHMLKTSKMAKILLKAGSNTEAQNKLGR
FT                   TPLHNAILQANKRQVNIKNIHNIVLKLIKSGANPNAVDYYGFTPLEYAIRINDSKIFKL
FT                   LIKNNAKFKKNRYELFCQALESGNLTATKYLFKKEFLNNINDKNGQNYLYYIATGGNKE
FT                   VLEYLVKKNHDNGKKILTQFVDKQRNTPIHIAAQNGQFEIIKNFQKLGFDINARNADGE
FT                   TVLHILARAQNGEMIKELIKLGADINIKNKIGKTALDKVEEDFKGISKKISNKQLQELF
FT                   EESNIIARTGRIEDETKYLYQYRQDGYYKNIEREGNRGRSATLLVPEVNISLFFTGIGL
FT                   LYNANDSTIRHFMPHDFWTDNARRTEDFFNMRLDNKKFVQTHSKEKFLKTYKNFLKDNP
FT                   QKDYNEIIANLYPKGLIGIALQNDDLEHKLYALEAKYYVSEKYNMDLPMTIVKNKKLIP
FT                   "
FT   gene            762697..763674
FT                   /locus_tag="A1I_04065"
FT   CDS_pept        762697..763674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04065"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG0113 Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79164"
FT                   /protein_id="ABV79164.1"
FT                   /translation="MYPLIRLRRNRKAAWLRDLVAETTLRVEDLVLPLFVVEGHNQRQE
FT                   IKTLPDIYRLSIDQVIETARKAADLGIKAIALFPCIDQSLKNENGDEAYNLDNLMCRTI
FT                   RSIKNAGINIGIICDVALDPYTTHGHDGIIHNGEVDNDKSVKALCNQALTLAKAGVDIV
FT                   APSDMMDGRIMAIREYLDKEHFINVGILAYAAKYASSFYGLYRDAVGSTKKTYLDKASY
FT                   QLDIRNIKEAMLEIEHDIAEGADMVMVKPGMMFLDVIREAANNFNTKIFAYQITAEYAM
FT                   LKFAANAGAIDFEKGLLESLISFKRAGASGIFTYAALEAAELYL"
FT   gene            763828..765423
FT                   /locus_tag="A1I_04070"
FT   CDS_pept        763828..765423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79165"
FT                   /protein_id="ABV79165.1"
FT                   /translation="MATSNKPLLKNRVESLEPELSLDKKSAFKDWKFLKPKSGGANEAG
FT                   EYGGVYQNADGNITAMIKQEASSSKNIAEFLGSKFFAAISPGNGAEVSLIAPDGFSKSK
FT                   NSDSQIYVKSEFFKNYSSDMYVDMDKHMSAETKPSSWFRKDGGRPLFMGARNKLFRTLE
FT                   NAFKEVKYQNFENIMPTSLLIGDFDIHVGNIGVIRDEKNPKILPKLVRIDFAGSFDKLT
FT                   NQIYSHSRMRHLPGFGPTNHFREFPSKLRRSPELGDSLIAASKINLTKTINESFDELTK
FT                   YYSDEAIANFANQAMPGLFKKSEKITPQQVKDSLLDVMLKRQESLKEYGLEIKLTNVIS
FT                   KKYTYPYFEIKEQELKSLMKEHPNYFEKILKGEERKIGGKKLKLRDKVSSTLNKILETL
FT                   GIRPSAKKHLIKTIKSLNEEVNNEKDLIDFSKEVETKKVKAPTKEKAKAKEKAKAKEKA
FT                   KAKEKAKAKEKAKAKEKPNLLDLNEEDLKAIKHLKEEILKPTKLKAVETTKQDSKSKTA
FT                   HQKDASKAKKIMQK"
FT   gene            765567..765641
FT                   /locus_tag="A1I_t07989"
FT   tRNA            765567..765641
FT                   /locus_tag="A1I_t07989"
FT                   /product="tRNA-Asn"
FT   gene            765874..767664
FT                   /locus_tag="A1I_04080"
FT   CDS_pept        765874..767664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04080"
FT                   /product="Outer membrane protein Sca15"
FT                   /note="COG4625 Uncharacterized protein with a C-terminal
FT                   OMP (outer membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79166"
FT                   /protein_id="ABV79166.1"
FT                   /translation="MFNKLNRCTLALMLLTSSMSFSALPTKVVDPNYEYFDDDILNVIE
FT                   NRVGNNNPNIHIVPIYPINAPDEFVEPAAMEIANNLNNGKVSLIYNNLGGHWTASVIRK
FT                   DASGAATLYYNDPNGGSYTSTSLLKAIRTLRPDIQLRDLQIHQQSDGTSCGAFTAEDLV
FT                   VLAEMNDDELTLESARALLSNIKDAQMLRNKHAGIVTQENREYFEDEDKDKEEVFNSAK
FT                   DKKFVEQLRKALPGSDAEKFGNSLDELIEEQQVKEAFSKLTDRPKERNSEIIRAALRHA
FT                   LTDTHNSAMSAIHSRLSNGPLVVAAGDDDVAGDTWQHGVWARASISHSKDKASNKTAEY
FT                   FSGYKTKGHSNTIGVDTLINDNLLLGLAYTNAYTSIKPQNQNAGNVDKARTNMFSLYSS
FT                   YNIPNYNWFVDGTISYAESVIRGKNVRNGNEVASSKYKSHLYSGSVSLGYNYHTSNDIY
FT                   ITPSLGMTGSLIKDSGYKETGTNFQNLNVAKKHYNKLSSTLGVRTFKNINQGKLTITPE
FT                   LYSFVNYSLKNKTPSVNAQLQGIDETLPTINFKSNKVDYNLGVGLSLKHNMMEYGINYT
FT                   ATFAKKYEAHSGSLKVRVNF"
FT   gene            768114..768302
FT                   /locus_tag="A1I_04085"
FT   CDS_pept        768114..768302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04085"
FT                   /product="Transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79167"
FT                   /protein_id="ABV79167.1"
FT                   /translation="MIKYHKHIGIDIGKYNFVVGIEGIKDTKEYENTSSGIFEFINDNK
FT                   DILANSLTVVETKADMN"
FT   gene            768308..769069
FT                   /locus_tag="A1I_04090"
FT   CDS_pept        768308..769069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04090"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79168"
FT                   /protein_id="ABV79168.1"
FT                   /translation="MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGK
FT                   ERADKLEVFKPESKQNIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDV
FT                   LSNQITEITNQVEVIISSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIV
FT                   SLAGLAPKANDSGKYQGYRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGK
FT                   KKMVALTALMRKIIVIANAKLKSLLFNLKHS"
FT   gene            769411..771252
FT                   /locus_tag="A1I_04095"
FT   CDS_pept        769411..771252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04095"
FT                   /product="Aminopeptidase P"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79169"
FT                   /protein_id="ABV79169.1"
FT                   /translation="MVKERINSLRNLFEEHSIDGYIVPSNDKYMSEYVPEYAKRLEYIT
FT                   GFTGSNGMAVICKDIVLFFTDGRYLEQARKELDLKLFKIFDLKDISKFAWKDYLSRAGY
FT                   DPELFTYPAIANLLDSMDKPWDDNLQKIKGNLIDKIWQDQPLEPNSQVYLHDIQFAGVS
FT                   HIEKIDKCRNTSSRGLSTGSRKIDTEEYSLIILDSSSICWLLNMRASDVAYTPLMFAKV
FT                   IITPEKLYLFINPARISPEIIKERPEITILPEEEFENILKDQDNIFIDDSIASIHIMDL
FT                   ITDKKVHKIKDPCLMLKACKNEVEIKHAINFHIKDAVALCEFFADLEESSHCKKTQSVD
FT                   EAISGEYEEIATQSATARNDEILNEYTLGLKLTEYRAKQGGYVSDSFPAICGFRENSAV
FT                   IHYRADAKTAKKIEGQGILLIDSGGQYKGATTDITRTITIGTATDEQKKRYTQVLKGHI
FT                   ALAKAKFPKNIITGANLDILARQYLWQDELDYPHGTGHGVGSFLSVHEGPQSINLRNKT
FT                   ILQAGMILSNEPGFYIPREYGIRIENLIYVKENNGWLEFETLSLVPYAKELIDVKLLNN
FT                   DEISYIKHYYQKIKTQIHHLLSPAAKEWLDNEINLFL"
FT   gene            771466..771540
FT                   /locus_tag="A1I_t07991"
FT   tRNA            771466..771540
FT                   /locus_tag="A1I_t07991"
FT                   /product="tRNA-Gln"
FT   gene            771840..772475
FT                   /locus_tag="A1I_04100"
FT   CDS_pept        771840..772475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04100"
FT                   /product="Leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79170"
FT                   /protein_id="ABV79170.1"
FT                   /translation="MLKDKPVSDIRFFRAKIIDIDNFVNVFKTHISLTSVTLTGSIPTE
FT                   YPEKTASALSELIMTTTTITYLNLSSNELLGNRTGIYSGIFSPDRGVPALSKAIGINNS
FT                   ITNLDLRDNELIDRDIFFLAEACKKNTSLKTLNLSWGYISKQGGEFFLDAFEINYSLTT
FT                   LDLSHNFSTVDYISEKIEKYLERNKSKELNRNNELTENKTQNFETEIF"
FT   gene            complement(773015..773091)
FT                   /locus_tag="A1I_t07993"
FT   tRNA            complement(773015..773091)
FT                   /locus_tag="A1I_t07993"
FT                   /product="tRNA-Arg"
FT   gene            complement(773308..773721)
FT                   /locus_tag="A1I_04105"
FT   CDS_pept        complement(773308..773721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04105"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79171"
FT                   /protein_id="ABV79171.1"
FT                   /translation="MARKNDIIQKIDSFIGKKIYSLRLAKGLSRQQLAEVIDVTHQQLQ
FT                   KYERAINRISVGRLVLIAEALDRNIDYFFEGLEEANKPQPVHTQHQRMCIEVSRNFMKI
FT                   QSTDEQQAVNNLVKCLAGKDKLKTTTATNNNNA"
FT   gene            774062..774907
FT                   /locus_tag="A1I_04110"
FT   CDS_pept        774062..774907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04110"
FT                   /product="Putative ribonuclease BN"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79172"
FT                   /protein_id="ABV79172.1"
FT                   /translation="MKKIFNCLYIALFKTIEHDGVEHSGYMSFMVLLSIFPFLVFLLAL
FT                   TSFLGASELGQNFIQIFLESMPERATESIEKRIKELLSVPPQSLMNLAVVGSVWTASSF
FT                   VECLRTILNRVYEIKSPPPYIRRRLLSILQFLVISILITFTMFLLVFIPIVFTKIPVLL
FT                   ETIEQYKNILNFIRYVLILVLLFLGASSLYYILPNVKLNFIDVFPGALLTVILWVISGY
FT                   LLSTYIVYYNQLNLMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLMKNYNIVKKRIDEK
FT                   "
FT   gene            complement(774999..775358)
FT                   /locus_tag="A1I_04115"
FT   CDS_pept        complement(774999..775358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79173"
FT                   /protein_id="ABV79173.1"
FT                   /translation="MENIKIYFKLDDIRVISRKDLAKDEELRFLFKDKLEKLATEFLSE
FT                   AKKDIEALHEILCDEDANSKKEHRLYVYMLSDQAKKQDTQNLIYVKSPYKFSKNELETL
FT                   DIYVHLAQLLNTNAE"
FT   gene            complement(775402..775572)
FT                   /locus_tag="A1I_04120"
FT   CDS_pept        complement(775402..775572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79174"
FT                   /protein_id="ABV79174.1"
FT                   /translation="MFGQLNIVYPLLISIFLFLVVFVITKIVKYEKTLKEKNLNIIQLY
FT                   LDKKFLHNNLT"
FT   gene            complement(775632..776093)
FT                   /locus_tag="A1I_04125"
FT   CDS_pept        complement(775632..776093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79175"
FT                   /protein_id="ABV79175.1"
FT                   /translation="MSDFITDTKLYEIAIANKQHVEDRRDEINNYYISLFAALVASMPF
FT                   IEKITTNVAECNTNYITKLSLIILALIGLILAVTWASNLKHTVSYLKSLDKIIIDLEQK
FT                   YNKPFITNIVRDLERSKTPQRVTKHQLVIPYTFISIFSLIIIYSVIQII"
FT   gene            complement(776116..776832)
FT                   /locus_tag="A1I_04130"
FT   CDS_pept        complement(776116..776832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79176"
FT                   /protein_id="ABV79176.1"
FT                   /translation="MINLRKYQVHMKLQEKFKLLEPTAFGPWLAAFKKLFLSEELAQDI
FT                   EQIQPDELKEYNTKISELKDERTKLNYELIPTNEISKEIAQLEKKAKNVPCKALLILSN
FT                   NVIEVNDNVVATGGDVRRVDKYKANINLSFNEICNKQMEDFYKLITQLPEDRKEWSSYL
FT                   QKLEKDKGYNPAEAVKKVVDINRLVKKFEQSSNKEYHNNFKLVADGTNKLLDYIDHLPQ
FT                   EVPLTGQEESHIIAHM"
FT   gene            complement(776837..777061)
FT                   /locus_tag="A1I_04135"
FT   CDS_pept        complement(776837..777061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79177"
FT                   /protein_id="ABV79177.1"
FT                   /translation="MKLQSKIQFFQAVLKKPKLIKKFGKPVNKEYNKYFEPIRVGTNAL
FT                   LGYLCNLIKEVSDIGNSNDLYITYGCIGV"
FT   gene            complement(777224..777463)
FT                   /locus_tag="A1I_04140"
FT   CDS_pept        complement(777224..777463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79178"
FT                   /protein_id="ABV79178.1"
FT                   /translation="MRLSKEFLDFLIKLPKDHREFKDYFAKEEKNIEFFKNISDKNQLI
FT                   EELKYSGHYSQIKESIQEIEAYLLGQYNYGCSGV"
FT   gene            777851..778789
FT                   /locus_tag="A1I_04145"
FT   CDS_pept        777851..778789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04145"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /note="COG0331 (acyl-carrier-protein) S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79179"
FT                   /protein_id="ABV79179.1"
FT                   /translation="MKTAFIFPGQGSQAIGMGNDFYDNFKSAKETFQTIDEALNRKLTD
FT                   IIFNSTSEELTLTTNAQPALMAVSMAIINTIKAETNKNIVQLCDYVAGHSLGEYSALCA
FT                   AESISIETAAKLLHTRSSSMQEACPANFGAMAACIGISIDKLEKIVKESKCEIANDNIE
FT                   GQIVISGKVEAVDHAINLIKEAGYKAIKLKVSAPFHCSLMKPAEEKMRIALDNSVITKP
FT                   LIPVIQNYTAKPVLEPLEIKQNLVLQICGRVRWRETLELFNELNITHIVEIGAGNVLTN
FT                   MLRKINYPFKLSNISNVEEMKLFLQAYETAN"
FT   gene            778773..779687
FT                   /locus_tag="A1I_04150"
FT   CDS_pept        778773..779687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04150"
FT                   /product="hypothetical protein"
FT                   /note="COG0107 Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79180"
FT                   /protein_id="ABV79180.1"
FT                   /translation="MKLQIRFFANLYNFLIEDYPLQPNKENIIKLSKSLFKNSAEVNFL
FT                   LQNIHILDLPYCEPNRVEAIKDILKLYILKSDKLNINIPKFKYKIRYDKFLKQHVTEKI
FT                   LQPPIKELDTSYVLFRNYSPQELTILREKGNNLLFFNSKLCEVIKLLNFINQFFVVDHS
FT                   KVSYCILDIASRFYDEEDLKIFLDSEIDIELNYIGIITNHECKNLDSFINSKQVAYNRF
FT                   LILYHEAFKSFDKKELTILFKACSNNNNLVKSLILCPNSLTLEQCIKNIENYIELHQTL
FT                   IKAPICLKKYTNEKITLEILSIS"
FT   gene            779710..779801
FT                   /locus_tag="A1I_t07995"
FT   tRNA            779710..779801
FT                   /locus_tag="A1I_t07995"
FT                   /product="tRNA-Ser"
FT   gene            complement(779808..780041)
FT                   /locus_tag="A1I_04155"
FT   CDS_pept        complement(779808..780041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79181"
FT                   /protein_id="ABV79181.1"
FT                   /translation="MSKKIKYTDGEIGTVKIVQDFLPSPKELLLKDDSVKITISLSKES
FT                   IEFFKSEAAHLHVPYQKMIRALLDKYTEHYNK"
FT   gene            complement(780016..780300)
FT                   /locus_tag="A1I_04160"
FT   CDS_pept        complement(780016..780300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04160"
FT                   /product="hypothetical protein"
FT                   /note="COG2929 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79182"
FT                   /protein_id="ABV79182.1"
FT                   /translation="MHSSFEWDEEKNKINIQKHNVNFYEAQKAFLDINRIILEDIDHSI
FT                   IEKRYFCLGKIEDNILTVRFMFRNHRIRIFGAGYWRKGKKIYEQENKIY"
FT   gene            complement(780478..780750)
FT                   /locus_tag="A1I_04165"
FT   CDS_pept        complement(780478..780750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79183"
FT                   /protein_id="ABV79183.1"
FT                   /translation="MEQATRLISPFLKLFACCFNPRIDDKLFKKLLDFINITTNVYEIF
FT                   KGSTIQEKRGFLNFVFANLQLKGGKLDYSLAFPFDKMQKIEGCPM"
FT   gene            complement(780901..781464)
FT                   /locus_tag="A1I_04170"
FT   CDS_pept        complement(780901..781464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04170"
FT                   /product="Polypeptide deformylase"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79184"
FT                   /protein_id="ABV79184.1"
FT                   /translation="MPILKIIKTPNSLLRIKSLPVTIIDSQMKDFMKSMLETMYNEEGI
FT                   GISAIQVGKPIRALIVDIPKEENDQIKREPFFIINPEVNYLSEEKVILNEDCISIRKED
FT                   GIAFIIGDVERPKNISISYIDLEGNSKELTCNGNNSDYDLWFSRCLQHELDHLDGILFI
FT                   DRLYNAKFPKTEIEISGNLQTENI"
FT   gene            781602..782345
FT                   /locus_tag="A1I_04175"
FT   CDS_pept        781602..782345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79185"
FT                   /protein_id="ABV79185.1"
FT                   /translation="MNQLITFLEEKGFIDEATSLRNGATEFKLSYIWDESVFKLSYIWD
FT                   ESVIEIAKILRTDNTLTHFELEESLVEHTGVEAIIWALQMNYTITNCTIFLADNYVEIV
FT                   GGEYAYEKRMYEDVDQIEPLIKRNKEYVKKLSLFINSLFSNDNIPFSIKNFMVLNFYSI
FT                   ADKQLLKKYLIEQQVNDIELKPYAPIISSGFPSPLFKSAMLLIALESSKLFSPNNLKIP
FT                   FPVVFQPVREILPPTAKFTAFPDTI"
FT   gene            complement(782081..782545)
FT                   /locus_tag="A1I_04180"
FT   CDS_pept        complement(782081..782545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79186"
FT                   /protein_id="ABV79186.1"
FT                   /translation="MFPQSFNLNSTGIGQCHNNTIIIGENSLDYSGYSINTINDLNGDG
FT                   KPELIIGATGYPSQQNAGQGAIYIVSGNAVNLAVGGSISLTGWNTTGKGIFRLLGENNF
FT                   DDSSAISSIADLNSGDGKPELIIGAYGFSSISLTCCSIKYFFNNCLSAIE"
FT   gene            783284..783631
FT                   /locus_tag="A1I_04185"
FT   CDS_pept        783284..783631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79187"
FT                   /protein_id="ABV79187.1"
FT                   /translation="MKELVESLEIKRVIAEVDNLRNGNDTFYLWSNQIGVEGAKAIAES
FT                   IKVNKTITYLNLHLEDKITKEIQEYIQRNVNISKGYNPQAEELKIQGNILSNKGEHGKA
FT                   IEKYNEAITNY"
FT   gene            783609..784112
FT                   /locus_tag="A1I_04190"
FT   CDS_pept        783609..784112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79188"
FT                   /protein_id="ABV79188.1"
FT                   /translation="MRQSQIIKNPLYITNKTNAEKQQAELLAKQQKQEELQFNKLLLAV
FT                   QNDKLEDAKILIQHSNIQTLSKKTDNDDNTILHIVAQKNIPELYELLIKLAPELVNTIN
FT                   KEDKTAFAMFQVQREKQQAEEYMINQRTIIEETMNLVSIGNERITEKSEKGILILNIRK
FT                   NGSW"
FT   gene            784174..785967
FT                   /locus_tag="A1I_04195"
FT   CDS_pept        784174..785967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04195"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79189"
FT                   /protein_id="ABV79189.1"
FT                   /translation="MFFKAVEPKENIVINHTRASETKIPGKLIDKDGVAIWDCPGFMDT
FT                   RSTAQEIANAFYIQKLFTTSKQLKFVLAITEADLKNKTNILPIVKQFTEIFTDIEFLEN
FT                   SVSLVITKVSNKKNLDNIKKDFDNVITQNNDNIPIKTKKMLEFLKKSIHIFHEPDEEIF
FT                   VQNTEILDTINSSTEYVDLSIKPNTANIAISKEAGECAKELFEITYSNINKLIDIFTGA
FT                   IIDPNKCMTSTDDNIFIKSSNVIESLPKSSLPVKYASFNRLPIHNDSLDPFLKLDQIKS
FT                   LQEALFKNSSNNNSNLAEDNFLKVLEIFEEFVINNEQLKQTMQNYAYAFKQQIDINKCF
FT                   SQVCGNKFVDYSHMKQALQKCKENINLVLEKEVKCLKIEDGRTRAEDGKHDIDYYKKAI
FT                   KYLDLYKDDQNCIKQKANAYKNLGHIYNNQNNYKDAVLNYEKALELNKELPDVYEKLGN
FT                   ILFNNMQYIEAIECFKVVDKSIKIENCFKELIKLKADNPTIRIDKGDYYFSIDRHDKAM
FT                   GCYRDALSLSLDDKNWLIISQKINELSKIIGIPVRFGALHQTICKITEQKQSLDDIESN
FT                   DLLVAGNDSHEVNINGASNNI"
FT   gene            complement(786141..786620)
FT                   /locus_tag="A1I_04200"
FT   CDS_pept        complement(786141..786620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79190"
FT                   /protein_id="ABV79190.1"
FT                   /translation="MKNKETYSMLFDYCRWNQPKNLKDILDKSVEVIDITLYDGELFHI
FT                   AASEKSIELLNILLNYYEKTKLYGESYTTEYLYNRTKLQDILEDIRDTFFVSPEIEQII
FT                   DKYIVLKVDSDDENTNLEDANTSETTESNESSPSPENPNLLGTESEINFDSLSQH"
FT   gene            complement(786623..786955)
FT                   /locus_tag="A1I_04205"
FT   CDS_pept        complement(786623..786955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79191"
FT                   /protein_id="ABV79191.1"
FT                   /translation="MSSIDKAFFIKDLAVRIKQTSDVKTVNKFYQIEKTFNKTLTVIDA
FT                   YSKNLAQERKKAFEEVIRDYENGDSEVNILENLLSSHKKSISLLDNGLTEEHQKLAGLI
FT                   MESTRE"
FT   gene            complement(788713..790425)
FT                   /locus_tag="A1I_04225"
FT   CDS_pept        complement(788713..790425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04225"
FT                   /product="Glutamine amidotransferase"
FT                   /note="COG2071 Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79192"
FT                   /protein_id="ABV79192.1"
FT                   /translation="MEQDGNAIYIDYRKIVPLNTKTQSIEKILEAGKAKAKEMLQNVDG
FT                   LIIPGNEVAVYPELFDSKENFGETDKECSIAESILIDVAIQKGIPITGICGGHQLINVY
FT                   FGGKLANVDELDYSKVRIDKDLELARITKNSSIVEDLESAHLPPQKFWASHKQIVKKIG
FT                   NLNFINPVAMIENEIVATESEFGAPIKTFQFHPEILSEQSEIELERNKKIFKIFVETCN
FT                   NYRNKKINLGEIKQDIEIITESQDDNHENEISVENLKDFRNSIKEISSKISTNKYSTFE
FT                   EIETNNKRLQQIIISKKINCDLNEKEIALINLGVTAKQFIEQNDDLISTLCNNFYGLKS
FT                   LVGLGFTLERLFSKDTEEQKFLIQNGYNVKTLVELGISLETLFSKDTEEQKFFIQYGYN
FT                   VKPLVELGISLETLLSKDTEEQKFFIQYGYNVKTLVELGISLETLLSKDTEEQKFFIQN
FT                   AYNIKYLKEIGISIPELVAMESEQQKFLIQYTSNVKYSIETKFPTSEQKLIIEAILIKK
FT                   LVSLSEFHNMDLNQQKSFVENTDFKGYDAPVLDQEITDMPVIGVSSEFPTDQA"
FT   gene            complement(790388..791197)
FT                   /locus_tag="A1I_04230"
FT   CDS_pept        complement(790388..791197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04230"
FT                   /product="Glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79193"
FT                   /protein_id="ABV79193.1"
FT                   /translation="MLVTFENIEQIYKLLTTTDLSTLTISTENLKILLAYNQLLDDTEY
FT                   NEENRKQLKKLLQDNFNEINLSKVAETINDHRAKFTGNIDEHLHEARLDCINYLLPKIY
FT                   ELSEAPEIKAALKDRSLPLDNIDEKLYEEILPHINELLPKICNSHEISQIKKLFNKEPL
FT                   PSKDIDQSLYEEILPYTKLLSKMYNLDEAVLSKRLATYFSNIEEIKGYLETVNYTNSDT
FT                   ILWSFQDEQKPDSSNNTKPTIRSRRGYSRGSQRTYNGTRRECYIYRL"
FT   gene            796524..797108
FT                   /locus_tag="A1I_04245"
FT   CDS_pept        796524..797108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79194"
FT                   /protein_id="ABV79194.1"
FT                   /translation="MPQKIILSDSEKILIEDFLDKKTSEEIIADSEHIKDSSNFTKNNP
FT                   LNRNTIIRLIDHYNDKHKNNKAALEESLDKLAAFAAVTKSLQVPEKLKACVEVYKEGIK
FT                   LSEVQKEIDNSEKLQKFTKAFESHVNTTTRKENKADDTNWQNRRFDSLSRLITLNSQCA
FT                   AVCYDGEEILVAFNELNYKSKSSIPKQLRQL"
FT   gene            797162..799510
FT                   /locus_tag="A1I_04250"
FT   CDS_pept        797162..799510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79195"
FT                   /protein_id="ABV79195.1"
FT                   /translation="MPLEKQDEFAEKHNLAGKREKLFLRAAQHYYENNSDQTDIFKYIY
FT                   NGDEEDLKQIRDNIKDNSAIAAAFRAKQDLMKLEDALTPDTPEKRKFNAAIIKEFEKDP
FT                   SYTLVYDGPLDNKGHAEMRIVDYLRKRSRDPNNKLNENIYIGLSKLCCTSCDVAINKSN
FT                   LEFRIKGSDGKEHKVNIDPTRGGHGEGFEWSIVNTIKDDEVKLEAFLGKDAYEIYKSLK
FT                   PEEANTALYSIVRHIAENKLKVNGAKVELIQKEDPTAPFHEKPKFAMQYAYNSASKPED
FT                   NLKRNNLTKKAKNPTSSLIPKAPTTAEYEELEKKLAELNAKLQIKDQEIENLQSKLTIS
FT                   ENKRKNVDIDVNNNDTTNKKPRTSDLLDQSLDNDIGSPLLDNQSKTQTQNLKISPELSP
FT                   YNSPQQDNEEMFFPGPDASTQQILDFDPIKYLQSSNKNNNANKITTSKDEEEDLGYESE
FT                   VPHTKGPISPSAAQIDELSPSSSPHIPFSFDSDSNLTQAEKKHLVNLLQTELDGNNKYD
FT                   LTERLAAENSNQELLNKLDREAVITANINIKAIDAQKSAEAGKVEVRGEKNHLTDHKDN
FT                   TQTLIDEIQKGVIDKNTVIAIERKQYGDNLSMKDVIKLASILEHNEKNPNNPITLPKEL
FT                   ENTPILQDAILYKTAKEHGVKVISLEGKNLEHGKASELQNENREQYMTSVISEIRSKGY
FT                   NVIANVGSSHEENLKKALENQQKDNVGFNHIPRKLNQEAITNEVLQKALAIAKAIPVKM
FT                   ISINSREGNNILPQQSLTKTQLKRSSQIR"
FT   gene            799614..800819
FT                   /locus_tag="A1I_04255"
FT   CDS_pept        799614..800819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04255"
FT                   /product="Putative AAA+ superfamily ATPase"
FT                   /note="COG1373 Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79196"
FT                   /protein_id="ABV79196.1"
FT                   /translation="MERLYQKEVEEYLTNYGKLVFISGPRQVGKTTISKQSIKNNVNSV
FT                   YLNWDYLEDRQQILNKHNETFEKLLLIKANNKPRIILDEIHKFKDWKNLVKGFYDKFGD
FT                   SIEFIITGSAKLNIYKKGGDSLMGRYINLTVHPLSVAEISKNFSDNIEYIANPKNIRKD
FT                   EFDALINFGGFAEVYLKGTTRFHRIWSKQRFEQLFREDVRNTEDINNIYTLELLATIIN
FT                   EQVGALTNYTNLANKVRASDQTIRRWLSLLEKHYYCFSIRPWAKNVVRSLIKEPKYYLW
FT                   DWSQIKDSGAKFENLIASHLLKAVYFWNESGLGDFSLCYLRDKQKQEVDFVIIKDDKPW
FT                   ILVEAKVSDLSISPSLKYFHELLKPEFSFQVVQNKQAIDSSCFDKPGLWIVPAITFLSQ
FT                   LK"
FT   gene            complement(800974..802113)
FT                   /locus_tag="A1I_04260"
FT   CDS_pept        complement(800974..802113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04260"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79197"
FT                   /protein_id="ABV79197.1"
FT                   /translation="MLKVIVETKTLVQALGFASSVVEKRNVISELANIKLSAKDGLLEL
FT                   SSTNMDLYLSQKIGVQVVSEGELTVSTKTLNDIVKKLPDSELTLTDLGTTGLEITGKNC
FT                   RFNLFTLPVESFPVMDNINPEASFKISCAEFAKIIESTKFSVSLDETRYNLNGIYLHVK
FT                   DSEFYAASTDGHRLSVSSVVLAEKIEDFGVILPQKSAEEILKIVKDSKNANADIEILLS
FT                   SNKIKFICNENVIMLSKLIDGTFPDYSSFIPENSSSKLVINRKIFADTIERIAIITVEK
FT                   FRAVKLSLSGEALEISAIGEARGNAKEVINSSKETENFYEYSGETNLDIGFNPQYLEDV
FT                   LKAIKSDLVELYFSSVSAPVLIKFPESPKDIFVVMPVKV"
FT   gene            complement(802118..804730)
FT                   /gene="pheT"
FT                   /locus_tag="A1I_04265"
FT   CDS_pept        complement(802118..804730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="A1I_04265"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79198"
FT                   /protein_id="ABV79198.1"
FT                   /translation="MKFTLSWLKQFLDTSASVTEIAESLTAIGLEVEEIIDKAADLQKF
FT                   EVAYIVSTKPHPSADKLKICEVETKNGNLQIVCGASNARAGIKVVLANIGVEIPNGKFK
FT                   IKESNIRGEKSCGMLCSEEELFLASESEGIIELPEDAVVGEPFTKYYGLDDPVFVINVT
FT                   PNRGDALSVYGIARDLSAKGIGMLKELEIPAVKSTFSSKVKLNIKDKEACPLFTFREIR
FT                   NLKNKPSPDWLQKLLKNIGVKPISSIVDVTNYMSYSFGQPMHAYDADKIGGGIVVDRHC
FT                   EENVILRLDCGISGEESVIQDPVDKPRDDNRGFHALNDKKYLLNKSDLVIKDENGVQAL
FT                   AGIIGGISSSCDSNTMNILLEAACFNAKMVAASGRRLQIDTDSRYRFERNIDRNFTEKA
FT                   LNIATDLILSICDGGEVSEILISGEKEPAKKTLDFPAGYLEKITGIKLTILLHNEANKG
FT                   EFVGNTEHSIAAYKEVREDASTGLTPKLPLEASYVKGLNIKGIEAILNKLGFATDTEKD
FT                   VIKITPPSWRHDINILEDVVEEITRIYGYDKIESIKLPELEQDNNRLREHKRISSFKRI
FT                   LASKGYDEVVTNSFMNSKDAKLFTELKDELFLLNPISVEDNYMRPTIVPNLLDIVRKNL
FT                   ARSIKDMAFFEVGPNFIGLNTEATYLTAILTGSYNSKNPHSIGRSYDIFDLKSDLETVF
FT                   DYAGLSIEKCIVSNQATPLYYHPTRSVNLALGKNLLGHFGQIHPKILKHYDIKEEVFAF
FT                   ELNITNLPAPKAKFGKRDEFIISDYQANFRDYAFIIARDQPVGEIISYINNFNKKLVKS
FT                   VILFDIYSGDKLPSGKKSIAIRVGLQADDRTLNEDDLNSFSKDLIANIEQKFQGTLRE"
FT   gene            complement(804727..805776)
FT                   /gene="pheS"
FT                   /locus_tag="A1I_04270"
FT   CDS_pept        complement(804727..805776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="A1I_04270"
FT                   /product="phenylalanyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0016 Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79199"
FT                   /db_xref="GOA:A8GWH2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWH2"
FT                   /protein_id="ABV79199.1"
FT                   /translation="MDNIETILRLAEEKILLVQSLKVLQEYKVEFLGKNGIVTNELKKL
FT                   GSLSEQDRKEFGLKINKLKEEIQNIIKAKEEILEEEELNLKLSSDKIDLSLPARRYKQG
FT                   SIHPITQCMEELIQVFAKFGFSIEDGPNIENDFHNFTALNFEDDHPARQMHDTFYLKGQ
FT                   ENDKPMLLRTHTSTVQIRAMKNGKPPFRFIAPGRTYRSDSDMTHTPMFHQIEGLVIDKD
FT                   INMGHLKYVITEFIRCFFENSNIELRFRPSFFPFTEPSAEVDIRMSKTDKWLEVLGCGM
FT                   VHPNVLKNVGIDNSQYQGFAFGLGVERFAMLKYNIKDLRQFFEGDMRWLKHYSFSSFDI
FT                   PNLAGGLTK"
FT   gene            complement(805954..807201)
FT                   /locus_tag="A1I_04275"
FT   CDS_pept        complement(805954..807201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04275"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79200"
FT                   /protein_id="ABV79200.1"
FT                   /translation="MSNLKQEIVTFGCRLNIYESEIIRKNLAASGLDNVAVFNTCAVTK
FT                   SAEKQARGAIRAAKKNNPDLKIIVTGCSAQTNPKMYGDMPEVDKVIGNEEKLLPSHYQI
FT                   NDEKIVVNDIMSVKETANHLISSFDGKSRAFIQVQNGCDHNCTFCIIPYGRGRNRSIAI
FT                   GAIAEQVKHLVLNGFKEVVFTGVDVTAYGGDLPGSPTFAQMIKRVLNLVPELKRLRLSS
FT                   IDVAEIDDELFELLAYNERIMPHFHISLQAGDDMILKRMKRRHNRAEIIEFCNKLRAIR
FT                   PEVSFGADIIAGFPTETPEMFENTRKLIAEAELQYLHVFPYSEREGTPAARMPQVPKAI
FT                   RKERAEILRQEGQRQLAEFFKKHIGQKVELLVENNNTAHTENFIPVKLDEPLEIGQIFK
FT                   AKLVGVEDRYMKCVLV"
FT   gene            complement(807194..808003)
FT                   /gene="dapF"
FT                   /locus_tag="A1I_04280"
FT   CDS_pept        complement(807194..808003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="A1I_04280"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COG0253 Diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79201"
FT                   /db_xref="GOA:A8GWH4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWH4"
FT                   /protein_id="ABV79201.1"
FT                   /translation="MSSKINFVKMHGLGNDFVIINKKDLTGTYDLSQLAKSMAKRHLGI
FT                   GCDQFIIYEEQNDSYEMIIYNIDGSSAKLCGNATRCLAKLIYLDTGKKDITVVVGNKKL
FT                   LCHVIDENNISVNVGGVSFNESWMPSRDKIWEFAERYMIDLKETICVDVGNPHLVIFSK
FT                   LELQDQKIVGEKLQDKALFADGVNVNFAEVRDNKIYLSVWERGSGLTLACGSGACGSFA
FT                   AGLKLGFIHSPCEVVFKHGSLIMKEENGNIIMQGPASLVAKGMYYCE"
FT   gene            808126..809136
FT                   /locus_tag="A1I_04285"
FT   CDS_pept        808126..809136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04285"
FT                   /product="Glycosyltransferase"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79202"
FT                   /protein_id="ABV79202.1"
FT                   /translation="MLSRDLGGIQQAFLDYSNALKMQNIEVINVTSYKAKINSFISSNF
FT                   KLPNLLPFDLISVLVLKYIIYKTKPDIIIAHGNRAINFSKLAKTSNIRLIGIAHNYSLK
FT                   GLRKCDFVIALTHHMKEHLLKNNFSESKIFILPNMINITKEFTPNKSYKKPVVIGVLAR
FT                   FVAKKGVDVFINSIKILQDKNYKIQAVIGGNGEEQDNITALVNKLNLQNKISFTGWVND
FT                   KDKFFEQTDIFCLPSLHEPFGIILLEAMENSLPIVSTDTEGPSEILKHMQDGLICKADS
FT                   PKDLAEKIAYLIDNPQKATELSQKAYLKLTQTYNITVISEKLVTLLHSLKKIAVC"
FT   gene            809449..810615
FT                   /locus_tag="A1I_04290"
FT   CDS_pept        809449..810615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04290"
FT                   /product="RND efflux system, outer membrane protein"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79203"
FT                   /protein_id="ABV79203.1"
FT                   /translation="MSNIAIATAQYNLVNSYRFPQINLQGSVNRTKTSKQLKQPNQPKI
FT                   SNNFGLGSVLNYEIDLWGLAANASESARRTLLASEYSKEAVRLTVISNVTISYFNILAL
FT                   DKQIYLTKRLIETQTEIYKLTQKLYDLGVGDLISVSEAASELALTNSSLPPLVQQRQEQ
FT                   ETALKILLGCSPENIVNGLVYRDKPIDYFPTTPVLPSILPSELLEQRPDIKAAEQNLFA
FT                   ADSNLRAVKATYFPQISLTGLLGFGSNKLNTLFGSSAETWQVGGTIAGPIFDFGKTRAN
FT                   VEVAESTKQQYIAIYKATVRTAFGEVMDALSLEQTASNNFRIWQQNETALTSIFKLANQ
FT                   RYKHGNIDYLTVLTAKQNMLQNEIDGVSIKLSQLSSMVNVFHALGGNW"
FT   gene            812072..815230
FT                   /locus_tag="A1I_04305"
FT   CDS_pept        812072..815230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04305"
FT                   /product="RND family efflux transporter"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79204"
FT                   /protein_id="ABV79204.1"
FT                   /translation="MGISEIFIKRPVLATLFMATILLFGIFGYRLLPVSVLPDIDFPTI
FT                   QVSVSLPGADPTTMASSVALPLEKQFSTISNIDSMSSVNSAGSTQITLQFDLSRDIDAA
FT                   AQDVQAAISSAAKQLPNDLPTPPSYRKVNPADAPIFYISLTSDTLPLYTVDYYAETIMA
FT                   ERLSMLPGVAQVQVYGSQQYAVRVQVDPVKMAANNIGLDQVSSIISSSNVNLPTGALYG
FT                   KDIYSSIQAPGQLQNAKEYNDLILTYRNGSPLFLKNIGKAIDSVANNKIAAWYRDKPGI
FT                   ILAIQKQPDTNTIEIVDGIKEVLPLLRRQIPEGVNINIMFDRSISIRESVNDANFTMIL
FT                   ALILVVLAIFLFLHNFRSVIIPTIALPLSIVGTFAFMYLFGFSIDNMSLMALTLAMGFV
FT                   VDDAIVVLENITRHIEAGQNKIQACINGTKEIGFTIVSMTLSLTAVFIPILFMSGILGK
FT                   LLHELAVVITTAILLSGVISITVTPMLCNVFLKDEKHSTVIPQLDCGISGGIISQAASQ
FT                   DTVVKPRYDKIPLTEKAFEYIKQKYSNSLEVVAEYSKTTMLVFLLVIIATAYLFGLVRK
FT                   GFMPDSDTGQILIFTEAAQTISFDAMVKEQQQVSDVLLKNPNIESFFSAVGVSGRNSSV
FT                   NQGTIFISLKPRNQRVGADEVIDQLRSKLNHLVGLKVYIQNVPTITIGGQATKSQYQYT
FT                   LQGLDQDELFGFSPKLQAKLAATPGFLDVTSDLQMSQPQTLVQIDRYKAAKLGISVEQI
FT                   QNVLYAAYGAEQISTLYTPTAQYDIILELDPKYQTDSSMLSLVNINSANNTLVPLTTLA
FT                   KIVNSVGPLSISHFGQLPSVTVSFNLQDGFSISDAVPKVNEAVRELQMPATITGSFQGT
FT                   AQAFQSSFSDLGLLLGLAVIVIYIILGMLYESFVHPVTILSGLPTAVFGALLTLLIFNS
FT                   ELDMYGFVGLIMLIGIVKKNAIMIIDFALELERTSNKSSKDAILEACTIRFRPIMMTTL
FT                   AALMGAMPIALGIGSTGAERRSLGLAVVGGLLTSQLLTLYITPIIFLYLEAGKRKLQSV
FT                   SSHG"
FT   gene            815332..815640
FT                   /locus_tag="A1I_04310"
FT   CDS_pept        815332..815640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04310"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG2026 Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79205"
FT                   /protein_id="ABV79205.1"
FT                   /translation="MEYIESPLFSKLLNSYFTDEEYASFQWHLAMHPKSGDVIQGSGGL
FT                   RKIRWTAKGKGKRSGVRIIYYYKDKEDQIWLLTIYAKNEATNIPTSILKKIKEELGL"
FT   gene            815637..815930
FT                   /locus_tag="A1I_04315"
FT   CDS_pept        815637..815930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04315"
FT                   /product="Putative transcriptional regulator"
FT                   /note="COG2944 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79206"
FT                   /protein_id="ABV79206.1"
FT                   /translation="MKAKKNANGRDIGAEILQSIKDIKAGKGLTQKIETKTDIIDIRKH
FT                   LHLSQVDFAALMHINVRTLQEWEQGRRRPRGPAISLLKIASKHPEIFIDSKL"
FT   gene            816070..817014
FT                   /locus_tag="A1I_04320"
FT   CDS_pept        816070..817014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04320"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="COG0039 Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79207"
FT                   /db_xref="GOA:A8GWI0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWI0"
FT                   /protein_id="ABV79207.1"
FT                   /translation="MKKNPKISLIGSGNIGGMLAHLISLKNLGDIVLFDVAEGIPQGKA
FT                   LDIMQANTLAGSDIKIKGTNDYKDIEGSDAIIITAGLPRKPGMSRDDLISVNTGIMKSV
FT                   AENVKKYAPNAFVIVITNPLDVMVYVMLKESGLPHNKVIGMAGVLDSSRFNFFLAEEFK
FT                   VSTNSVSSIVLGGHGDAMVPLARYSTVKGVPIPDLVKMGLSTNERIEKIIDRTRNGGGE
FT                   IVALLKTGSAYYAPAASAVEMLESYLQDKRQILTCAAYLQGEYGVKDLYAGVPIIIGKN
FT                   GVEKVIELQLTTNEQALFDKSVDGVRKLIEAVK"
FT   gene            817262..817501
FT                   /locus_tag="A1I_04325"
FT   CDS_pept        817262..817501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79208"
FT                   /protein_id="ABV79208.1"
FT                   /translation="MSTENLNKVLKDVQNKILNSGTTQDKLTTIGTLQKSIHQKELKNE
FT                   KLTQEEIDNIYKTLNILKKSRNIIEKKIYATLVY"
FT   gene            817570..818274
FT                   /locus_tag="A1I_04330"
FT   CDS_pept        817570..818274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04330"
FT                   /product="Variable membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79209"
FT                   /protein_id="ABV79209.1"
FT                   /translation="MSSDIVFDNELEWDDSGMPAAFQKSYGSGNVLDRLKTAVDDYIFE
FT                   LKQTGVVQDKVKLFEEKANAIQSSKDKRNISTASTSVKDRIQNFEGNNPSKIKKYWTEG
FT                   RREFVEKHAQHTQSKDPQTERNQRKNAVSASSNEHDNYAANRQETHKQLINKFENLAKT
FT                   QEIDSKEQSKRISSNNFQKLQQGNTKNLKEKFEKLANEAKLIGTQAQQKSKLTNKSNEK
FT                   PKVKPANHTRGI"
FT   gene            818323..818727
FT                   /locus_tag="A1I_04335"
FT   CDS_pept        818323..818727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04335"
FT                   /product="hypothetical protein"
FT                   /note="COG3755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79210"
FT                   /protein_id="ABV79210.1"
FT                   /translation="MRKIIILYLIFFNYLTYASDSKIDCDNAYTQFDMNYCANEDFKKA
FT                   DKELNQLYQEILKYTSEEETNLLKKSQNLWIKFRDADCEFGSFQVRDGTVFPMILSMCL
FT                   AGKTKVRIEELKNILECSEGDLSCRVLRNR"
FT   gene            complement(818768..819034)
FT                   /locus_tag="A1I_04340"
FT   CDS_pept        complement(818768..819034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79211"
FT                   /protein_id="ABV79211.1"
FT                   /translation="MSNTKEVVDSIEDILAFIGDAVSDMSGGTKATFTLLKSMDNFNDI
FT                   FSDQEVIVEDFYPSTYSNDIFTTAYNIIGSVCDYVCSYFWGSK"
FT   gene            819215..820357
FT                   /locus_tag="A1I_04345"
FT   CDS_pept        819215..820357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79212"
FT                   /protein_id="ABV79212.1"
FT                   /translation="MSDNLKSSNLIKDSESLTGSFHIVDLSADDLAHKGVSLARTLGTE
FT                   EYKDTEKNLANSGWEVLATSVDDKNTNQYGYKAVAFINRNTKEIHISSSGTIITEKYDL
FT                   IDDARITFGRLPNKMLPVKAFVTKILEQVGGQENVIDYKFSTSGHSLGAIVSDLTGIEI
FT                   HSRGLKFEKSVTFDNPGSKKVVENAIKNKDFSGEVVTSIEELAKHCEVYNAKHNFINTA
FT                   NPQLATKINIVAPPKLDTTIDQSAKSAGIWGWTDYLTSKVGEVVNTCADYLGINKVVHA
FT                   ISNHRLVNFADATSNQNTFEVIDWKKVNGQVMLKPDPKLDKIKSTGNDYVVIKHEKVIL
FT                   DSLTESFTLLTEQGYSYKDLATYHIQQEEANLIGQVIAVC"
FT   gene            complement(820659..821420)
FT                   /locus_tag="A1I_04350"
FT   CDS_pept        complement(820659..821420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04350"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="COG1218 3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79213"
FT                   /protein_id="ABV79213.1"
FT                   /translation="MNNNLINTLKDLIIDTGKIALDIKKSGILIDTKSDGSVVTNADKE
FT                   ISKIIYQNLQDLTPEIDIVCEEQPLPILSNNTFWLIDPIDGTRSYVNGKSTYTINIGLI
FT                   KNGVPTIGLIYQPETDKLYYTDEKNQLKIEQHSKEIPIIHKQKELNAVIGFYHSNKATK
FT                   EFLSKYSFNKIDAIGSSIKLCLIAEGSVDICPKFGQTMEWDIAAGHALIKAGGGNILDL
FT                   DGKEITYGKKDFANPNFLACSKYWLENVVPV"
FT   gene            complement(821422..822270)
FT                   /locus_tag="A1I_04355"
FT   CDS_pept        complement(821422..822270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04355"
FT                   /product="hypothetical protein"
FT                   /note="COG0553 Superfamily II DNA/RNA helicases, SNF2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79214"
FT                   /protein_id="ABV79214.1"
FT                   /translation="MQKVKTLMIKVNKILLHLLLYLIVPTSSYGQIIPTYSVNSVTMKD
FT                   LLPKIDQDSLVLINIDNTIITPKSKFFRYNDNPYVNFTKNLYSLAVNDSSVNNSIAQLM
FT                   QQRQMMLVEKNWGDFINQMKKQGATVLGLQEITTPCNLIENYEGWLYTLLYGLGINFTS
FT                   KVNDKDVFRFDPTDASAPIFYLGIIFTGNTNKVKSLIEFLKIIPKEPSKIIVFANNEQD
FT                   LKDMNSYLRNVDIEYYGIEYLGWQQLQGSPDLEVAKLQQSTLLNTGQWLEDDVAAKMLN
FT                   K"
FT   gene            complement(822233..823111)
FT                   /locus_tag="A1I_04360"
FT   CDS_pept        complement(822233..823111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79215"
FT                   /protein_id="ABV79215.1"
FT                   /translation="MFKKYIFILLLLVTSIVKAENIEVNNLDKIKQDFEENYIKNYLPQ
FT                   DLLVVIDLDKILFKPLLSLGEQIDKDVYAKLAPTLQKISKNPKNIYIDQLILTSDKYKK
FT                   ELLDSNFPNFVSDIRNKNIPIIAVNGGFTGNFNNIPKFEIWIADYLKKNFNIDFSNSFP
FT                   KNNYIIFNNLKSFSNTYPVFYKGILTSNNISGAELMINFFVQMNFMPKVLIMVSGSTEL
FT                   LSSMEAQLANYSSSVLFIGYYYNNQDSRDNNANYNVIINDLTNQMNNIKRNNPPLKTNN
FT                   AKSKNPYDQSK"
FT   gene            823404..823841
FT                   /locus_tag="A1I_04365"
FT   CDS_pept        823404..823841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79216"
FT                   /protein_id="ABV79216.1"
FT                   /translation="MVNMFGSFFSSFGGAIGNAFGGGIFSSIGRFAGKMLGEYLDQLNH
FT                   EPEEYDYIKNFKESFKYVTANYGEPIPLIFGTTKVSGKIIWADKVKEIANSTRHKEYFP
FT                   YFHNVNLLRLLRNIAISFLLPSVFVRVRLVKLTGYGQMMKS"
FT   gene            824093..825604
FT                   /locus_tag="A1I_04370"
FT   CDS_pept        824093..825604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79217"
FT                   /protein_id="ABV79217.1"
FT                   /translation="MIPGSGEFVYDTEIQYKTQESFFGGVVNHEAINTHNHYNIADSVY
FT                   SLNQLQTTCPNIKWVAPVVSWFGDNLDINYCSIKPAIEFNDPLTTYSSTWQVGRYNREN
FT                   AKIISKDEYESPNYGGSVNDASLVRYLKELKKRNLKIMFYPMFFMDLPGKPWRGHVSGS
FT                   AEAVSNFFHKTDGYNNFILHYAHLVKDYADAFIIGSELIGITSIRDSANNFPAINELCN
FT                   LARLVKEIVGNKVQVTYAADWSEYHHTSGGWYNLDPLFASSYIDFVGIDAYFPLTSSLS
FT                   SRITKEDIIKGCHSGEGYDYYLDGSGNKQALSAAYAWKNVAYWWENHHYNPDGNKTAWQ
FT                   PKMKKIWFTEFGFPSIDKASNQPNVFFDLKCTDGGAPKYSSAGTDFLAQRIAIKGFIEY
FT                   WQAQEYIEEMFLWTWDARPYPAWPHGNIWSDNHLWEKGHWVNGKLGTCSLAEIILELSN
FT                   RCGIDIQGIDISTIDEIVDGFILNKVLSAVDVINSLRIFYFFDIY"
FT   gene            825591..825686
FT                   /locus_tag="A1I_04375"
FT   CDS_pept        825591..825686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79218"
FT                   /protein_id="ABV79218.1"
FT                   /translation="MTYTNEVYENQEEELLLNFDHNGNHDEVKIS"
FT   gene            complement(825732..829811)
FT                   /locus_tag="A1I_04380"
FT   CDS_pept        complement(825732..829811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04380"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79219"
FT                   /protein_id="ABV79219.1"
FT                   /translation="MLKTDSPIKTHLKSILGGQIVAQQAAAYQTTQEITEYAKKHDYNL
FT                   SFTGYSLGAWFAELSLYFAYQDFNYFKAKAITFDSPGSAKIMDSFKPNIISYKTHFDIR
FT                   NLDITTYLSAPNFVNTSNPHIHKAYRLFPKVTAAEYSNKIINALNKAIPIKNYISLLSL
FT                   NSDLLDSMLDSFDSKTGKPIKYEQIIDWPCIKYEPKDNTLGGKLIDSMPIGGVIKDLAK
FT                   RGITATTLGSFLEVFDHFISGNVAIEQILEFYKHLEDPTQAEGKKQFELFYEGHYKSQK
FT                   VNLSEDVVNVNDIGSSDYYLKQLTKLSNKEIDKKEIPNLVKQQLKIIKDQYKIKLQNKK
FT                   YYIFTNSLSIKVDDLKEQILRLIEVSYEAKEVLENLNAYNSHELIESIKNINSNLSSLL
FT                   PYNLIRREDILQDIEKNLNEKQFITISGYTGIGKSTLAIEYGREQRDKAKKIVHFINAD
FT                   SAYKITEAYIQFAKEFSIYTTGEKEEDITRLIHENIAKLNSNTLFIFDNVEVYKDIEPY
FT                   LNSMMSILKDKVQVIITTKNNKLSDDITNIELKPFNIKTAVTYLENSLGNRFNDEDIND
FT                   LIEELGNKDEILPYSLSKAVAYLKENKLLKVKDYLNFLRNNKDKQPETILLLEILEKSS
FT                   LAWLILQYSACLDPDFISIDIFKELFLLDEEKLQEPIKKLEALSLMKLIYQDGQAGLQL
FT                   HGLVQFAVKRYVDRHKEHAIDEQKIYISLAEALDSLFPILIDVPNEDWEASKLFYPHVI
FT                   KILNVNIEINKFIKANLYQKIGYYSDGVLHRFKESLKYHKEALKIFQKLYQGNHSDIAK
FT                   SLNNIGVAYNNLGDIFKGLKYLRKALKMNQALYQGNHSDIANSLNNIGAAYNTLGDIAK
FT                   GLEYYEKALKMNQTLYQGNNLYIAISLNNVGEAYRNLGNTTKALIYHQKALKIFQVLYQ
FT                   NNHHYIAAALNNVGQVYQDSEDNFKGLQYLEEALKMFQKLYQGNHPCIATSLNNVGLAC
FT                   RDLGDNSKGLQYLEEALKMFQELYPSNHSYIAALLNSIGLSYKDLGNPAKALIYYKGAL
FT                   EIYQTLYQDNPLHIVSMLNTFNSIGAAYYKLGNTSEGLKYLKYVLEMYKALYQNNNPYI
FT                   ASALNNVGEAYKGLGNISKGLEYLEEALNMNQKLYKCNHSSIAGSLDNVSLAYEKLKDT
FT                   NKSIELCKQAYLMYVQTLGLKHSHTKNLESYIKIISPEFIKNNETREFILQRGDFEEIT
FT                   LEVKQKIQKKVLNKIYTNAAKGKWSTGKFRFLGIWGAASYLCDKYLAKQLRDLSSAKNI
FT                   ETAKMLCFEAVCLGAINHPNKDFICAVEFTKAYPELTQKITTEHPEYFIDGSILRACIN
FT                   DEAILNKLLQPLNSNS"
FT   gene            830055..830369
FT                   /locus_tag="A1I_04385"
FT   CDS_pept        830055..830369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04385"
FT                   /product="hypothetical protein"
FT                   /note="COG1872 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79220"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWJ3"
FT                   /protein_id="ABV79220.1"
FT                   /translation="MKFFVYNPLLKTASLNIKVKAAAKSNDIKEFIIINDVLHLKLSIK
FT                   AHAQQGKANEEIINFLAKEWQLLRSNLEITKGHTNSLKTILIKNIDEEYLNLILKPYIK
FT                   "
FT   gene            830522..832387
FT                   /locus_tag="A1I_04390"
FT   CDS_pept        830522..832387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04390"
FT                   /product="heat shock protein 90"
FT                   /note="COG0326 Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV79221"
FT                   /db_xref="GOA:A8GWJ4"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8GWJ4"
FT                   /protein_id="ABV79221.1"
FT                   /translation="MKQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKL
FT                   RYLSQSEAELVAGDSNFKITVKGDKNNGQVIIRDNGIGMNKEDLIENLGTIARSGTANF
FT                   LKNLSGDSKKDNMLIGQFGVGFYSSFMVADKVTVTSRKAGEDKVYVWESEGEGEYIVSN
FT                   SDREFSRGTEIALHIKKEEDSFLDHFRLKHIVKSYSDHIAVPIYFFDEGDNNEIQLNSA
FT                   SALWTRSKSEITEEQYKEFYKSLSYAVDDPWVTMHNKNEGAIEFTNLLFIPSSKTYDLF
FT                   HPDRKRRVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNNVLEKI
FT                   KNAITKRVLGELKKKKEDSPDEYNNFWANFGGALKEGLCEATTDHEKLLEVCIFRSALH
FT                   NKMISLDEYIKGFKEGQNTIYYLSGDNPDKLLSSPQIEGLLSKNIDVLLFTDTVDDFWV
FT                   NVNSEYKGHAIKSATRSDIDVDQATSSSEEKNKDDKKSDDEYKSLTDYFKEVLGILVKD
FT                   VKISKKLTSSPACLAVSEAAMDIRMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDL
FT                   KANNKNNEELVKLIFDQACILEGEPVADTGAFSKRLNDIVQKAIL"
FT   gene            832655..833899
FT                   /locus_tag="A1I_04395"
FT   CDS_pept        832655..833899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1I_04395"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="COG0156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1I_04395"
FT                   /db_xref="Ense