(data stored in ACNUC1104 zone)

EMBL: CP000850

ID   CP000850; SV 1; circular; genomic DNA; STD; PRO; 5786361 BP.
XX
AC   CP000850; AAWA01000000-AAWA01000041;
XX
PR   Project:PRJNA17109;
XX
DT   06-OCT-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Salinispora arenicola CNS-205, complete genome.
XX
KW   .
XX
OS   Salinispora arenicola CNS-205
OC   Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae;
OC   Salinispora.
XX
RN   [1]
RP   1-5786361
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Foster B., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Jensen P.R., Moore B.S., Penn K., Jenkins C.,
RA   Udwary D., Xiang L., Gontang E., Richardson P.;
RT   "Complete sequence of Salinispora arenicola CNS-205";
RL   Unpublished.
XX
RN   [2]
RP   1-5786361
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Foster B., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Jensen P.R., Moore B.S., Penn K., Jenkins C.,
RA   Udwary D., Xiang L., Gontang E., Richardson P.;
RT   ;
RL   Submitted (01-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e38ffb1251417c784497ba61812e7b49.
DR   BioSample; SAMN02598378.
DR   EnsemblGenomes-Gn; EBG00001453877.
DR   EnsemblGenomes-Gn; EBG00001453878.
DR   EnsemblGenomes-Gn; EBG00001453879.
DR   EnsemblGenomes-Gn; EBG00001453880.
DR   EnsemblGenomes-Gn; EBG00001453881.
DR   EnsemblGenomes-Gn; EBG00001453882.
DR   EnsemblGenomes-Gn; EBG00001453883.
DR   EnsemblGenomes-Gn; EBG00001453884.
DR   EnsemblGenomes-Gn; EBG00001453885.
DR   EnsemblGenomes-Gn; EBG00001453886.
DR   EnsemblGenomes-Gn; EBG00001453887.
DR   EnsemblGenomes-Gn; EBG00001453888.
DR   EnsemblGenomes-Gn; EBG00001453889.
DR   EnsemblGenomes-Gn; EBG00001453890.
DR   EnsemblGenomes-Gn; EBG00001453891.
DR   EnsemblGenomes-Gn; EBG00001453892.
DR   EnsemblGenomes-Gn; EBG00001453893.
DR   EnsemblGenomes-Gn; EBG00001453894.
DR   EnsemblGenomes-Gn; EBG00001453895.
DR   EnsemblGenomes-Gn; EBG00001453896.
DR   EnsemblGenomes-Gn; EBG00001453897.
DR   EnsemblGenomes-Gn; EBG00001453898.
DR   EnsemblGenomes-Gn; EBG00001453899.
DR   EnsemblGenomes-Gn; EBG00001453900.
DR   EnsemblGenomes-Gn; EBG00001453901.
DR   EnsemblGenomes-Gn; EBG00001453902.
DR   EnsemblGenomes-Gn; EBG00001453903.
DR   EnsemblGenomes-Gn; EBG00001453904.
DR   EnsemblGenomes-Gn; EBG00001453905.
DR   EnsemblGenomes-Gn; EBG00001453906.
DR   EnsemblGenomes-Gn; EBG00001453907.
DR   EnsemblGenomes-Gn; EBG00001453908.
DR   EnsemblGenomes-Gn; EBG00001453909.
DR   EnsemblGenomes-Gn; EBG00001453910.
DR   EnsemblGenomes-Gn; EBG00001453911.
DR   EnsemblGenomes-Gn; EBG00001453912.
DR   EnsemblGenomes-Gn; EBG00001453913.
DR   EnsemblGenomes-Gn; EBG00001453914.
DR   EnsemblGenomes-Gn; EBG00001453915.
DR   EnsemblGenomes-Gn; EBG00001453916.
DR   EnsemblGenomes-Gn; EBG00001453917.
DR   EnsemblGenomes-Gn; EBG00001453918.
DR   EnsemblGenomes-Gn; EBG00001453919.
DR   EnsemblGenomes-Gn; EBG00001453920.
DR   EnsemblGenomes-Gn; EBG00001453921.
DR   EnsemblGenomes-Gn; EBG00001453922.
DR   EnsemblGenomes-Gn; EBG00001453923.
DR   EnsemblGenomes-Gn; EBG00001453924.
DR   EnsemblGenomes-Gn; EBG00001453925.
DR   EnsemblGenomes-Gn; EBG00001453926.
DR   EnsemblGenomes-Gn; EBG00001453927.
DR   EnsemblGenomes-Gn; EBG00001453928.
DR   EnsemblGenomes-Gn; EBG00001453929.
DR   EnsemblGenomes-Gn; EBG00001453930.
DR   EnsemblGenomes-Gn; EBG00001453931.
DR   EnsemblGenomes-Gn; EBG00001453932.
DR   EnsemblGenomes-Gn; EBG00001453933.
DR   EnsemblGenomes-Gn; EBG00001453934.
DR   EnsemblGenomes-Gn; EBG00001453935.
DR   EnsemblGenomes-Gn; EBG00001453936.
DR   EnsemblGenomes-Gn; EBG00001453937.
DR   EnsemblGenomes-Gn; EBG00001453938.
DR   EnsemblGenomes-Gn; EBG00001453939.
DR   EnsemblGenomes-Gn; EBG00001453940.
DR   EnsemblGenomes-Gn; EBG00001453941.
DR   EnsemblGenomes-Gn; EBG00001453942.
DR   EnsemblGenomes-Gn; EBG00001453943.
DR   EnsemblGenomes-Gn; EBG00001453944.
DR   EnsemblGenomes-Gn; EBG00001453945.
DR   EnsemblGenomes-Gn; EBG00001453946.
DR   EnsemblGenomes-Gn; EBG00001453947.
DR   EnsemblGenomes-Gn; EBG00001453948.
DR   EnsemblGenomes-Gn; EBG00001453949.
DR   EnsemblGenomes-Gn; EBG00001453950.
DR   EnsemblGenomes-Gn; EBG00001453951.
DR   EnsemblGenomes-Gn; EBG00001453952.
DR   EnsemblGenomes-Gn; EBG00001453953.
DR   EnsemblGenomes-Gn; EBG00001453954.
DR   EnsemblGenomes-Gn; EBG00001453955.
DR   EnsemblGenomes-Gn; EBG00001453956.
DR   EnsemblGenomes-Gn; EBG00001453957.
DR   EnsemblGenomes-Gn; EBG00001453958.
DR   EnsemblGenomes-Gn; EBG00001453959.
DR   EnsemblGenomes-Gn; EBG00001453960.
DR   EnsemblGenomes-Gn; EBG00001453961.
DR   EnsemblGenomes-Gn; EBG00001453962.
DR   EnsemblGenomes-Gn; EBG00001453963.
DR   EnsemblGenomes-Gn; EBG00001453964.
DR   EnsemblGenomes-Gn; EBG00001453965.
DR   EnsemblGenomes-Gn; EBG00001453966.
DR   EnsemblGenomes-Gn; EBG00001453967.
DR   EnsemblGenomes-Gn; EBG00001453968.
DR   EnsemblGenomes-Gn; EBG00001453969.
DR   EnsemblGenomes-Gn; EBG00001453970.
DR   EnsemblGenomes-Gn; EBG00001453971.
DR   EnsemblGenomes-Gn; EBG00001453972.
DR   EnsemblGenomes-Gn; EBG00001453973.
DR   EnsemblGenomes-Gn; EBG00001453974.
DR   EnsemblGenomes-Gn; EBG00001453975.
DR   EnsemblGenomes-Gn; EBG00001453976.
DR   EnsemblGenomes-Gn; EBG00001453977.
DR   EnsemblGenomes-Gn; EBG00001453978.
DR   EnsemblGenomes-Gn; EBG00001453979.
DR   EnsemblGenomes-Gn; EBG00001453980.
DR   EnsemblGenomes-Gn; EBG00001453981.
DR   EnsemblGenomes-Gn; EBG00001453982.
DR   EnsemblGenomes-Gn; EBG00001453983.
DR   EnsemblGenomes-Gn; EBG00001453984.
DR   EnsemblGenomes-Gn; EBG00001453985.
DR   EnsemblGenomes-Gn; EBG00001453986.
DR   EnsemblGenomes-Gn; EBG00001453987.
DR   EnsemblGenomes-Gn; EBG00001453988.
DR   EnsemblGenomes-Gn; EBG00001453989.
DR   EnsemblGenomes-Gn; EBG00001453990.
DR   EnsemblGenomes-Gn; EBG00001453991.
DR   EnsemblGenomes-Gn; EBG00001453992.
DR   EnsemblGenomes-Gn; EBG00001453993.
DR   EnsemblGenomes-Gn; EBG00001453994.
DR   EnsemblGenomes-Gn; EBG00001453995.
DR   EnsemblGenomes-Gn; Sare_R0001.
DR   EnsemblGenomes-Gn; Sare_R0002.
DR   EnsemblGenomes-Gn; Sare_R0003.
DR   EnsemblGenomes-Gn; Sare_R0004.
DR   EnsemblGenomes-Gn; Sare_R0005.
DR   EnsemblGenomes-Gn; Sare_R0006.
DR   EnsemblGenomes-Gn; Sare_R0007.
DR   EnsemblGenomes-Gn; Sare_R0008.
DR   EnsemblGenomes-Gn; Sare_R0009.
DR   EnsemblGenomes-Gn; Sare_R0010.
DR   EnsemblGenomes-Gn; Sare_R0011.
DR   EnsemblGenomes-Gn; Sare_R0012.
DR   EnsemblGenomes-Gn; Sare_R0013.
DR   EnsemblGenomes-Gn; Sare_R0014.
DR   EnsemblGenomes-Gn; Sare_R0015.
DR   EnsemblGenomes-Gn; Sare_R0016.
DR   EnsemblGenomes-Gn; Sare_R0017.
DR   EnsemblGenomes-Gn; Sare_R0018.
DR   EnsemblGenomes-Gn; Sare_R0019.
DR   EnsemblGenomes-Gn; Sare_R0020.
DR   EnsemblGenomes-Gn; Sare_R0021.
DR   EnsemblGenomes-Gn; Sare_R0022.
DR   EnsemblGenomes-Gn; Sare_R0023.
DR   EnsemblGenomes-Gn; Sare_R0024.
DR   EnsemblGenomes-Gn; Sare_R0025.
DR   EnsemblGenomes-Gn; Sare_R0026.
DR   EnsemblGenomes-Gn; Sare_R0027.
DR   EnsemblGenomes-Gn; Sare_R0028.
DR   EnsemblGenomes-Gn; Sare_R0029.
DR   EnsemblGenomes-Gn; Sare_R0030.
DR   EnsemblGenomes-Gn; Sare_R0031.
DR   EnsemblGenomes-Gn; Sare_R0032.
DR   EnsemblGenomes-Gn; Sare_R0033.
DR   EnsemblGenomes-Gn; Sare_R0034.
DR   EnsemblGenomes-Gn; Sare_R0035.
DR   EnsemblGenomes-Gn; Sare_R0036.
DR   EnsemblGenomes-Gn; Sare_R0037.
DR   EnsemblGenomes-Gn; Sare_R0038.
DR   EnsemblGenomes-Gn; Sare_R0040.
DR   EnsemblGenomes-Gn; Sare_R0041.
DR   EnsemblGenomes-Gn; Sare_R0042.
DR   EnsemblGenomes-Gn; Sare_R0043.
DR   EnsemblGenomes-Gn; Sare_R0044.
DR   EnsemblGenomes-Gn; Sare_R0045.
DR   EnsemblGenomes-Gn; Sare_R0046.
DR   EnsemblGenomes-Gn; Sare_R0047.
DR   EnsemblGenomes-Gn; Sare_R0048.
DR   EnsemblGenomes-Gn; Sare_R0049.
DR   EnsemblGenomes-Gn; Sare_R0050.
DR   EnsemblGenomes-Gn; Sare_R0051.
DR   EnsemblGenomes-Gn; Sare_R0052.
DR   EnsemblGenomes-Gn; Sare_R0053.
DR   EnsemblGenomes-Gn; Sare_R0054.
DR   EnsemblGenomes-Gn; Sare_R0055.
DR   EnsemblGenomes-Gn; Sare_R0056.
DR   EnsemblGenomes-Gn; Sare_R0057.
DR   EnsemblGenomes-Gn; Sare_R0058.
DR   EnsemblGenomes-Gn; Sare_R0059.
DR   EnsemblGenomes-Gn; Sare_R0060.
DR   EnsemblGenomes-Gn; Sare_R0061.
DR   EnsemblGenomes-Gn; Sare_R0062.
DR   EnsemblGenomes-Gn; Sare_R0063.
DR   EnsemblGenomes-Gn; Sare_R0064.
DR   EnsemblGenomes-Tr; EBT00001607674.
DR   EnsemblGenomes-Tr; EBT00001607675.
DR   EnsemblGenomes-Tr; EBT00001607676.
DR   EnsemblGenomes-Tr; EBT00001607677.
DR   EnsemblGenomes-Tr; EBT00001607678.
DR   EnsemblGenomes-Tr; EBT00001607679.
DR   EnsemblGenomes-Tr; EBT00001607680.
DR   EnsemblGenomes-Tr; EBT00001607681.
DR   EnsemblGenomes-Tr; EBT00001607682.
DR   EnsemblGenomes-Tr; EBT00001607683.
DR   EnsemblGenomes-Tr; EBT00001607684.
DR   EnsemblGenomes-Tr; EBT00001607685.
DR   EnsemblGenomes-Tr; EBT00001607686.
DR   EnsemblGenomes-Tr; EBT00001607687.
DR   EnsemblGenomes-Tr; EBT00001607688.
DR   EnsemblGenomes-Tr; EBT00001607689.
DR   EnsemblGenomes-Tr; EBT00001607690.
DR   EnsemblGenomes-Tr; EBT00001607691.
DR   EnsemblGenomes-Tr; EBT00001607692.
DR   EnsemblGenomes-Tr; EBT00001607693.
DR   EnsemblGenomes-Tr; EBT00001607694.
DR   EnsemblGenomes-Tr; EBT00001607695.
DR   EnsemblGenomes-Tr; EBT00001607696.
DR   EnsemblGenomes-Tr; EBT00001607697.
DR   EnsemblGenomes-Tr; EBT00001607698.
DR   EnsemblGenomes-Tr; EBT00001607699.
DR   EnsemblGenomes-Tr; EBT00001607700.
DR   EnsemblGenomes-Tr; EBT00001607701.
DR   EnsemblGenomes-Tr; EBT00001607702.
DR   EnsemblGenomes-Tr; EBT00001607703.
DR   EnsemblGenomes-Tr; EBT00001607704.
DR   EnsemblGenomes-Tr; EBT00001607705.
DR   EnsemblGenomes-Tr; EBT00001607706.
DR   EnsemblGenomes-Tr; EBT00001607707.
DR   EnsemblGenomes-Tr; EBT00001607708.
DR   EnsemblGenomes-Tr; EBT00001607709.
DR   EnsemblGenomes-Tr; EBT00001607710.
DR   EnsemblGenomes-Tr; EBT00001607711.
DR   EnsemblGenomes-Tr; EBT00001607712.
DR   EnsemblGenomes-Tr; EBT00001607713.
DR   EnsemblGenomes-Tr; EBT00001607714.
DR   EnsemblGenomes-Tr; EBT00001607715.
DR   EnsemblGenomes-Tr; EBT00001607716.
DR   EnsemblGenomes-Tr; EBT00001607717.
DR   EnsemblGenomes-Tr; EBT00001607718.
DR   EnsemblGenomes-Tr; EBT00001607719.
DR   EnsemblGenomes-Tr; EBT00001607720.
DR   EnsemblGenomes-Tr; EBT00001607721.
DR   EnsemblGenomes-Tr; EBT00001607722.
DR   EnsemblGenomes-Tr; EBT00001607723.
DR   EnsemblGenomes-Tr; EBT00001607724.
DR   EnsemblGenomes-Tr; EBT00001607725.
DR   EnsemblGenomes-Tr; EBT00001607726.
DR   EnsemblGenomes-Tr; EBT00001607727.
DR   EnsemblGenomes-Tr; EBT00001607728.
DR   EnsemblGenomes-Tr; EBT00001607729.
DR   EnsemblGenomes-Tr; EBT00001607730.
DR   EnsemblGenomes-Tr; EBT00001607731.
DR   EnsemblGenomes-Tr; EBT00001607732.
DR   EnsemblGenomes-Tr; EBT00001607733.
DR   EnsemblGenomes-Tr; EBT00001607734.
DR   EnsemblGenomes-Tr; EBT00001607735.
DR   EnsemblGenomes-Tr; EBT00001607736.
DR   EnsemblGenomes-Tr; EBT00001607737.
DR   EnsemblGenomes-Tr; EBT00001607738.
DR   EnsemblGenomes-Tr; EBT00001607739.
DR   EnsemblGenomes-Tr; EBT00001607740.
DR   EnsemblGenomes-Tr; EBT00001607741.
DR   EnsemblGenomes-Tr; EBT00001607742.
DR   EnsemblGenomes-Tr; EBT00001607743.
DR   EnsemblGenomes-Tr; EBT00001607744.
DR   EnsemblGenomes-Tr; EBT00001607745.
DR   EnsemblGenomes-Tr; EBT00001607746.
DR   EnsemblGenomes-Tr; EBT00001607747.
DR   EnsemblGenomes-Tr; EBT00001607748.
DR   EnsemblGenomes-Tr; EBT00001607749.
DR   EnsemblGenomes-Tr; EBT00001607750.
DR   EnsemblGenomes-Tr; EBT00001607751.
DR   EnsemblGenomes-Tr; EBT00001607752.
DR   EnsemblGenomes-Tr; EBT00001607753.
DR   EnsemblGenomes-Tr; EBT00001607754.
DR   EnsemblGenomes-Tr; EBT00001607755.
DR   EnsemblGenomes-Tr; EBT00001607756.
DR   EnsemblGenomes-Tr; EBT00001607757.
DR   EnsemblGenomes-Tr; EBT00001607758.
DR   EnsemblGenomes-Tr; EBT00001607759.
DR   EnsemblGenomes-Tr; EBT00001607760.
DR   EnsemblGenomes-Tr; EBT00001607761.
DR   EnsemblGenomes-Tr; EBT00001607762.
DR   EnsemblGenomes-Tr; EBT00001607763.
DR   EnsemblGenomes-Tr; EBT00001607764.
DR   EnsemblGenomes-Tr; EBT00001607765.
DR   EnsemblGenomes-Tr; EBT00001607766.
DR   EnsemblGenomes-Tr; EBT00001607767.
DR   EnsemblGenomes-Tr; EBT00001607768.
DR   EnsemblGenomes-Tr; EBT00001607769.
DR   EnsemblGenomes-Tr; EBT00001607770.
DR   EnsemblGenomes-Tr; EBT00001607771.
DR   EnsemblGenomes-Tr; EBT00001607772.
DR   EnsemblGenomes-Tr; EBT00001607773.
DR   EnsemblGenomes-Tr; EBT00001607774.
DR   EnsemblGenomes-Tr; EBT00001607775.
DR   EnsemblGenomes-Tr; EBT00001607776.
DR   EnsemblGenomes-Tr; EBT00001607777.
DR   EnsemblGenomes-Tr; EBT00001607778.
DR   EnsemblGenomes-Tr; EBT00001607779.
DR   EnsemblGenomes-Tr; EBT00001607780.
DR   EnsemblGenomes-Tr; EBT00001607781.
DR   EnsemblGenomes-Tr; EBT00001607782.
DR   EnsemblGenomes-Tr; EBT00001607783.
DR   EnsemblGenomes-Tr; EBT00001607784.
DR   EnsemblGenomes-Tr; EBT00001607785.
DR   EnsemblGenomes-Tr; EBT00001607786.
DR   EnsemblGenomes-Tr; EBT00001607787.
DR   EnsemblGenomes-Tr; EBT00001607788.
DR   EnsemblGenomes-Tr; EBT00001607789.
DR   EnsemblGenomes-Tr; EBT00001607790.
DR   EnsemblGenomes-Tr; EBT00001607791.
DR   EnsemblGenomes-Tr; EBT00001607792.
DR   EnsemblGenomes-Tr; Sare_R0001-1.
DR   EnsemblGenomes-Tr; Sare_R0002-1.
DR   EnsemblGenomes-Tr; Sare_R0003-1.
DR   EnsemblGenomes-Tr; Sare_R0004-1.
DR   EnsemblGenomes-Tr; Sare_R0005-1.
DR   EnsemblGenomes-Tr; Sare_R0006-1.
DR   EnsemblGenomes-Tr; Sare_R0007-1.
DR   EnsemblGenomes-Tr; Sare_R0008-1.
DR   EnsemblGenomes-Tr; Sare_R0009-1.
DR   EnsemblGenomes-Tr; Sare_R0010-1.
DR   EnsemblGenomes-Tr; Sare_R0011-1.
DR   EnsemblGenomes-Tr; Sare_R0012-1.
DR   EnsemblGenomes-Tr; Sare_R0013-1.
DR   EnsemblGenomes-Tr; Sare_R0014-1.
DR   EnsemblGenomes-Tr; Sare_R0015-1.
DR   EnsemblGenomes-Tr; Sare_R0016-1.
DR   EnsemblGenomes-Tr; Sare_R0017-1.
DR   EnsemblGenomes-Tr; Sare_R0018-1.
DR   EnsemblGenomes-Tr; Sare_R0019-1.
DR   EnsemblGenomes-Tr; Sare_R0020-1.
DR   EnsemblGenomes-Tr; Sare_R0021-1.
DR   EnsemblGenomes-Tr; Sare_R0022-1.
DR   EnsemblGenomes-Tr; Sare_R0023-1.
DR   EnsemblGenomes-Tr; Sare_R0024-1.
DR   EnsemblGenomes-Tr; Sare_R0025-1.
DR   EnsemblGenomes-Tr; Sare_R0026-1.
DR   EnsemblGenomes-Tr; Sare_R0027-1.
DR   EnsemblGenomes-Tr; Sare_R0028-1.
DR   EnsemblGenomes-Tr; Sare_R0029-1.
DR   EnsemblGenomes-Tr; Sare_R0030-1.
DR   EnsemblGenomes-Tr; Sare_R0031-1.
DR   EnsemblGenomes-Tr; Sare_R0032-1.
DR   EnsemblGenomes-Tr; Sare_R0033-1.
DR   EnsemblGenomes-Tr; Sare_R0034-1.
DR   EnsemblGenomes-Tr; Sare_R0035-1.
DR   EnsemblGenomes-Tr; Sare_R0036-1.
DR   EnsemblGenomes-Tr; Sare_R0037-1.
DR   EnsemblGenomes-Tr; Sare_R0038-1.
DR   EnsemblGenomes-Tr; Sare_R0040-1.
DR   EnsemblGenomes-Tr; Sare_R0041-1.
DR   EnsemblGenomes-Tr; Sare_R0042-1.
DR   EnsemblGenomes-Tr; Sare_R0043-1.
DR   EnsemblGenomes-Tr; Sare_R0044-1.
DR   EnsemblGenomes-Tr; Sare_R0045-1.
DR   EnsemblGenomes-Tr; Sare_R0046-1.
DR   EnsemblGenomes-Tr; Sare_R0047-1.
DR   EnsemblGenomes-Tr; Sare_R0048-1.
DR   EnsemblGenomes-Tr; Sare_R0049-1.
DR   EnsemblGenomes-Tr; Sare_R0050-1.
DR   EnsemblGenomes-Tr; Sare_R0051-1.
DR   EnsemblGenomes-Tr; Sare_R0052-1.
DR   EnsemblGenomes-Tr; Sare_R0053-1.
DR   EnsemblGenomes-Tr; Sare_R0054-1.
DR   EnsemblGenomes-Tr; Sare_R0055-1.
DR   EnsemblGenomes-Tr; Sare_R0056-1.
DR   EnsemblGenomes-Tr; Sare_R0057-1.
DR   EnsemblGenomes-Tr; Sare_R0058-1.
DR   EnsemblGenomes-Tr; Sare_R0059-1.
DR   EnsemblGenomes-Tr; Sare_R0060-1.
DR   EnsemblGenomes-Tr; Sare_R0061-1.
DR   EnsemblGenomes-Tr; Sare_R0062-1.
DR   EnsemblGenomes-Tr; Sare_R0063-1.
DR   EnsemblGenomes-Tr; Sare_R0064-1.
DR   EuropePMC; PMC2695832; 19481972.
DR   EuropePMC; PMC2749086; 19474814.
DR   EuropePMC; PMC3124969; 21731546.
DR   EuropePMC; PMC3158105; 21876764.
DR   EuropePMC; PMC3194868; 21873479.
DR   EuropePMC; PMC3233102; 22003011.
DR   EuropePMC; PMC3314556; 22401625.
DR   EuropePMC; PMC3360062; 22655051.
DR   EuropePMC; PMC3370544; 22492446.
DR   EuropePMC; PMC3811353; 23892741.
DR   EuropePMC; PMC4551226; 26092459.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01333; CRISPR-DR20.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000850.
DR   SILVA-SSU; CP000850.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002390
CC   Source DNA and bacteria available from Paul Jensen
CC   (pjensen@ucsd.edu)
CC   Contacts: Paul Jensen (pjensen@ucsd.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5786361
FT                   /organism="Salinispora arenicola CNS-205"
FT                   /strain="CNS-205"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391037"
FT   gene            148..1923
FT                   /locus_tag="Sare_0001"
FT   CDS_pept        148..1923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: stp:Strop_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95937"
FT                   /db_xref="GOA:A8LVG8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVG8"
FT                   /protein_id="ABV95937.1"
FT                   /translation="MAGTTDLAAVWTATTDELADEIISAQQRAYLRLTRLRAIVEDTAL
FT                   LSVPDAFTRDVIESRLRPAITEALTRRLGRPIQVAVTVRVTEDGASRPTGTLYHSAPNP
FT                   ETGALPLDTVDGLAATGPDDGADHHFPTIPGQTQPEHRTATPVGPYGAEQTTQVPRDGQ
FT                   EPLFGNAFAGPPHPERRDGGEQALLVPPATDLPFDGRYRTDGVAPRDQHGIRALPRDHG
FT                   TDSGPGRVDHRPGGREDRRLSGPADGGGNRLNPKYMFETFVIGSSNRFAHAASVAVAES
FT                   PAKAYNPLFIYGSSGLGKTHLLHAIGHYATTLGNAHSVRYVSTEEFTNDFINSLRDDKT
FT                   SAFQRRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATL
FT                   EDRLRTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPDVLEFIASRVSNSIRELE
FT                   GALIRVTAFASLTRSSVELSLAEEVLRDFIPDGAGPEITADQIMVATADYFGVSLEDLR
FT                   GHSRSRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSL
FT                   YNQIAELTNRIKQNT"
FT   gene            2705..3838
FT                   /locus_tag="Sare_0002"
FT   CDS_pept        2705..3838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: stp:Strop_0003 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95938"
FT                   /db_xref="GOA:A8LVG9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVG9"
FT                   /protein_id="ABV95938.1"
FT                   /translation="MKFRVERDALAEAVAWTAKSLPSRPSVPVLAGVLLRVSDANLQVS
FT                   GFDYEVSSQVTVEVQGDADGAALVSGRLLAEITKALPAKPVDIAAVGAHLELVCGSARF
FT                   TLPTMPVEDYPTLPEMPVSTGTVDAAAFAAAVAQVAVAAGRDETLPMMTGVRLELSGGT
FT                   LAMLATDRYRLALREMEWNPDDPEITLNALVPARTLHDTAKALGSLGGQVTMALSQGAA
FT                   GEGMIGFAGGTRRTTSRLLDGANYPPVRSLFPATHNAQAQVPVSALIEVVKRVALVAER
FT                   TTPVLLSFSGDGLVVEAGGTEEARASEAMEATFTGDPLTVGFNPQYLIDGLSNMGTQSA
FT                   VLSFVDAFKPAVISPVGEDGEVVPGYRYLIMPIRVSR"
FT   gene            3877..4749
FT                   /locus_tag="Sare_0003"
FT   CDS_pept        3877..4749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; KEGG: stp:Strop_0004 6-phosphogluconate
FT                   dehydrogenase, decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95939"
FT                   /db_xref="GOA:A8LVH0"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH0"
FT                   /protein_id="ABV95939.1"
FT                   /translation="MQLGLVGLGRMGGNMRERLRAAGHEVIGYDNRPELSDVANLGELA
FT                   EKLDAPRAVWVMVPVGVTDDTIAKVADVLGTGDIIIDGGNSRFSDDAPRAERLDERGIG
FT                   YVDVGVSGGVWGRQNGYGLMVGGAKDHVDRLMPIFEALKPAGEFGFVHAGPVGAGHYAK
FT                   MVHNGVEYGLMHAYAEGYELLTKSELVTDVPGVVKSWREGTVVRSWLLDLLDRALDEDP
FT                   ELAELSDYTEDTGEGRWTVDEAVRLAVPMNVIAAALFARFASRQDESPAMKAVAALRQQ
FT                   FGGHAVRKR"
FT   gene            4766..5896
FT                   /locus_tag="Sare_0004"
FT   CDS_pept        4766..5896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: stp:Strop_0005 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95940"
FT                   /db_xref="GOA:A8LVH1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LVH1"
FT                   /protein_id="ABV95940.1"
FT                   /translation="MYVRRLELVDFRSYERVGVDLEPGANVLVGHNGVGKTNLIEALGY
FT                   VATLDSHRVATDAPLVRMGAGAAVIRCAVVHEGRELLIELEIVPGRANRARLGRSPARR
FT                   ARDVLGALRLVLFAPEDLELVRGDPAERRRYLDDLLVLRQPRYAGVRADYERVVRQRNA
FT                   LLRTAYLARKTGGTRGGDLSTLAVWDDHLARHGAELLAGRLDLVAALAPHVTRAYDAVA
FT                   AGTGAAGIAYRPSVELPTPTTDRADLTAALSAALAAGRSAEIERGTTLVGPHRDDLTLT
FT                   LGPLPAKGYASHGESWSLALALRLAGYDLLRVDGIEPVLVLDDVFAELDTGRRDRLAQL
FT                   VGDASQLLVTCAVEEDVPARLRGARFVVRGGEVHRA"
FT   gene            5889..6494
FT                   /locus_tag="Sare_0005"
FT   CDS_pept        5889..6494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   stp:Strop_0006 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95941"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH2"
FT                   /protein_id="ABV95941.1"
FT                   /translation="MPDDAVSAADPCRHLGPGADGGAVTPAGVEGLPAGASGPQLARAV
FT                   LDAAKARRSVAQPQRRSVRGGPSGGGRRPRGYSGPGPDPRDPQPLGAVLDRLVKARGWQ
FT                   QPAAEATVFGAWERVVGPEVAQHSRPVKLDNGELTVEARSTAWATQLRLLAGSLLQQIA
FT                   REVGHNVVRRLHIHGPAAPSWSRGPRRVRGRGPRDTYG"
FT   gene            complement(6485..7066)
FT                   /locus_tag="Sare_0006"
FT   CDS_pept        complement(6485..7066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95942"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH3"
FT                   /protein_id="ABV95942.1"
FT                   /translation="MGLDNVVVNWPRTGRFYNPVAPAEFVDFGEIVDMPQISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATENAAEDEDPVIDPDGCGWIADGLERFVA
FT                   RHRTVGEAITFDTVSEVLHALLGDGRLAEQQLRWLGSRLDRLRDDNGDPPQWTFTCAEL
FT                   SVLAAFYRRCADRGFAVYAESAAPRRAVQP"
FT   gene            7563..9509
FT                   /locus_tag="Sare_0007"
FT   CDS_pept        7563..9509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: stp:Strop_0008 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95943"
FT                   /db_xref="GOA:A8LVH4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH4"
FT                   /protein_id="ABV95943.1"
FT                   /translation="MAAQDKQEYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWE
FT                   VVDNAVDEALAGYCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKPGVEVALTVLHAG
FT                   GKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYFWRQSYTDSKPSPLEKGEPTD
FT                   ATGSAVSFWPDPAVFETVDFDFQTIYRRLQEMAFLNRGLTIHFLDERVAADEDGKMREV
FT                   TFCYKGGIADFVRHLNASKTPIHKSVVEFGTEEDGMSVEIAMQWNESYGESVYTFANNI
FT                   NTHEGGTHEEGFRAALTSVINRYGADKRLLKSDEKLSGEDIREGLAAIISVKLTNPQFE
FT                   GQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASQAARARVAAQQARKLA
FT                   RRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKIL
FT                   NVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLL
FT                   TLLFRFMRPLVELGHVYLAAPPLYKIKWNRKGDDAQYAYSDRERDGLIALRQQKKPNAK
FT                   PDDIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSF
FT                   IQRNAKDVRFLDI"
FT   gene            9641..12160
FT                   /locus_tag="Sare_0008"
FT   CDS_pept        9641..12160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0008"
FT                   /product="DNA gyrase, A subunit"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; KEGG: stp:Strop_0009 DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95944"
FT                   /db_xref="GOA:A8LVH5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH5"
FT                   /protein_id="ABV95944.1"
FT                   /translation="MTDTPESTPNEPDAPETGGAVVAHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWALRYPLVDGNGNFGSPGNDPAAAMRYTECKLDPLAMEMLRDIDEDTVD
FT                   LQDNYDGRAKEPTILPSRIPNLLVNGSEGIAVGMATKIPPHNLREIGAAVQWCLEHPEA
FT                   DEASTLEALLGIVKGPDFPTHGLIVGQAGIQDAYRTGRGSIRMRAVVEVEEDKRGRPAL
FT                   VVSELPYQVNPDNLAERIAELIREGKLGGIADIRDESSGRTGMRLVLVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRSYVEHQIEVIRRRTAFRLRKAEER
FT                   AHILRGLAKALDALDEVIALIRRSPTVDDARQGLIRLLDIDEIQATAILDMQLRRLAAL
FT                   ERQRILDDLVKLELEIADFKDILAKPERQRRIVSEELGEIVAKWGDDRRTQIIPFDGEV
FT                   SMEDLIAREDVVVTITRTGYAKRTKVDAYRSQRRGGKGVSGASLRQDDIVSHFFVCSTH
FT                   DWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEISDYQVAPYL
FT                   VLATKNGVVKKTKLEEFDSNRSGGIIAINLREDDELVGAALVAPEQDLLLVSKNALAIR
FT                   FNASDEALRPMGRATSGVIGMRFSEDDELLAMEVVRHGLDVLVATNGGYAKRTPIEEYP
FT                   VQGRGGKGVLTAKITERRGGLVGAVVIDPDDELFAITSNGGVIRTPVKPVRRTRDRNTM
FT                   GVKLMDLPDGVTIVAIARNADEPDEQD"
FT   gene            12165..13073
FT                   /locus_tag="Sare_0009"
FT   CDS_pept        12165..13073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95945"
FT                   /db_xref="GOA:A8LVH6"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH6"
FT                   /protein_id="ABV95945.1"
FT                   /translation="MTETQAKSGNAGNSANPVDEEGAKSAAPAAGRAAVGRATVPADVP
FT                   APKFTRAPGMAPPPDKPTKAPESAEDPAEATKVEPPRADGAATAEATPGTTQPVTAGAG
FT                   QTNTTALGSLTGALRLGDTGTQPRVTGTARPQPGSAGRPQGGGLPPGVGGAAAVGAARV
FT                   GEAVRAARTAVSSAASRGPRRARLNLRRIDPWSVMKFAFAVSVVLFIVVVVATSVLYLA
FT                   LDAMGVFASVNDSLSDLVNAGGGQSADGFQITARGVILSSALIGLVNVVLFTALATLGA
FT                   FVYNVCADLVGGVELTLAERD"
FT   gene            13204..13280
FT                   /locus_tag="Sare_R0001"
FT                   /note="tRNA_Ile1"
FT   tRNA            13204..13280
FT                   /locus_tag="Sare_R0001"
FT                   /product="tRNA-Ile"
FT   gene            14087..15292
FT                   /locus_tag="Sare_0010"
FT   CDS_pept        14087..15292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0010"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   sen:SACE_1141 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95946"
FT                   /db_xref="GOA:A8LVH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH7"
FT                   /protein_id="ABV95946.1"
FT                   /translation="MEPRHDPIPPGGRIKLYRRRRGLTQEVCAQLKGVSVGAWRKWESG
FT                   ERSVNSLADWIEIARILNVRDLYKLTGHPLGVLPDDPAEHESVPPLRAAMTAYAPDIDQ
FT                   LSSVAELRSAVRLAWTTWYQSRQRYTYTSPVLPGLVHASRAAVASLDGNERRQAQRVAA
FT                   DLYLLVRAFAKKVGAQDLAVIAADRALTAAYEADDPAYRASAAWNMGQVLSNRGHTEDA
FT                   VDMCRQAIADLQRTADDDPVRLAALGGLHLLLSIQYARLRDERRTLDVLDRADELAART
FT                   GETEHHFIFFGPTNTAIHRAAATLELSRPGEAARIAERVDVGRSPSIERRHSHLTHLAR
FT                   AYASKRDDYAAIHMLQRAHRESPEESSLNLLMRGTVRELLTRETATSRDELRGLAELVG
FT                   VV"
FT   gene            15477..15656
FT                   /locus_tag="Sare_0011"
FT   CDS_pept        15477..15656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH8"
FT                   /protein_id="ABV95947.1"
FT                   /translation="MFRLFRKRRRRSGRLDATGPATVYAGRAGAYRPLRDQPTVILDTR
FT                   PLMTRLGRQRACSR"
FT   gene            15656..15889
FT                   /locus_tag="Sare_0012"
FT   CDS_pept        15656..15889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95948"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVH9"
FT                   /protein_id="ABV95948.1"
FT                   /translation="MAAAHARPAPIGLSPAQLRNRMIVSARRIIVEHWPRVDRCPLCGT
FT                   GWPCTPTGYAYAFLGSVGQANWVPPEQVLGRR"
FT   gene            16357..16869
FT                   /locus_tag="Sare_0013"
FT   CDS_pept        16357..16869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95949"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI0"
FT                   /protein_id="ABV95949.1"
FT                   /translation="MQVSQALDVMEAILRAAEHPDIVEVTRYGADTQPGGQSPPGIKVR
FT                   HQSGTAAMLWAGVSPRDATPVPLPTGPLPPKQRAARILVLTQQLLDVARPEVFASWELC
FT                   RQPGVEVPVAAAVRITARDGSTIYLRGTAASGDTEPETDPYPDYQIPQGVQSWHRLNAQ
FT                   PAEPASV"
FT   gene            17038..17418
FT                   /locus_tag="Sare_0014"
FT   CDS_pept        17038..17418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95950"
FT                   /db_xref="GOA:A8LVI1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI1"
FT                   /protein_id="ABV95950.1"
FT                   /translation="MAEGARVAVGAVDNQTYGALMRRTPIVIIVAAAMALGAGIAGAGI
FT                   YLTVTDETSPTSQVPAPEPSAEPAPADPYEVYLDLAPVDAVNLSREDAQARAMLGCGQT
FT                   WAPGTVDAALAEAYAELCADME"
FT   gene            complement(17613..17879)
FT                   /locus_tag="Sare_0015"
FT   CDS_pept        complement(17613..17879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0015"
FT                   /product="regulator of chromosome condensation, RCC1"
FT                   /note="KEGG: stp:Strop_1979 regulator of chromosome
FT                   condensation, RCC1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95951"
FT                   /db_xref="GOA:A8LVI2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI2"
FT                   /protein_id="ABV95951.1"
FT                   /translation="MPLTTSGTATHTTTLPTGTHTLTAHYTSTNTCPNSQSPPTTITIK
FT                   PDLPITGPTLTTTTGAATLSILAGATLIYATHRRHRPPHHHPA"
FT   gene            complement(18032..18661)
FT                   /locus_tag="Sare_0016"
FT   CDS_pept        complement(18032..18661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0016"
FT                   /product="regulator of chromosome condensation, RCC1"
FT                   /note="KEGG: stp:Strop_1979 regulator of chromosome
FT                   condensation, RCC1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95952"
FT                   /db_xref="GOA:A8LVI3"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI3"
FT                   /protein_id="ABV95952.1"
FT                   /translation="MMGRFCRWAVRGADAGRVGRVIVGWFLLVVAVTVTQAVTGVWSLA
FT                   AQHTPSPSSAASDTVLAWGQNNDGELGDGTTTDRDTPVDVDLPAGTEVTDVAAHGDHSL
FT                   AVTSAGTVLAWGNNSSGQLGDGTTTDRDTPADVNLPTGVTITAITGGNDHSLAVTSAGA
FT                   VLAWGNNSSGQLATAPPPTATHPPTSTYPQASPSRPSPPATTTAWP"
FT   gene            complement(19079..20239)
FT                   /locus_tag="Sare_0017"
FT   CDS_pept        complement(19079..20239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0017"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   pde:Pden_2124 hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95953"
FT                   /db_xref="GOA:A8LVI4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI4"
FT                   /protein_id="ABV95953.1"
FT                   /translation="MLVPALALAVAGLGAPAAAAPAASVLECAGKPATIVGTPGFDNIV
FT                   GTPAADVIVALDGDDAIRGLGGDDTICGGDGADVIFGQDGNDLVLGDAGHDIIQGGAGD
FT                   DDLRGGAGHDIVGGGDGDDDVIGDPGHDRLTGGNGRDFMSGDTGDDHIFGNNDFDVLLG
FT                   DAGNDRLSGGRENDLIFGGANNDILSGGHGDDGLDGGPGNDTLTGGDGDDGLVGGSGND
FT                   QLSGGAGSDGLEGDDGNDRLTGGSGDDGLGGGSGDDILIGGDGNDGLNGGNGRDQISGG
FT                   KGTELIFGGAGDDIIQGGSDSDRILGDAGNDRIHGNGGDDIIDGGAGNDFASGGNGNDR
FT                   MEGGSGNDRLFGNADDDNLDGQTGVNFNNGGAGTNICQNPAVGPGC"
FT   gene            20879..21007
FT                   /locus_tag="Sare_0018"
FT   CDS_pept        20879..21007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95954"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI5"
FT                   /protein_id="ABV95954.1"
FT                   /translation="MFKKLLILVGIVGVAAIVAKRVKESNDERALWHEATSAPDLR"
FT   gene            21050..21125
FT                   /locus_tag="Sare_R0002"
FT                   /note="tRNA_Ala1"
FT   tRNA            21050..21125
FT                   /locus_tag="Sare_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(21409..23997)
FT                   /locus_tag="Sare_0019"
FT   CDS_pept        complement(21409..23997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0019"
FT                   /product="tRNA synthetase valyl/leucyl anticodon-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95955"
FT                   /db_xref="GOA:A8LVI6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LVI6"
FT                   /protein_id="ABV95955.1"
FT                   /translation="MPAKASLEGIEQVWSRVWEQNGTYRFDRSVTRDEVYSIDTPPPTV
FT                   SGALHVGHVFSYTHADAIARFQRMRGKMVFYPMGWDDNGLPTERRVQNYYGVQCDPSLP
FT                   YDPGYTPPTEPPGRPQPISRRNFVELCRNLTKIDEQAFEALWRHLGLSVDWSLTYATID
FT                   DRSRAISQRAFLRNLARGEAYLADAPTLWDVSFRTAVAQAELEDRERQGHYYRLSFTSA
FT                   AGDTIHVETTRPELLPACVALVAHPDDKRYQHLFGSTAVTPVFRVPVPIKAHPLAQPDK
FT                   GSGIAMICTFGDLTDVLWWRELALPTRPVMGRDGRLLPEPPPGITNAEAVAAYRTLAGL
FT                   TAFSAKAKMVELLRASGDLAGDPQPTAQAVKFYEKGDKPLEIVTTRQWYVRNGGRNAQL
FT                   RAALIRRGRELSWSPRFMRSRYENWVEGLAGDWIISRQRFFGVPIPVWYPLDDSGEPDY
FT                   ERPILPDDAALPVDPSSDTPTGYHDSQRHQPGGFMADPDVMDTWATSSLTPEIAGGWTV
FT                   DDDLFGRVFPMDLRPQAHEIIRTWLFATMLRSHQEFDRLPWRTALLSGWILDPDRKKMS
FT                   KSKGNSVVTPMSLLAEYGSDAVRYWAVSGRPGTDTAFDTGQMKIGRRLAIKILNATKFV
FT                   LRFESPTLRAPHVAHVTEPLDRSMLARLADVVAAATTGFTQYDYTRSLECTEHFFWSFC
FT                   DDYLELVKERAYGNPDDPAVRSAHAALALALRTLLRLFAPMLPFVTEEAWSWWQEGSVH
FT                   RASWPARQELVGDADGVDRANRIDETNGSDEAVEDLLGLASGVLAAIRRAKSEAKQSMR
FT                   ASVARLTLRGRASDLAAFALVSRDVRAAGVVRDVDTAEADVPLTPEITLG"
FT   gene            24135..25088
FT                   /locus_tag="Sare_0020"
FT   CDS_pept        24135..25088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0020"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   stp:Strop_0016 SUA5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95956"
FT                   /db_xref="GOA:A8LVI7"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI7"
FT                   /protein_id="ABV95956.1"
FT                   /translation="MSADSGVAEAAAVLRAGGLVAFPTETVYGLGANALDAQAVARIFA
FT                   AKARPSFDPLITHLAEAAELEKLVGTVSPAVAVLAERFWPGPLTLIVDRPAAIPPIVTS
FT                   GLETMAVRVPDHAAARGLIAAAGVPVAAPSANRFGQLSPTWAEHVVAGLGAAVDVVLDG
FT                   GPTRCGIESTIVDVRGERPVVLRLGALPVESLEEAVGPVTVRPGSSGQPVAPGTLAAHY
FT                   APRTPLRLVTGAGPMDGGGARRGFLGFRSRPAGEWAAVEVLSSDGDLTEAAARLFDALH
FT                   RLDGAGVDEIVVEPVPEVGVGRAVNDRLRRAAATWG"
FT   gene            complement(25147..29685)
FT                   /locus_tag="Sare_0021"
FT   CDS_pept        complement(25147..29685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0021"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; E1-E2 ATPase-associated domain
FT                   protein; KEGG: stp:Strop_0017 ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95957"
FT                   /db_xref="GOA:A8LVI8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI8"
FT                   /protein_id="ABV95957.1"
FT                   /translation="MMSLGRIAGSMLASGGVPQLVGHAARNVGSAATQAARLAGLTRRR
FT                   VWSRPGRHHIEVHGVCQDGGDQLARQVEAALERVPGVIWARVNAPSGRVIVAVGPPKPR
FT                   LRDLIATVARAERVSPHEPDPEIPPPHPPEEGPRTPRTLGALASDALGLTISAATRILP
FT                   FTPVPGEVAGLLNAVDLHPRLHALAGRGLRADPRADVLFPLAEAVVQGLAGGWTGIVLD
FT                   GVQRVVQWGEARAQLVAWAKAEPQLTGTPDRASAHVLPAERPCPKPDGPAETYVTRMLH
FT                   AGAVAAAATIPMAGVKRAAALSLSALPKATGSGREGYAAQLGALLARRGVIAMDRSVLR
FT                   ELDRIDTLVLDAAILGSDRGLLTDLAPLDDTDLGEVAARAFALFDPDRPGAVHRDGSWR
FT                   VGPLDRLDVAVPGDTPHSDRLRNAGGRLLGLAYGDRLVALLRVETEPAPGVDLLPAAAR
FT                   RAGLRLVVADDDPGRYDFADTVLAGGDRLAETVRQLQRDGAVVMLVSGDRVALGAADCG
FT                   LGLTTDEEPPPWGAHLLVGTDLRISALVVEAAGVARRMTEQNIRLGFAGTGLGALSALT
FT                   AAREQLPGRSLAAVNGTAALAFAHGVWRAQRLPNRTGAPTPHRTVPWHLMPVRTVLDRL
FT                   DSGSDGLDPVEADRRHTGGVADGGPSPTLLRAFLDELANPLTPVLAAGAVLSASFGSLV
FT                   DAGLVGGVVGGSALVGAVHQRNTERSLAELLSRTAVTARVRRGGAEHLLPADHLVPGDV
FT                   IVLEPGDAVPADCRVLEANGLEADESSLTGESLPVGKTDEPVTAADLAERHSMLYEGTT
FT                   IAAGHGRGVVVATGADTEAGRSLALARHAPTTGGVEARLGGLTGSAIPLALGSAVAVAG
FT                   AGVARGVPLSETAATAANLAVASVPEGLPFLVSAAQLAAARRLAERGALVRNPRTIEAL
FT                   GRVDVLCFDKTGTLTEGRLMLSGVGDGDRYAKVDQLDDHLRTILAVALRATPDADDPEQ
FT                   LPEQADRAVRRAAHETGTAVRTGAGAWRPAGGLPFEPSRGYHATVGACDAGLLLSVKGA
FT                   PETVLPRCLNRRTEAGVVPMDDSTREAVQQELLRHAGAGQRVLALAERIVPDETVTDED
FT                   VRDLTFVGILALADGIRASAAPAVENIRRAGVHTIMITGDHPATAEAIASVISPGDGQQ
FT                   VVTANDLEDLDDEALAARLVTTDVVARCTPAHKVRIIQALRSCGRTVAMTGDGANDAPA
FT                   IRLADVGIALGQRGTPAARAAADLVVMDDRLETIIATLAEGRAMWSSVRHALSILFGGN
FT                   LGEIAFSIVTAAVDGRSALNGRQLLLVNLLTDLAPALAVAVRPPRPEHSENLLREGPDT
FT                   SLGATLNQELGVRATSTALGATAGWVLSRWVAASPRRSGTVALVSLVGTQLGQTLLAGG
FT                   ATPGVLLSTAGSVGVLVLVVQTPGLSHFFGCTPLGPISWTIATGSAAGAALANGAVARL
FT                   VQQLPAPPRPGVDLHDLIARLRRHGQASHDGGGRHERPTPGSGVRHDASPE"
FT   gene            29847..30164
FT                   /locus_tag="Sare_0022"
FT   CDS_pept        29847..30164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95958"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVI9"
FT                   /protein_id="ABV95958.1"
FT                   /translation="MEGGEGGKPRRSPPFLEVEMSMLTRELSGGRDMIRTFTHRVEVPM
FT                   LGEVAIPPPDKLAYYAGVGLLTLLQVIEWPIALVVTAGHLLADQHLSGLAKGVGEAMET
FT                   A"
FT   gene            30307..30501
FT                   /locus_tag="Sare_0023"
FT   CDS_pept        30307..30501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95959"
FT                   /db_xref="GOA:A8LVJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ0"
FT                   /protein_id="ABV95959.1"
FT                   /translation="MFTLVTTVVLYVGGFVFLYGVIRLAIRHALEEAEVRRIQAQRAEE
FT                   LAAHRDRTLLREKGYFTGS"
FT   gene            complement(30588..31223)
FT                   /locus_tag="Sare_0024"
FT   CDS_pept        complement(30588..31223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0024"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: stp:Strop_0020 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95960"
FT                   /db_xref="GOA:A8LVJ1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ1"
FT                   /protein_id="ABV95960.1"
FT                   /translation="MEIDIYADLVCPWCYLGKRRLEQALASYDGVVTVRYRPFQLDPSP
FT                   VPEPLPLLDTLAAKFGGRGRAQQMADQVARAAAGAGIEFDFDRALAANTFDAHRLVAWA
FT                   TEHGRAGETVEALHRSHFRDGIDIGARPALAAIAGEVGLDATAAHAFLESDGQVAQVHT
FT                   ELAAARELGITSVPTFVLAGRYAVTGAQESPTLLAALTEVRRQLTAGT"
FT   gene            complement(31244..31663)
FT                   /locus_tag="Sare_0025"
FT   CDS_pept        complement(31244..31663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0025"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   stp:Strop_0021 Fe-S metabolism associated SufE"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95961"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ2"
FT                   /protein_id="ABV95961.1"
FT                   /translation="MPPRLAEIVDEFVAAPRDVVLEMLLEYADVIGPLPPEHVDRTDME
FT                   QVPECQTAFFLRARVTPEGDVETLFDCPPEAPTTRAFAGILAEGLAGAGPEQVLAVPDD
FT                   LYQRMGLAQVISPLRVRGGTAILARLKRQIREQAG"
FT   gene            complement(31823..32248)
FT                   /locus_tag="Sare_0026"
FT   CDS_pept        complement(31823..32248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0026"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   stp:Strop_0022 putative signal-transduction protein with
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95962"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ3"
FT                   /protein_id="ABV95962.1"
FT                   /translation="MTGYRVRDVMTKQVIYLPTETTLDEAARVMREADIGDVVATEGAT
FT                   LVGMLTDRDIVVRAVAERSDPARTTIDAIITREVVMIDQNCTVGEAAALMRERGVRRVL
FT                   VCDNDRKLVGIVSLGDLATRFDPQSALGQISERTPTT"
FT   gene            32505..33272
FT                   /locus_tag="Sare_0027"
FT   CDS_pept        32505..33272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0027"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   stp:Strop_0023 lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95963"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ4"
FT                   /protein_id="ABV95963.1"
FT                   /translation="MGWRSFVAVGDSFTEGLNDVYPEGGYRGWADLVATRLAAEVGPDF
FT                   RYANLAIRGRLFPRVVDEQVPAALAMQPDLISFAAGGNDVLRRTFDPDDMIARFNDVVG
FT                   RLRSGGSDVVLFRFADVMARLPGQRLVAPRVRLLNQAVGETAQRHGAILVDLYADDTYL
FT                   NPMLWSTDRLHLSSAGHRRVAAQVLTALGVSCAEEWLLVPERPLPKPWLTARTDDLRWA
FT                   AHHLAPWLTRRLTGRSSGDTVTAKRPTLSPLTD"
FT   gene            33356..34249
FT                   /locus_tag="Sare_0028"
FT   CDS_pept        33356..34249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0028"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: kra:Krad_3079
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95964"
FT                   /db_xref="GOA:A8LVJ5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ5"
FT                   /protein_id="ABV95964.1"
FT                   /translation="MSVPSDPDPRLQSYADPRRLVTTGWLAEHLGAPGLVVVECDEDVL
FT                   LYESGHIPGAVKVDWHVELNDQVTRDYLDAEEFAELCAAKGIGRDDTVVFYGDNFNWWA
FT                   AYALWVFTLFGHPDVRLLDGGRQKWIAEGREVTRERTSRPRAGYPVPQRDDAPIRAYRD
FT                   HVMDHVAAGRPLVDVRSPGEYTGEMLHMPDYPQEGALRGGHIPGAVNKPWRSAANDDGT
FT                   FRSPAELRAVYADQLGLGPDDDIVAYCRIGERSSHTWFVLRHLLGFPRVRNYDGSWTEW
FT                   GNLVRAPVVRGDRPRG"
FT   gene            complement(34333..35568)
FT                   /locus_tag="Sare_0029"
FT   CDS_pept        complement(34333..35568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0029"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; proteinase inhibitor I9 subtilisin propeptide;
FT                   KEGG: stp:Strop_0039 peptidase S8 and S53, subtilisin,
FT                   kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95965"
FT                   /db_xref="GOA:A8LVJ6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ6"
FT                   /protein_id="ABV95965.1"
FT                   /translation="MTLPRTHRRRLATVGMLTSAAMIITMVASPATATPATAEIRNAGS
FT                   ATAVADSYIVVLKDSAVGAPTGSRQPTVQRTADSLAERFGGTIGHVYRDALHGFEIQLS
FT                   ERAAHRLAADPAVAYVEQNQVTPTIASGVQPNPPSWGLDRIDQRHLPLDNQYAYPNTAP
FT                   NVHAYLVDTGIRGTHLDFGGRVTGGVDLVDGALPADDCNGHGTHLAGTVGGTDHGVAKA
FT                   VQLHPVRVFGCTGSGTQATVIAGVDWITGNAVRPAVALMGLGGAASTSLDAAVTNSIAS
FT                   GITYAVASGSSNGNACNYSPARVPAALTTAGTTPTDARMTSNNHGPCLDLHAPGSGITS
FT                   TWYTSNTATATVSGSSMAAAHVTGCAALVLSAQPTWSPARVARYLIRRATVGVVTGVPT
FT                   DDTPNRLLYCGP"
FT   gene            35894..36475
FT                   /locus_tag="Sare_0030"
FT   CDS_pept        35894..36475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0030"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_0024
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95966"
FT                   /db_xref="GOA:A8LVJ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ7"
FT                   /protein_id="ABV95966.1"
FT                   /translation="MGSGRRRSRKDEILEIAVGLFAARGYHGVSMDDIGAAAGVTGPAL
FT                   YHHFAGKEAMLVAALVPVSEGLLAGGQERAAAHPDDPHAALESLIDFHVDFALAQPAVI
FT                   ALHLHELDRLPDQPRRRIRRLQRLYVEEWVSVLTAAHPGLPDGEARVLAHAAFGLMNST
FT                   PFLGGEVNRQRRAELLRGATLAALLAPTAR"
FT   gene            36598..37935
FT                   /locus_tag="Sare_0031"
FT   CDS_pept        36598..37935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0031"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: stp:Strop_0025
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95967"
FT                   /db_xref="GOA:A8LVJ8"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ8"
FT                   /protein_id="ABV95967.1"
FT                   /translation="MIESLLVVNRGEIARRIIRTAKRLGVRAVAVHSEADAGLPFVAEA
FT                   DEAVCVGPANPAESYRNVEAVLAAAKSTGAQAIHPGYGFLSENADFAQAVEASGLIWVG
FT                   PGADAITAMGDKINARNLMAAAGVPVAPGTTEPAADLAAAVDAAAGIGYPVMVKAAAGG
FT                   GGMGMGIANDEAALRTEFDKVRSFAERMFGDGSVLIERYFPRVRHVEVQILGLADGRVV
FT                   ALGERECSVQRRNQKLVEESPSPAVTPELRSRFLAAAVRAGEAVGYRNAGTVECLLDPT
FT                   TDEFFFLEMNTRLQVEHPVTESVYGVDLVEEQLRVAAGLPPTFDPDAVTPRGHAIELRV
FT                   NAEDPKRFLPGPGAITVWTEPAGEGVRVDAGYVAGNTVTPFYDSLMAKLIVSGADRAEA
FT                   ISRARAAVAQFQLVGPKNNLPFFAELLDNAEFLSGDYDTGIVSRMR"
FT   gene            38129..39040
FT                   /locus_tag="Sare_0032"
FT   CDS_pept        38129..39040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0032"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   stp:Strop_0026 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95968"
FT                   /db_xref="GOA:A8LVJ9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVJ9"
FT                   /protein_id="ABV95968.1"
FT                   /translation="MPGFVSIREVGPRDGLQNEEPIPTEAKVRLLDALSRTGVRRIEAV
FT                   SFVHPKAIPQMADADEVWRRAERADGVRYSALVPNIRGAQRALAAGFTEVEVVVSASDT
FT                   HNRRNINRSTDESLDDVAELVGLLHDAGAQAEVIVATSFGCPYEGDVDPVRVAGIVDRV
FT                   ARDGADRVAFGDTTGMATPRRVREVVTAVRDRNAGIPVLLHFHNTRGTALANLLTAIEL
FT                   GVTEFDASVGGLGGCPYAPGASGNLATEEAVHMLHDMGIDTGVDLAALIEAAELAEELT
FT                   GRRLPSGVLRAGPRTRLTPLAS"
FT   gene            39238..40770
FT                   /locus_tag="Sare_0033"
FT   CDS_pept        39238..40770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0033"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: stp:Strop_0027
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95969"
FT                   /db_xref="GOA:A8LVK0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A8LVK0"
FT                   /protein_id="ABV95969.1"
FT                   /translation="MTLDGEALEQLRKRARAGGADKYHAANAAKGKLFARERVASLVDD
FT                   GSFVEDGLYANALAEGLPADGVITGTATIDGRPVCLMANDSTVKAGSWGARTVEKIIRI
FT                   IEQAYATKVPMVYLVDSAGARITDQVELFPGRRGAGKIFWNQVRASGSIPQVCALFGPS
FT                   AAGGAYIPAFCDVVAMVDGNASMYLGSDRMVEMVTGEKTTLEAMGGARVHCAESGVGHF
FT                   LCRSEADALDVVRRYLSYLPTNWTQPPPAAPAAEAPTKVDLAALVPASERQAFDMRRYA
FT                   KGLLDQGSFFEIQALWAKELTIGFGRLDGEVVGVVGNNSMFKGGVLFVDSADKATRFVQ
FT                   LCDAFNVPLLFLSDVPGFMVGSAVEKQGIIRHGAKMITAISEATVPKICVVVRKAYGAG
FT                   LYAMAGPGFEPDATIALPTAKIAVMGAEAAVNAVYANKIAAIGDESERAAFVAARREEY
FT                   EQDIDIVRLAGELVVDAIVEPHELRTELIRRFAAARGKDRHFATRRHGVTPV"
FT   gene            40828..41982
FT                   /locus_tag="Sare_0034"
FT   CDS_pept        40828..41982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0034"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: stp:Strop_0028
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95970"
FT                   /db_xref="GOA:A8LWE7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWE7"
FT                   /protein_id="ABV95970.1"
FT                   /translation="MDFRLTEEHEALRTSVRDLAREVVAPVIAEHYERHSFPYDVIRQM
FT                   GKMGLFGLPFPEEHGGMGGDYFALCLALEELARIDSSVAITLEAAVSLGAMPIYRFGTD
FT                   EQRERWLPRLLTGTALAAFGLTEPGFGSDAGGTQTRAVLDETTDEWVINGAKAFITNSG
FT                   TDITDLVTVTAVTGTRPDGSKELSTIIVPTGTPGFTVAPGYSKVGWTASDTHELTFDDC
FT                   RVPAGNLLGERGRGFAQFLRILDEGRIAIAALAVGLAQGCVDESVRYARERHAFGRPIG
FT                   SNQAIQFKIADMELRVHTARLAYYDAAQRMLAGEPFKRQAAIAKLHASTIAVDNARDAT
FT                   QIHGGYGFMNEFPVARFWRDAKILEIGEGTSEVQRMIIARELGL"
FT   gene            42110..44671
FT                   /locus_tag="Sare_0035"
FT   CDS_pept        42110..44671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0035"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   stp:Strop_0029 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95971"
FT                   /db_xref="GOA:A8LWE8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWE8"
FT                   /protein_id="ABV95971.1"
FT                   /translation="MNPEDDRSRWSSGRTGLPDLLRGHRLAAGLTQAELATRAGIGVRT
FT                   VRDVERGRSSRPQRTTIELLATALGLAGAARSTFVAARHVPTPRSPEPEPPSYDGSAGV
FT                   VRPAVLPPAVELIGRERDVVELVGMLTSDPAVRLVSLVGLAGVGKTALALAVAHAAAGR
FT                   LPGGVAGVLVGEGSDVAEVLAVSAAVFGAARLPELATRLDGQPALLIVDAVERAPGTAV
FT                   ETVHRLASAVPSLRVLVTGRHPVGLRGERVRPVAPLDAPPPDRDDADSASLARYPAVAL
FT                   FTARLALVRPNPPTAAELPALARLVRRLGGLPLAIELMAARGRILDLNELLDRYGDRVL
FT                   DLATFSGAGERPGWNAADPGPVQRTPATAVETLRDAVATSYLLLTPKERAALRRLAAFS
FT                   NRWSVKLAEEMLDVGPDAADTVVTDSVALLDRLLELGLLSVRGAGPFRFRLLDAVREFA
FT                   VEQTAGVGELTAVRRRHARVIARLVARTAPNLVGSDLIAAVHRLDNMGGDISSALAHAA
FT                   VDDPVTALRLAAGLTRWWRFRGRDVAGRRWLRRLLADPRTADAAPVLRAWAGLGVARLA
FT                   AEHGAGAEELPAARAALGAFRSAGDVAGELEARTVLSALLTGTGDHDEARGQAEAVLAL
FT                   ATRHGRTRDMTVAQNNLAWHGIRVGDLATARRRLAAADRLAAQCGDRRLRALAMANLAE
FT                   VARLEGRYGVAVDQGRRTLAALTALGDPGHHRRVLGTVGLALARDGRVVEATEVLAELR
FT                   RGGPVAGLGRMPADGICALIEGTLALHQGDRDLAAEWFAVAVESGANGQDRRDLVEALV
FT                   GLAASTADPAVLDRLREVCRDSGFRLLPPEMESLEAVTRRP"
FT   gene            complement(45043..45207)
FT                   /locus_tag="Sare_0036"
FT   CDS_pept        complement(45043..45207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95972"
FT                   /db_xref="GOA:A8LWE9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWE9"
FT                   /protein_id="ABV95972.1"
FT                   /translation="MSTTGTTGAALVPGLRVAGGVAAAIALLGAGIALTIRRSGARTAV
FT                   DEPRVTTTV"
FT   gene            45370..46848
FT                   /locus_tag="Sare_0037"
FT   CDS_pept        45370..46848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95973"
FT                   /db_xref="GOA:A8LWF0"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF0"
FT                   /protein_id="ABV95973.1"
FT                   /translation="MGRDVTQGAFSREDRIRYRRKVRRCLDVFALMLDDFGFDGDRPMT
FT                   GLEIELNLVDSAAEPAMRNEEILADIADPLFQTELGQFNLELNAAPRLIEGTGFAGYEQ
FT                   DLRGSLARADERAAKSDAKIVLVGILPTLTEGHLVADNLSTNERFRVLNDQIVRARGED
FT                   IELDIRGVERLQTHTDSIAPEAACTSLQFHLQVAPDSFADYWNASQAIAAAQVAIGANS
FT                   PYLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   SLLPICEEEDPVEVLHAGGVPQLGELRLHNGTVYRWNRPVYDIMNGRPHLRVENRVLPA
FT                   GPTVVDMLANAAFYFGLARGLAEAERPTWSQLTFSSAEENFLTAARRGMDAMLHWPRLG
FT                   EVPVAGLVLDVLLPQAAVGLDRFGVAPVERDRLLGVIEQRCQTGRNGAVWQSEAVWAAE
FT                   RHRNLDRPAALHHMLQRYAELQRSNEPVHTWPVD"
FT   gene            complement(46934..48370)
FT                   /locus_tag="Sare_0038"
FT   CDS_pept        complement(46934..48370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95974"
FT                   /db_xref="GOA:A8LWF1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF1"
FT                   /protein_id="ABV95974.1"
FT                   /translation="MARRGWGTSITTALGTAAGAGAAQLGFGYGLGIINWAPPPDESTA
FT                   ATAWTASLIWAMWIAATSTVVGAVGAQHLRRRSRAGDHATSNRSGSGSGEAEATSATTS
FT                   PGDLDPAATTETGARHLSVDASDTDGALGRLALAAAAGFGALVTVLLTAVPARVAVVPG
FT                   VTAPRDVAAGYATVGVLVGVAIAVWALHSRAAAGNVIATLGWLWLLAVVAVVDGVVAGR
FT                   GLSSAQLGIWQLSAGGEGLWLRDWFYWPGAVLSLGSALLIGVLVARRAPRHPDRQVGAT
FT                   ASGAAGPLLVAVAYLVAVPDLAELAAGQASAHLIAPYAVIVGFGGSALVTALGNRADRR
FT                   TRAYPPRPVESHAGPGTDGSTTATPTTRGRVRGSGSRRSRTVKSDPTAEAGEPTAASDA
FT                   TGASAPDDQPSDASGRPSAPGGARRGRGTAARSGSAGGDPTTEVPVQRTAEAAPADATT
FT                   ASKESTDGGSRRARSTRRTS"
FT   gene            complement(48473..48883)
FT                   /locus_tag="Sare_0039"
FT   CDS_pept        complement(48473..48883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95975"
FT                   /db_xref="GOA:A8LWF2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF2"
FT                   /protein_id="ABV95975.1"
FT                   /translation="MVNQPTAWRHSPRIAYTFGLLALVGAATVLVVVARHPAFATPQLS
FT                   TPVPAPEITVFEDVPGHGDTTGSDPFMPDDGLDEPAMVPRVDSNPAAGPAARTPGKHPP
FT                   EDVRRSLFWSGIFGLTISLAGLGLVGTRRRGW"
FT   gene            complement(48987..49274)
FT                   /locus_tag="Sare_0040"
FT   CDS_pept        complement(48987..49274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95976"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF3"
FT                   /protein_id="ABV95976.1"
FT                   /translation="MLPRTGDVLHVTRAASVQFLRPITFRVIRVLDWPTYDGWLWLDGY
FT                   ELNASGDAVSRRSIFVQQDGLYQIQAAPQRQPHTVRTPRRPLVRTPVRVG"
FT   gene            49693..50574
FT                   /locus_tag="Sare_0041"
FT   CDS_pept        49693..50574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0041"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   stp:Strop_0036 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95977"
FT                   /db_xref="GOA:A8LWF4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF4"
FT                   /protein_id="ABV95977.1"
FT                   /translation="MTERRSPTIRRRRLGAELRRQREAAGITIESVAEHLECSASKISR
FT                   IETGHTTATPRDVRDMLRIYGVVGAESDELVQIAREARQKGWWHPYSTVLVGAYVGLEA
FT                   AASSIRAYEQQVVPGLLETEEYASAMIRAARPDFTPEQVAQRVRVRLGRQSLLTQNDPV
FT                   DLWVVLDETVVSRPVGGDTVMRGQLKRLLEVAELPNVTVQILPFEVGAHAGMDGTFSIL
FT                   SFPEPSDPDVVYAENATGGLFLEKSDELQKYSFIFDHIRAAAMRPEESIARIAKLAEEP
FT                   LWKWRPRSSPWT"
FT   gene            50544..50765
FT                   /locus_tag="Sare_0042"
FT   CDS_pept        50544..50765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0042"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   stp:Strop_0037 protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95978"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF5"
FT                   /protein_id="ABV95978.1"
FT                   /translation="MATKEFPVDLTQGTWFKSSKSGPNCDNCVEVAYVPGAVGVRDSKD
FT                   RSGPALVFSPGGWRSFVTDARGGAFDRR"
FT   gene            50962..51366
FT                   /locus_tag="Sare_0043"
FT   CDS_pept        50962..51366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95979"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF6"
FT                   /protein_id="ABV95979.1"
FT                   /translation="MTTIGSENLTNGPGKPERFGGKYRGTRRDSVLTEVVSPEAESGER
FT                   KDGPAPERPSPSRPLSSLDHDPLTGPRFPADGWSAGPAESLVDHPLLRGLLMELPPKGS
FT                   VPPPGWLDRWFEATRAILELLYVQGSGRSR"
FT   gene            51562..53118
FT                   /locus_tag="Sare_0044"
FT   CDS_pept        51562..53118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0044"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Proprotein convertase P; proteinase inhibitor I9
FT                   subtilisin propeptide; KEGG: stp:Strop_0039 peptidase S8
FT                   and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95980"
FT                   /db_xref="GOA:A8LWF7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF7"
FT                   /protein_id="ABV95980.1"
FT                   /translation="MGLSRRSVFVGLATMAMVASATPAMAAEPVGTIRSAGGATAVADS
FT                   YIVVFKDSRVSRGAVEQSVDRLLDRHGGQMARMYTAALRGAEVRVDASAAARIAADPAV
FT                   AYVEQNHTVSIAGTQPNPPSWGLDRVDQRNLPLDSSYTYPNTASDVTAYIIDTGIRTTH
FT                   TDFGGRATWGTNTADNNDTDCNGHGTHVAGTVGGSAYGIAKEAKLVAVKVLNCAGSGSY
FT                   AGVIAGVDWVTANADKPAVANMSLGGGANSSVDNAVTNSINSGVTYALAAGNSNANACN
FT                   YSPARTPAAITVGSTTSTDGRSWFSNYGTCLDLFAPGSSITAPWNDSDNGTNTISGTSM
FT                   ASPHAAGAAALVLSANPSYTPQQIRDALVDNATDNVVGGPGSGSPNKLLYIGDGGTPPP
FT                   PPPPGCTGTNDTDVAIPDAGAAVTSSITITDCDGNASAASTVAVDIPHTWRGDLVIDLI
FT                   APDGSSYRLKTNNLSDSADNVNETYTVNLSSEVADGTWKLQVQDVYRADTGYINTWTLT
FT                   V"
FT   gene            complement(53191..53994)
FT                   /locus_tag="Sare_0045"
FT   CDS_pept        complement(53191..53994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0045"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   stp:Strop_0040 glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95981"
FT                   /db_xref="GOA:A8LWF8"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF8"
FT                   /protein_id="ABV95981.1"
FT                   /translation="MTRGKRNVLGVLVDATDYATATEAVVTAAYERQPLALTALAVHGV
FT                   MTGVLDPVHNARLNSFDVVTPDGQPVRWALNVLHRAGLTDRVYGPTLTLHVLSRFADEG
FT                   LPIYLYGSTEETLAKLVPALERMFPALKLAGVEPSKFRSVQPGEDVEIADRIRSSGARL
FT                   VLVGLGCPRQEIFTYAMRPLLDMPLMAVGAAFDYHAGLLRQPPPWMQRAGLEWFWRLGL
FT                   EPKRLWRRYVILNPAYLSRLAAQKVGLWKAKPPEPATERPTGFAV"
FT   gene            complement(53991..55064)
FT                   /locus_tag="Sare_0046"
FT   CDS_pept        complement(53991..55064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0046"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: stp:Strop_0041 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95982"
FT                   /db_xref="GOA:A8LWF9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWF9"
FT                   /protein_id="ABV95982.1"
FT                   /translation="MSVAFVTGSGGLIGSEAVRHFAGLGLDVVGIDNDMRQEFFGEEAS
FT                   TAWNVRRLTEELGPAYSHHSIDIRDRDSLAKLFRRYGRDTTVVIHTAAQPSHDWAVRDP
FT                   FTDFDVNAAGTLNVLQNVREHCIEAPFIHCSTNKVYGNRPNSLPLVELETRWEIEPGHP
FT                   YEQGIREDMSIDSCLHSIFGASKVAADVMVQEYGRYFDMRTACFRGGTLTGPAHAATEL
FT                   HGFLGYLMRANMERRTYKIFGYQGKQVRDAIHSSDVVSAFESFFRNPRSAAVYNLGGGR
FT                   HSNTSMREAFALARQITGQEMISEYVEANRIGDHKWWIGSNEAFHADYPDWKQVYDVPM
FT                   IMREIYEANVDKWVPQP"
FT   gene            complement(55168..55253)
FT                   /locus_tag="Sare_R0003"
FT                   /note="tRNA_Leu5"
FT   tRNA            complement(55168..55253)
FT                   /locus_tag="Sare_R0003"
FT                   /product="tRNA-Leu"
FT   gene            55506..56267
FT                   /locus_tag="Sare_0047"
FT   CDS_pept        55506..56267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0047"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   stp:Strop_0042 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95983"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG0"
FT                   /protein_id="ABV95983.1"
FT                   /translation="MSVLQRFEKRLEGLVEGAFAKVFKGVVHPVEILNAMQREAEAHKA
FT                   ILAGGRTLVPNRYVIDLSPYDHSRLAPYAAALAQELAQSQAEFIGEQAWTVYGDVIVEI
FT                   ERGEGLDTGMFRVTAEVYTGGEVAPVSGPGYDAGPPAYPAYEQGGGYGPPPGHGGGHNV
FT                   RLVSGDGRTYPLQLGSTVIGRGDQATLRLPDVGISRRHARLDFDGGQVVLTDLGSTNGT
FT                   MVNGQRVSAVALNPGDMIQLGTTTLTFRVDG"
FT   gene            56274..56759
FT                   /locus_tag="Sare_0048"
FT   CDS_pept        56274..56759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0048"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   stp:Strop_0043 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95984"
FT                   /db_xref="GOA:A8LWG1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG1"
FT                   /protein_id="ABV95984.1"
FT                   /translation="MPELVITVARFGFLILLWIFVFTVVGVIRRDLFAGARSGRLVAAP
FT                   RGVGAALGQATKPARVKRGRAAHQLVVTAGQLAGTRITLGEAQITIGRAEDSTLVITDD
FT                   YASARHARLVPRDGQWFVEDLGSTNGTYLDRAKVTGPTPVPLGVPIRIGRTSLELRP"
FT   gene            56756..58192
FT                   /locus_tag="Sare_0049"
FT   CDS_pept        56756..58192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0049"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: stp:Strop_0044 protein
FT                   phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95985"
FT                   /db_xref="GOA:A8LWG2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG2"
FT                   /protein_id="ABV95985.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGNALVDALRSAVTNATQQLRETVDANPQLEGMGTTLTAILFS
FT                   GSKLGMVHIGDSRAYLLRAGEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDAEYSVRQVLTGDRYLICSDGLSGVVSADTIADTMREYADPQQCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEATPIVGGAASRDRGMATSADDSTPAARASALSASPPAP
FT                   PDEPTAGADDEPERRRRRPIRVAAVTLALLVLVGGAVYGGWSYTQRQYYVGATEGGQVA
FT                   VFRGIEGQVAGVDLSTVHSTSSAELDDLTLAAQERVKQGIPAKSESDAARRLAELTADV
FT                   PTNPNLKPTCPPSPSPSPSAVSVTPTPTPVAGTPSPSPSAAIPSAAATDQPTEPTTSPD
FT                   ALPADPAPPAVDPAACRSPE"
FT   gene            58221..59711
FT                   /locus_tag="Sare_0050"
FT   CDS_pept        58221..59711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0050"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: stp:Strop_0045 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95986"
FT                   /db_xref="GOA:A8LWG3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG3"
FT                   /protein_id="ABV95986.1"
FT                   /translation="MTVAATPASPPATTGGQNGVRLARSRRNAELSLLMLAMVLVAAYG
FT                   AMVEASVLDRVTPNFWVPAAALSAVFLGLHVAIRFLAPFADPALLPSVALLNGLGVGFL
FT                   HRLDLARATPAERADLATFAGTGGRQLAWTLISVALAAGLLAVVRDHRSISRYAYTLGL
FT                   AGIVLVMIPAVLPSSISEINGAKLWVRVGGFSIQPGEFAKLALLAFFAYYLVRKREVLS
FT                   LASRRILGVDLPRGRDLGPVVVVWLISLLVLVFEKDLGTSLLYFGMFVVTLYIATERVS
FT                   WLLIGLVLFFGGAYLAYVLGSTVGGPFANFYLRAEIWLDPFADPYNDGYQLVQGLLALG
FT                   TGGMFGAGPGGGQPLKLPEVQNDFIFAGLGEEIGLFGLSALLVIYLLIVERGLRAALAV
FT                   HDSFGKLLAGGLAFTLGLQVFVIVGGISRLIPLTGQTTPFLSAGGSSLMANWLLIAVLL
FT                   RVSDAARRPVSGGSGPAPRPTGGPPEQLHGAPTEVIRP"
FT   gene            59708..61219
FT                   /locus_tag="Sare_0051"
FT   CDS_pept        59708..61219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0051"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: stp:Strop_0046 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95987"
FT                   /db_xref="GOA:A8LWG4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG4"
FT                   /protein_id="ABV95987.1"
FT                   /translation="MNAPLRRVGLVVIVLFGLLFANLNWIQAYKADDYRNSDYNGRVQV
FT                   AEYERKRGNIEAGGTALAVSKETGGELKYLRTYPGGPKYAHVIGYKPVNLADTGIEESE
FT                   NEFLAGTSDRLIGDRLRDLVTGDETAGANVLLTISKQAQDVAYEQLRKNRLGVKKGAAI
FT                   ALDPSTGAVQALVSMPSFDPDPLASHDTDEATAAFNELQQDPDGPLKNRVLKEVLPPGS
FT                   TFKIVTAAAALENGVTTETKIPAGPSWTPPTSGQPIGNAAPSICPEAEVTLMNAVTESC
FT                   NTGFAQLGVRLGADTLKEKARQFGFDQDEDDLTVGRIGEDGESVAASRTGSMENADGSV
FT                   DPAALAQSSIGQRDVRMTPLQGALIAATVAHDGRQMSPYLVSQILGPDRTTNYYPTTKP
FT                   RELRQPVSGEVAADLRAMMVSAVENGTGRNARIGGYTVGGKTGTAQDGDKPPHGWFIGF
FT                   ALDKDGKPVSAVCVVLESAGDSGSAEAARIAGQIMRAAIASPGSR"
FT   gene            61221..62648
FT                   /locus_tag="Sare_0052"
FT   CDS_pept        61221..62648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0052"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   stp:Strop_0047 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95988"
FT                   /db_xref="GOA:A8LWG5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG5"
FT                   /protein_id="ABV95988.1"
FT                   /translation="MLSPGVKLGNRYRLDERIASGGMGDVWRGTDQVLGRTVAVKSLLP
FT                   ALLDDPDFAERFRGEARTMATINHPGVVDIYDFGSDQQIAFLVMEYVEGDALSSTLKRV
FT                   GRLTPARTMALVAQAADALHAAHLEGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVA
FT                   QLTAAGSVLGTASYISPEQATGAVATPVSDVYALGVVAYQCLSGRRPFEGDNPLEIAMQ
FT                   HVRETPRSLPADIPPQVQVVVERAMAKDPADRWQSAAALAGVTRQLKVQLSQIARETGR
FT                   ARPVSAAPASPAPGRAKVPPPAVARPPRASRPPIVAPQPSGPPMVAPQPSRPSVAVPQP
FT                   SRPPVVAPQASRPPAPALAPRPQPGWPRVAAAAPASARPGYAPVPAPPPRRSRLGTVFL
FT                   AILLAVLVLACFGMVSFILRQSNQAGPSGVPARRTGTSSELRLDGRDDPVGTSYRRQQL
FT                   PRTGGDETTTSEGRQTR"
FT   gene            62645..64456
FT                   /locus_tag="Sare_0053"
FT   CDS_pept        62645..64456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0053"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: stp:Strop_0048 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95989"
FT                   /db_xref="GOA:A8LWG6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG6"
FT                   /protein_id="ABV95989.1"
FT                   /translation="MTAQARLLGGRYQVGELIGYGGMAEVHRGRDLRLGRDVAIKMLRT
FT                   DLARDATFQMRFRREAQNAASLNHPAIVAVYDTGEEQAPTGETLPFIVMEFVNGRTLKE
FT                   VLGGEGRLQPRRALEICADMCAALEFSHRHGIIHRDIKPGNVMLTQTGQVKVMDFGIAR
FT                   ALASGATTMTQTSAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLCGHPPFVGDS
FT                   PVSVAYQHVREAPPTPSDLNPEVPPAVDAIILKALSKNPLNRYQSAGEMRADLLRAAAG
FT                   RPVMATPVLRQDETTQVAPAGAGYPPTASGPYTQRIPARVGDPRRRRASSWLIAAFVAL
FT                   GVLAVVALAAARFGLPDTPEQATVPQVTGLTQAEAFAAIQRANLAPDTGTEVRNNDCVQ
FT                   GRVANQEPGQGTRLQPNEVVTVYICAGPATAKIPDTLVGTTFENAKRQLENAGFTVKRA
FT                   EVDDGAPKDTVLRVSPEEGAQVAEGEEVTLTVSRGNVGTVPNVVNSYVNDAKEELEDAG
FT                   YQVRVRSGDPVPPGEEGRVTKQDPRPNTKLQKGKRVTITVTVAEEPTESPSPSPEPTES
FT                   PSPEPPDGGGGGGVPLPTSLPARHPAR"
FT   gene            complement(64501..65151)
FT                   /locus_tag="Sare_0054"
FT   CDS_pept        complement(64501..65151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0054"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   stp:Strop_0049 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95990"
FT                   /db_xref="GOA:A8LWG7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG7"
FT                   /protein_id="ABV95990.1"
FT                   /translation="MRILVIDNYDSFVFNLVQYLGQLGADCEVRRNDEISVAEVGKANA
FT                   DGVLLSPGPGSPDRAGICLDVIRDYAGVLPLFGVCLGHQAIGEAFGATVARASELLHGK
FT                   TSEVRHHDVGVLAGLPERFTATRYHSLTLLPETLPDELEVTGWTDSGVVMAMRHRTLPI
FT                   EGVQFHPESVLTEGGHLMLANWLASCGYPEALERAPALAAEVDARRRTAFSPT"
FT   gene            complement(65155..65439)
FT                   /locus_tag="Sare_0055"
FT   CDS_pept        complement(65155..65439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95991"
FT                   /db_xref="GOA:A8LWG8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG8"
FT                   /protein_id="ABV95991.1"
FT                   /translation="MYAWIWRKLPFGLPGKLAGSVLLAAVTVTLLWFVVFPWAEPLLPF
FT                   DDVQVTNPAGPGDPGAPGPLPGEGQTPTEDGHDLPYDTDENNPPPSPEE"
FT   gene            complement(65444..67114)
FT                   /locus_tag="Sare_0056"
FT   CDS_pept        complement(65444..67114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0056"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: stp:Strop_0051 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95992"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWG9"
FT                   /protein_id="ABV95992.1"
FT                   /translation="MTRAPDGWQHDRGDDPTAFIPKVEHPWQQPTHDPEQPSAQLDPPP
FT                   QSGSPSHPPRSTAASARPASPPGAPPPRSAHQPTGHRPDLPPPSGPPPPPGPPAPPAHA
FT                   TTPTYTHPAGPTFDTRRPPASEKPPAPHQPPAAHRDLGPEPPSHTPGTATPTPSSHDRR
FT                   HHSGSEPRIDPATVDPAPPTWDHTPQTADAPTALIPATPLRSATPGGSTVTGTNQGTAA
FT                   PTDPTGTTTDAAPPPSRPTATTSPASPTDPAATALIPRVVSRTPPTHDSTALMGAVPRT
FT                   SQGAEHMADATAPETAEPRRGERVVKLRPEQSADGYKSVYSELTRPTFTSRLRIGVRAA
FT                   GEILITFGMVVLLFAGYEIWGKSVIVNAHQDDLSQQLAEAWGPTGDPTVTPSATSSSAP
FT                   VPAPQTVQGTPIAGLYIPRLNKSWIVVEGITQKDLRYAPGHYPTSALPGQLGNFSIAGH
FT                   RNRATFWRLDELDEGDVIVAEDRNEWHVYRVTRNHIVRPSQVEVVAPVPGEPDAKPTTA
FT                   MLTLTTCHPKFDNYERLIIHAKLDRTQAKSAGRPAELGG"
FT   gene            complement(67111..67914)
FT                   /locus_tag="Sare_0057"
FT   CDS_pept        complement(67111..67914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0057"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   stp:Strop_0052 protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95993"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH0"
FT                   /protein_id="ABV95993.1"
FT                   /translation="MEYTSGAASWKKALRRAAAALVQRPRRRRFGWPVGVPLIAAAAGL
FT                   LFTTTATTAGGTTLREDRRPQLNQLIQDRRAEVVASEQQAAALRARVEAYTSALAGSDG
FT                   TIQKQQARAAASREAAGFTELTGQAVTVELDDAPRRSDGSLPTGATNDDLVVHQGDVQA
FT                   VVNALWAGGAEAMSIMDVRVLATSAVRCVGNTLLLHGRVYSPPFKIVAIGDPASLERAL
FT                   AESEGVRLFRDLANTYELGYNQTVSTVTVPAFDGSAALRAATVPE"
FT   gene            68100..68363
FT                   /locus_tag="Sare_0058"
FT   CDS_pept        68100..68363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0058"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   stp:Strop_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95994"
FT                   /db_xref="GOA:A8LWH1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH1"
FT                   /protein_id="ABV95994.1"
FT                   /translation="MPKSQVRKKKVYTPPTDVRPTATAATRKPSPVWLPATAVSLIVAG
FT                   IGWLVVYYLSEQAYPVMSWGYWNLAVGFGAMVGSLILLSRWR"
FT   gene            68671..70827
FT                   /locus_tag="Sare_0059"
FT   CDS_pept        68671..70827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0059"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: stp:Strop_0054
FT                   protein of unknown function DUF224, cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95995"
FT                   /db_xref="GOA:A8LWH2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH2"
FT                   /protein_id="ABV95995.1"
FT                   /translation="MGSVQIVTTIVAAAITAVAVWLAVRAVMTMTAVIRLGQPDPARFT
FT                   DKAARTRTMLAETAGHTRMLRWSVVGAAHWFVMVGFIVLSLLVLEAYFEVVSPTGGLPL
FT                   IGNWVVYGLVTEGLGILGIAGILVLIAIRLHNRPNRPGGKSRFTGSTMWQGYFVEAVIL
FT                   GVLIMGFAIRGFKVATDHFEYPVWAAPLSHAVGGLLPSWEAGVSVAALIKIAISMAWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRNPGRPGSGLGALRPMTSNGKPLDFEEADPEKDQF
FT                   GVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYLL
FT                   AGGGRDLAGAEQATAAQLAHVDALALAEAEKPLIGGAEESGVIDPDVLWSCTTCGACVE
FT                   QCPVDIEHVDHIVDMRRYQMLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGLD
FT                   FEVPRVGEVEDFEYLFWVGCAGAFEDRAKKTTRAVATLLHEAGVSFAILGEGETCSGDP
FT                   ARRIGNEFVFQMLAQQNVETLNEAFDGREPSKRKIVATCPHCFNTLGNEYGQLGGEFEV
FT                   VHHTQLLAHLVATGKLTPVQPIDGGVTYHDPCYLGRHNRVFAPPREVLGTAVQGEVTEM
FT                   PRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAATVAVGCPFCSTMLNDGVN
FT                   GKGAGEQVEVVDVASVLLRSMRPE"
FT   gene            71210..72223
FT                   /locus_tag="Sare_0060"
FT   CDS_pept        71210..72223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0060"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: stp:Strop_0055 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95996"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH3"
FT                   /protein_id="ABV95996.1"
FT                   /translation="MATTPPHRDASVWSRRPKGLRRAARGLLTLTAAVAVSVGVLAVPA
FT                   HAEPSVDEIEAAIDKQWRELEPTIEQYNKVRAQLKVNREKSAELEKKIAPLLLESEIAT
FT                   NRIGDLASRYYMTGPSREIGALLVNPDSDSIGEQLVLLDRVAAMERKQLEEVVAIRQKY
FT                   DTEKQKLDALIVAQGKQEKGLAAKKKQIDAEIKRLKASLPVTTVSTPQCPTINGVVSAA
FT                   ARTAIKTACAQVGDPYVWGATGPNSFDCSGLTQYAYKAAGIYLTHYTGAQWNEGKAISR
FT                   SEARPGDLVFFSSPSNLHHVGLYLGNSQMVHAPRTGKPVMVGSINSMSVAGFRRPG"
FT   gene            complement(72345..72923)
FT                   /locus_tag="Sare_0061"
FT   CDS_pept        complement(72345..72923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0061"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: stp:Strop_0056
FT                   deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95997"
FT                   /db_xref="GOA:A8LWH4"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LWH4"
FT                   /protein_id="ABV95997.1"
FT                   /translation="MLLSDRDLAAEIKAGTLALEPFDPALVQPSSIDVRLDKLFRVFNN
FT                   HLYTHIDPSRQQDDLTSTVEVPAGEPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVANLPIMLWPGMKIGQLCIFRLSSPAEYPYG
FT                   SAVYGSRYQGQRGPTPSRSWQSWHTWPTR"
FT   gene            73001..73534
FT                   /locus_tag="Sare_0062"
FT   CDS_pept        73001..73534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0062"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_0057 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95998"
FT                   /db_xref="GOA:A8LWH5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH5"
FT                   /protein_id="ABV95998.1"
FT                   /translation="MASWSEFAADVPRLAEGIRRLLQQYGPGLGYLATVRADGGPRVHP
FT                   VSPVLTDEGLFCFVIDSPKRRDLERDGRYALHSFPAEECDDEAYLAGHARPVTDPTWVT
FT                   RLAHQHRASSGTDWRLFEFTIDIAMIARRDAASPARPAVHVWLEPGAPTASERLGRVRG
FT                   ASRTSTVGQRAEAA"
FT   gene            complement(73610..74614)
FT                   /locus_tag="Sare_0063"
FT   CDS_pept        complement(73610..74614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV95999"
FT                   /db_xref="GOA:A8LWH6"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH6"
FT                   /protein_id="ABV95999.1"
FT                   /translation="MGLRPNLLSRRSAGIASTSFALLLGAVTAGYVPAHAAPADGHHAA
FT                   GHAESAECAPVDAHAKVKARPGGVNAHDPNHLTEAQVLARENELDELVHERMRRAGAAG
FT                   LTSAAPASIAVPVAVHVIQENSTRAGGNIPDSMIYSQIDVLNQSFSGETGGAATAFTFQ
FT                   LQSINRVTNPSWYPIIKDSSAERSMKSSLRTGGMETLNVYLGDLSSGLLGWATFPERSL
FT                   NDMDGVVVLSESLPGGTATNYNLGDTGTHEVGHWLNLYHTFQRGCRGSGDGVSDTPAEA
FT                   SPAYQCPTGRDTCSAPGLDPITNFMDYTYDSCMYEFTPGQASRMLTAWNVYRA"
FT   gene            74903..74976
FT                   /locus_tag="Sare_R0004"
FT                   /note="tRNA_Gly1"
FT   tRNA            74903..74976
FT                   /locus_tag="Sare_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(75029..75577)
FT                   /locus_tag="Sare_0064"
FT   CDS_pept        complement(75029..75577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96000"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH7"
FT                   /protein_id="ABV96000.1"
FT                   /translation="MTHGRTLAGRAVVCSACPGRRLAGWPRATTHGPRPADGAPAILES
FT                   LRPRRRRSNRDRFATRDPPHGPGVPFPAPRRSGAARPAAGDKPPPLSHRSVCGGPRASR
FT                   SPRQPPGVLRGRSRSVSGATDARRGGGACGPSRAALTRAALIYQHTAQERDQHIADGLS
FT                   EQIKKNRDRARKGHGKAKK"
FT   gene            complement(76641..77435)
FT                   /locus_tag="Sare_0065"
FT   CDS_pept        complement(76641..77435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0065"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sen:SACE_7344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96001"
FT                   /db_xref="GOA:A8LWH8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH8"
FT                   /protein_id="ABV96001.1"
FT                   /translation="MTSADTTTEQFPVRVFGGPTALFEYGGLRLLTDPTFDAPGDYYES
FT                   GQRILTKTAPPSGSSADLGRIDVVLLSHDKHPDNLDNSGRVLLADVPLTLTTPEGGRRL
FT                   GNRAKGLADWESIELDRPGGGRITVTGVPAIHGPGAREDVEPITGQVVGFVLTGEGLPT
FT                   VYVSGDNASLDAVKEIAERFEPVDTAILFAGAPRFPGVLFDGALIVLDSVQAAEAAEIL
FT                   GTRRVVPVHYDSWAHFTEGRNELVAAFTAAGLVDRLDLGDER"
FT   gene            77525..78124
FT                   /locus_tag="Sare_0066"
FT   CDS_pept        77525..78124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0066"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   sen:SACE_7345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96002"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWH9"
FT                   /protein_id="ABV96002.1"
FT                   /translation="MTESWTVEPVLPSAPGAEQYLALDFVNSAIALPGGQFIDLLGTPE
FT                   TTNHWLTERGLAPAGAGVQEMCATQLRSLREHVRALFAAHVAGLSPLPAALSAVNDALS
FT                   RAPTAALLLWNDKEGPYRAAPCPTNEVLEHALAALAASTADLLTGPHSGCLTACDSTPC
FT                   NRYLLRRGRRHWCSTRCGDRARAARAYARRTQSKVD"
FT   gene            78756..79595
FT                   /locus_tag="Sare_0067"
FT   CDS_pept        78756..79595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0067"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: sma:SAV543 putative methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96003"
FT                   /db_xref="GOA:A8LWI0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LWI0"
FT                   /protein_id="ABV96003.1"
FT                   /translation="MTATLMDGRTLSRQLLESTAERVTGFHRSHGRRPCLATVLVGEDP
FT                   ASHTYVRIKVNRCTEVGIDSRRFDLPTLTTTEQLVRVLRDLSSDSAVDGILLQHPTPPQ
FT                   IDEHAAFEAIDPSKDVDGVTGTSFAAMAFGYRGFASCTPAAIMRLLDAYDVPLSGQRAV
FT                   VVGRSAILGKPIGMLLLARDATVTYCHSRTTDLAAHVAEADLVVAAVGVPHLVRGEWIK
FT                   PGAVVVDAGYNAGNVGDVQAATAANRASLITPVPGGVGPMTIAVLLAQTVDAAERHG"
FT   gene            complement(79903..80340)
FT                   /locus_tag="Sare_0068"
FT   CDS_pept        complement(79903..80340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96004"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI1"
FT                   /protein_id="ABV96004.1"
FT                   /translation="MRDPHRRVVVAVDMDEQVKEAVRPYWEQLIRLDCEHDVRVRRAEY
FT                   TERLSRQWTDILTDLLGSPAAAGAAEMTEKELAEVVGRIVAEQRAAAEKLEDMMAEKVN
FT                   STDMQERCEHFEQLRERLERRADGLFHSASTAPAGDGDGPV"
FT   gene            80497..81000
FT                   /locus_tag="Sare_0069"
FT   CDS_pept        80497..81000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96005"
FT                   /db_xref="GOA:A8LWI2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI2"
FT                   /protein_id="ABV96005.1"
FT                   /translation="MTLADQSDVHLDLRSALYTATSLQTTIRHADAKARIMLGLLGGSV
FT                   VVVLQQAPTLGRFDSAPLLAATAVAAVVWLAALAAGGWHLLAAVSPRLSPADRANRFAF
FT                   PATRPATTGVREQRNEAWDLASALAGIAVDKHSRVRRARPAVAVAMFAAAALTALTTIV
FT                   AIAM"
FT   gene            81072..81755
FT                   /locus_tag="Sare_0070"
FT   CDS_pept        81072..81755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0070"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: sma:SAV3775
FT                   transcriptional regulator with cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96006"
FT                   /db_xref="GOA:A8LWI3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI3"
FT                   /protein_id="ABV96006.1"
FT                   /translation="MTDTPWLPGTLLRRIDETSRRALLRLGVERTAAAPRVLLREGVRE
FT                   SHVILLDDALAKVTVAMTDGRQALIDVRVSGDIIGEMSALNGEPRSATVTTCRTSKIRI
FT                   IQRSELRAFLRGHPDAAMELAGIVANRLRTANRRRVDFAAHPVKIRLARVLWEIAAAYG
FT                   YRDRDGIVVDIHLTQDELATMCGVAEITLQKALRDLRTAGILATGYRRMLVRDAAALQR
FT                   CADTP"
FT   gene            complement(82224..82457)
FT                   /pseudo
FT                   /locus_tag="Sare_0071"
FT                   /product="hypothetical protein"
FT   gene            complement(83114..83716)
FT                   /locus_tag="Sare_0072"
FT   CDS_pept        complement(83114..83716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_3471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96007"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI4"
FT                   /protein_id="ABV96007.1"
FT                   /translation="MNTILRRSVLGIAGLALSTGVVAGPLAADTTTPTTSMPADSAVAV
FT                   SVAQAAKPDMDILIPHGTQGQQSRIDLGDEQVSNVKAIIEATKKAGMDERAAVVAIATS
FT                   LQESKLENLGHLGDRNDHDSQGLFQQRPSSGWGTVEQITDPEYSTTAFLEGLKQVEGWQ
FT                   DMPLTKAAQTVQVSAYPFHYAQWETQAADLVAEHWTS"
FT   gene            84240..84572
FT                   /locus_tag="Sare_0073"
FT   CDS_pept        84240..84572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0073"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: sen:SACE_4980
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96008"
FT                   /db_xref="GOA:A8LWI5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI5"
FT                   /protein_id="ABV96008.1"
FT                   /translation="MDVELLDRTTAAEYASWFRALADPSRVQLVELLARHGAPMSVGQI
FT                   VAAMGLAQSTVSQHLMILAEVQFVLVEPVGNARYYRINTDCVSGFPSAADVVMGKPAPA
FT                   TGGKCS"
FT   gene            84865..86082
FT                   /locus_tag="Sare_0074"
FT   CDS_pept        84865..86082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0074"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   stp:Strop_0633 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96009"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI6"
FT                   /protein_id="ABV96009.1"
FT                   /translation="MSSTQRLPVAVIGAGPIGLAAAAQLATRGLDFVVLEAGDEIAASI
FT                   REWAHVRLFTPWQINTDPAARDLLEQAGWTVPDSERLPTGGELIDSYLSPLAAHPAIAS
FT                   HVRLGVTVTVIARQGFDKVRTVGRDTSPFLIRLSDGGELLASAIIDASGTWCTPNPLGG
FT                   NGIPAHKETEAVAAGRVFNGMPDVLGRLRAQFAGESVAVVGAGHSATGTLLALADLAEA
FT                   EPGTSLHWVLRAPNPSRAYGGGDADALAARGAIGTRIKALVDAGKITVHTSFLVQEITD
FT                   RSLVSADGRKIDAAVLVNSTGTRPDHGPTTELRLDLDPILGSTRALAPLIDPNHHSCGT
FT                   VPPHGVDELTHPETGFYIVGAKSYGRAPTFLLATGYEQARSVVAALAGDWEAARDVQLE
FT                   LPETGV"
FT   gene            86607..89450
FT                   /locus_tag="Sare_0075"
FT   CDS_pept        86607..89450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0075"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M4 thermolysin; Proprotein
FT                   convertase P; peptidase M20; peptidase M28; Peptidase M4
FT                   thermolysin; KEGG: sco:SCO1226 bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96010"
FT                   /db_xref="GOA:A8LWI7"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI7"
FT                   /protein_id="ABV96010.1"
FT                   /translation="MIVTVQAAGAIIALGYTSASELPELDALERLAISTAAADQYVSGT
FT                   STGFVKGEDEKYSRQQVTPASRGLTYVTYSRTYKDLPVFVGGEAVVVTDSKSTVRSSTA
FT                   GSGPLQVSTSAKVSAKKAKAVALGKHQGTVRGEPTLGVIAEGDGRLVWEVVVSGDGEHG
FT                   PSVAHAFVDGQTGAYVGSWDEVARGTGNGHYNEQVHLDTTGSAGRFELRDPTRGNMRTL
FT                   NDAASGTPFTDADDVWGNGVGSDLVTGAVDTQYAGAAVWDMLEEKFSRNGIDDAGRTAT
FT                   MFVGLPAANAYYACAGTGDASRDQTKYGRTTDRARQVNSVDVVAHELGHGIFCHTPGGS
FT                   RGITNETGGLNEGTGDIFGALAEHFVANPNDPADYLVGEEVNLSGRGPIRTMYDPSKNG
FT                   DPNCWSTDIPRTRVHSAAGPLNHWFYLAAEGSKPAGKPASPTCNGTDVTGIGLWQAGEI
FT                   YYHALLRKTSGWTYTQARKATLDATRELYPNSCAEFNVIKAAWNAVSVPAQGDPTCTTG
FT                   TPTPTASPSAPGPSSSPTSPPGGEPAAAPDIDGAKVEAHLEELGRIAAANGGNRAHGTP
FT                   GYRASLDYVKGELDAAGYNTRIQQFNSGGKPGFNLIADLPDREDHDKVVMLGAHLDSVD
FT                   IGPGINDNGSGSAGILEVALTYAASGAKGDKAIRFGWWGAEEDGLVGSKAYVTSLSAAE
FT                   RESITAYLNFDMIGSPNPGYFVYNDDAKGDFITEALEEGFAAEDVPSEGVSLRGRSDHA
FT                   PFMAVGIPSGGTATLSLVPVMSQAQAAKWNGKAGQPFDPCYHRNCDTVENISTAALDTH
FT                   TDVAAYAAWKLTGVHAAGGSAGSTHVTNNTHFPIRDRSVVESPITVQRDGPAQAVREVK
FT                   VDIVHSYRGNLEIHLLAPDGTEYLIKRPSRLDRADDVKLTKPIDSSAEKTDGTWKLRVR
FT                   DLHSGNIGTLRSWSLIF"
FT   gene            complement(89708..90382)
FT                   /locus_tag="Sare_0076"
FT   CDS_pept        complement(89708..90382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0076"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sen:SACE_6605 two component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96011"
FT                   /db_xref="GOA:A8LWI8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI8"
FT                   /protein_id="ABV96011.1"
FT                   /translation="MLVIEDDRDIREAIDDSLSATGHVVRPCGTALDGLRELASRQSDV
FT                   VILDLHLPDLDGATVLSLIRADSAVPVVVATACDTESEIIRLLRAGADDYVVKPYSVEQ
FT                   LEARIAAVLRRGAGQAATVLTIGGLHLDAEARIASLDGVRLQLSRLEFDLLTYLAQRAG
FT                   KVVTRRQLLDHVWRSEGRSLETVDVHVTWLRRKLGESASTPRYLHTVRGVGIRLGAPED
FT                   AG"
FT   gene            complement(90861..91730)
FT                   /locus_tag="Sare_0077"
FT   CDS_pept        complement(90861..91730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0077"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   stp:Strop_0083 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96012"
FT                   /db_xref="GOA:A8LWI9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWI9"
FT                   /protein_id="ABV96012.1"
FT                   /translation="MYVTAPDRVGEVQLSDGRLLGWAEWGPPDGTPVLFSPGAATSRWL
FT                   GFGAEAIDRLGVRLASVDRPGLGASTPLPGRTFADFVADIRQFTAIRGLGRPAMVGNSQ
FT                   GAPFALACAEGGVTAALAIVSGADEVAAPEFASALPAELRKLVDWTVRDAAEAERFFAG
FT                   FSADALLDLVLGGSPECDLAVYREPGFADAYRRALNEAFGQGAAGYARDTVLAMRPWAI
FT                   DLDKISVPVDVWYGELDQSHSPDNGSLLTTRIPGAQHHLVPAIGGAVLWTHAEPILSTL
FT                   LTRAGTQS"
FT   gene            complement(91940..93550)
FT                   /locus_tag="Sare_0078"
FT   CDS_pept        complement(91940..93550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0078"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_2735 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96013"
FT                   /db_xref="GOA:A8LWJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ0"
FT                   /protein_id="ABV96013.1"
FT                   /translation="MHDTHPGDMGQRATRRSWFGLAVLGLPTLLLSLDQSVLYLALPHL
FT                   SADLGAGSIESLWILDIYGFMLAGFLVTMGTLGDRIGRRKLLLIGAAAFGVSTVAAAYS
FT                   DSAQMLIVTRAAMGVAGATLMPSTLALISNVFHDAKQRGVAIAVWFSCLMVGGALGPVV
FT                   GGALLEHFWWGSVLLLGAPIMMLLLVLGPVLLPEYRDPSAGRIDLLSVLLSLLTVLPII
FT                   YGIKELAYDGWTAEPLVVMSAGVVFGAVFVTRQHRLAEPLVDIRLFRTRAFSAALVILL
FT                   FGSVTTGGIYLLVNLYLQMVEGLSPLRTGLWLLPSTLAIVVGSMTAPALAPRVRPAYLI
FT                   SSGLAVTTFGYLLLTQVDPTGGLPLLVTGFVLAFLGAGPMGALGTDLVVGSASPEQAGS
FT                   AASLSETGNHLGIAIGIAVMGSIGTTVYRDRIDTTVPDGIAADAAEAARENVTGAVTAA
FT                   EGLPAGPAAQLLDAAATAFTHGLNTAAYIGAGLFLTLAIVAAVSLRETRMPAGETASGV
FT                   ADESAPTDTAARAAQKPTE"
FT   gene            93741..94757
FT                   /locus_tag="Sare_0079"
FT   CDS_pept        93741..94757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0079"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-G type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: rha:RHA1_ro05361 sigma factor, sigma 70 type, group
FT                   4"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96014"
FT                   /db_xref="GOA:A8LWJ1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ1"
FT                   /protein_id="ABV96014.1"
FT                   /translation="MTVDGAVRADFSQLAAPLRRELLVHCYRMLGSMHDAEDLVQETYL
FT                   RAWRSYDGFEGRSSLRTWLYRIATTVCLRAMENRGRRPLPVGLGAPGADPEERPIHDGE
FT                   TPWLEPLPDALLRREREDPAAIVSARQSVRLAFVAALQHLPPRQRAVLILRDVLQWRAV
FT                   EVADLLGGSPAAVNSLLQRARATLGHLSPREDRVTEPTTAAERELLDRYVTAFEAKDIA
FT                   GLVRLFASDAVWEMPPYTSWYRGPRDIGRHLALRCLATPGPVRLVPTAANGQPALAGYV
FT                   AAGGSTFALTNLQVLSVTSTAITRITVFSDPRLFTAFGLPASVAAAQMNELAPANGC"
FT   gene            94729..95007
FT                   /locus_tag="Sare_0080"
FT   CDS_pept        94729..95007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96015"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ2"
FT                   /protein_id="ABV96015.1"
FT                   /translation="MSWHRPTAADHCFLCSGRTMRAAWTAPAIVVPAGQDGSMRGRIPD
FT                   DSGVTDRFGDNGFVSRQVRLRLDEVGCWVAFGHESIRETARHAPGRV"
FT   gene            94988..95458
FT                   /locus_tag="Sare_0081"
FT   CDS_pept        94988..95458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0081"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0084 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96016"
FT                   /db_xref="GOA:A8LWJ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ3"
FT                   /protein_id="ABV96016.1"
FT                   /translation="MRQDEYDAYSEQQLREYVESQTGLVSTEAALRKAHRDRERFLPHG
FT                   LATERHRLLVAENDSGEMVGTVWLGLDSPGSKDEPDGRSAEMAWLYDIRVDTAYRRSGY
FT                   GAAILSAVEVLARDAGALRLGLNVFGHNTPALALYERSGYEVTTQQMAKRLR"
FT   gene            95530..96420
FT                   /locus_tag="Sare_0082"
FT   CDS_pept        95530..96420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0082"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   stp:Strop_0085 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96017"
FT                   /db_xref="GOA:A8LWJ4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ4"
FT                   /protein_id="ABV96017.1"
FT                   /translation="MIMRIGIVILPDQRWVESERRWRQVDEWGFDHAWTYDHLGWRDLV
FT                   DGPWFDSMTTLTAAAATTRRIRLGTLVASPNFRHPAAFARQVTALDDVSGGRAVLGLGA
FT                   GGIGFDSAVLGGETLPPRQRVDRFAEFVELLDLVLREDGTTWRGDWFAAVDARNNPGCV
FT                   QTPRVPFVVAANGPRSMRLAVRYGQGWVTTGSGGDDLDAWWDGVADLAVRLDKSLASAG
FT                   REPSSLDRYLSLDSAPVFSLRSADFFAEQVERAAALGFTDVITHWPRSSSWYAGDEAVL
FT                   VDVASRLPELRRVTD"
FT   gene            complement(96426..96977)
FT                   /locus_tag="Sare_0083"
FT   CDS_pept        complement(96426..96977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0083"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   stp:Strop_0086 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96018"
FT                   /db_xref="GOA:A8LWJ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ5"
FT                   /protein_id="ABV96018.1"
FT                   /translation="MRPELSRRLAELIRWVDPGPGAAHLVSDISGWWRDPAVLADLGPA
FT                   LVAPFRQSPPTVVISPAVTGYLLGPLAATALGVGFVAAHKPHDGRLPPGTLTWAQSQPD
FT                   YLGRRLDLAVRDRHLEAGDRVLVVDDWVSTGAQVRALYEICTARGATPVGTATVVADCP
FT                   PEVAAELRIRGLLTRADLSP"
FT   gene            97223..97864
FT                   /locus_tag="Sare_0084"
FT   CDS_pept        97223..97864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0084"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: stp:Strop_0087 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96019"
FT                   /db_xref="GOA:A8LWJ6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ6"
FT                   /protein_id="ABV96019.1"
FT                   /translation="MAGRHARTRRLSPTAIAATAAVGVALAIGGTVGAVRLTSGDVSDR
FT                   SVAVAPTEVDPPAAASAPPSGSPSASGSPSASGSPSLPSPIASPASVRKTQAPSRSKPR
FT                   TATPQPTATNSSAPAVETGSCGASYYSEGQLTASGEPFDPSAMTAAHKTLPFDTRVRVT
FT                   NPATGTSVTVRINDRGPFVEGRCIDLSRAAFAEIAPLSAGHVEVRYEVLG"
FT   gene            97965..99092
FT                   /locus_tag="Sare_0085"
FT   CDS_pept        97965..99092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0085"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: stp:Strop_0088
FT                   stage II sporulation E family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96020"
FT                   /db_xref="GOA:A8LWJ7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ7"
FT                   /protein_id="ABV96020.1"
FT                   /translation="MLCCVRTHPFQSGRGPLSPGSRAGLGAAFALLALVSAVECVDGRG
FT                   ANYTALLIVAPFLAAALASWQVVLGVGAVAIVLGAGFALAEQVGSLSAAVAVAGIALGT
FT                   VLAAATAAVRQRHGERIAELSKLATVAQQAVLRPLGPQVGSLAVAARYISSTSTAEIGG
FT                   DLYEALDTPYGVRMIIGDVRGKGLEAVRLASIVLGSYRHVAYERADLRAVVADLDRAVA
FT                   RSVGDEDFVTAALVEERGGTLTIVNCGHPAPLLLRRGAVIALEPPAPAPPLGFMPAVRS
FT                   RVERLEPGDRLLLFTDGLGEARREGEFFPTTCRAWRLLGHGTVADGLASLEAALVEWVH
FT                   GRLDDDIALVLMEYTGARTGGSAAVPSWEVGTTEG"
FT   gene            99175..101028
FT                   /locus_tag="Sare_0086"
FT   CDS_pept        99175..101028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0086"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   stp:Strop_0089 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96021"
FT                   /db_xref="GOA:A8LWJ8"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ8"
FT                   /protein_id="ABV96021.1"
FT                   /translation="MTHYKSNLRDLEFNLFEVFGADRTFSQAPYTELDVDTARSFLSEV
FT                   DRLAREDLAASYTDSDRNPPVFDPATHTAPLPEPFKKSYQRFMDSEFWRLDLPEALGGS
FT                   NAPRALWWSLAELVLGANAPVWMYASGPSFAHVLHVEGTERQRKWAKLFIDRGWGSTMV
FT                   LTEADAGSDVGAGRARAIPQPDGSWHIEGVKRFITSGEHDLGDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFDEDTGELGERNGVFATNVEHKMGLKVSNTCELTFGEHGVPA
FT                   QGWLLGDKHDGIRQMFMIIEYARMMVGTKAIATLSTGYLNALEYAKNRVQGADLTQMTD
FT                   KSAPRVAITRHPDVRRSLLLQKSYAEGLRALVCYTATWQDKVAIATAAGDEKAVKLAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTFGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKVVRDNGKALLAVAGEIQEFISTEGGNGQLKEERQALGRALAEVQSILGTL
FT                   TGWLGEAQGGNTQALYQVGLSSRRFLLAVGDLVVGWLLQRQADVALTALTADGSADREF
FT                   YTGKVAAARFFAREVLPRIGADRRIIENADPGIMDLPEEAF"
FT   gene            101213..101482
FT                   /locus_tag="Sare_0087"
FT   CDS_pept        101213..101482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96022"
FT                   /db_xref="GOA:A8LWJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWJ9"
FT                   /protein_id="ABV96022.1"
FT                   /translation="MGIGSGIFLIALGAILTFAIRANVWWVDLRAVGWVFILAGLAVLL
FT                   TTLWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
FT   gene            complement(101564..102193)
FT                   /locus_tag="Sare_0088"
FT   CDS_pept        complement(101564..102193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0088"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: stp:Strop_0091
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96023"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK0"
FT                   /protein_id="ABV96023.1"
FT                   /translation="MEDFVALLDSKHCRQHRRTRAAGSPIRQAGGMTDAYAQDRTLVLL
FT                   RHSKAEPPGDRPDVDRPLAPRGRADAAAAGAWLAHNALLPDLVICSSARRTRETWHGVA
FT                   MGMTGAPPEGGSAGPAPDVQYADDAYEAHPEDLLALVRRVNPVTRTVLLIAHNPGVSQL
FT                   SALLNPEQADRDALRTSEVVVHRTTAEWAGLGRGDTVVTTAHTARG"
FT   gene            complement(102219..103157)
FT                   /locus_tag="Sare_0089"
FT   CDS_pept        complement(102219..103157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0089"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: stp:Strop_0092
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96024"
FT                   /db_xref="GOA:A8LWK1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK1"
FT                   /protein_id="ABV96024.1"
FT                   /translation="MYTVVVLALPDVIAFDLATPVETFGRVRLPDGRPGYRVLVAGPDD
FT                   VVDAGPVRLAVSEQLDALDRADLVVVPGRNNPLRPSPPSVLAALRAAATRGTRVASICV
FT                   GAFTLAEAGLLDNMRATTHWLAAEHLAHQHPSIQVDPDVLYIDNGSILTSAGAASGLDL
FT                   CLHVIHTDYGAAVAADAARLAVAPLHRAGGQAQYILRNRPPLRTSVLEPVLAWIETNAH
FT                   RALTLADLAAAANLSTRTLTRRFAVETGQSPMQWVAGVRIRHAQELLETTDYTIDRIAN
FT                   QTGFTTTSNFRAQFQEVVGTTPGAYRTTFRL"
FT   gene            103264..103971
FT                   /locus_tag="Sare_0090"
FT   CDS_pept        103264..103971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0090"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: stp:Strop_0093
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96025"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK2"
FT                   /protein_id="ABV96025.1"
FT                   /translation="MKGLPMPTLRAQFVLFDGFDLLDVIAPFEVLSAGSAALGGVLECV
FT                   LVSESGRDSIPSGAAGVSLPASTALEPEAPGYVIVPGASGPVDGDPDAGERTVPALLGR
FT                   FAGSPAMSLVARALAAPQVTVVAVCGGGLALAMAGLLEGRTATTHHLGIDRLQSIGVNA
FT                   VRARVVDDGDLVTGGGVLSGVDVALYLLERDFGCAAARAVEDLFEFERRGTTWKTSAGR
FT                   LPRTPVTGQRVQA"
FT   gene            103968..104444
FT                   /locus_tag="Sare_0091"
FT   CDS_pept        103968..104444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96026"
FT                   /db_xref="GOA:A8LWK3"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK3"
FT                   /protein_id="ABV96026.1"
FT                   /translation="MSAFLLSVHVLAAILTIGPVAITASMFPRFARLALDKPADPRRSA
FT                   VVRILHRITRKYAVIGVLVPVFGLATGASIGVLGDAWLIVSMVLTAGAAAVLIAVVLPG
FT                   QRRTLHCLDTGAQPADLARVAPRMGMHAGIFNLLWAIVVVLMIYRPGSTTGVGL"
FT   gene            104441..104722
FT                   /locus_tag="Sare_0092"
FT   CDS_pept        104441..104722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96027"
FT                   /db_xref="GOA:A8LWK4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK4"
FT                   /protein_id="ABV96027.1"
FT                   /translation="MSPRHLLRVIGSVELATLALMLLNIVTVHTPTVSRILGPVHGLAY
FT                   TLTVLAAALVMRRRHRVWLIALVPGIGGLLAARVAAPEPFATVSDVDL"
FT   gene            complement(104846..105523)
FT                   /locus_tag="Sare_0093"
FT   CDS_pept        complement(104846..105523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0093"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: stp:Strop_0096 channel
FT                   protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96028"
FT                   /db_xref="GOA:A8LWK5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK5"
FT                   /protein_id="ABV96028.1"
FT                   /translation="MTTSAPTRLKPVDLGKPRMRGWLHAYAFFVALVCGAVLCSIAASR
FT                   PGWSPLVSTLVYSLTVCGLFGTSALYHRRVWSERGYQVMRRMDHSMIFVFIAGTYTPFC
FT                   VLLLEPRPATIMLSLVWGGALGGVALKLIWPHAPRWVSAPLYLALGWVAVAMLPDILRA
FT                   GGVTALVLLIVGGAIYSVGAFSYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
FT   gene            105786..106529
FT                   /locus_tag="Sare_0094"
FT   CDS_pept        105786..106529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0094"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   stp:Strop_0097 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96029"
FT                   /db_xref="GOA:A8LWK6"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK6"
FT                   /protein_id="ABV96029.1"
FT                   /translation="MRIRPAGAHALLLDCSDADADADAATFDANVDDTADTEHGDAGRP
FT                   AATVVADRVEAWRAELWRLREQGDLDAVEIVPAATTVLLDGLSDPAHTAALLNDWAPTP
FT                   ISTGTANTGTTDTGTTSTGAVEVPVIYDGVDLATVAGHWNVDVTAVVRRLTATEFRVAF
FT                   CGFAPGFAYLTGLAAGLGVPRLSTPRPRVPAGSVGLAGPYAGIYPTASPGGWLLVGRTD
FT                   LPLFDVHADPPARLAPGTRVRLVAA"
FT   gene            106526..107461
FT                   /locus_tag="Sare_0095"
FT   CDS_pept        106526..107461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0095"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: stp:Strop_0098 UreA
FT                   amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96030"
FT                   /db_xref="GOA:A8LWK7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK7"
FT                   /protein_id="ABV96030.1"
FT                   /translation="MTGIPPADRVGAADTPGRSAEPGMVEEPGMVEVVRAGALTTVQDL
FT                   GRPGWAHLGVPRSGALDPSALRLANRLVGNPETAAGLEITLTGCGLRFRGATTVAVTGA
FT                   DVPVRVNDRPGDVGRPLAVPAGAVLRVGPPRTGLRSWLAVAGGFAVEPVLGSRATDTLS
FT                   GLGPPLLRDGDRLPMGVPAGPPAPVDATATVPTPAEVRLALRLGPRADWFTPLALELLL
FT                   GTAYTLTPLSNRIGARLSGAPLPRAVVGELPSEGLVLGAVQVPADGQPLVFLADHPTTG
FT                   GYPVVGVVVDVTPLAQARPGTTVRFHGSQR"
FT   gene            107445..108194
FT                   /locus_tag="Sare_0096"
FT   CDS_pept        107445..108194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0096"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: stp:Strop_0099
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96031"
FT                   /db_xref="GOA:A8LWK8"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK8"
FT                   /protein_id="ABV96031.1"
FT                   /translation="MDLNADLGEGFGVWQLGDDAALLDLVTSANVACGFHAGDAVTMRR
FT                   VCAGAAERGVAVGAQVGYRDLVGFGRRPIAYEFAELRDEILYQLGALDGFCRVVGTRVR
FT                   YLKPHGALYHAVAHDESQAAAVVAAVAEYDDQLPLLCPPGSVLAQLATGAGLRAVGEGF
FT                   ADRGYLPNGRLVPRGAPNALITDPELMARQAVRIATDRTVVAVDGSVIPCPAQSICLHG
FT                   DTPGAVRCAELIRAVLVDAGVPLSPFT"
FT   gene            complement(108238..110076)
FT                   /locus_tag="Sare_0097"
FT   CDS_pept        complement(108238..110076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0097"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   KEGG: stp:Strop_0100 alkyl hydroperoxide reductase/thiol
FT                   specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96032"
FT                   /db_xref="GOA:A8LWK9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWK9"
FT                   /protein_id="ABV96032.1"
FT                   /translation="MATAPRVRAPELKGRRWLNTGGRHLTLPDLRGRITVLDFWTFCCI
FT                   NCLHVLDELRPIEQKYADVLVVIGVHSPKFEHEKDPDALADAVERYGVHHPVLDDPELN
FT                   MWQQYAARAWPTLAVIDPEGYVVATMAGEGHAEGLVRLVDDLIATHEAKGTLHRGDGPY
FT                   VPPAEPETTLRFPGKAVVLGNGNLLVSDSARHSIAELAPDGERVVRRIGTGARGRADGP
FT                   ATAATFAEPQGLCLLPAHVARLVDYDLVVADTVNHLLRGVRLATGEVVTVAGTGRQWRS
FT                   TVDDHAHDALSVDLSSPWDLAWYDGRLVIAMAGIHQLWWFDPVKRTAGMYAGSTVEALK
FT                   DGPLAEAWLAQPSGLSVSADGSRLWVADSETSAIRYVQDGVLNTAVGQGLFEFGHVDGP
FT                   AAQALLQHPLGVCALPDGSVLIADTYNGAVRRYDPESDSVGTVADGLAEPSDLVLTPDG
FT                   GVLVVESAAHRLTQLAPGTLTAAGASTVNGPRHRTERKPTELRAGEVTLEVIFTPAPGQ
FT                   KLDDTYGPSTRLVVSASPPELLLAGAGTNTELTRRLVLNGAVSEGVLQVTAQAATCDAD
FT                   VEHAACHLTRQDWGVPIRVTDEAADRLPLVLRGMDA"
FT   gene            111087..111854
FT                   /locus_tag="Sare_0098"
FT   CDS_pept        111087..111854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96033"
FT                   /db_xref="GOA:A8LWL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL0"
FT                   /protein_id="ABV96033.1"
FT                   /translation="MNEALRLAMNEAGHTAHSLAERVGVDRKTTTRWLVKDHIPHPAHR
FT                   TAAAEALGVDTEDIWPDTSRRRNPVWFRPWQEFEREATLLRSYQPLVLPGLLQTEAYAR
FT                   AVLSIGGLRGRTDVDRLVATRLSRQAILTKDDPPQFAAVVDETALRRPVGGRATMREQA
FT                   RALLATCEAPHVRLHVVPSAVGAYAGLNGPFVIGTGADHRMAVYLDNQLEGEMVSAPND
FT                   VAAILAAWENVRGEALSHWQSVDLLREVAESWT"
FT   gene            111845..112036
FT                   /locus_tag="Sare_0099"
FT   CDS_pept        111845..112036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0099"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   stp:Strop_0103 protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96034"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL1"
FT                   /protein_id="ABV96034.1"
FT                   /translation="MDLTGARWHKSSRSSGNGGDCVEVADNLPGVVGVRDSKDPTGPAL
FT                   VFGPGAWRAFVAQFPGRD"
FT   gene            112116..112304
FT                   /locus_tag="Sare_0100"
FT   CDS_pept        112116..112304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96035"
FT                   /db_xref="GOA:A8LWL2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL2"
FT                   /protein_id="ABV96035.1"
FT                   /translation="MFDPLRLDDALLGSDDGRTALRAPRPTHADDFWPWFVVLAVGTRA
FT                   AGAVFGTRARDEQARVG"
FT   gene            complement(112301..113086)
FT                   /locus_tag="Sare_0101"
FT   CDS_pept        complement(112301..113086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0101"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mbb:BCG_2316c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96036"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL3"
FT                   /protein_id="ABV96036.1"
FT                   /translation="MKVHHLNCGSIRVFREPLVCHVLLVETNNGLVLVDTGYGLDDIAD
FT                   PRRRIGPTRTIVRPVLDPDETAARQVERLGFRRDDVRHIVVTHFDADHIGGLSDFPHAA
FT                   VHTTADEVRGARNPPTWRERSRFRPAQWRHGPRIIEHGAAGEPWRGFAAVKPLDEIAPG
FT                   FVLIPLPGHTRGHACVAVDAGEQWLLHAGDAFYHPGSIDGGGGVPFVLRAMETLVAFDR
FT                   RRVRENHARLAAVRARAEPDLTLFSAHDPAAFATLSSGG"
FT   gene            complement(113242..114156)
FT                   /locus_tag="Sare_0102"
FT   CDS_pept        complement(113242..114156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0102"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sen:SACE_3749 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96037"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL4"
FT                   /protein_id="ABV96037.1"
FT                   /translation="MTDKPLTGQVALVSGATRGGGRGIAVQLGAAGATVYVTGRSTTTS
FT                   RSPMNRPETTEQTADLVTAAGGHGIAAPTDHLDVAQVRDLVARIDREQQGRLDILVNNV
FT                   WGGDPLTVWDKPLWEQPLDDGLLLQRQAVHTHIITSWHALPLLVARRRGLVVEVTDGTA
FT                   DQGYRGTFFYDLAKSGVIRAAQAQAGDLRPHGVTAVALTPGFLRSEAMLDHFGVTEDTW
FT                   RDAITADPYFAMSESPAYLGRAVAALAADPDVSRWNGQSLATWQLAKEYGFTDADGSRP
FT                   DWGGYFGATQQGDGDDVDPQDYR"
FT   gene            complement(114315..115727)
FT                   /locus_tag="Sare_0103"
FT   CDS_pept        complement(114315..115727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0103"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO2309 transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96038"
FT                   /db_xref="GOA:A8LWL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL5"
FT                   /protein_id="ABV96038.1"
FT                   /translation="MELGMVERRAAWTVIALCAAQFMLILDVVIINVAVPSIRQDLGLL
FT                   DSRIQLTATAYTITFGSLLIISGRVGDLLGRKRLLLTGLTFFVAASLGAGAAQVDWHLF
FT                   VSRGLQGVGAAMVSANALAAITASLAEGPARNWALGLWAAVSSAGAIAGQLVGGAITQF
FT                   LGWRWIFFINIPVGLAVVAVLALLLRDTPATNRPRINLAGAFLLAGGLASGIMALTWLA
FT                   EDGGRDRSFAAAVTAFVLLASFALVERSESTPVLRYALLRLPGVRAANATLLLNAGALG
FT                   ATLFFLTLYLQIVLGYSPLAVGVAFAPITLLIMLLSPRAAKLVTRFGARRVLVSGLTVL
FT                   AAGALLLARLPVHGDYWTDVLPGMLLLAIGSGLTYAPTYIAASSGVTAEDQGAASGLIN
FT                   SAQEIGAAVCLAMLALIATTAAGPGGSATSLAEGYRAGVLAAAVLFAIGATIAVTVPRR
FT                   LGQATEAEKVAS"
FT   gene            115830..116453
FT                   /locus_tag="Sare_0104"
FT   CDS_pept        115830..116453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0104"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: mjl:Mjls_1498 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96039"
FT                   /db_xref="GOA:A8LWL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL6"
FT                   /protein_id="ABV96039.1"
FT                   /translation="MSESPLTRQAILTAALALVDEQGIEALSMRRLAAALKVDPMSIYH
FT                   HVPNKAALVSGLVQTVFSEMALPAPGGSWPVQVRAWARAYRDLALAHPNLVLQIVTDAA
FT                   AVSEAAILVSEPLYAALDSAGLGARAVVDSANTLIDFVNGYTLALAEGTTSQSAGVGSM
FT                   GERLAAMDPDQVPTMCQVHDALKDEQTTSSGFEAGLDIIIRGIS"
FT   gene            complement(116581..118905)
FT                   /locus_tag="Sare_0105"
FT   CDS_pept        complement(116581..118905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96040"
FT                   /db_xref="GOA:A8LWL7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL7"
FT                   /protein_id="ABV96040.1"
FT                   /translation="MTSEGTHHPGQQPEEASPGAGGPTPYGDRPAKQDDGYAPGQPDLG
FT                   WAPPPPPQPTPAGPAWSAEAPPTAAWGTARPPEQDPAATSAAWSREPGTHPWPAQQEQP
FT                   GPSSPPEAPAWAPPQSPTAWTPQPPVTPQPPVVRATAQVPQPAPAWPTPDTPASSHPEP
FT                   APEWNGGAGQQPGWAPEAAAWAPLGSTAQAPEAPTPGWPGQDRPSQSTGQLAPEHPGGR
FT                   PLGQQDPAVAATNEGGWHPGEPAAPAGTAVPGNSSPQPWVPAPRSGPEGLNVSHVEPWA
FT                   PGEAWGNSERPANLGQEPVGFGEPPAYQPAPGPGISPANAVPLPPQEQRVPGASLAASP
FT                   PADFAMPQPATAPPPADFTMPPPAAMPPPAAVPPPAAPEPPRIDPGYQADQHGWPPAAA
FT                   GPGGPPAPPAVPAPPTSPEFTDHPAPPAASAGVSASAAVPLSSRVTPPADQAQLPATPA
FT                   PQPRVYGRPAPPEPVERAEPDGYQADQQRFGPESPPEYGRDAGLGANGGITSESGYNPE
FT                   GGYNPQSRYNPEDGFGTDAGFGHGGEDRPAEPTGYAPVVPAPAAPFPPDIPAFADAPPS
FT                   ERPVNGTRPHPGEERPTDRFGGATTGTASVDNTTAFPPPPEPAFSPPAHPPAQSRDLAH
FT                   PPTQSWEQDSPATQDAEQGRFDAFQPIAEPAAEAPPPKVRNGRVLAAVLVAAVLILAVP
FT                   LGLLALLGKIGANESAPAFDPAVGSCVKQADTTAVAVDCGDVDAYTVVSKVDTKEQCAD
FT                   PVQPHVTLAGSNRVLCLEPAS"
FT   gene            complement(119271..119408)
FT                   /locus_tag="Sare_0106"
FT   CDS_pept        complement(119271..119408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96041"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL8"
FT                   /protein_id="ABV96041.1"
FT                   /translation="MSMIDRIRNRRDASRRARAIERALRSANSPAVRDEILTIAQRQMY
FT                   "
FT   gene            complement(119637..121109)
FT                   /locus_tag="Sare_0107"
FT   CDS_pept        complement(119637..121109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0107"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   stp:Strop_0107 catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96042"
FT                   /db_xref="GOA:A8LWL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWL9"
FT                   /protein_id="ABV96042.1"
FT                   /translation="MSRIKEFNLPDLGEGLTEGEILSWLVKVGDTVELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQSIFHAEGATVEVGSPIIAIDTDPTAGPVEATESVEAAGTVSGAPS
FT                   AAAPAAVTSTEGAGESGQGGRTPVLVGYGPRTTVAKRRPRKGAAASAAVPAAPTPAPPV
FT                   PAPAAPPRPAPAPAVTGPTTVGNGRGGPAGGALVLAKPPVRKLAKDLGVDLSTLTGSGP
FT                   LGSISRDDVQRAASATTTAEPLAVAAAGSTAASVGAHREQRIPVKGVRKLTAENMSRSA
FT                   FTAPHVTEFLTVDMTRAMKALDRLRQRREWRDVRVSPLLLVAKAVLLAVRRHPMVNATW
FT                   AGEEIVVKDYVNLGIAAATERGLIVPNVKDAGRLSLRELADALTDLVQTAKTGKTSPAD
FT                   MSGGTLTITNVGVFGVDTGTPILPPGESAILAFGAVRKMPWVHKGKVRPRQVTTLGLSF
FT                   DHRIIDGELGSRFLRDVGDFLADPEAALLAWT"
FT   gene            complement(121115..122104)
FT                   /locus_tag="Sare_0108"
FT   CDS_pept        complement(121115..122104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0108"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: stp:Strop_0108 transketolase, central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96043"
FT                   /db_xref="GOA:A8LWM0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM0"
FT                   /protein_id="ABV96043.1"
FT                   /translation="MATETLTLGKALNAGMRKALENDPKVVIMGEDVGKLGGVFRITDG
FT                   LQKDFGDQRVIDTPLAESGIIGTAIGLAIRGYRPVCEIQFDGFVYPAYDQIVSQVAKMH
FT                   YRSRGKLRIPMVIRIPFGGGIGAVEHHSESPEAYFAHTPGLKVATCASPQDAYVMIQQA
FT                   IASDDPIVFLEPKRRYWEKGPVEVDGPLPEAYPLHAARVARPGTDATLIGYGPMVRTCL
FT                   DAATAAAEDGRELEVIDLRTLAPLDLGLVYESVRRTGRAVVVHEAPSNIGLGAEVAARI
FT                   TEECFYSLESPVLRVTGFDIPYPASRVEEEYLPDLDRVLDAVDRTFGW"
FT   gene            complement(122104..123279)
FT                   /locus_tag="Sare_0109"
FT   CDS_pept        complement(122104..123279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0109"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG:
FT                   stp:Strop_0109 pyruvate dehydrogenase
FT                   (acetyl-transferring)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96044"
FT                   /db_xref="GOA:A8LWM1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM1"
FT                   /protein_id="ABV96044.1"
FT                   /translation="MAKGDPGVNTRGRRAVPRSRKGATGDPELVQLLTPEGERIESVTG
FT                   PDGIEYRVDFTDEEYRGFYRDLVLVRKLDAEATALQRQGELGLWASLLGQEAAQVGSGR
FT                   ALRTQDMAFPTYREHGVLYCRGIDPIMPLGLFRGVDQGGWDPNEFKFNMYTIVIGAQAL
FT                   HATGYAMGVTMDGKTGTDEGEAVIAYFGDGATSQGDVNESFVWASVFNAPMVFFCQNNQ
FT                   YAISEPLERQTRIPLYRRAAGFGFPGLRVDGNDVLATYAVTRHALDNARHGQGPSLIEA
FT                   YTYRMGAHTTSDDPTRYRIASEVEAWQAKDPIARMKTFLQKQKIADDGFFTEVDEQAKR
FT                   ESVHLRERVLEMPNPEPGSMFDHVYPNGSPLVDQQRAQFSQYLESFEGSAH"
FT   gene            complement(123899..124399)
FT                   /locus_tag="Sare_0110"
FT   CDS_pept        complement(123899..124399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tva:TVAG_493550 hypothetical protein Pfam:
FT                   Endotoxin_C VAR1 FbpA XRN_N Methyltransf_15 RNA_pol
FT                   DNA_pol_B_2 Bt_P21 Choline_kinase PAZ DUF2031 dUTPase_2
FT                   PROSITE: GLY_RICH SER_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM2"
FT                   /protein_id="ABV96045.1"
FT                   /translation="MLRRRVSAPRAQYGSAALADPVGSADGIGPVSVGSGVGAGVGDGG
FT                   SEGEDDGEGEGAGDGGSTSAGEGNGAGAGGGGPATCTAGGGLRAGRVALGTTDRELESL
FT                   GTATTGVGSGCGGMTTGRTDGVGMSGASLLGEAVLATVAGPVLTAVRIGMEAVPASNAT
FT                   VNR"
FT   gene            complement(124565..125782)
FT                   /locus_tag="Sare_0111"
FT   CDS_pept        complement(124565..125782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96046"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM3"
FT                   /protein_id="ABV96046.1"
FT                   /translation="MGTPQTPYDAVLHAARDVAELDNALDAEMLGAALLGSVYAVAETR
FT                   RDDAVRAFVSDFLAATSRRRAAAATTIRSVFAALVPDAVGADRVRPGATAPAWSGQLGR
FT                   VHLTGCWAYGDVFGDQTSYLATFAYDDPAVGPEHALVALVDHNIGITKDVFVGGPPARV
FT                   LDQIRQMCAEDELTWFRDETPANMHTEVRRHLAITDDLGELPGEGSLATDRALVGARLA
FT                   LLPTSRAAVRGAEPLTAAERTDLVRRFLAAPEAAHFGLDSIDGAQLASLHFCIGLLLDH
FT                   TATFTDPDPLRWSPTVAGLFLLDWVHRRAVLDMDDAALLPRVLRGWAAYASRKRGLSTS
FT                   ATARTDAAIEEMVPEFARLYTTGERRSPSTAAVAQLLADGVDPDDPVALDAWIEANRHH
FT                   LTDDGS"
FT   gene            126060..127895
FT                   /locus_tag="Sare_0112"
FT   CDS_pept        126060..127895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0112"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: stp:Strop_0113 chaperone protein DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96047"
FT                   /db_xref="GOA:A8LWM4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LWM4"
FT                   /protein_id="ABV96047.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREVGTNWSVDIDDKKYTPQEISARTLMKLKRDAE
FT                   SYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVIEVKSTSGDNLLGGDDWDQRIIDHLVKTFNGEHGI
FT                   DLSQDKMAMQRLKEAAEKAKIELSAAATSNINLPYITAGAAGPLHLDVTLTRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKVADVEHVILVGGSTRMPAVTELVKDLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGEREIAAYNKKLGTFELTGLPPAPRGMPQIEVTFDIDANGIVNV
FT                   HAKDLGTGKEQKMTVTAGSSLPKEDIERMRRDAEEHAEEDKRRREEAETRNLAEALQWQ
FT                   TEKFLAESGDKLPTESRDQINEALGELRSALGGQDIEKIKSAHAQLAQVSQQAGSQLYT
FT                   QQGEQAGATGAQAGGAQAGGPDDVVDAEIVDEDKK"
FT   gene            127938..128837
FT                   /locus_tag="Sare_0113"
FT   CDS_pept        127938..128837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0113"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: stp:Strop_0114 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96048"
FT                   /db_xref="GOA:A8LWM5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM5"
FT                   /protein_id="ABV96048.1"
FT                   /translation="MTDKPRATDPDVAGSVPGGSASAGEAGAEPRVVIRDNRKISNAAG
FT                   SGSKNAGSKNAGSGSEGTGSGSGAAGAGSEATGSGSGATGPGSEATGVTDSDSGSAAAD
FT                   AGSESPAAGLVEDADVVVDEIQAEAAEGAPASPPVVDAPAAPVDAAPATSLGTESETLR
FT                   AELDERTRDLQRVTAEYANYRKRVDRDRGLVTEQATGAVLAALLPILDDLDRAREHGDL
FT                   VGPFGSVAEQLTTALGKFGLTPFGEEGDPFDPTRHEAVTHQTSADVTEPTCVQVMRRGY
FT                   LVGERLLRPALVGVAEPE"
FT   gene            128918..130093
FT                   /locus_tag="Sare_0114"
FT   CDS_pept        128918..130093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0114"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: stp:Strop_0115
FT                   chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96049"
FT                   /db_xref="GOA:A8LWM6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM6"
FT                   /protein_id="ABV96049.1"
FT                   /translation="MSSQDWIEKDYYAALGVQKAASADEIKKAYRKLARESHPDHNPGD
FT                   AKAEERFKAVSEAYTVLGDDAKRREYDEMRSLFGSGAFRRNARGAGRPGGVPFDVGDLF
FT                   GGGAAGGERRFNGAGFQDLFGSIFSGAGGAASRGPARGRDVETEVVLDFDDAVRGVTLP
FT                   LTLRTPGVCDTCRGNGAKPGTQPRACPACHGAGVTTRNQGSFSFSEPCRECQGVGTVVD
FT                   EKCPECQGTGGVTKTRTLNVRFPAGVADGQRIRLAGRGEPGARGGPAGDLFVQVKVQPD
FT                   DLFGRSGEDLTLTAPITFAEAVLGTDLRVPTLDGAVTLRVPPGTPSGRVLRARGKGVVR
FT                   TDGRAGDLLVTLEVVVPAKLSEEARAALETFVSQTPPAAREHLDARVRRVS"
FT   gene            130139..130579
FT                   /locus_tag="Sare_0115"
FT   CDS_pept        130139..130579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0115"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: stp:Strop_0116
FT                   putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96050"
FT                   /db_xref="GOA:A8LWM7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM7"
FT                   /protein_id="ABV96050.1"
FT                   /translation="MSDNVVGADDPAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQP
FT                   GRAAGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEQAQLRVARLEAEL
FT                   DAAYRRIAELEAVARFPGSDLVPTSRTSTALVVWRPRRNPER"
FT   gene            130681..130878
FT                   /locus_tag="Sare_0116"
FT   CDS_pept        130681..130878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96051"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM8"
FT                   /protein_id="ABV96051.1"
FT                   /translation="MAESAKDVAQQTEDRLGQVTEDVRKRFDALVEGRFSEKIKEGWFS
FT                   DSGDSGNDPGRQANQNQDPR"
FT   gene            complement(130984..131409)
FT                   /locus_tag="Sare_0117"
FT   CDS_pept        complement(130984..131409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWM9"
FT                   /protein_id="ABV96052.1"
FT                   /translation="MQESAFHGFANPVDPSPAELRAWAYHPDSIPLTSMPQDWDLLVSG
FT                   NGLVATLFDLAMDPACPARRFALHCLYIYAADGIRTKFRAHPKRRFWKLVELAERDGDE
FT                   LMRTWAHNSRFLRDQPNAFVYRDWCEGGLVRANRRLT"
FT   gene            complement(131639..132844)
FT                   /locus_tag="Sare_0118"
FT   CDS_pept        complement(131639..132844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0118"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   stp:Strop_0119 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96053"
FT                   /db_xref="GOA:A8LWN0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN0"
FT                   /protein_id="ABV96053.1"
FT                   /translation="MHDSTTLLIEVGALLFLLGLLGRLGRRIGLSPIPLYLLAGLLFGH
FT                   GGVFGFKASEEFFAVGAEIGVILLLVMLGLEYSASELVGNLRAAAPAGLIDGLLNALPG
FT                   AAFALLLGWDWVAAIVLAGITWISSSGVIAKVLGDLGRLGNRETPVVLSVLVIEDLAMA
FT                   FYLPLLTAVLAGAGLVAGGAALAVAVATVLVVLVVAIRYGRTISNIMSARDPEALLLGV
FT                   LGLTLLVAGAAAKLQVSAAVGAFLVGIAISGPVAHHATELLTPLRDLFAAVFFLFFGLV
FT                   TDPRDIPPVLLPALALAVVTMGTKTLTGYLAARRAGIGEPGRWRTGLTLVPRGEFSIVI
FT                   AGLAVAAGSVDPQLAALATAYVLITVVVGPTLARVPDLEGFKSWLRRRAAKQQARPAPV
FT                   GD"
FT   gene            complement(132850..133350)
FT                   /locus_tag="Sare_0119"
FT   CDS_pept        complement(132850..133350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0119"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: stp:Strop_0120
FT                   TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96054"
FT                   /db_xref="GOA:A8LWN1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN1"
FT                   /protein_id="ABV96054.1"
FT                   /translation="MRVRVEQTALPGIGVRHDLMTESGRRLGVVSHRNGRRDLVLYDPD
FT                   DPDACQADIPLTDDEAEALADILGASLLLGQLSGLREQAAGLLTEQVAITAGSSYVGRK
FT                   LGDTKARTRTGASIVAVLRQGEVIVSPDPSFRFVAGDVVVVVGTRQGLDGVTAILADGD
FT                   PDG"
FT   gene            133520..136111
FT                   /locus_tag="Sare_0120"
FT   CDS_pept        133520..136111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0120"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: stp:Strop_0121 ATPase AAA-2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96055"
FT                   /db_xref="GOA:A8LWN2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN2"
FT                   /protein_id="ABV96055.1"
FT                   /translation="MNTERLTTKSRETITRAVALAGQGGHATVEPWHLLLSLLDTEGST
FT                   AAGLLRAAGADPDELRRVAQRAVDALPVARGSSVAEPTLAREFVNAIGAAEQIARPLGD
FT                   EYTSTEHLLAGLAQVGGAVSAALKAAGATEDALVASFPTVRGGDRRVTTADPEQTYQAL
FT                   AKYGVDLTASARDGRTDPVIGRDTEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVAGDVPESLRDKKLVSLDLGAMVAGASYRGQFEERLKSVLEEIKNSDGQVITFLDE
FT                   LHTVVGAGKGEGSMDAGNMLKPMLARGELRMVGATTLDEYREHIESDPALERRFQPVLV
FT                   GEPTIEDTVGILRGLKERYEVHHGVRITDGALVAAATLSDRYITDRFLPDKAIDLVDES
FT                   ASRLRMEIDSRPVEVDEIERAVRRLEIEEMALAKESDDASVERLERLRKELADKREQLT
FT                   ALSERWQTEKGHITRLSTAKEELERLSGEAERAERDGELERAAELRYGRIPALKVDLTQ
FT                   AAEELARLQADGAMLKEEVGADDIAAVVASWTGIPAGRMLEGETAKLLRMETSLSEQVV
FT                   GQERAVGAVADAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALAGFLFDDERAMV
FT                   RIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVILLDEVEKAHPDVFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNTILILTSNLGSSVIGDLTLAEEQRREGVLAVVRSHFK
FT                   PEFLNRLDDTMVFAALQGDDLRAIVDIQLDRMRRRLADRRLGLEITDPARRWLAEHGYD
FT                   AIYGARPLRRLVQTAIGDQLAKALLAGRIRDGDTVRVGLSDTGDSLTVTAT"
FT   gene            136207..136833
FT                   /locus_tag="Sare_0121"
FT   CDS_pept        136207..136833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96056"
FT                   /db_xref="GOA:A8LWN3"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN3"
FT                   /protein_id="ABV96056.1"
FT                   /translation="MNGSVAYLLAATGCLVAVAGVVTAVLAQRRTRRRPTGERVAGDPL
FT                   RDRDADALRGDPRRLKPGDLVEVRGGVTYAVRGSVRLVEGAWSWTEHLLDDADGVRRWL
FT                   SVEEDPELELVLWAAEPGTTITPGAPTIDFAGRRYRWNESGRARYTAVGTTGLDPNGTL
FT                   RYHDYQASGGARLSFEAYGDAGWEVARGERLHRSEVMIYPQGEVA"
FT   gene            136834..137340
FT                   /locus_tag="Sare_0122"
FT   CDS_pept        136834..137340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96057"
FT                   /db_xref="InterPro:IPR024486"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN4"
FT                   /protein_id="ABV96057.1"
FT                   /translation="MLVTLATPYVDTSAADLSLALDGVEHPALHVLHVDLPGGVQVRLR
FT                   LLGASHQVVLRAPGAALTETVACLPGRRPDLPDRVHDESVGYRFTATVLRPGDDALRER
FT                   VAALRAGLADDPYALVGVFPGDVDAVTALAVRPGPPGGALGWRTWHAYPQTRELVVTET
FT                   AVALR"
FT   gene            137337..137762
FT                   /locus_tag="Sare_0123"
FT   CDS_pept        137337..137762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96058"
FT                   /db_xref="InterPro:IPR025341"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN5"
FT                   /protein_id="ABV96058.1"
FT                   /translation="MNSRRWFVVAAAFAVIGALVVALAIGYGNFSPRGFVEDHYERAAA
FT                   QDLDDEALAYTSTKRPSQVAQEITDAWRPADQYIDSSGVYLRYDDDSVVILPVAAGSLI
FT                   LLERLTTAYPRYHSLVGSHWGWGRGSTVRGGGPGSGK"
FT   gene            137799..138221
FT                   /locus_tag="Sare_0124"
FT   CDS_pept        137799..138221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0124"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   sen:SACE_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96059"
FT                   /db_xref="GOA:A8LWN6"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN6"
FT                   /protein_id="ABV96059.1"
FT                   /translation="MQTLVTDLLVTLAYGVVGIALMGVGYGLVDVATPGRLNELIWNER
FT                   NRNAALLLASNLLGVGTIVVAAIAASEDDLVVGLVGAASYGFLGLVVMAAAFLLLDLVT
FT                   PGRLGEILVDPEPHPAVWVTAAIHLAAGAIIAAAIS"
FT   gene            138269..138988
FT                   /locus_tag="Sare_0125"
FT   CDS_pept        138269..138988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96060"
FT                   /db_xref="GOA:A8LWN7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN7"
FT                   /protein_id="ABV96060.1"
FT                   /translation="MWVGIAAMVVVAILVAAVLTDSESTTVPPPTATERNDTVAILRDA
FT                   AERQGICYGWHLQERYGDVVSGGSNLGDGVLVAGHPRCPRWLQVTATVVYTAESSESED
FT                   SAVVTVKGSPEFDDDARDLTAGLSRFGLTEAAFVEEPGWAVTRAAVSLPLLAVEIGAAS
FT                   PEPMVTTAPTGVPTPLPAAGSDLWRDRSGWLIGATGLLLIAVLLVVVGLVQRRRAAAAV
FT                   ANGQGAGVTSRRKPGRV"
FT   gene            138985..140544
FT                   /locus_tag="Sare_0126"
FT   CDS_pept        138985..140544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0126"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: sen:SACE_0456
FT                   putative spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96061"
FT                   /db_xref="GOA:A8LWN8"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN8"
FT                   /protein_id="ABV96061.1"
FT                   /translation="MTADAPIRWRPARAAVLAAVFVCAACGLVYELALVALGSYLIGDT
FT                   VGQASIVLGVMVFAMGVGALAAKPLQSRAAAMFAAIELALALLGGLSVLGLYAAFAWLN
FT                   LYVPALVGTAFVLGLLIGAEIPLLMVLLQRIRQQAAGSAVADLFAADYVGALLGGLAFP
FT                   FLLLPLFGQLKGALVVGAVNAVAGLALVFTVFRRELSGRARTALTAGSVLVALCLGYAW
FT                   LTAHDFEVTARQQLYRDPVVHAERSRYQEIVLTRSVAEPGGGTDLRLFLNGDLQFSSVD
FT                   EHRYHEALVHPALAGARGEVLVLGAGDGLAARELLRYPDVRRITVVDLDSAVVALARTE
FT                   PRLQRLNGGSLDDPRVRVLHADAFGWLRTTAERFDVVIADLPDPDETATAKLYTVEFYT
FT                   LVRNVLATEGRLVVQAGSPYFAPRSYWSIEASLRGAGFATTPYHVDVPSFGDWGFLLAA
FT                   PGAIPPTLALPSDAPALRFLDPATLAAAGVFPPDRRRIDVPESTLLRPRVLEFARAEWR
FT                   GY"
FT   gene            140586..141440
FT                   /locus_tag="Sare_0127"
FT   CDS_pept        140586..141440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96062"
FT                   /db_xref="GOA:A8LWN9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWN9"
FT                   /protein_id="ABV96062.1"
FT                   /translation="MWGAIQEGRIVSDPYQPARVRPGVVTISSYLIFFYAALSVFDVIM
FT                   GLTTLGTVQEIYREEFAGTDAEGSEGVVVVTVAVMSLVSLLFAVGMVVLALLNNRGKRV
FT                   ARIVTWAVGGFALCCVGVSLAVSAAGNAMSIDDTSGDMASQEEIERRLAEALPSWYEPM
FT                   LTSALGAIALVAALILLALPPANEYFRKPQQQWEPPVPGAVYPGAPGGGPAYPVNPGQP
FT                   GYPQAGPPPGQPGHPQAGPPPGQPGHPQAGPPPGQPGSASGSSEQGGGAQSGSDGTGAS
FT                   SAG"
FT   gene            141499..142104
FT                   /locus_tag="Sare_0128"
FT   CDS_pept        141499..142104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96063"
FT                   /db_xref="GOA:A8LWP0"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP0"
FT                   /protein_id="ABV96063.1"
FT                   /translation="MSYPDPARRPAVVTAAAALLALMAVAAVMYAVASLFVLAGTVDVF
FT                   RSAAAGTAASPDEVDAMVLLVSTWMVGGAVVSLLAGVLLAVLAGVVRTGRSGARVAIWV
FT                   VAGLGVLAGCCGLTVLGGMRALPLPVAEEDRSAAELFARLSEAYPDWWIPLGVGLSVGQ
FT                   VLGYLVVAVLLASPPASNWFRRPTPSTHAPYPPPYAPR"
FT   gene            142113..142922
FT                   /locus_tag="Sare_0129"
FT   CDS_pept        142113..142922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0129"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   domain; KR domain protein; KEGG: stp:Strop_0124 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96064"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP1"
FT                   /protein_id="ABV96064.1"
FT                   /translation="MPFDQPATERRALITGATAGIGAEFARQLAADGWHLVLVARDATR
FT                   LTESAAELTSRHGRKVETISADLSTDEGCTEVERRLAGGSPVGLVVNNAGVSLNTPFLT
FT                   SSPEDEARLLRLNVHAVMRLTLAAVQSMVERRSGAVINVSSVSGFGPVMPGSTYPASKA
FT                   WVTSFSESVGLSARDFGVRVMALCPGYTRTEYHDRAGIDTSKTPGWMWLRADEVVTGAL
FT                   RDLRKGKLVSVPVWKYKLMVAGLRHAPRRLVEAFSQDTRGRVSPEQR"
FT   gene            143067..143606
FT                   /locus_tag="Sare_0130"
FT   CDS_pept        143067..143606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0130"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   stp:Strop_0125 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96065"
FT                   /db_xref="GOA:A8LWP2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP2"
FT                   /protein_id="ABV96065.1"
FT                   /translation="MGDHDDLRKFITDLAVVHGRVVLSSGRAADWYVDLRRVTLHHEAA
FT                   PLVGRVLRATTADWAYDAVGGLTLGADPIALSMLHATAGTDRPLDAFVVRKAGKAHGLQ
FT                   RRIEGPDVAGRRVLAVEDTSTTGQSVLTAVEALREAGAEVVGVAVIVDRGAGAAVRAAG
FT                   LPYRAAYTLADLGLVA"
FT   gene            143664..144041
FT                   /locus_tag="Sare_0131"
FT   CDS_pept        143664..144041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0131"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: stp:Strop_0126
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96066"
FT                   /db_xref="GOA:A8LWP3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP3"
FT                   /protein_id="ABV96066.1"
FT                   /translation="MDYVGTALAEMTMPQISPLAGEPIERADAERLAGVLKALADPARL
FT                   RLLSLIQSAPEGEACVCDLTAPLGLSQPTVSHHLRILTEASLLEREKRGVWAYYRLVPS
FT                   AIATIADLLTPPRKRAGKKAR"
FT   gene            complement(144196..144909)
FT                   /locus_tag="Sare_0132"
FT   CDS_pept        complement(144196..144909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0132"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   stp:Strop_0127 uncharacterized membrane-associated
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96067"
FT                   /db_xref="GOA:A8LWP4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP4"
FT                   /protein_id="ABV96067.1"
FT                   /translation="MSTPTTTLALGPDWLDPEVLISTFGLLGILVIVFAESGLLIGFFL
FT                   PGDSLLFTAGLLTADGKYITWPLWLVCLLITLSAIAGDQVGYAFGRKVGPALFRRPNSK
FT                   LFKQENLLKAHDFFEKYGARSVVLARFVPIVRTFTPIVAGVSRMNYRTFVIYNVVGAVL
FT                   WGTGVTVLGYFLGQIPFVKANIELILIAIVGISVIPIVVELLRARLAARRGTTAAERAA
FT                   AEEAIRETREHFGKH"
FT   gene            complement(145226..145438)
FT                   /locus_tag="Sare_0133"
FT   CDS_pept        complement(145226..145438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96068"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP5"
FT                   /protein_id="ABV96068.1"
FT                   /translation="MSLPDEDFAPSDHLMPDERDPEAEPADALEQATVVDPGEVDVEPR
FT                   RGLEVSGWDATEQARVVGTDEDDYR"
FT   gene            145624..145788
FT                   /locus_tag="Sare_0134"
FT   CDS_pept        145624..145788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP6"
FT                   /protein_id="ABV96069.1"
FT                   /translation="MISVVVREPRVVERPGRTGPVVPAVINCGILPAVDSAVRRTHGQQ
FT                   RPATAESVK"
FT   gene            145801..146823
FT                   /locus_tag="Sare_0135"
FT   CDS_pept        145801..146823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0135"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: stp:Strop_0130 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96070"
FT                   /db_xref="GOA:A8LWP7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LWP7"
FT                   /protein_id="ABV96070.1"
FT                   /translation="MPIASPEAYAEMLDRAKEGRFAYPAINVTSSQTLNAALKGFADAE
FT                   SDGIIQVSTGGAEYLSGPSVKDMVTGAAAFAAYAHEVAKKYPINIALHTDHCPKDKLDK
FT                   FVRPLMAISQERVRAGQEPLFQSHMWDGSAVPVAENLTIAEQLLGEAAKGKVVLEIEVG
FT                   VVGGEEDGVENAINEKLYTTVDDGLAMVEALGLGEKGRYMAALTFGNVHGVYKPGNVKL
FT                   RPEVLNQIQGAVGAKYGKEKPLSLVFHGGSGSLLSEIRESLDYGVVKMNIDTDTQYCFT
FT                   RPVADHMFRNYDGVLKVDGEVGNKKKYDPRVWGKAAEAGMAARVVEACEDLRSTGTRMK
FT                   "
FT   gene            147013..147441
FT                   /locus_tag="Sare_0136"
FT   CDS_pept        147013..147441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96071"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXK5"
FT                   /protein_id="ABV96071.1"
FT                   /translation="MQNLLPEPPATLLPAHDEADRALAAAEENGGDEDFAAVAARFPTF
FT                   SAAWAALAARAFAADQVVQAYAYARTGYHRGLDQLRRSGWKGHGPVPWSHEPNQGFLRC
FT                   LWVLSRTADAIGEADEAARCAQFLRDCDPAAADALASD"
FT   gene            complement(147514..149274)
FT                   /locus_tag="Sare_0137"
FT   CDS_pept        complement(147514..149274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0137"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: stp:Strop_0132 ATPase involved in chromosome
FT                   partitioning-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96072"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXK6"
FT                   /protein_id="ABV96072.1"
FT                   /translation="MVDENPDRSYAPGRQPAPERDIEPLWPAAQTTPPSWSPVPAPGGP
FT                   GQPPGAGDGTPVPTGWAPHVPSEAARAWAPHPNIDPVGAASETHAALTSQDVVPAPRPA
FT                   VGVNLHQPFGLDPVGPPVGAPAALTPIGHRPTAGTPAGGEPAGDEAAPAGRGDAPAESP
FT                   WALPPQRPATNGTRGSQLGTDWEPTDPTTHPGTAAPAGGPESGPAPAQNGRSPEAPAPG
FT                   AWAPHAAAPEPSAPPIAARAVPPTPYPPPPEGPAPGHQPAASVSAALPPAGWTPMPGAP
FT                   PTAEDFARRRQLRPMDPMATMGVRAVANKMGLRLPPGRLEQELRRDIEMVRRNFGGLRQ
FT                   VTVVNPKGGAGKTVAILLLAMTFGQKRGGYILAWDNNETQGTLGMRAQQDFHARTVRDL
FT                   LRDLAQFQGSHGRVGDLSQYVRAQGEGMFDVLASDESATGGEMLTAAAFGEIREVVSRF
FT                   YKLIFVDTGNNVRAQNWQAAMDATDQLVVTMSARNDSAETAARMLDHLEQSGRQRLVRQ
FT                   AVTVVSMPPSRKEMDLPAIEAHFAARTRAVLLAPYERLIDSGEPLRYGALSSAARDAWL
FT                   KIAAAVAEGL"
FT   gene            complement(149344..150339)
FT                   /locus_tag="Sare_0138"
FT   CDS_pept        complement(149344..150339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3655 diacylglycerol kinase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96073"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXK7"
FT                   /protein_id="ABV96073.1"
FT                   /translation="MYDVVLLTLGSERDAPGTCGSGGGCCGNSGAASGEPPAERCETPR
FT                   VPVLACADALAARGARVDPVTARSDAEIDDVLSRLDGPPRPDGLNWPDADARTRLVVGT
FT                   ASDAQLRTVLRRLVRRYAPPASRRPADLPADRTVPDLPPVGVLPLDPVRGGSHRDLAAQ
FT                   LGLPRDPVAVAAAVLEGTPRRLDLLRNDGGSVTLDGALFGAADEGGRPLHWRGRVEVDD
FT                   TLLSTGDDPLLACAIGNAGGYARLADVTLLTAPDPGDGLVEVAVAVPVVAQSRWGRRRV
FT                   RLEVRRARGRAVAVVPREGTVPFLDDGAEGELSRKRSWWTEPGAWAVWAS"
FT   gene            150467..151756
FT                   /locus_tag="Sare_0139"
FT   CDS_pept        150467..151756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0139"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   stp:Strop_0133 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96074"
FT                   /db_xref="GOA:A8LXK8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXK8"
FT                   /protein_id="ABV96074.1"
FT                   /translation="MPAIVLLGAQWGDEGKGKVTDLLGERVDHVVRYSGGNNAGHTVIT
FT                   PDGQKYALHLMPSGALSPSAKIVIGNGVVVDPKVLLAEIDGLAERGVDVSRLRISGDAH
FT                   LIMPHHRALDRVVERYLGSSRIGTTGRGIGPAYGDKVARMGIRVQDLLDPGILRKKLEL
FT                   ALREKNQMLFKVYNRKAIDVEATVEEYLGYAERLRPYIAETRALLWDALDRGDTVLLEG
FT                   AQATMLDMDHGTYPFVTSSNPTAGGACVGAGVPPTAITKVIAVSKAYATRVGAGPFPTE
FT                   LFDDNGQHLRKIGHEYGTTTGRERRCGWFDAVVARYACRLNGVTDLVVTKLDVLTGLPK
FT                   VPICVGYEIDGRRIDDMPMTQTDFHHATPIYEELDGWWEDITAARTEAELPAAARRYVA
FT                   RIEELCRTRVSVVGVGPGREENVVYHPLLP"
FT   gene            151822..153072
FT                   /locus_tag="Sare_0140"
FT   CDS_pept        151822..153072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0140"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: stp:Strop_0134 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96075"
FT                   /db_xref="GOA:A8LXK9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXK9"
FT                   /protein_id="ABV96075.1"
FT                   /translation="MRVLLVGAGGREHALALGLVADPSVEVLFAAPGNPGIGTVAVLRD
FT                   VVPTDPTEVAALAVECGADLVVVGPEAPLVAGVADAVRAKGIPAFGPSAEAARLEGSKA
FT                   FAKDVMAAAGVPTARAYTCSDAESVGRALDDFGAPYVVKDDCLAAGKGVVVTEDRAVAE
FT                   QHAQGCGQVVIEEYLAGPEVSLFVVTDGEAAVPLLPAQDFKRVGDGDSGPNTGGMGAYA
FT                   PLPWAPPGLVDEVMRDIVHPTLAELRRRGTPFAGLLYVGLAITARGPRVIEFNARFGDP
FT                   ETQVVLALLETPLAGLLHAAATGELAAHPPLRWRDGAAVTVVVAAQGYPAKPRTGDVIL
FT                   GAERPGVVQAGTVRRAADGALLSAGGRVLCGTATGADLAAARDAAYTLVRGIELADSHH
FT                   RSDIAAAAVDGRIDIPR"
FT   gene            complement(153113..154549)
FT                   /locus_tag="Sare_0141"
FT   CDS_pept        complement(153113..154549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0141"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0135 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96076"
FT                   /db_xref="GOA:A8LXL0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL0"
FT                   /protein_id="ABV96076.1"
FT                   /translation="MQALVIVTPSLLARFASTATTGDADAGPAGLARLIFTMTRTAHRH
FT                   RTPLLLVEAATLLSATGNGVAIVALPWLVLERTGSATAAGVVAAASGLPLLLSSLLSGT
FT                   VVDLLGRRRTALASDALSAISVAAIPLVDTLLGLNLGWIVALAVLGAVFDPAGMTARET
FT                   LLPAAAQAAGWRIERANGIHEAIFGLAFLIGPGLGGLLIATVGPEATFWVTAAGFALSV
FT                   LLIAAVRLPGAGRPERPPNGLWRGTQEGLVFVWRDPLLRTIALITMVLVALYLPVEGVL
FT                   LPAWFVAEGEPARLGAVLMAMSAGAVAGALGSSAAGRFVRRRHLMAVALVVTGVALLGL
FT                   AFLPPYPAMLAFAVLVGLAYGPVNPLANYAMQTRTPERLRGRVVGVMTSFAYAAGPAGY
FT                   LLAGPLVEWLGLATAFLVLAGALLVTALAAAPLPVLAALDEPPRYPPAPPGGTSGRSEG
FT                   PVPLGEQWLPAAHRDPPAIG"
FT   gene            complement(154647..155861)
FT                   /locus_tag="Sare_0142"
FT   CDS_pept        complement(154647..155861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0142"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: stp:Strop_0136
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96077"
FT                   /db_xref="GOA:A8LXL1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL1"
FT                   /protein_id="ABV96077.1"
FT                   /translation="MAEFSLDLTEEQRDLRDWVHGFATEVVRPAAAEWDAREETPWPII
FT                   QEAAKVGLYGFEFLTTCWGDPSGLSLPIACEELFWGDSGIGLSIFGTGLAVAAIYGSGT
FT                   PEQLLEWVPQCFGDLDSPTVAAFCTSEPEAGSDVGAIRTRAVYDQATDEWVLNGQKAYA
FT                   TNGGIAGVHVVTASVDPELGSRGQAAFVVPPGTAGLTATRKLRKLGLRASHTADVFLDD
FT                   VRLPGRCLLGGKEALDERLARARSGQRAASQAAMRTFELSRPTVGAQALGVARAAYEYA
FT                   LDYAKERVQFGRPIIENQAVAFTLADMKMEIDAARLLVWRASWMGRNNRPFTAGEGSMS
FT                   KLKAGEVAVTVTEKAVQLLGGAGFLRDHPVERWYRDAKIYTIFEGTSEIQRLVIARAVS
FT                   GVQIR"
FT   gene            complement(155863..156315)
FT                   /locus_tag="Sare_0143"
FT   CDS_pept        complement(155863..156315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0143"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   stp:Strop_0137 sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96078"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL2"
FT                   /protein_id="ABV96078.1"
FT                   /translation="MTDFDPARFANVGPKEFAQLVKSTPDDKITEVMSGDLRGKVLDEV
FT                   FGRMPQLFRADRAGSTNAVIHWNITGRPDGGTDTYEVVIADGGCTVNQTSQHDPKLSLT
FT                   LGPVEFLKTVSGGANPVMMFMTGKLKAKGDLGLAANIANLFDIPKA"
FT   gene            156384..157058
FT                   /locus_tag="Sare_0144"
FT   CDS_pept        156384..157058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0144"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_0138
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96079"
FT                   /db_xref="GOA:A8LXL3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL3"
FT                   /protein_id="ABV96079.1"
FT                   /translation="MSSTPTFRRLPRAVREQQMLDAAVKVFSRRGYHAASMDEIADDAG
FT                   ISKPMVYAYLGTKEELFIACLHREGTRMMQAIAGAVAPDLSADERLWRSLRAFLGFVGA
FT                   HRDGWAVLYRQARGEQPFAGEIAAMRSRMVEIVAGMLAHTLRAECREVAETELEVVAYA
FT                   LVGATESVADWLVDHPEADPEQTATRVMNVAWVGAAQLLAGTSWHPPTSQGEAPPDAPS
FT                   AG"
FT   gene            complement(157101..157718)
FT                   /locus_tag="Sare_0145"
FT   CDS_pept        complement(157101..157718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0145"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   stp:Strop_0139 uncharacterized membrane-associated
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96080"
FT                   /db_xref="GOA:A8LXL4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL4"
FT                   /protein_id="ABV96080.1"
FT                   /translation="MESALDLLRQLITSPLVYLLLFALTAVDAVFPMVPAETAVITAAV
FT                   LVGGVAPELVGIWAVATLGAMAGDHASYLIGRGGGARRLASFPAQSRRRASSEWARRAL
FT                   HRRGGLVLTSARYVPGGRTAVTLTMGAVRYPLRSFLLFDAIGGASWALYSVLLGYFGGL
FT                   AFQQDPLRGVLAGLGLSIGVTALLELGRRLGQRSRRRAAARR"
FT   gene            complement(157762..158682)
FT                   /locus_tag="Sare_0146"
FT   CDS_pept        complement(157762..158682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0146"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   stp:Strop_0140 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96081"
FT                   /db_xref="GOA:A8LXL5"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL5"
FT                   /protein_id="ABV96081.1"
FT                   /translation="MGGPQEPAGTGQIARSRVRLADLPAIGASYRRALLGALPGSGSRR
FT                   AGRPPAVELCVDGVGVDRARLAAYDRVCGFRLTDRLPATFPHVMGFPLALRLMTAPDFP
FT                   IPLTGVVHVGNRITVHRPVDAAETLDFSAYATNLRPHERGRQIDMVLIGAVDGEEVWRG
FT                   VSTYLSREHTSDAGERHDRGERPPAPPASAFWRVGRRVGPAYAQVSGDHNPIHTSRLGA
FT                   RLFGFRRPIAHGMWSKARCLAALEPRLPDAYTVDVAFKLPLPLPGTVAFGGTPAGDFAL
FT                   RDVRGRPHLLGTLRERGRGPSPRLL"
FT   gene            complement(158682..160037)
FT                   /locus_tag="Sare_0147"
FT   CDS_pept        complement(158682..160037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0147"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: stp:Strop_0141 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96082"
FT                   /db_xref="GOA:A8LXL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL6"
FT                   /protein_id="ABV96082.1"
FT                   /translation="MTDRYASFVQSGVGRALVKRLGLPDPPQLRRHRPGDPLVPGPVLL
FT                   GAAAGGRLAGPVGKLLTAAGVELRDPADVAAGTRLGALVYDATGVTDSTALRQLYDYLH
FT                   PHARSVLPSGRVIVLGTAPAECATPREATAQRALEGLTRSIGKEFGRGVTAHLVYVTDT
FT                   GDPGTATSLEATLRFLLSGRSAYVSGQVVRVGTGQAEPPADWDRPLDGQVVLVTGAARG
FT                   IGAALARVLARDGAQVVALDIPAAGDELAAVANKIGATAVQLDLTAPDAPTRLADHLSA
FT                   RHGRADVVVHNAGITRDRTLGRMDVDRWDQVLDVNLSSQERINDVLLERGLIPAGGRIV
FT                   SVSSIAGIAGNRGQTNYATSKAGVIGLVESLAPTLRERGISVNAVAPGFVETRLTARVP
FT                   LVLREAGRRMNSLAQGGLPVDVAETISWLAWPATGAVSGNVVRVCGQSLLGA"
FT   gene            160093..161385
FT                   /locus_tag="Sare_0148"
FT   CDS_pept        160093..161385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0148"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: stp:Strop_0142 acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96083"
FT                   /db_xref="GOA:A8LXL7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL7"
FT                   /protein_id="ABV96083.1"
FT                   /translation="MQNIRRVAVIGGNRIPFARSNSRYAEASNADLLGAALDGLVARYG
FT                   LAGQQVGEVVAGAVLKHSRDYNLTREVVLGSTLDPHTPAYDIQQACGTGLEAAILVANK
FT                   IALGQLDVGIAGGVDTTSDAPLAVNEEMRRTLLTLNTARTLGERLRIAARLRPSQPFRP
FT                   EIPRNAEPRTGLSMGEHAARTAVHWQVDRRSQDELALRSHHRLAAAYERGFFDDLMTPY
FT                   LGLTRDQNLRPDTSLEKLGGLRPVFGTKGPDAEQATMTAGNSSPLTDGASTVLLASEEW
FT                   AQAHSLPVQAWFTWSQTAAVDFVPGEEGLLMAPAYAVPRMLARAGLTLQDFDFYEIHEA
FT                   FAAQVLATLAAWESPEFCRDRLGLDAPLGAIDPDRINVNGSSLAAGHPFAATGGRIVAT
FT                   LAKLLAERGGGRGLISICAAGGQGVTAILER"
FT   gene            complement(161415..161867)
FT                   /locus_tag="Sare_0149"
FT   CDS_pept        complement(161415..161867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96084"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL8"
FT                   /protein_id="ABV96084.1"
FT                   /translation="MTAGLPFGVGSVVQLAEQHYCYGLGTLTLRIVEVGRRVRHTDGLW
FT                   INVRGVQLESPPRHRRILARLDAIQTQPVPIPVTHIPVRPGWDCAGCGAAWPCPDHRRR
FT                   LLDRYAGKPAALGIYLSTQMTAAVPDLRHLPPEELYERFLGWLQLA"
FT   gene            complement(161864..162199)
FT                   /locus_tag="Sare_0150"
FT   CDS_pept        complement(161864..162199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96085"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXL9"
FT                   /protein_id="ABV96085.1"
FT                   /translation="MGIYRSASRWSREEAEAEAAHEILTNHMADPENGCCTICLAPGPC
FT                   GPANAAANRLVDLGRPVLLPESRRDRRAGWRGWFGSTGAVPATGSTRWRRASLLTFAWL
FT                   LRLGVIS"
FT   gene            162426..162968
FT                   /locus_tag="Sare_0151"
FT   CDS_pept        162426..162968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0151"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; KEGG: stp:Strop_0144 UbiC transcription
FT                   regulator-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96086"
FT                   /db_xref="GOA:A8LXM0"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM0"
FT                   /protein_id="ABV96086.1"
FT                   /translation="MGGSDWLSVSMPYVQPDATHAGDVWAADAAGQGRSGTQRILAVGE
FT                   VVAAAEVAAALRVAPGDPVTVRRRLMLLDDEPVELTDSYYPVAIARGTALAEQRKIRGG
FT                   AVRLLAEVGYRPRRVREDVYTRLPEPAERRLLGLADHEWALGLTRVLSTQDDVPVEVSV
FT                   MTMVPWGRRLRYELAID"
FT   gene            162987..163700
FT                   /locus_tag="Sare_0152"
FT   CDS_pept        162987..163700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0152"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   stp:Strop_0145 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96087"
FT                   /db_xref="GOA:A8LXM1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM1"
FT                   /protein_id="ABV96087.1"
FT                   /translation="MASGSDSRPRHEQVAADLRSRIMSGELPPGSALPSIPTLVRQYSA
FT                   ATATVQRALGALKAEGAVYSEVGKGVYVRPRRPLVVEASAYLAPTSDGYAYRLRSVAEV
FT                   VPPAEVARELGIGAGERAVLRHRLLVCGDEPVELSWSYYPAAIASGTELAERRKIPGGA
FT                   PRALADLGYPQRQTRDRVCARMPTTEEVEALDLPPYVPVLRQLRVIRSVDARPVEVSIL
FT                   IKGSHRHELHYDQRG"
FT   gene            163901..165619
FT                   /locus_tag="Sare_0153"
FT   CDS_pept        163901..165619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0153"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: stp:Strop_0146 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96088"
FT                   /db_xref="GOA:A8LXM2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM2"
FT                   /protein_id="ABV96088.1"
FT                   /translation="MNLETLLADRLGPAFAAVAGAPVDPVLRRSQHADYQCDAALSLAR
FT                   RLGRRPRDIAAEVLGQVELADLCSAVAVSGPGFINLTVADSALGTLLSTAAVDSRLGVA
FT                   PSAATETVIVDYSSPNVAKEMHVGHLRGTVIGDAAVRLLEWRGHQVIKANHLGDWGTPF
FT                   GMLIEHLLDLGESEAADELSVGDLDSFYKAARVKFDADDAFRERAQRRVVALQRGDELT
FT                   LRLWRLLVAESEKYFLTVYDQLGVLLTERDFRGESYYNEQLAPVTDELDRLGLLRESGD
FT                   AACVFPAGFVGRDGQPLPIIVRKRDGGFGYGATDLAAIRHRTQDLGATRLLYVVGLPQR
FT                   QHFELVYAVAWQAGWLSPPARAEHLGFGSILGSDGKMLRSRTGDSIKLVGLLEEAVTRA
FT                   AELARQKNPDLSATEVADVARAVGIGAIKYADLSTDRNKDYVFDWQRMLSLDGNTAPYL
FT                   QYAHARIRSIFRRAEIEQFTPTPITVGHPAEHALALELAGFGAVVASVEQTLQFHRLAG
FT                   YLHTLATTFSGFYEHCPVLRAEDAVRDSRLALCDLTARVLRQGLYLLGIATPDRM"
FT   gene            165696..167120
FT                   /locus_tag="Sare_0154"
FT   CDS_pept        165696..167120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0154"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="KEGG: stp:Strop_0147 adenylosuccinate lyase;
FT                   TIGRFAM: adenylosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96089"
FT                   /db_xref="GOA:A8LXM3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM3"
FT                   /protein_id="ABV96089.1"
FT                   /translation="MTTIPNVLANRYASPELVALWSPEEKIRMERRLWLAVLTAQRDLG
FT                   VDVPDGVVEAYRRVLDQVDLASIAQRERVTRHDVKARIEEFSALAGHEHVHKGMTSRDL
FT                   TENVEQLQVRASLELIRDRVVATLARLARLAVEHSGLVLTGRSHNVAAQATTLGKRFAS
FT                   AAEELLIAYERLDDLIGRYPLRGIKGPVGTAADQLDLLDGDAGKVAELERRVAEHLGFG
FT                   RVLDSVGQVYPRSLDFDVLSALAQVAAGPSSLATTIRLMVGQELATEGFQPGQVGSSAM
FT                   PHKMNTRSSERVNGFAVIIRGYLSMAGELAGDQWNEGDVSCSVVRRVALPDAFFAADGL
FT                   FQTFLTVLDEFGAYPAVVNRELERFLPFLATTKILVAAVRRGVGREVAHEVIKEHAVAV
FT                   ALAMREKGATENDLFDRLAADHRLNLTRADIAGLVADRTAFVGAASAQVRAVAERVAGV
FT                   VARHPDAAAYTPPPIL"
FT   gene            complement(167217..167681)
FT                   /locus_tag="Sare_0155"
FT   CDS_pept        complement(167217..167681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0155"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   stp:Strop_0148 protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96090"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM4"
FT                   /protein_id="ABV96090.1"
FT                   /translation="MLVVTTDQLPGYEVRQILGEVVSSMARTRNPYREGVKNLRGGAYD
FT                   PMAPDNLTRWRTDSVARLGEEARRLGANAVIGMRFDSRDCGEMWMEICAYGTAVIVVPT
FT                   VPDVMPPDQPLVAAETAHEPAIAEEQPSGIAEPPSAPDLGSAAGTPTRDS"
FT   gene            complement(167810..168493)
FT                   /locus_tag="Sare_0156"
FT   CDS_pept        complement(167810..168493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0156"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   stp:Strop_0149 peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96091"
FT                   /db_xref="GOA:A8LXM5"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM5"
FT                   /protein_id="ABV96091.1"
FT                   /translation="MRIRSLVAVLATTVAGVLGVSSGAVANPGPTPLIIGGGYVSSAPW
FT                   AAAVFSNGSFTCSGTIIAPQWVLTARHCVGGSMSVRVGSVYRSSGGVTRTVTAAYGRYD
FT                   LALMRLNSSVNTSYVTLANSNPPVGSTNSIYGWGMTCYSGCSASNQLKTADVRVTTNNA
FT                   SDAYGGQAIRTTRINGNAWRGDSGGPQFYNGRQVGVASTANGFNIQNYGSVAYNRSWIA
FT                   AVAGV"
FT   gene            168868..169131
FT                   /locus_tag="Sare_0157"
FT   CDS_pept        168868..169131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0157"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: stp:Strop_0150
FT                   phosphoribosylformylglycinamidine synthase, PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96092"
FT                   /db_xref="GOA:A8LXM6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM6"
FT                   /protein_id="ABV96092.1"
FT                   /translation="MPRVVVDVMLKPEILDPQGQAVANALPRLGVNDVASVRIGRRIEI
FT                   EFTGEPDLNRAQEIADKLLANPVIEDFTVRLVEDDETVDARR"
FT   gene            169128..169808
FT                   /locus_tag="Sare_0158"
FT   CDS_pept        169128..169808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0158"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: stp:Strop_0151
FT                   phosphoribosylformylglycinamidine synthase I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96093"
FT                   /db_xref="GOA:A8LXM7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM7"
FT                   /protein_id="ABV96093.1"
FT                   /translation="MTARVGVVTFPGSLDDGDAARAVRLAGAEPVRLWHADPQLHGVDA
FT                   VVLPGGFSYGDYLRCGAIARFAPVMGTIVDAARQGLPVLGICNGFQILCEAHLLPGALT
FT                   RNQHLHFRNRDQILRIESAGTAWTNAFQPGQEVLIPVKNGEGCYVADAATLDQLEAEGR
FT                   VVARYVGNPNGSQRDIAAITNSAGNVVGIMPHPEHAVEELTGPSLDGLGFFTSALKHLV
FT                   ETPA"
FT   gene            169876..172425
FT                   /locus_tag="Sare_0159"
FT   CDS_pept        169876..172425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0159"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: stp:Strop_0152
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96094"
FT                   /db_xref="GOA:A8LXM8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM8"
FT                   /protein_id="ABV96094.1"
FT                   /translation="MTTQDPVRDSDAAVAGPTAAPDRDATVIGWVGGVDTVPHAGDSPD
FT                   ELQPYAELGLRDDEYARIRQLLNRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKAP
FT                   SSDRMLAGIGENAGVVRVSDELAVTFKVESHNHPSFVEPHQGAATGVGGIVRDILAMGA
FT                   RPVAVMDPLRFGAADHPDTARVLPGVVAGIGGYGNCLGLPNIGGEVVFDPCYQGNPLVN
FT                   ALCVGVLPVDRLQNKAAAGTGNVVVLMGAKTGRDGIGGVSVLASATFDEGSEQRRPSVQ
FT                   VGDPFIEKLLIEACLELYDEQLVVGIQDLGGAGLTCALAETAAAAGTGMRVWLERVPLR
FT                   EPSMEPHEILASESQERMLLVVEPEKLEAVLQTAEKWGVLATAIGEVTAPAPDGQPGRL
FT                   VITWRDHLVVDVPPGSLADDGPVYHRPMREPADLILLQADRAETLPRPSDPDSLRETVL
FT                   RMIASPNLADKTWVTEQYDRYVLGNTVLAQPEDSGVIRIDERSGIGIALSVDGNGRYAR
FT                   LDPYHGAKLALAEAYRNVAVTGAKPIAVTDCLNFGSPEDPGVMWQFAEAVRGIADGCGE
FT                   LGIPVTGGNVSFYNQTGAAAIHPTPVVGVLGVLDDVADRIPMGFVPRDGGHDQIYLLGD
FT                   TNVELSGSEWAWATHEHLGGVPPRVDLDRERAIADLMAVAARGGHLSSAHDLSDGGLAQ
FT                   SLVESCLRRGVGARVTLPEQFTGGSMPFVFLFSESAGRVLVSVPRGHEKAFTALAAEHG
FT                   VPCELIGVTDTAGGALELHGQFRLGLDELRAAHSATLPRLFGGAELGAANASAVGDAGS
FT                   PAGAVATPPVTMTEEPTATGGPAAPIDTEPPPGADER"
FT   gene            172429..173184
FT                   /locus_tag="Sare_0160"
FT   CDS_pept        172429..173184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0160"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RSc1273 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96095"
FT                   /db_xref="GOA:A8LXM9"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXM9"
FT                   /protein_id="ABV96095.1"
FT                   /translation="MTAAAHTQPGSGARFEWGLAGAAELSRVCAVLVVVDVLSFTTAVE
FT                   VAVGRGTRVHPFPWGEQAAEYARRIGAVAAVGRRSVVPEQPWSLSPAALAAAPAVRELV
FT                   LPSPNGSAISAAASATGLPVVAACLRNARAVGRWLHRQGYGTTHAPIGVVAAGERWPDT
FT                   SLRPAVEDQLGAAYVLDALSRVPGGLSVEAALALAALASTPDVPAAVRGSVSGRELAEG
FT                   GFAADVEMAVQVNVSDVVPVLRNDVFSAA"
FT   gene            complement(173268..175280)
FT                   /locus_tag="Sare_0161"
FT   CDS_pept        complement(173268..175280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96096"
FT                   /db_xref="GOA:A8LXN0"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN0"
FT                   /protein_id="ABV96096.1"
FT                   /translation="MILARRPPAAEGIQWKAVDVSTHRRAWKQRAGVVAALVVGALLTV
FT                   PASPASAAPGVNNLSASPSRIEAGGTMTVNYSINISDGNPANVTVASSNGELTCVSGCS
FT                   HSDVTRNQGFQASFRLASDAADGRATITVTAVDSEGEDTADTTVTLVGKPEPQPTPPPT
FT                   QAQTVKSVSGEVVNQSTGSAVPSALVVLKDSNGKKFDTMTDNGGNFRFTGSTQNPIAPG
FT                   RIDIGASFENVYATKSFSASAGQSVSGQRISLAIKNETPSPTASSSIAPAPTVGAEEEV
FT                   EQSIEAVVDTPTEAAGNEDSGGIGSLLIILLGGLLVAAGVGTIVLLWLRRKENDDEADE
FT                   ADGPPSTATGAVPVARGGYGGLDDHTRIVNPTAAAPTMVGGDPSLADAPTMMHRPVVDD
FT                   VPPDPYGAPPNPYGTPAGQSGWAGSGYGDQPDAYGTGGFGATGPAEGGYGGTATPSSGG
FT                   GYGSTATPSSGSGYGGDYGTPTSAGSGYPPASGGSYGYGERYNEATGHFHQEAATQYPA
FT                   PADPYPTGRYQQDAGYSHPDPTYGQGGEPAGGYDQRGSYDDPGYGQHGGYGGGYGGYGQ
FT                   ETPTPYGGYGQQPPTAYGGYSQQPPTQYGGYGQDLPTQRGGYDGYDQEAPGQHGGYDDR
FT                   GYGQGGYGDPNQTDRPRSDAPPPDRGGRRLDWLDD"
FT   gene            175383..175736
FT                   /locus_tag="Sare_0162"
FT   CDS_pept        175383..175736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96097"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN1"
FT                   /protein_id="ABV96097.1"
FT                   /translation="MSSSCVSSAAVVAALSALDEGRVPDRPVFRAAVRALLTGLAERAP
FT                   GRSVEVRVPPYGAVQCVPGPRHTRGTPPNVVEMDPETWLRVATGALSWAKAVTEGRVRV
FT                   SGVRADLAAYLPL"
FT   gene            175890..177470
FT                   /locus_tag="Sare_0163"
FT   CDS_pept        175890..177470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0163"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: stp:Strop_0154
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96098"
FT                   /db_xref="GOA:A8LXN2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN2"
FT                   /protein_id="ABV96098.1"
FT                   /translation="MPRGDGRLSHDLDPQRPGPQDACGVFGVWAPGEEVANLTYFGLYA
FT                   LQHRGQEAAGIAVSDGTGVVVYKDLGLVAQVFDEPTLASLRGHVAIGHARYSTTGASTW
FT                   ENAQPTMRSTTSGTTIALAHNGNLVNAAELHRAAGERELMADGATNDTSLVTMLLASRP
FT                   DLSVEAAALEVLPQLRGAFSFVFMDESTLYAARDQHGVRPLVLGRLERGWVVASETAAL
FT                   DIVGASVVREVEPGELIAIDEDGLRSARFASPEPKGCLFEYVYIARPDATIAGRNVHAA
FT                   RVQIGRQLAREHQVDADLVIPVPESGTPAAIGYAAESGITFGAGLMKNPYVGRTFIQPS
FT                   QTLRQLGIRLKLNPLRENVRGKRLVVVDDSIVRGNTQRAIVRMLREAGALEVHVRISSP
FT                   PVAWPCFYGIDFATRAELLANGLDNEGIRRSIGADTLGYVSLSGLIAATEQPKSRLCRA
FT                   CFDGEYPIDLPPDTLIGKHVLEGVGRRVAAESPDLHSAPLVAALSGHDTFSSARAPRPD
FT                   PEEPTTHRR"
FT   gene            177539..178684
FT                   /locus_tag="Sare_0164"
FT   CDS_pept        177539..178684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0164"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: stp:Strop_0155
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96099"
FT                   /db_xref="GOA:A8LXN3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN3"
FT                   /protein_id="ABV96099.1"
FT                   /translation="MSERSGAGSSQTGAGGDRQPWTTGTGSPVRRRAASYLDAGVSIEA
FT                   GDRAVELLKSKVKQTRRPEVMGDLGGFAGLFRLDTKKYRNPILASSTDGVGTKLVIAQQ
FT                   LDIHDTVGIDLVAMVVDDLVACGAEPLFLLDYIATGEVVPDKVAEIGAGIADGCRYAGC
FT                   ALLGGETAEHPGVLRPDEYDISATGVGVVEESEILSSERVEVGDVVIAMRASGLHSNGF
FT                   SLVRHVLLGAGRMRLDVVIEDFGRQRTLGEELLTPTKIYAQDCLKLIAEAEVRVFAHVT
FT                   GGGIPGNLVRVLPEHVDAVVNRSTWKPQPIFDLVQSKGRIEAPEMEATFNMGVGMFAVV
FT                   SAEDADRALATLTGRGVDAWQAGEIVEGTGNVQLVGQHTRG"
FT   gene            178824..179954
FT                   /locus_tag="Sare_0165"
FT   CDS_pept        178824..179954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0165"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: stp:Strop_0156 radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96100"
FT                   /db_xref="GOA:A8LXN4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN4"
FT                   /protein_id="ABV96100.1"
FT                   /translation="MAVRGQSSRMRGLAAVPAYVVMQPTTLCNLDCVYCYLPLRAADRR
FT                   MPVAVAEAVAASVNPWARAGRFSVVWHGGEPLAAGRELLAALIAPFGPEVEHHVQTNAA
FT                   LIDDAWCRFFAEHQIRVSVSVDGPREHNGGRVTRGGRPAYDRIVQGVAALRRHGLPFSA
FT                   LAVVGHPKPGLARELYDFFLDLGPDVLGVNIEETEGVNTRANRHDAAAVTAFWAELVAA
FT                   WRRNPRIHLREVEWSLRYAAAALDGVEGEVLPHQLDPIPTVGHDGSVTVLSPELAGFTN
FT                   PRYGDFSSGNVLVTPLAEILAEATQTPWVGEFLTGVEACRSSCPYFGFCGGGHAANRYF
FT                   EQGRFDGTETEHCRNSKIRLLEGVLEHARGHRSPAV"
FT   gene            179923..180159
FT                   /locus_tag="Sare_0166"
FT   CDS_pept        179923..180159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96101"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN5"
FT                   /protein_id="ABV96101.1"
FT                   /translation="MPEDTGHRQSEYAAGTSAYDVADRVRAARADLTTLLREAETARHL
FT                   RAEAAGDGTASAVCAWNHFENIPTFYNWNNRPR"
FT   gene            complement(180321..180536)
FT                   /locus_tag="Sare_0167"
FT   CDS_pept        complement(180321..180536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96102"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN6"
FT                   /protein_id="ABV96102.1"
FT                   /translation="MGRGRAKAKQTKVARELKYHSPNTDLAALQRELGGGRKSDHDFDD
FT                   DYKEYVDDDDEDHADDDPDNRARPDR"
FT   gene            complement(180828..181910)
FT                   /locus_tag="Sare_0168"
FT   CDS_pept        complement(180828..181910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0168"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   stp:Strop_0159 Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96103"
FT                   /db_xref="GOA:A8LXN7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN7"
FT                   /protein_id="ABV96103.1"
FT                   /translation="MGVFATTDDPGSAGHEQVVFCQDKQTGLRAIIGIYSTALGPALGG
FT                   TRFYPYASEEAALADVLDLSRGMAYKNALAGLDLGGGKAVIWGDPEQLKSEALLRAYGR
FT                   FVATLGGRYYTACDVGTYVSDMDVVARETRFVTGRSLEHGGAGDSSILTAWGVFQGMRA
FT                   AAEHVWGTPTLRGRRVGVAGLGKVGKYLVGHLIEDGAEVVATDVNPRALAWARATHPQV
FT                   TLVDDATALVASDIDVYAPCALGGALNDDTVPALRAKVVAGAANNQLAHPGIEKLLADR
FT                   NILYAPDYVVNAGGVIQVADEIEGFSFERAKLRATKIFDTTREILRLADAEGVPPAVAA
FT                   DRLAERRMAEVGRLRTILLP"
FT   gene            182130..182969
FT                   /locus_tag="Sare_0169"
FT   CDS_pept        182130..182969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96104"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN8"
FT                   /protein_id="ABV96104.1"
FT                   /translation="MPSLFAAYLRVYEPLTAFDRDRQAYWRRYVEQGRAVAPVEGPGRQ
FT                   LTSVIEALGAGWTRLPDLPDEAYVLEADDTLLVCPWNLRIRVAEAALNARDGVPPVLAD
FT                   AFVPPVLAGQAKAVVDDWRSGARVLEHGVPRVHEQIATWGVPLRWFVLFEPAERHHVTQ
FT                   PGRRALRYRTEISKARRRSSRALAVLRKSVGAAPITEAVEEAARWLEEFHPRSVVELDY
FT                   GGLVALLSDETLAADDSPELVAAGLAGLSRGEAEEASAAYDKLVARWRAVQLLERCN"
FT   gene            183222..183431
FT                   /locus_tag="Sare_0170"
FT   CDS_pept        183222..183431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0170"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein MerR; KEGG: stp:Strop_0161 DNA
FT                   binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96105"
FT                   /db_xref="GOA:A8LXN9"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXN9"
FT                   /protein_id="ABV96105.1"
FT                   /translation="MASRTHEPEPLLTPAEVASMFRVDPKTVTRWAKAGKLSAIRTLGG
FT                   HRRYRESEVRALLQGQIPQQRQGD"
FT   gene            complement(183515..183895)
FT                   /locus_tag="Sare_0171"
FT   CDS_pept        complement(183515..183895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0171"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96106"
FT                   /db_xref="GOA:A8LXP0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP0"
FT                   /protein_id="ABV96106.1"
FT                   /translation="MTMLDRLATEKYILLTTFRKDGRAVPTPVWAVRDGDALVVWTVAG
FT                   SGKVKRIRRSGDVTIAPCDVRGRPHGPAVPGHAVLSDSAGTRRVRGLIKEKYRVLGRLT
FT                   LLGSRLRRGEQGTVGIRVTLKG"
FT   gene            184220..185077
FT                   /locus_tag="Sare_0172"
FT   CDS_pept        184220..185077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0172"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   stp:Strop_0163 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96107"
FT                   /db_xref="GOA:A8LXP1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP1"
FT                   /protein_id="ABV96107.1"
FT                   /translation="MSDRWVVVGAGTMGLGIAYVAAGAGHDVDLVEVDQARGQVAAVRL
FT                   GELWDRAVGRGRLTAEQADANRSRVTMRATLDEVSAGPDVVVEAVPERADLKRRVLREA
FT                   ETLGPVLLASNTSSISIAELAEGLNRPEAFLGLHFFNPVWAMALLEVVVGPATTSQSVD
FT                   AAVALAGRLGKDPVVVRDMPGFATSRLGVTLGLEAIRMVADKVAEPADIDKAMVLGYRH
FT                   PIGPLELTDLVGLDVRLDIARTLEAAYGQRFAPPPLLVEMVAAGHLGKKSGQGFYRWQN
FT                   GVKA"
FT   gene            185074..185817
FT                   /locus_tag="Sare_0173"
FT   CDS_pept        185074..185817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0173"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   stp:Strop_0164 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96108"
FT                   /db_xref="GOA:A8LXP2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP2"
FT                   /protein_id="ABV96108.1"
FT                   /translation="MTGLRVDEQADRVVATLDRPAKRNAIDADLVHALHDLCADLEVRP
FT                   RLLLLTGGAEGIFAGGADIGQLRERGRLDALAAINSAVFARIRALPMPTVVAVDGPALG
FT                   GGAELAYACDLRVCTARAIFGQPEVRLGILAGAGATHRLPALVGEARAKEMLFTGRRVD
FT                   AEEALRIGLVNRVVAEPAELLPSAHALLDEVAKGSALALRLTKSAVDAPPAAHPHLDLV
FT                   SQAVLFEDEEKHRRMTEFLERRRPS"
FT   gene            complement(185870..187219)
FT                   /locus_tag="Sare_0174"
FT   CDS_pept        complement(185870..187219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0174"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /note="KEGG: stp:Strop_0165 ABC-type branched-chain amino
FT                   acid transport systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96109"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP3"
FT                   /protein_id="ABV96109.1"
FT                   /translation="MLISRATRAATLAACAMSLLATSACGTDRSDEATATPIRLYGTDS
FT                   TMLSSFPSELGTRAGLVDGMKGTTPLTPLPEDFKNRLRSIDSGLTDFVYAAEAYDAVLI
FT                   SALAAQLAGTTDPAAIAKQIVGVTNDGERCETAATCLELASDGQDIEYRSVSITRAGFT
FT                   TAGEPSTASYATLHFDGEQINDSKTEFVGAGSESTASTEAPPPPKRQGAGASNRNDGSP
FT                   LVLGGLLPKTGDLALSNPPLAAGAALAIEEINAAGGVLGDPVTWIDGDDGTNPAVAKAT
FT                   VASHVAAGVDVIIGAGASGVSRAVLPDVVEAGLVLFSPSNTDASLTDLDDEGHYFRTAP
FT                   PDSLQGRALADVILRDGPQQVAIVARQDSYGEGLQNIVRSELERAGIDSDRLKLITYQP
FT                   PEDAEAAPVDFTAGVHEITSFGADAVLIIGFSESAGLIRALADAGVPLHR"
FT   gene            complement(187429..187947)
FT                   /locus_tag="Sare_0175"
FT   CDS_pept        complement(187429..187947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0175"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: stp:Strop_0166 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96110"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP4"
FT                   /protein_id="ABV96110.1"
FT                   /translation="MGQEMVDPVDVRQAFARFSLRSSLLVPASVQQAFEVFTGAIADWW
FT                   VTEYTWSGPGLLAALGMEPWAGGLLYEIGPHGFRNDWGRVLVWDPPRRLVFTWQIGADR
FT                   LPVPDPARASEVEALFQPDHSGRTRVEVEHRHFDRHGRAAEGYRRALTTGWSELLARYA
FT                   SVVAKRALG"
FT   gene            188213..188674
FT                   /locus_tag="Sare_0176"
FT   CDS_pept        188213..188674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96111"
FT                   /db_xref="GOA:A8LXP5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP5"
FT                   /protein_id="ABV96111.1"
FT                   /translation="MDPETGRRYAEEVGVVLAQMGTTPAFGKLLGWLLVCDPPNQTTAQ
FT                   LCEAMGLSKASVSTGMRVLEQSGMVRRVPSPGRGHAYEMHPDAFARALDPTEKMRVFID
FT                   LMQRGIDLIGDAQAPEASRLRHTRDFYAFMIERTPALMEEFRRQERKDT"
FT   gene            188677..189960
FT                   /locus_tag="Sare_0177"
FT   CDS_pept        188677..189960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0177"
FT                   /product="Sterol 3-beta-glucosyltransferase"
FT                   /EC_number="2.4.1.173"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   glycosyl transferase family 28; KEGG: stp:Strop_0168 sterol
FT                   3-beta-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96112"
FT                   /db_xref="GOA:A8LXP6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP6"
FT                   /protein_id="ABV96112.1"
FT                   /translation="MRVLVVTVGSRGDVQPYVALGKGLQAAGHHVTLATCARFRTVVTD
FT                   QGLAYGQLSDDILQLLDSTAGRAAMEDATGVFGSIKTNIKLARQANPINRKLLVDVWAA
FT                   AQQAEPDVIVYHPKALAGPHVAEKLGVPVVLALPVPVSVPTGDFPLVGLPALPLGRWYN
FT                   RLTYRLAGAGYRMYDGMVNAFRRETLGLARTSGAALTTRLPDGRPIPVLHGISEHVLPR
FT                   PADWPAHVHLTGYWFLDGADRWQPPPALVDFIEAGDPPVYVGFGSMAGRDPHRLTRVVG
FT                   EALRLAGVRGIITTGWGGLEMVEQSDTNWHLTQAPHDWLFPRVSAVVHHGGAGTTAAAL
FT                   RAGKPSVICPFILDQFVWGRQVFALGAGSAPIPQRKLTAQRLAAAIREVTTNADVQGAA
FT                   ARLGRSLAAEDGVANAVARIDAVLDRAG"
FT   gene            190378..191529
FT                   /locus_tag="Sare_0178"
FT   CDS_pept        190378..191529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0178"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   stp:Strop_3150 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96113"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP7"
FT                   /protein_id="ABV96113.1"
FT                   /translation="MRRKYVRALGAMGLSAALIAAAGCQAAEDDTAGGSGDCGGKIAMF
FT                   GAYSGPNSGLAIPALKSAQLAVKQHNEANPDCEVTLQEFDTKGDPTEATPVANRVAGDA
FT                   SFLGVIGGAFSGESKATMDVYEAAEMVMVSPSSTAIELTAGGNEVFHRVVGNDAVQGAA
FT                   AAVYLRDVVRARKVFVINDGTTYGAGITDELTRALGELAGGTDQVQEKQVNFAATISKI
FT                   KAAAPDAIAYGGYSNEAAPLVKQMREAGVTATFLGLDGIYDPSFPEGAGASAEGAIVTC
FT                   LCLPSDKAGGTFAADFEAEYGVPPGPFGAEGFDAANVLIEGLAEGNTTRKDLLAWVDSY
FT                   DKEGVSKSLKFDENGDVDKSRVVTWAYEIKGGEITAQQEIKLS"
FT   gene            191785..192525
FT                   /locus_tag="Sare_0179"
FT   CDS_pept        191785..192525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0179"
FT                   /product="alpha/beta hydrolase fold-1"
FT                   /note="KEGG: mav:MAV_4984 alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96114"
FT                   /db_xref="GOA:A8LXP8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP8"
FT                   /protein_id="ABV96114.1"
FT                   /translation="MGEIVVVRDGSGPEILLVHGGAGPRRTWGAIAPLAARWTLGYVHR
FT                   RGYPPSPPPQERQDFQVDALDLAPLLVGRPHVVAHSYGVLGTLIAAAAAPGSVRSLTLI
FT                   EPPLNYLVPDDLEVARLGRIGDAVLTHGMDVDPTELREFLHLAGAPIGDGPLPEDVVAS
FT                   VRRAHGGRPTSEARPQLDTIRDAGVPVLVASGDHAAALERICDALADALGGTRSVHPGA
FT                   GHFVAAAPGFAEQLETFLRKSVTW"
FT   gene            192672..195074
FT                   /locus_tag="Sare_0180"
FT   CDS_pept        192672..195074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0180"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   sma:SAV247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96115"
FT                   /db_xref="GOA:A8LXP9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXP9"
FT                   /protein_id="ABV96115.1"
FT                   /translation="MADQLGLLLRRLRNQAGLTQEQVAERSGVSVRTIRRLESARNIDH
FT                   RLGTLNLLADALELGSEDRELLATMLARTSTPPTFAVHAASTETRPTASASGPPRAPSR
FT                   QTSVLVPARAVLDAAETLAREAKRRWQREEEQRQVHDPFPLPLCWQPAPAQLVDYAANV
FT                   QRLPPGATPQLDLSGDMGSIAEVYRRIRSGRLVILGRAGSGKSIMLIRLVLDSLAAFTL
FT                   PERVPMIFNLGSWDATAITLRDWLIGQLLRDHPHLARRAPGGPTLAAALVDADLILPIL
FT                   DGFDEIADGLRREALEAFNATSLPLVLTSRRDEYAEAVRGAGAPLNWAAGIELVDLTLD
FT                   DLAAYLPRTARQAGRDDTVAVWDPVLKLLQATTCPASVNLTRVLSTPLMVVLARTMYSE
FT                   TPERDPAELLDITRFPSAKSVEEHLLAGFVPTVYRPSVPDREAGGFRQRTWNPHHAERW
FT                   LGYLAHQLVRHGQDRRDLAWWQIGDSLRRSTRIGTATLVSALCTAVSAWMTGLVAGQVD
FT                   PEQILVEGAMMGLSAGLAFGAVYAAITAFGGTFQPTHVRLRLRRRHSVVARPPIQTFTV
FT                   RFAVVLLGGFVMGVGSACATALVRARYWETPLASLEVIRATLINMLVFGLIFGLAAGLV
FT                   FGLLAALEVPVDVSFVATPVSLLSANRATVSQQILFLAPVLALTIAVGGRLVVDLLEGG
FT                   VLGELRWAWPDAFLIGAAGGLGGALSYMFCFTAWGQWVILTRVWLPLTGRLPWNTMAFL
FT                   EGAYRRGVLRQTGAVYQFRHVRLQQHLSHSYCERRRRSRRTPVHSEG"
FT   gene            195313..195675
FT                   /locus_tag="Sare_0181"
FT   CDS_pept        195313..195675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96116"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ0"
FT                   /protein_id="ABV96116.1"
FT                   /translation="MHTRWMSAIFVNNGLVVSGQLGVWYGRITGNTNGTYQSWAQHRAE
FT                   DSGRAADLHVPGGAYRSRGNGYQALGRGWHNHGNDSECAPYTYTSSATILAGFRARDAA
FT                   VFDEAYGARFEMTDNP"
FT   gene            196483..197361
FT                   /locus_tag="Sare_0182"
FT   CDS_pept        196483..197361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96117"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ1"
FT                   /protein_id="ABV96117.1"
FT                   /translation="MHPGVKGVKTLTDESGKANFSGIYNQETPFAYYANLRRLKYEIPQ
FT                   HGATVFNQLIDAQPWGDGYRPTVLDVCCSYGIVGVLTKTDLELDDVYTYYQGTVDDGRT
FT                   VDQVRRAETEFIGQRARPDAPHVLGLDVAENATQHGVAVGALDGAFVENLEATAPSSEL
FT                   AKKMSEVDLITTTGGIGYVTERTFERLLTCTEAPPWVAAFCLRTYDYSPISDVLAQYGL
FT                   VTEKADQAVRQRQFIDDTEREWALSELAARGVDPSEMEAGGYLYADFYLSRPREDATET
FT                   ALADLVTIPSN"
FT   gene            complement(197656..198504)
FT                   /locus_tag="Sare_0183"
FT   CDS_pept        complement(197656..198504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0183"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   stp:Strop_0170 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96118"
FT                   /db_xref="GOA:A8LXQ2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ2"
FT                   /protein_id="ABV96118.1"
FT                   /translation="MRDGATQVRRGAQWRRHSPPRSTSSSSPGQYSLAKIIGIWAAVTA
FT                   PMALGYWVVTPAIAVGPYDTVVLATVTLTVGLIWQFVLAMFILRREEGSMGPSAMARRL
FT                   WLQVPRDRVTGRPRKRLLWLLAPLGVAFTLNMLYLAPAVQNLQQHLLPGIAPLPFQDGE
FT                   TLFSDEVAPQMVGAWWFLALFMTLSIFNVFLGEEFIFRGILLPRMQGVFGSYDWFANGV
FT                   LFGLYHLHQPWTIGGIMLASGLIMSLPVKRYRSMWLAVVPHAIQTVIVFWMLLGLMRGT
FT                   V"
FT   gene            198926..199840
FT                   /locus_tag="Sare_0184"
FT   CDS_pept        198926..199840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0184"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   stp:Strop_0171 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96119"
FT                   /db_xref="GOA:A8LXQ3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ3"
FT                   /protein_id="ABV96119.1"
FT                   /translation="MGAGHDHGQQAVRAGERHRGRLWAAFGLLALFMLVEAVAAALTGS
FT                   LALLSDAGHMFTDVLGIGMALAAITAASKASRTGQRTFGLYRMEVLAALANAVLLFGVA
FT                   SYVVVEAVRRISQPPEVLAGPMLAVAVAGLLANVVAFLLLRSGSQESLNVRGAYLEVLG
FT                   DLFTSVGVIIAAVVITLTGWWYADPLIAVAVGLFILPRTYHLGRAALRVLVQAAPPHLD
FT                   ISAVRAALRAVDGVADVHDLHVWTLTSGMEVASAHLALERDADFAAVLATSRRLLHDRF
FT                   AVEHATLQAEPADANGVCHESGW"
FT   gene            199834..200115
FT                   /locus_tag="Sare_0185"
FT   CDS_pept        199834..200115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96120"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ4"
FT                   /protein_id="ABV96120.1"
FT                   /translation="MVTCIAPGTSCRDPPTTRRTPSIWELFVNRPCSLTARRAGVGRVV
FT                   AGGLPAPGYPSVGDGAALAAHLVYVGFTTAPVRDVGLRGGMTERRWLR"
FT   gene            200141..202180
FT                   /locus_tag="Sare_0186"
FT   CDS_pept        200141..202180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0186"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   stp:Strop_0172 copper resistance D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96121"
FT                   /db_xref="GOA:A8LXQ5"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ5"
FT                   /protein_id="ABV96121.1"
FT                   /translation="MAAPVGGTVMSMAALTRRPFLLPAGMVLVAAAIGAVLLWWGGGAV
FT                   SQAPPGLPDPGPTTAWLLPTARLGMQVSAVATVGLLLAVVVLSPRDDGRRLSPIGYRRL
FT                   RAAAVAATSWGAASVVALCYTLVDLFGLPAAQVLSLRAVLNFATSVPLGQSLALSGALA
FT                   LAAAVVAATSLRPGGALAALLLALGALVPPVFTGHAAASGNHQLAVSGLLLHVLPVTVW
FT                   AGGLLALAVTSRGTTADLAIAVRRFSPLAVGCLAAVGLSGLLSAAVRLTSTADVLGTRY
FT                   GYVLLIKAAALVAIAAAGLAHRRRALPALAAGRRGPFLRVAAVETLLFAAAIGTSVALS
FT                   RTPAPIGEDTEDAATALLGFPMPPPMSVDTLATAWLPEPLIIAAVLVAAGFYTAGVWRL
FT                   HRRGDSWPVSRTALWLVGCALIIVATSSGLARYGPLLFSIHMIQHLLLMMLAPIMLALG
FT                   GPITLALRALAPSTDPRWPGPREWLQTALHSRVSRALTNPVVALVIYVASLYLMYFTGL
FT                   YELALRSHAAHLAMVGHFLGAGYLFFWVVIGVDPAPRRIPHPLKLILVLISMVLHAFLG
FT                   VTLMQSTTLIAENWWIALERPWGPTPLADQRTAGGIAWSFGELPTVVVLGALMRQWMKA
FT                   DEREARRRDRAADRAEAEGREDAELAAYNRMLADLAERDRQVRR"
FT   gene            202284..202946
FT                   /locus_tag="Sare_0187"
FT   CDS_pept        202284..202946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0187"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: stp:Strop_0173 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96122"
FT                   /db_xref="GOA:A8LXQ6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ6"
FT                   /protein_id="ABV96122.1"
FT                   /translation="MTRNTRLTLAAVVALILVVVVVLAVNRRDAIPTAETAGGTVDPAV
FT                   LVRDESHRLATATDGKVTLVEFLDFECEACAAAYPAVKEILTAYEGQITFVVRYFPIPS
FT                   HPNAELAAHTAQAAANQGHFRGMYQMLFENQSVWGHKEEPQTEVFLDYARALGLDMDRF
FT                   QRDLDDPATVARVARDRADGEAVGVQGTPTFFLNGSPLTDLRSKDDLTAMIDAALAG"
FT   gene            202943..203578
FT                   /locus_tag="Sare_0188"
FT   CDS_pept        202943..203578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0188"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG:
FT                   stp:Strop_0174 vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96123"
FT                   /db_xref="GOA:A8LXQ7"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ7"
FT                   /protein_id="ABV96123.1"
FT                   /translation="MTSATAVRPATAPADGRFLNTVTAWVLTVGGAVGLLAATILTVEK
FT                   INLLADPGYVPTCSINPILSCGSVMSTAQAEVFGIPNPLLGIAGFAAVTTMGAALLAGA
FT                   QFPRWWWLALQGGVILGVAFVHWLIYQSLYRIGALCPYCMVVWAVTMPIFLYTTLRTLR
FT                   DSATTLPRTVRAGAERVARYHSLVLVVWYAVIVAAILHRFWDYWSTLA"
FT   gene            203615..203797
FT                   /locus_tag="Sare_0189"
FT   CDS_pept        203615..203797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96124"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ8"
FT                   /protein_id="ABV96124.1"
FT                   /translation="MRRLGYGRNLRAVRPIVRRVGRYRNAGLISLLVNEISPARSSYAT
FT                   DACGWAAEGNDPPGA"
FT   gene            complement(203807..205222)
FT                   /locus_tag="Sare_0190"
FT   CDS_pept        complement(203807..205222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0190"
FT                   /product="nitrate/nitrite transporter-like protein"
FT                   /note="KEGG: stp:Strop_0175 nitrate/nitrite
FT                   transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96125"
FT                   /db_xref="GOA:A8LXQ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXQ9"
FT                   /protein_id="ABV96125.1"
FT                   /translation="MNTTSSARKAGRAGNGEWLESWNPEDDATWDKGLAWRTLWISTFT
FT                   LTLCFTSWFLASAIAPKLTNLGFDLTTSQLYWLTAMPGLAGGLMRLIWMVLPPIMGTRK
FT                   MVTLTTVLLLLPVVGWGIFVQDPSTPFWVLLSLSFLSGIGGGAFSGFMPSTSYFFPRRR
FT                   QGTALGIQAGIGNFGVSLVQLLTPWVIGFSMIGFLGSSRPMATAPGEPARDVWYQNAAY
FT                   IYIPFIIVGAVLAWTMLRSVPVKANVRQQFDIFRNVDTWWMTLLYIMTFGTFAGLSAQF
FT                   GLLMKNLYGAGNPDIVQGTGATAQLLVDGYSVPDPIKFVFLGPLVGAAARVAFSPLTDK
FT                   FGGARWTLISGVGLVASIGFTITALRPDTSSAATLDAGFDRFLWGMLAIFLFSGIGNAS
FT                   TFKQMPMIFERRQAGGVIGWTAAIAAFGPFFFGVGLTIMSPTAFYLIGLAFAVLCVMIT
FT                   WLRYARPGAPKPS"
FT   gene            complement(205219..206637)
FT                   /locus_tag="Sare_0191"
FT   CDS_pept        complement(205219..206637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0191"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0176 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96126"
FT                   /db_xref="GOA:A8LXR0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR0"
FT                   /protein_id="ABV96126.1"
FT                   /translation="MPVKPTPDDPTPDETAAGQNSRDDRGRNRVLTLSTIGFTVMFAVW
FT                   LMFGILGKPISDEFNLSEVQLSWIIAAAVLNGSLWRLPAGIVADRIGGRRVMTAMLLLT
FT                   ALASFLVSRANSYPMLLALAFLVGFAGNSFTAGIAWNSAWQPREKQGFALGLFGAGNVG
FT                   ASVTKFIGPPLIAGTAGATYLGVIEGGWRLVPVVYAVLLLVLAAATWFLTPRRDRVPSH
FT                   GTPLREQLEPLKQIRVWRFSLYYVAVFGAYVALAAWLPTYYMNNYDVSLQTAAYLTALY
FT                   IFPASLLRPVGGSLSDRLGARRVMYWTFGLMLLSTGILMMPPGHIVVDHPDGTQTSHLA
FT                   YQLGIVPFTVLVVLLGCAMGVGKAAVYKHIPEYFPRQVGAVGGLVGMLGGLGGFFLPPM
FT                   FAYTKAWTGLPSSTFLVLFILTAICAVWMHLTVVRMLHGESPQLADHFEKPEPVDQPTA
FT                   PATAATRVPEEARE"
FT   gene            206966..210664
FT                   /locus_tag="Sare_0192"
FT   CDS_pept        206966..210664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0192"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: stp:Strop_0177 nitrate reductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96127"
FT                   /db_xref="GOA:A8LXR1"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR1"
FT                   /protein_id="ABV96127.1"
FT                   /translation="MSAHRPPEVHDPATDQVPGAAPLLAARRFLRRETVGDHGRTLHQV
FT                   KDGDWDQFYRDRWRYDRVVRSTHGVNCTGSCSWNVFVKDGLITWEHQATDYPTTGPDSP
FT                   EYEPRGCPRGASFSWYEYSPSRVRHPYVRGVLAEMFRDGLQRLGDPVAAWADIVENPLK
FT                   ARAYKSQRGRGGFVRASWDEVTTMVAAAHVYTTKTYGPDRVVGFSPIPAMSMASFAAGT
FT                   RYHALLGGTLLSFYDWYADLPIASPQIWGDQTDVPEAGDWWNATYLMMWGSNIPVTRTP
FT                   DAHFLTEARYRGTKVVAVSPDYADNVKFADDWLAPHPGTDGALAMAMGHVVLTEFFRDR
FT                   TVPYFTDYVRRYTDLPFLVTLRQTTSGRWATDRFLTASDLGEEDGAHKTVLVDERTGEP
FT                   VVPNGSLGFRYGEAGEGRWNLDLGDVLPALGLLDLSDEAVEIDLARFDVGDTEGGATIR
FT                   RGVPVIRVGEHLVTSVFDLVMAQYGVRRGDLPGEWPTGYDDPESPNTPAWQERITGVPA
FT                   PLAARIGREFARNAERSKGRSLIVLGAGANQWFHSDMTYRAFISLVTLTGCQGVNGGGW
FT                   AHYVGQEKARPITGQQHMSFALDWQRPMRHQASTPFWYLHTDQWRYERVPADELSSPLG
FT                   TGRFSGMAFADTVAAAQRMGWSPGHPAFNRNPLDLTDEAAVAGVSVQEHIVAELKAGRL
FT                   RPMAEDPDDPANFPRCLTLWRANLLGSSGKGNEYFLRHLLGIDSAATAQECDPQHRPRD
FT                   LVWRDEAPTGKLDLLTAIDFRMTNTGLHADVVLPTATWYEKHDISTTDMHPFVHAFSPA
FT                   VEPPGDAHSDYDTFLALADRVSELAASHLGVRRDVLAAPLQHDTPDELAMPSGRVRDWK
FT                   AGECEPVPGSTMPKLIEIERDYTQIGAKMRAVGLLLDKLGTNTKALTVDVTAELDYLRH
FT                   QNGVVTDGPFAGRPSLATADRMCEAILALSGTTNGRVAAAGFEALEKRTGQPFADLIAG
FT                   HESDRITYPDTQRAPQPVFTSPEWSGSEKGGRRYSPFTLNVERLKPWHTITGRQHFFVE
FT                   HDWVAELGEQLPAFRPPLNMARHFGAPGELVDGGVTVRFLTPHAKWSIHSMYHDNELML
FT                   ALSRGGPVIWISVPDAAKVGIRDNDWIEAHNRNGVIVARAVVSHRMPEGTVFQYHSPER
FT                   TVNVPKAEKSGRRGGYHNSLTRLLVKPTHLAGGHAQLTYAFNYYGPIGSQRDEITVIRR
FT                   RDQEVEY"
FT   gene            210664..212283
FT                   /locus_tag="Sare_0193"
FT   CDS_pept        210664..212283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0193"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   stp:Strop_0178 nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96128"
FT                   /db_xref="GOA:A8LXR2"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR2"
FT                   /protein_id="ABV96128.1"
FT                   /translation="MRIRAQVAMVMNLDKCIGCHTCSVTCKQTWTNRDGTEYVWFNNVE
FT                   TKPGIGYPKHYEDQDRWHGGWQLDDKGRLKLRSGGRLKRLSRLFVNPDLPTIDDYYEPA
FT                   TFDKDILVNAPAGLKDTPVKQPRSALTGEPMAVTWGANWEDSLGGAHEHAAGDPNIARM
FT                   PAEAAAQVKFEFEKTFLFHLPRICEHCLNPACVSACPSGAMYKREEDGIVLVDQDRCRG
FT                   WRMCVSACPYKKVYVNHTTGKAEKCTLCFPRIEAGQPTICSETCVGRLRYLGIVFYDED
FT                   AVLAAASVADEHDLLEAQRAVFLDPTDPAVREAARAAGMPQDWLDAAERSPVWRLISEY
FT                   KVALPLHPEYRTLPMVWYIPPLSPVLDAVGGAGRDDADADDVFHTIRELRIPVEYLAEL
FT                   FTAGDVEAVAGVLMKLAAMRSYMRARTLDGTVAEDLLDGIGMTGDQVEAMYRLLAIAKY
FT                   DERYVIPVAHTKDAAALEAQATANPDCALDCEGGPGMTTQATAESFHLVEGEQVRPGRP
FT                   GLLSRRADGRRGLTINPLRGRA"
FT   gene            212280..212951
FT                   /locus_tag="Sare_0194"
FT   CDS_pept        212280..212951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0194"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   KEGG: stp:Strop_0179 nitrate reductase molybdenum cofactor
FT                   assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96129"
FT                   /db_xref="GOA:A8LXR3"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR3"
FT                   /protein_id="ABV96129.1"
FT                   /translation="MTTPTDRSRIFDLVSLLLTYPDDELLGAGAELRGAAERIEAREVR
FT                   GWINGFLDWLLASALIDAQRHFVQTFDLRRRSGLYLTYYLHGDTRKRGMALLVLKQRYR
FT                   AHGLRLADGELPDLLPVVLEFAATVGPGEGEAPLRQHRQGIELLRAALTESGTPYRLLL
FT                   DAVCAVLPELTDADRAAITALAADGPPVETVGLDSIGDGPDLHAAALAPYPACSPSEAS
FT                   R"
FT   gene            212948..213691
FT                   /locus_tag="Sare_0195"
FT   CDS_pept        212948..213691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0195"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="KEGG: stp:Strop_0180 respiratory nitrate reductase,
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit; PFAM: Nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96130"
FT                   /db_xref="GOA:A8LXR4"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR4"
FT                   /protein_id="ABV96130.1"
FT                   /translation="MTTLVWIVLPYLCLAVFVAGHVWRWRHDQFGWTTHTSQVLENRIL
FT                   RLGSPLFHLGALGVVGGHAMGLLVPASVTEWLGLSEHAYHLIAVWGGTVTGLMLMVGLV
FT                   LLIIRRMVNGRIRAVTTRMDKVLYAALAVMVTLGMIATVGVNLVGGGYDYRETIAVWFR
FT                   GIFWFQPDSGLMTGAPLVYQLHAIGGFLFLALWPFTRLVHVWSVPLAYLWRPYVVYRAR
FT                   RRPAPAPSPSPDQVRDAAREPAARR"
FT   gene            213798..214127
FT                   /locus_tag="Sare_0196"
FT   CDS_pept        213798..214127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0196"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   stp:Strop_0181 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96131"
FT                   /db_xref="GOA:A8LXR5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR5"
FT                   /protein_id="ABV96131.1"
FT                   /translation="MQHKYLPEVHVRFLERFPDVAEAHGELARIVRERNSFDDRTDRLI
FT                   KLAVAVGSEAEGAVRSNVRKALQHGATVEDVQAVALAAITTCGFPTAIAALGWIDSVVL
FT                   APSDA"
FT   gene            complement(214172..215008)
FT                   /locus_tag="Sare_0197"
FT   CDS_pept        complement(214172..215008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0197"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: stp:Strop_0182 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96132"
FT                   /db_xref="GOA:A8LXR6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR6"
FT                   /protein_id="ABV96132.1"
FT                   /translation="MARLPHGKPVVDPTTVGAHTHDFLVLFYAHLAHGRVLIDGRRWTV
FT                   TDGDLFVIAPGQVVSFDDRFEEATTDGWTVWFPTDVVRPGMPGAYSSWRAHPLLSPFAR
FT                   GINRAQRLPVPPTDRAGLVERFAALDAELRARREGHQEAVLAHLTLLLVATARLSTDVA
FT                   DHLRSADEPLLAAVFEAIEARYHEPISLADVAADLALTAGHLTTVVRRKTGRTVQQWIT
FT                   QRRMQQARLLLTETDLTVTAISRRVGYPDTSYFIKRFRSGHGVTPTQWRDAVPPMR"
FT   gene            215198..215851
FT                   /locus_tag="Sare_0198"
FT   CDS_pept        215198..215851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0198"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: stp:Strop_0183
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96133"
FT                   /db_xref="GOA:A8LXR7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR7"
FT                   /protein_id="ABV96133.1"
FT                   /translation="MTGQHNTSHEHRAYLPAMGKQWLLPLYDPFARFVGIKRVHEKLLD
FT                   RANIRPGQRVLEIGCGTGDLLQTLKRRYPDVSALGIDPDPSALRRARRKAARAKLRIQY
FT                   ERAFADDLPLPDGSFDRVLSSFMLHHIDEEEWTRVLREVKRVLRPGGELHVADLDGTLP
FT                   GQEGGHAHHSGQTADSLPERALSALVDAGLTGVRENGYGRARLGRYVFYRADVG"
FT   gene            complement(215922..216563)
FT                   /locus_tag="Sare_0199"
FT   CDS_pept        complement(215922..216563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96134"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR8"
FT                   /protein_id="ABV96134.1"
FT                   /translation="MDSEPVDPMDADPGPADPGPVAESTDRVAGLLLAAGSGRRYGGPK
FT                   ALVSFQGRPLVLRSRDVLVAAGCAPVLVVVGAQAEAVTALVGSGAIRNPAWPTGMGSSL
FT                   RAGLAALEVTAVTAVVVVLVDMPGVGVEAVRRLAAVARPDVLAVAGYHGNRWGHPVLLG
FT                   REHWTGAAASARLDRGARDYLRQHRGLVRVVPCADVADATDLDVPPMIRR"
FT   gene            complement(216602..217711)
FT                   /locus_tag="Sare_0200"
FT   CDS_pept        complement(216602..217711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0200"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   sco:SCO6174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96135"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXR9"
FT                   /protein_id="ABV96135.1"
FT                   /translation="MTAEIRYVAPALRQWCSAGVPFAVATVVGVSGSTPCPVGTVMAVC
FT                   ATGEVAGGVAGGCVDGAVFTVAQEAIRSGRAHRSRYAHQSDAAPIVGLACRSEIDVVVL
FT                   PAAVDVLTPLLDRLLANQTVGSALVLPADRPAALLVADPNRLWGSSGDAEVDEMVACRL
FT                   RAPASHGGRQIERLVGARGRPVDVLLVGHQPAPRMLLYGMSPVARAMSQLGRFLGFDVT
FT                   VCDPRPTFMRAGHFPDAHQVVCDWPHRHLSSIDVDARTVIVVLSHDDRHETELLSLALR
FT                   GRAGYVGVMGSRVTQRERLLRLTAAGLTADDLCRLRAPIGLDLGAQTPQETAVSICAEL
FT                   VAVSGAGGTGRPLTYLDGPIHRHTGAPVG"
FT   gene            complement(217771..220080)
FT                   /locus_tag="Sare_0201"
FT   CDS_pept        complement(217771..220080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0201"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: rpd:RPD_0914 aldehyde oxidase
FT                   and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96136"
FT                   /db_xref="GOA:A8LXS0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS0"
FT                   /protein_id="ABV96136.1"
FT                   /translation="MSAMAWIGSDHVRHDGTEKVRGEPIYGADRTAEAMTYAVPVSATV
FT                   GRGRITALDTTAAQRVPGVLAVLTHENLDRLHPADFAYGVGSASASYQPMQDAVVAYRG
FT                   QPIALVVAETLEAAAEAAGLVTAGYEVEPFAVTLDDPAAESVDQAQAVPTFPVLEIGEG
FT                   DRLLDQAPVVVDATYGTPAQHHNGLELLSTVAEWKDGSLLIHEGTQAAGRVRHALANQL
FT                   GIPMEMVRAVAPYLGGGFGQRTGQTFNTVLAALAARRIGRPVKLIVPRADVFHMVHFRP
FT                   ASRHRIRLGARDDGTITSLVHDAHAQTSRHDLMPFWGPEVSSRMYGIPNFRGTTTLVRL
FT                   DTQTPGYMRAPMEMVTMFAVESALDELAERLHVDPVELRRRHDTATDPLTGRPFSSRRL
FT                   KQCLDRGAERFGWSRRDPAAGSMRADDGSLVGWGMAAGCYPGIASAAGSRIRLHENGTA
FT                   DVAVSGHEMGQGIRTVIALVAAESLGLPPDRIRITIGDTRVAPQPETGGSWGTATAVPA
FT                   VRDAANDIRAQLHQIAAARGESVATVDVTECRLADGRLVGPDNSGPLMTGLLMAAGRSS
FT                   VEATGQYYAPGQQPSEAPTLAPARKSAVMADVGSAFVGPAFPGFVTWSYIAHFVEVRVG
FT                   ARVRRPRVTRMLSVIDCGRVISRRTATSQALGGLVWGISTALSEESIVDPRYGGFLNSN
FT                   LGDYKMPVNADIPTLDVDFIDEPDPSFSAFGIKGLGEVVHVGAAAAITNAIYHATGVRV
FT                   RDLPVHIEDLMTETSR"
FT   gene            complement(220077..221075)
FT                   /locus_tag="Sare_0202"
FT   CDS_pept        complement(220077..221075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0202"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   sus:Acid_3649 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96137"
FT                   /db_xref="GOA:A8LXS1"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS1"
FT                   /protein_id="ABV96137.1"
FT                   /translation="MRTFTYTRVRSVPEAVTAFATSTDDRPHYLSGGTTLVDLMKLDIE
FT                   APGQVIDLTDVTDLDFVREEDGDLVIGALTRMSDVANHPLVGARCPALADSLLSGASQQ
FT                   LRNMARVGGNLLQRTRCDYFRSVEFPCNKRRPGSGCAAIGGVNRQHAILGTSEHCIAVY
FT                   PGDWAVALTAFDANLAVVGPSGTRSIPIHDLIVPPGDTPHRETTLTPGEFITTIRVPMT
FT                   PTARSSSYRKVGDRSSYSFALASAAVGLHLDAGGTVDEVRIALGGLGTVPWRLWDAERA
FT                   LTGGRLDDATVRAALEPEFRSACTTRQNAFRVRLGVETVLEAVASAQERVG"
FT   gene            complement(221075..221569)
FT                   /locus_tag="Sare_0203"
FT   CDS_pept        complement(221075..221569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0203"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rpd:RPD_0916 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96138"
FT                   /db_xref="GOA:A8LXS2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS2"
FT                   /protein_id="ABV96138.1"
FT                   /translation="MVDESMTVRTRLIVNGQNREWILDARTTLLDALRDHLGLYGTKKG
FT                   CDHGQCGACTVHLDSRPVVSCLTLAAQVAGSAVLTVEGLTESSDDLHPMQRAFLACDAL
FT                   QCGYCTPGQLMSAVACVAEGHAGTTDDIREFMSGNLCRCGAYQGIVQAVAMVHAAGHGR
FT                   S"
FT   gene            222623..224141
FT                   /locus_tag="Sare_R0005"
FT   rRNA            222623..224141
FT                   /locus_tag="Sare_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            224556..227674
FT                   /locus_tag="Sare_R0006"
FT   rRNA            224556..227674
FT                   /locus_tag="Sare_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            227760..227881
FT                   /locus_tag="Sare_R0007"
FT   rRNA            227760..227881
FT                   /locus_tag="Sare_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(228287..230101)
FT                   /locus_tag="Sare_0204"
FT   CDS_pept        complement(228287..230101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0204"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: stp:Strop_0186 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96139"
FT                   /db_xref="GOA:A8LXS3"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS3"
FT                   /protein_id="ABV96139.1"
FT                   /translation="MTVTLYGDNDPPADDRPTVQVTAVQWPVEELEPASLQRDGKRPRR
FT                   TRILIAAGIATAVLASVAGVGAFAYVGDVPRGTTVLGTELGGRSQADATRELRTALERQ
FT                   ASELNAPLPVRVGERTAELVPAEVGLQVDVDATVTAAMQTQAHVVDRLVGSRTVRPVVT
FT                   VDEERLDAALKEVLGDQGRKMTMPGITWDGLTPKAIHPQPSLGLDPKASTQAVREGWLS
FT                   NGPVTIPLAETHAVTTAEEVDRMVAELAKPAVAAPVTLTTDKGSLSIPPKAIAKSLRFT
FT                   ADKAGTLAAEVDVKQLRTALGGDLAKVEVTPKNARMTLSGGKPKIIASSDGKELDTATL
FT                   GEELLAVLPQPDNRRVTGTLKPTKPELTTEKLAGLGIKEKVSTFTTRFSGGLSSPRSQN
FT                   IITAAKAVDHTLVLPGETFSLNKHTGERNYAKGYQDAPVILNGKLVPGVGGGVSQFTTT
FT                   LFNATYYAGLEDVEHKPHSYYFSRYPSVIESTIFYPNLDFKFRNNTKYGVLIDTSYTSS
FT                   TITVSIWSTKIWDRVKTEYSPRRNITKPKTVYLEPGPTCIAARGSDGFSQDAYRVFHKD
FT                   GKVVKREKFSWRYAAEPRFICGPEPESS"
FT   gene            230255..231172
FT                   /locus_tag="Sare_0205"
FT   CDS_pept        230255..231172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0205"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: stp:Strop_0187
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96140"
FT                   /db_xref="GOA:A8LXS4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS4"
FT                   /protein_id="ABV96140.1"
FT                   /translation="MREDKAALAYGGGWVDRAGALRADPDRLAALLIAPDTRFLPLWRD
FT                   RCLVNGSGPVQLNGEVAERARATAEETVFLGYAAGRAVFAVDLSGLTQEVALATVGATG
FT                   VVDVRGLVGQLGPAEAALQAYARGLLHWHRQQQYCGTCGESTRAREAGHARRCSGPNCD
FT                   RLYFPRIEPAIIVLVEAPGDSGRCLLARHAGTAEGAYSTLAGFVEVGETLEDAVRREVA
FT                   EEAGVVVTDVAYQGSQAWPFPAGLMVGFRATAATDEIRVDGVELLEARWFTRAELRERS
FT                   AAGHPLGRLDSIGRHLLTGWLASG"
FT   gene            complement(231180..232451)
FT                   /locus_tag="Sare_0206"
FT   CDS_pept        complement(231180..232451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96141"
FT                   /db_xref="GOA:A8LXS5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS5"
FT                   /protein_id="ABV96141.1"
FT                   /translation="MSRRTDDGDGSRTRAAGTGARALGTAGLAVTAAGLLANGLAYLAP
FT                   VLAARQLGSADLSALATTLGLIAIASVPGFGLQLAVAVHHAKHGHTDTHRATLLTAALC
FT                   GSALIVATPLLIATLRLPAEALLLSAVTTAAIVVSCRTLGELQGGQRFVRLAIAMGLLA
FT                   AGRYGGVLVGLLLGAGLTGSLLLGAVTAALTPIGLAALTRTADPATTSAAPPLEAGRIV
FT                   TGCAAMLAMLVVSYVDLFLARQLLSADDSGAYAVGTVLTKGALWAPQVATVLALPRLAQ
FT                   EDRFSRTVALAVTVGCGALLILGSTLAGDLAFRLAGGPHYTHLGTFAPLFAAVGALYAV
FT                   VFVLLNGAVATGVRWPAAPLWIGSVLLAAVTLSITPRTIAGLLWPTLGAAMVTTLAMAV
FT                   RTWASTPARSGRSDPAPRTAPDRG"
FT   gene            complement(232448..236755)
FT                   /locus_tag="Sare_0207"
FT   CDS_pept        complement(232448..236755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0207"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: stp:Strop_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96142"
FT                   /db_xref="GOA:A8LXS6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS6"
FT                   /protein_id="ABV96142.1"
FT                   /translation="MRAEVTSGSGRRPNRTRRLDRSFRHLAVCVVLTALAFQQAPGLVV
FT                   PDTKVDLTVDPAGWLLRSLHLWDPAGTFGQLQNQAYGYLWPMGPFFLLGSELGLAPWVV
FT                   QRLWWALLFCVAYLGVVRLAGRLGIGSPAARMIAGIAFALSPRILTQLGWSSVESWPSA
FT                   VAPWVLIPLVGLARGAPLRRAIAGSALAVACAGGVNATAVLAVVPLAVLWLATLTPVRR
FT                   RIAALAAWCGAVALATAWWLIPLLILGQYSPPFLDYIETARTTTSVTDAVTTLRGASYW
FT                   VAYLASPVEQAIPGGARLANELPLVLATLTVAALGVLGLSRRGMPHRRFLVTGLVLGAA
FT                   LVGLGHVSDLPNLLTGPQQQFLDGIGAPLRNTHKFDVLLRLPLALGVAHLVGVVVRAAR
FT                   TAPTGRRTHPVARAWLTAGVTMVSVATVASPAVAGGLATPASAGEVPGYWRDAADWLDT
FT                   NTGHGRVLVVPGARRPSYDWGSTTDEITQPLLDSRWAVRNAIPFTPPTTIRLLDAIEST
FT                   LATGAGSAGLADLLARSGVSHVLFRADLDHGRSDTARPAVVRQALQRSPGLSRVATFGP
FT                   IRGGPSEPDEIRDEGLDVPGRALEVYRVNRRVEPVVAYDREAVATVVGGPESLLDLAAA
FT                   GLLSPAPTVLAGDAATIGANGPVTMTDGLRRREVSFGRSRDNASHTLTPDETFELPAPA
FT                   HDYLPDWAPAWSTVAHLEGISTIQASTARSQVNTPGGTRPEHQPYAAMDGDPTTSWQSA
FT                   PYSRGNRQWIEIGLDKPTEITRVELSFDLTADSVPTTVTVTAGYERRTVEGFGDRMAFD
FT                   LDGIHATRRIRISIDDTFTLRPLGSGVVGISEISIPGVEASRTLRLPAAPATERPPAVV
FT                   VSAAPSTPACFVVNGKPHCSTDAVRGSEDGRTIDRTLTLPTAGTYDTQLWARPTAGPAL
FT                   NAALDEAVAAAQGLGLAPEVSASSTGVPHPARRPGAVLDGDPATSWSPSIRDDAPILRL
FT                   TWLKPQVINGLHFAVDPAVAATRLGSVRVIADDGFRSSLLGEDGLLTLDPPARTDELTI
FT                   QFLDRPSATSTDPYGYRLPEPLPIAVGEITVLPGAPSARPDPTTPVTLGCGSGPTMAIG
FT                   DDTVTTALRGTMRDLLELREVPAEPCGPATGTHLGADEHRLVATAGQLATPTRVALVPR
FT                   QTTPAAATPPSALDISTWGATERRVRVDERAAERILAVRENTNRGWQATLGGEPLRSVV
FT                   VDGWQQGWLLPAGAAGEIVLRFAPDGPYRIGIFTGGALFLGVAVLALLPERRGGTPARP
FT                   VRRRAARSLTLLAVGAAALVLLGGLVGGLIVTAGVLLALPGSVRTPRTANPRWVRHAAR
FT                   FADSGLPATLVLLAGWAYLDATQRHTAALPQLLVVLALGCLWLSTCIRFRLIHRTAGHP
FT                   ATATAPPAGMPERSHRSVAEATCGRDSGPSGIT"
FT   gene            236939..238798
FT                   /locus_tag="Sare_0208"
FT   CDS_pept        236939..238798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96143"
FT                   /db_xref="GOA:A8LXS7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS7"
FT                   /protein_id="ABV96143.1"
FT                   /translation="MATSGRTASTADQPVVFARRFRVDRVAAVAAALIVVSVAWRAGLA
FT                   ARGWFSQDEFVIAAQALDARLDADFLLRTFNNHLMPGGLLAAWLMVRSAGFVTWPWVLM
FT                   LAVAQAAVGIAGYRLLRDLLRPGWGLLVPLCLLLFSPLTLEASSLWLVGLLVLPVQLAL
FT                   VLAVRAHVWYVRTRRRRHLATVALWLVFGLLFDPKALLIAPLLFLLTVFLFTRGAPWRS
FT                   LVTAVVRYWLAWLVLVLLSGAYLAFYLTRPARALDRPTSVGQVLTFLGDLLGKTVVPGL
FT                   FGGPWRWTYAGDGPPLVDPYAVPMWLSWVVLATLVVVTVRRRPSAARAWLLLACYLGLV
FT                   AVLFAVTRVGGVLGPMVGTVPRFVADVVPVAAICVGVALFGIRDADEKVGSAWPVPVIP
FT                   RVVGPVAVGRVATIAVLVAAGVGTVWSTVRFGDNWGTKHGREYLATTQAELAAAPPDAV
FT                   FLDTIVPDRVVAGYFWPDNLQSHFFRPAPRRPVFVEAAERPLTFDEYGRIRAVTVEGTN
FT                   ILPGQVPDCGHLVESGRTARIPLETRLEEWPYVVEFGYVSSGDATATMRLGEATREITV
FT                   SSGLNQLYFPLSGAGDVIEVTLSTPDVAVCTRLITVGRVVPAS"
FT   gene            238799..240505
FT                   /locus_tag="Sare_0209"
FT   CDS_pept        238799..240505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96144"
FT                   /db_xref="GOA:A8LXS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS8"
FT                   /protein_id="ABV96144.1"
FT                   /translation="MGEGSADRGRAVRDRLLLYAVAGAVTAVVLAPLAAPGYVLRYDMV
FT                   FVPRQPLTWDLVAPAQSLPRAVPMDAVVSLVTQLVPGWAVQRIVLAGTVLLAAVGAARL
FT                   VPTQRRGVRLLGAVGYAWTPYLAERLLIGQWGLLVAYAALPWLVRAVLDLRAGRAGALA
FT                   RVVLTAAPAAITPTGGLIAFGVVALLSPQRERWWRSTVAVVGVAVLNSPWVTAALVTRA
FT                   GGTSDPAGVAAFAARGENWAGPLAALAGTGGIWSAQATPASRALPLVPLVTLVLLVLAA
FT                   AGVGLLRRRLPPGISARLVVLAGAGFLLAALGAAPGTAEVLRWAVAHLPGAGLLRDGQK
FT                   FLAPYALLLMVCAALGVERLVTRVERVSREVAGVVLVGVLLLPVAVMPDLAFGGAGRLR
FT                   PVSYPADWREVAGRLADDPGGEVLALPLSGYRAYPWNPGRIVLDPAPRYLPAAVLTDDT
FT                   LRVGDVAVLGENPRLREIRGLLEDGRPVAVTGVRWVVVQHHRANRVDPATLAGFEVVYQ
FT                   GMFLTLYRNPSVPPRSVAVSPGQWAVVAALGLAGVVVVAALVALRRRPTAW"
FT   gene            240541..240738
FT                   /locus_tag="Sare_0210"
FT   CDS_pept        240541..240738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96145"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXS9"
FT                   /protein_id="ABV96145.1"
FT                   /translation="MRRALILVVSGLVAAVLGILSVGGLAAATTATETEAVTEAENLQR
FT                   EAERADEPDPYQPEVYGGRG"
FT   gene            complement(240735..241916)
FT                   /locus_tag="Sare_0211"
FT   CDS_pept        complement(240735..241916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0211"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   stp:Strop_0193 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96146"
FT                   /db_xref="GOA:A8LXT0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT0"
FT                   /protein_id="ABV96146.1"
FT                   /translation="MERFAATPGHVLFLNWRDTRNPEGGGSEVYVERIAAELIVRGFRV
FT                   TLFCAAHRQAPTDEIDDAGIRLVRRGGRHTVYLWAALCYLAGALGLGPLSRRHGGRPDI
FT                   LVDVCNGLPFLAPLWARRPVVKLTHHIHREQWPVVLPPWAARFGWWVESSFAVRVYRRC
FT                   RHVTVSDATRQELTNLGVPADQVSVVHNGTPTLPATDAERAPFPLLVTLNRLVPHKRVE
FT                   VALRAVAALADELPQLRLVVAGQGWWKGQLQQIANELDITDRVEFRGFVTEEEKAALLA
FT                   SAWVALTPSLKEGWGLTIVEAGSAGTPTVAYRAAGGVGEAVVDGRTGLLADDIDDYVAK
FT                   VRILLQDASMRQEMGAAARQHAATFTWQAAGSRFASLLRNAESPHPTRRGAPS"
FT   gene            complement(242005..243216)
FT                   /locus_tag="Sare_0212"
FT   CDS_pept        complement(242005..243216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0212"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: stp:Strop_0194
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96147"
FT                   /db_xref="GOA:A8LXT1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT1"
FT                   /protein_id="ABV96147.1"
FT                   /translation="MSATVAPSTPRPSATSRLPALDALRAIGAVAVVAHHVGFHTGVSL
FT                   NSQWGGWLARMDVGVAVFFVLSGFLLFRPWALNAATGLPRPPVGRYFWRRALRILPAYW
FT                   LTVLVCLIVLPQNRPAVAGDWLHHLTFTQIYLPDQLRPGLGQTWSLATEVAFYLILPLV
FT                   AVGAVGRTWRPVRTVAIVSGGVLVTAGWLTLMGLGWIDTALYTMWLPSYAAWFCAGMVL
FT                   AVAHVALRTGTAPGALRVLDDLATAPVSCWAAAVGLLAIATTPIAGPRDLAEPTAAEFA
FT                   VKLTLYLAVGVLIMIPVAFGDRTTRVHELFGSPPARWLGTVSYGLFLWHPLVIEVIYLL
FT                   DDRPPFTGDLLGTFALTMAGGLALAALSYYGVERPIQTRGTRHRPHPVETQPDKTLPAV
FT                   NSPH"
FT   gene            243331..244377
FT                   /locus_tag="Sare_0213"
FT   CDS_pept        243331..244377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96148"
FT                   /db_xref="GOA:A8LXT2"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT2"
FT                   /protein_id="ABV96148.1"
FT                   /translation="MKLRVGAALFGLGVLFLVFAVGLPFYVAPAITKLPYDLKPTVLVA
FT                   EATDAEFLQITAVDESNVEIEVPRATLRSTVEVIPNPGDTRDKLPERLEGDAVIWDVYQ
FT                   TVRRDDTQRPITQYSTQLALYRISAAAAPWEEQWLQQDDSDEIPVGNVSYSGQIYKFPF
FT                   SSEKKDYQVFDRDLKEALPATFVGTETVKGIEVYRYEQRIENRALDTPEDSIQVLLGTF
FT                   APEATTGQIYYSNTRTIWVDPVTGAYVNVREQQRKELRPEVGPVTVLLDADFNYTDETV
FT                   TSSVDTVKSNRLKIGLASLWGPIAAAILGLIALVVGLRLVIQGNGATGRHSAPSAAAAD
FT                   PASTKADE"
FT   gene            244657..245268
FT                   /locus_tag="Sare_0214"
FT   CDS_pept        244657..245268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0214"
FT                   /product="cholesterol esterase"
FT                   /note="KEGG: sco:SCO5420 cholesterol esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96149"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT3"
FT                   /protein_id="ABV96149.1"
FT                   /translation="MQDRIDNPGRTRWRRFAALMVPATAVAGAIVFGMANGAIAASFAV
FT                   SGQTFKVSATELHGTGFVQYGGLAKEQDGTIHPVAVSGIRQAKLYDLCQSVKVPGAPVV
FT                   LTINAGGGSRPATATDLLIDMDVLEGDAEFRNINIGQDASTLTGGPAGAVGEKGSFGQQ
FT                   SDTVVIKDVRQVARSTHAGTFKLTGLRLAVNVGADAKECF"
FT   gene            245345..246730
FT                   /locus_tag="Sare_0215"
FT   CDS_pept        245345..246730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96150"
FT                   /db_xref="GOA:A8LXT4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT4"
FT                   /protein_id="ABV96150.1"
FT                   /translation="MSTAAPQPARTSRLRPPWRAFRRLRPSWRAVRRSRPSWRAFRQWR
FT                   RARPFWGGLLTLLAGLEIFGTTQMSLGGLTVQMGPTGFLSWLIPTILVTCGLLIWFSAR
FT                   QRIFYAVVAAVTAIFALIGVNLGGFFVGMLLGIVGSALAFAWTRDPRPPDQRGSEPADG
FT                   SPDQHGAAGSPDPRVLPVLLGLAGLTAVTALASPAPAQGSWANGLSTSALPAGCPTPAP
FT                   SSAEPGRPLPSPTDSPRPTPTGTLGQTPTGTLGQTPTGARDPSPTGPPSSRPSPTAPPS
FT                   DPPATPSPRPTGAGCPGPAPRPTEDTETGEPLPRISPDAEQPVVNVVPSKLTGSKVTMT
FT                   KLRFEGIVDLPTAEGTLKTLKFSMVKAVTDDFLLRVPGPADRTMRFATNELTIRGSVDF
FT                   YTTRFAGRFLGIKIVLTPDLPLPDGIPLPVPIPISFTDPEIDLAFVTSDTLTAKPQLRL
FT                   ALD"
FT   gene            complement(246774..248444)
FT                   /locus_tag="Sare_0216"
FT   CDS_pept        complement(246774..248444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0216"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   stp:Strop_0196 protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96151"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT5"
FT                   /protein_id="ABV96151.1"
FT                   /translation="MRRIDDIANRYVADWAALNPTGATYVGIPGHDDRLDDLSPDGYAS
FT                   RTDLTRRVLADVDATEPTSPAEHTAKEAMQERLGLELARYEAGEVGRGVSVITSGLHEL
FT                   RSVFDLMPTGGEGDRANIAARLNRFAEALEGYKTTLREATDAGQASAQAQLLEVARQCD
FT                   VWVDPDGDNFFHGLVERLDEGGTLGAELRRGATAATAATAEFGRFLRTELAPRGRTNQA
FT                   AGRERYELASQYFLGARVDLDETYAWGFEELARLEADMRTVAARIVGPGATVDEAVAAL
FT                   DADPARTIQGKEAFRDWMQGLADRAISELHGTHFDIPEQVHRIECCLAPTSDGAIYYTG
FT                   PSEDFSRPGRMWWAVPQGINDFSTWREVTTVYHEGVPGHHLQVAQTAVRAETLNRWQRL
FT                   LCWVSGHGEGWALYAERLMEELGYLEDAGERLGMLDGQALRAARVIVDIGMHLELEIPT
FT                   DNPFGFHPGERWTPELGWEFMRAHCRIPDEVLRFELNRYLGWPGQAPSYKVGERIWLQA
FT                   RADAKARKGADFDLREFHRQALDLGSLGLDPLRRALARI"
FT   gene            complement(248558..248974)
FT                   /locus_tag="Sare_0217"
FT   CDS_pept        complement(248558..248974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96152"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT6"
FT                   /protein_id="ABV96152.1"
FT                   /translation="MSRSRRHPALIVAAGAALLTLAAGCDSQSVAEQPADRPADGRLAE
FT                   YAECLRAQGIDVPEDLEGARPNRSGQPDRSGRPTDRPTDRPSARPSGSAGAEGRPAVDA
FT                   LRPDGVDDVSWQQAQDACAASRPQGGRRGDGQSS"
FT   gene            249148..250497
FT                   /locus_tag="Sare_0218"
FT   CDS_pept        249148..250497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3412 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96153"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT7"
FT                   /protein_id="ABV96153.1"
FT                   /translation="MSVHLDPWRMIRRRPARTVAAVALATATVAGGVSVFAAGTDSTGA
FT                   PSAEVRVGRGEVTAAVAARGAVQPAANRTLAFTADGTVVEVRVRPGDEVSAGQELAVVD
FT                   DGDVRAEVDRARQVLAEAEETLAELEDAGATDCVTGVVDREGAGGTSGTRIIGVAATAG
FT                   GAGGGRSAAGTVPTGSGSATPATHQPSVPPVTPSPEPTVAASVTPPVVDQDTPTPAAPS
FT                   GPDSSGGRPSSTADPHGCSAGGTGDADPLLRAHQQVTAARLALAAAQDRLAGTTITAPL
FT                   PGRVLAVAGPVGTLVRAGGRFIDLAVVDGMQVAASFPEADAGRIAVGQPAAVSLASSPE
FT                   TELAAEVVQVDPVGTAEGQVIAFGVRIAFAEPPANLLIGQTVAVRVEITTVRDVLRLPI
FT                   GAVRGEPDDSGVVRLVGAAEPHPVILGIRGDRFVEIRAGLTEGDRVLAAM"
FT   gene            250663..251376
FT                   /locus_tag="Sare_0219"
FT   CDS_pept        250663..251376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0219"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sen:SACE_6095 two-component
FT                   system, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96154"
FT                   /db_xref="GOA:A8LXT8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT8"
FT                   /protein_id="ABV96154.1"
FT                   /translation="MSSCRTRVLVVDDEDNIRALLSATLRLIEFDVRTAASGQEALALA
FT                   AEFDPDLVVLDVMLPDLDGFQVAQRLRDVRVGVPVLFLTARSAVEDRISGLTAGADDYV
FT                   SKPFSLEEVVLRIRAILRRSQVEPYPGADSGVLRYADLQLDEDAHEVRRADRVIDLSPT
FT                   EFKLLRYLMVNAGRVVSKAQILDRVWNYDFGGDGRIVESYVYYLRKKVDSRAPALIHTI
FT                   RGVGYTLRVPRTGER"
FT   gene            251378..253030
FT                   /locus_tag="Sare_0220"
FT   CDS_pept        251378..253030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0220"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sen:SACE_6094 PhoR-putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96155"
FT                   /db_xref="GOA:A8LXT9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXT9"
FT                   /protein_id="ABV96155.1"
FT                   /translation="MRRRAPRWRLRRWAHWNLRSRLVVVVAALTALALVAANAAGVVLL
FT                   RRTLIERIDDQLSAVNRPFNRDGPTPYDHPRVFPNVKLGPEQVLLLYGADGRLRDVRRS
FT                   DESNDLPILEPYEQLVADAAAGRPYSVGGVDGTSPWRVLVVDRGGDRGVAVLAVSLREV
FT                   DETVGLLLLIDIVVVLIALFLLGFLAAVVVRLGLRPLTRMEWVTAEITAGNLDRRVPDA
FT                   DPHTEPGRLGGALNLMLDRISAEVAARRDSERRLRDFVADASHELRTPLTSIRGFAELY
FT                   RRGGAPPGPDLDETMTRIEAEAARMGLLVEDLLLLAQLDHDRPARRRPVDLLAVAADSV
FT                   RDAHARAPFRDIRLTALDDDALFEAVTVSGDDHRLRQVAANLVSNALQHTPPDVPVTVR
FT                   AGRSHRVPAGPAPTVSVGGSLPAEEPVAVLEVTDTGPGIAADQAVRVFERLFRAERSRS
FT                   RGSGGSGLGLSIVAAIVSAHRGRVELVTAPGRGATFRVLLPAVSGSGRDEPGDLPRGVA
FT                   HDTPSRFRGCPGLPPSCGFQGVDHACATTPPGA"
FT   gene            252999..254159
FT                   /locus_tag="Sare_0221"
FT   CDS_pept        252999..254159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0221"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: ace:Acel_1450 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96156"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU0"
FT                   /protein_id="ABV96156.1"
FT                   /translation="MRVRRLLPAPSSSLVVNAGLGVAVLLGAALAYPAFTGPDRSATTE
FT                   PRTLPVSRATVTSVVSVAGSVRSAVTANAVFATSGTVAEVLATVGDSVTEGQVLARLDA
FT                   TVVERELAGAEADLTAARDAVERAAGNGDSSTQAETAVVQAELAVAEARERVDGATLTA
FT                   PMAGTVVAVNGGVGDSGDAGGSTGGTATGGSSTGSTSAGFVQIADLDRLEVSAGIPEAD
FT                   ATSLTVGMSATVSWNALPGTTAGARLAAVDPNATVTNDVVTYGITLSLDDRPEAARPGQ
FT                   SVQVTISLGTAENVVAVSALAVTSIGNRHTVSVLEDGAPVVRSVELGLQGDQLVEVTTG
FT                   LREGERVVLPSTGGTDTQPDTDGGRGRPAGGGLPGGGAPGGGRGGR"
FT   gene            254156..254899
FT                   /locus_tag="Sare_0222"
FT   CDS_pept        254156..254899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ace:Acel_1451 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96157"
FT                   /db_xref="GOA:A8LXU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU1"
FT                   /protein_id="ABV96157.1"
FT                   /translation="MTVYQATVGQPATWATTRPVLDVREMTKVYGQGEAAVHALRGVSL
FT                   TVAAGDYVAIMGSSGSGKSTLMNILGCLDVPTGGTYLLDGVDVGRLDDNRLALVRNRRI
FT                   GFVFQAFNLIPRTSAVTNVELPLAYAGVRPARRRRQALAALELVGLADRAGHEPNQLSG
FT                   GQQQRVAVARALVTQPALILADEPTGNLDSRSTEEILAIFDELHAAGRTIVMITHEPDV
FT                   ADRTRRLVALLDGRISSDVRRDGAR"
FT   gene            254896..256101
FT                   /locus_tag="Sare_0223"
FT   CDS_pept        254896..256101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0223"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ace:Acel_1452 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96158"
FT                   /db_xref="GOA:A8LXU2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU2"
FT                   /protein_id="ABV96158.1"
FT                   /translation="MSLWEILRFAGQGVAGNKLRSALTMLGILIGVAAVILLVAVGNGS
FT                   AQAVNRSIETLGTNTITVSSTARGGSTPSALTVDIAEALYDPALAPDVRAVSPVVTTAP
FT                   TITHDGADHQVAQFLGTYPTYFGSSNSQVASGAGFTDEDVTQGRRVVVLGRTVAAELFV
FT                   DADPVGRQVTVGGALYTVVGVLAEKPAAGGLTDSNDVAIAPLTAVQQTLTGYGAVNSIL
FT                   VEAAGADRVNAAQDQVTRILDQRLNDPTGATAAAPYRIQNASQLLATRTETARTFTVLL
FT                   GTVAGISLLVGGIGITNIMLVTVTERTREIGIRKALGAPRRTIATQFLAEATLLSVLGG
FT                   GLGVAVALIGSRFTIVGVQPVIVPSSVALALGVSVAIGLFFGSVPANRAAGLRPIEALR
FT                   YE"
FT   gene            256113..256574
FT                   /locus_tag="Sare_0224"
FT   CDS_pept        256113..256574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx13470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96159"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU3"
FT                   /protein_id="ABV96159.1"
FT                   /translation="MTTDLATALAAETRPWRNRATPWLAAAVLLVGGFAAGAQTHHAYG
FT                   PEPVPAAAGRGAGTEREGGGGRGARGGEETSPGTPATQPVVTGTVTHIDGDTLRLRRES
FT                   GETVTVRVDDRTQVRLPGTVKDLETGDTVSVAGTADGDSVAATNITTQE"
FT   gene            256674..257768
FT                   /locus_tag="Sare_0225"
FT   CDS_pept        256674..257768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0225"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: stp:Strop_0197 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96160"
FT                   /db_xref="GOA:A8LXU4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU4"
FT                   /protein_id="ABV96160.1"
FT                   /translation="MTFESTPDRSALRSWLPGFLALAAIWGSSFLFIKIGVRELHPLQL
FT                   TLYRVGTGALTLLILLAVLRVRLPREPRIWAHLVVTGALGVALPFTLFGYGEQRVESML
FT                   AGIWNATTPLVVLPMAVLAFRTERLTAARAGGLLLGFLGVLIVLGVWEGVGGAHFTGQL
FT                   MCLGAATCYGIAIPYQKKFVVGQSYSGLALSTAQLLTALALLAVVTPFVAGAPPAPTAL
FT                   TGPVVVSVAALGAVGTGLAFVIHFRNIRVAGASTAATVTYLIPVFAVLIGVFALGERLT
FT                   WHQPVGALVVLLGVAVTQGLIGPRRPPRAPAPPSSPATVPVAAGQERLPAHTTSRSAGQ
FT                   VLTTRSAGTPQRAARSQPNRCQSS"
FT   gene            complement(257648..258718)
FT                   /locus_tag="Sare_0226"
FT   CDS_pept        complement(257648..258718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0226"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: stp:Strop_0198 PHP C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96161"
FT                   /db_xref="GOA:A8LXU5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR017078"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU5"
FT                   /protein_id="ABV96161.1"
FT                   /translation="MTARDPIADLRRIAFLLERANEATYRVRAFRSAAKAVAALPSAEV
FT                   AELARAGKLTTLSGVGEVTARCVAESLAGEEPVYLRRLAATEGADLDAEATALRTALRG
FT                   DCHTHSDWSDGGSSIEEMALAAVELGHEYLVITDHSPRLKVAQGLTADRLRRQLDQVAS
FT                   LNEALPEGFRILTGVEVDILADGSLDQDEELLARLDVVVGSVHSGLSDERGRMTHRMLA
FT                   AIANPHLDILGHCTGRMVSSRPAGVTGPGDRGHRRRTRGESDFDADAVFAACAEHGVAV
FT                   EVNSRPERQDPPKRLIRRALEAGCQFAINTDAHAPGQLDWQRFGCERAARCGVPADRVV
FT                   NTWPAERLVVWAGSRS"
FT   gene            complement(258751..259521)
FT                   /locus_tag="Sare_0227"
FT   CDS_pept        complement(258751..259521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0227"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: stp:Strop_0199 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96162"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU6"
FT                   /protein_id="ABV96162.1"
FT                   /translation="MPAPLTGRRLAYPLLFLLASMLAASCATTRPGASPGTASSPATTQ
FT                   PATPTGSAAPTGSATPAGSTPSDGSAPPTAAATPPVTPSAEIRHVFPVRAGNASYHPTH
FT                   SVYPATDIFADCGVPVVAVTDGSVLEVSRVDRFNRGGPRGPFNGGLSVAVLGDDGVRYY
FT                   GSHLTEVAAGLDPGVRVRAGQQLGTVGRTGNANNVCHLHFGISPPCPGKDGWWIRRGVV
FT                   WPAPYLDAWRRGINRSPAVEVAAWQRRHGCPKEP"
FT   gene            259578..259943
FT                   /locus_tag="Sare_0228"
FT   CDS_pept        259578..259943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96163"
FT                   /db_xref="GOA:A8LXU7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU7"
FT                   /protein_id="ABV96163.1"
FT                   /translation="MTTDPYGAGRPHHPSGLFPAGPPARPTYREPHPVVGTAVALGGVF
FT                   AAAWLLLFGLLGTGVRAYAWWTMAAGGLAWLAALLLVRYGDRGVGTGIAIVVGGGWSIT
FT                   AAVVASRWMTDGNWPLW"
FT   gene            260209..260736
FT                   /locus_tag="Sare_0229"
FT   CDS_pept        260209..260736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96164"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU8"
FT                   /protein_id="ABV96164.1"
FT                   /translation="MSYFAAAVVRDDGGGWTAAEVNLRGAVDVDGVADRLRDVDPNADL
FT                   SLLFVEAEDEYLVILRLDEGEDLRVFGSDSAYAEETRLGALLVGDLKASVTGLDEIEEP
FT                   GASDSDPGSEQPAADPEADPVGDADLLADLGVSGSRLIALCGHEGMLPADVTAEACTVL
FT                   GCADEVEELREV"
FT   gene            260747..261244
FT                   /locus_tag="Sare_0230"
FT   CDS_pept        260747..261244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0230"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   stp:Strop_0202 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96165"
FT                   /db_xref="GOA:A8LXU9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXU9"
FT                   /protein_id="ABV96165.1"
FT                   /translation="MAEDLADPDAVGRRQRHELWMRRALEVAVTGADPTVTVVDDIPVG
FT                   AVLLGPDGTELATGRNERELTGDPTAHAEVLALRRAAGRLGRWRLDGCTLVVTLEPCTM
FT                   CAGALVLARVSTVVFGAWEPKTGAAGSLWDVLRDRRLNHRPEVYGGVLATETAAVLRAF
FT                   FR"
FT   gene            complement(261285..261992)
FT                   /locus_tag="Sare_0231"
FT   CDS_pept        complement(261285..261992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0231"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG:
FT                   stp:Strop_0203 purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96166"
FT                   /db_xref="GOA:A8LXV0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXV0"
FT                   /protein_id="ABV96166.1"
FT                   /translation="MSTHIGAKPGEIAERVLMPGDPLRAKWIAETYLEGAQCYSTVRGM
FT                   FGFTGRWNGVDVSVQGSGMGMPSASIYAHELINDYGVRSLIRVGTCGALTDDLQLRDVV
FT                   AASGSSTDSNMNRMRFDGLIDYAPVADFGLLRSSVEVAERRGITMRVGPVLAADAFYTA
FT                   RRDLYDSLADYGVLAVEMESAALYTTAARHKARALTILTVSDHLRTGAKTTSEEREHTF
FT                   SQMVEIALDTITA"
FT   gene            262069..262155
FT                   /locus_tag="Sare_R0008"
FT                   /note="tRNA_Ser1"
FT   tRNA            262069..262155
FT                   /locus_tag="Sare_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(262685..263701)
FT                   /locus_tag="Sare_0232"
FT   CDS_pept        complement(262685..263701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0232"
FT                   /product="O-methyltransferase family 2"
FT                   /note="PFAM: O-methyltransferase family 2;
FT                   Methyltransferase type 12; KEGG: stp:Strop_0204
FT                   O-methyltransferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96167"
FT                   /db_xref="GOA:A8LXV1"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXV1"
FT                   /protein_id="ABV96167.1"
FT                   /translation="MITPTPLMQLVAGAWGFKTLAVGVEFGLFTRLAGGRTITVAETAA
FT                   ELEIDERPADLLLAASASLGLLDKAGKGYRNSELAEQFLVEGRPYYFGAQVRYSDLHTY
FT                   LPWHRIGEALRGNRPLTWDPQQQKSMFDTTDPDLVTEFWDAMFATSRFTARALADAYDF
FT                   GAHRRLLDVGGGAGAFPIEFCQRLPQLQATILELPHVCVRAEERIAAEGLTDRIGIVAG
FT                   DFLGDPALPDGHDVILLSMILHDWDEPTNRALLTRCHAALPPGGAIVISELLLNDERTG
FT                   PPEAALMGMNMLVETEGGKNYSGAEYATWLDDAGFVDARIVPFDAPGANGAVVARRP"
FT   gene            263798..264178
FT                   /locus_tag="Sare_0233"
FT   CDS_pept        263798..264178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0233"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   stp:Strop_0205 protein of unknown function DUF307"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96168"
FT                   /db_xref="GOA:A8LXV2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXV2"
FT                   /protein_id="ABV96168.1"
FT                   /translation="MIRFVLNVLWLIFGGGIVLAFGYFVAALICFVLVVTIPFGVASLR
FT                   LASYSLWPFGRTLVAKPGAGVPSGLANVLWVLLAGWWLALSHLVAGISLCVTIIGIPFG
FT                   IANFKLVPAALWPLGQEVVELP"
FT   gene            complement(264284..264778)
FT                   /locus_tag="Sare_0234"
FT   CDS_pept        complement(264284..264778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96169"
FT                   /db_xref="UniProtKB/TrEMBL:A8LXV3"
FT                   /protein_id="ABV96169.1"
FT                   /translation="MTAAWLSGSGAIPPDHTATREPAASVAVVDLDGLADVDFGDTENE
FT                   LTRRGKLHTDVYACGPTLAGHETVSPIFVDDRLVLLWVGDPVRTPEGVATGTPLSEVHE
FT                   HYPGARLLDAPHGTYRFDGLLAREGDRAYLFLHDGRTVRKIIAGYAAWAQRAFDEGHSP
FT                   C"
FT   gene            complement(264860..265576)
FT                   /locus_tag="Sare_0235"
FT   CDS_pept        complement(264860..265576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96170"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYF9"
FT                   /protein_id="ABV96170.1"
FT                   /translation="MRPGPDESTIYTDHGEAQRMPGPTMTPPASKAPMIPRENSPPSHE
FT                   IVRGNMSYQLSAIVADAGLLHEETRGLDHAILGDLRQDFALLPVTPQLVEELTGAPPDY
FT                   TVVGPAREHPFTLVFSAALTETLAGWSQRGPLAYVEAEFAGGVGHQAAAVWLGGRRSWG
FT                   PRFDSVFDGPRGQWPINAALVEVGAESGAWVDLFAELGLYVERSTAGWLAHGRRGSGVD
FT                   YWDELVEEWERQQERE"
FT   gene            complement(265560..266768)
FT                   /locus_tag="Sare_0236"
FT   CDS_pept        complement(265560..266768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0236"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96171"
FT                   /db_xref="GOA:A8LYG0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG0"
FT                   /protein_id="ABV96171.1"
FT                   /translation="MMPFMVTNTMTLGRPFWTFWSATALANVGDGIRLAAFPLLAASLT
FT                   ANPVGVAAVTAAQALPWLVTGLLAGSLADRRGARTLLAQADIARVVVLGVLVVAVAMGW
FT                   ASLPLVLLASFLLGVGETVRDTAAQTALPGLVPERLLERANGRLVAGEIVGNEFVGPPV
FT                   GAALFVAGAALPFATNGASLALAVMLVLTLPLSVAARPPQDAPTHVRQGVVAGLRWLAR
FT                   HRVLRTLALVTAAVAAADSAWFAVLVLYATDRLGTGAAGFGVLLAAGALGGLLGSFLVD
FT                   RLVAGRRHRAIITWSLAITAGIPAVLAVTSQLWAAILVIVVTSGSFAVLNVTVVSLRQR
FT                   LVPRELLGRVVAAGRTLSFSAAAAGALLGGVLTATITIEATFIFSGLVAVSATIAWWVA
FT                   SRP"
FT   gene            complement(267253..268032)
FT                   /locus_tag="Sare_0237"
FT   CDS_pept        complement(267253..268032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0237"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: stp:Strop_0211 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96172"
FT                   /db_xref="GOA:A8LYG1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG1"
FT                   /protein_id="ABV96172.1"
FT                   /translation="MAGRVSSADRFHVDSSGIGQTDDVTDSVGPDPQYELFADEFLDHA
FT                   REGLYNAHYDRPACLRLLGEVAGRTVLDVACGPGLYAEELVGRGARVIGLDQSPRMVQL
FT                   CRQRVPSGEFRVHDLADRLHWLPDDSVDLVLFALGLEYVDDRTSTLRELRRVLRPDGAL
FT                   VLSRLHPTGDWLRHGGSYFDVRIVEETWSRGWQVRYWLAPLERTCEELHEAGFLIERLV
FT                   EPRPTAEAAHVDRDRYERLLREPIGFLAIRALPAPWR"
FT   gene            complement(268080..269504)
FT                   /locus_tag="Sare_0238"
FT   CDS_pept        complement(268080..269504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0238"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: stp:Strop_0078
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96173"
FT                   /db_xref="GOA:A8LYG2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG2"
FT                   /protein_id="ABV96173.1"
FT                   /translation="MTLTQSSGIPDAVAAARGRFERGLTRSLSARRRQLRALGAMLTEN
FT                   ESAFEAALWSDLRKNRAEAQLTEISLVLAEINHALRHLRRWVRPTRVPVPLVLMPAQAR
FT                   LVPEPLGVVLVIAPWNYPVLLLLSPLVGALAAGNTAVLKPSELAPATSSLIARLVPSYF
FT                   PDGAVHTVEGAVPETTELLAQRFDHIVFTGSGTVGRIVMRAAAEQLTPVTLELGGKSPA
FT                   WFDDSADIAVAARRLAWAKFTNAGQTCIAPDYVMTTPDRVPALVDALGTAIEDMWGRDP
FT                   HESSTYGRIVNDRQFDRLVGYLTGIDPAIGGTYDGTERYFSPTVVTFPATDHPAVGPDA
FT                   AHPVLQEEIFGPILPILPVASAEQAVQVINGWDKPLALYVFSSSPGIRRLFEEETSSGA
FT                   VVYNAALIHAAATGLPFGGVGASGMGAYHGSYSWRTFSHFKPVLEKPLKPDSLRLIQPP
FT                   FGKLGTALAQHLMRRA"
FT   gene            complement(269747..269985)
FT                   /pseudo
FT                   /locus_tag="Sare_0239"
FT                   /product="hypothetical protein"
FT   gene            complement(270282..270725)
FT                   /locus_tag="Sare_0240"
FT   CDS_pept        complement(270282..270725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0240"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: afw:Anae109_3662 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96174"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG3"
FT                   /protein_id="ABV96174.1"
FT                   /translation="MVDILHRVGIKTPTPEKVYHALTTVEGLAGWWTDDTKGSGDVGGV
FT                   LEFRFPSGGVDMEVTELRPSERVRWRVADGPEEWIGTMINWGLHQSGDYTIVLFKHEGW
FT                   QEPVEFMHHCSTRWGSYLMSLKSLVETGEGAPAPREVEISDWQ"
FT   gene            complement(270757..271116)
FT                   /locus_tag="Sare_0241"
FT   CDS_pept        complement(270757..271116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0241"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: sen:SACE_6152
FT                   possible transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96175"
FT                   /db_xref="GOA:A8LYG4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG4"
FT                   /protein_id="ABV96175.1"
FT                   /translation="MSTTAAEKFDDQLWSAIGDPTRRRMLDLLLVEGDGTATTLSQRLP
FT                   VTRQAVAKHLGVLDRAGLVRATPAGRERRYQVDDAQLARAAAQLSSVGSEWDARLQRIK
FT                   RIAEAIQRTQHIEHD"
FT   gene            complement(271113..271574)
FT                   /locus_tag="Sare_0242"
FT   CDS_pept        complement(271113..271574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0242"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: rha:RHA1_ro04215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96176"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG5"
FT                   /protein_id="ABV96176.1"
FT                   /translation="MEFGTIEREIYVEASPEIVFEVVSSPEHLRQWWPDDARYDPRPGS
FT                   AGEIVFGDRDAGGTVVPFTVVSARPPRTFSFRWTHPADEAAAEGNSLLVTFDLTPSGGG
FT                   TLLRVTEAGFRELGWEAAVLKRQYQKHVAGWDFHLSRLVPYIAGLGVRP"
FT   gene            272291..272662
FT                   /locus_tag="Sare_0243"
FT   CDS_pept        272291..272662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0243"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_0011
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96177"
FT                   /db_xref="GOA:A8LYG6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG6"
FT                   /protein_id="ABV96177.1"
FT                   /translation="MVLNHIGVHVRHFDASRVFYDAVLATLGGRRLLESPTQVGYGTNT
FT                   PDFWLYPLNGADEGVEVHIAFTAPDRATVRAFHDAALAAGAEVLHAPRIWPEYHPNYFG
FT                   AFVRDPDGNNVEAVCHEPE"
FT   gene            273383..273961
FT                   /locus_tag="Sare_0244"
FT   CDS_pept        273383..273961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_3348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96178"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG7"
FT                   /protein_id="ABV96178.1"
FT                   /translation="MNTILRRSVLGVAGLALSTGVVAGPLATFTDTTPTPAAAVQVAKP
FT                   DMDTLIPHGTQGEQSRISLGDEQTANVKAIIEATKKAGMDERAAVVAIATSLQESKLEN
FT                   LGHLGDRNDHDSQGLFQQRPSSGWGTVEQITDPEYSTTAFLKGLQQVEGWQDMPLTKAA
FT                   QTVQVSAYPFHYAQWETQAADLVAEHWTS"
FT   gene            complement(274084..274233)
FT                   /pseudo
FT                   /locus_tag="Sare_0245"
FT                   /product="hypothetical protein"
FT   gene            complement(274280..274567)
FT                   /pseudo
FT                   /locus_tag="Sare_0246"
FT                   /product="hypothetical protein"
FT   gene            274753..275007
FT                   /locus_tag="Sare_0247"
FT   CDS_pept        274753..275007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_1565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96179"
FT                   /db_xref="GOA:A8LYG8"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG8"
FT                   /protein_id="ABV96179.1"
FT                   /translation="MTHDYLISLIRTAVPAAVGALLAWLASTAGIVIDGDSSTALTAGV
FT                   VALAMAGSHALARVAEAHWPWLGVLLGTPAAPTYEAPGR"
FT   gene            complement(275532..275768)
FT                   /locus_tag="Sare_0248"
FT   CDS_pept        complement(275532..275768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96180"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYG9"
FT                   /protein_id="ABV96180.1"
FT                   /translation="MMAAAHARPAPIGLSPAQLRNRMIRSARRIIVEHWPRVDRCPVCG
FT                   SGWPCTPTAYAYDYLASVGQGDWAPPEHVLGRR"
FT   gene            complement(275765..275944)
FT                   /locus_tag="Sare_0249"
FT   CDS_pept        complement(275765..275944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH0"
FT                   /protein_id="ABV96181.1"
FT                   /translation="MFRLFRQRRRRSGRLDATGPATVYAGRAGAYRPLRDQPTVILDTR
FT                   LLMTRLAEQRACSR"
FT   gene            complement(276080..277087)
FT                   /locus_tag="Sare_0250"
FT   CDS_pept        complement(276080..277087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0250"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fra:Francci3_2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96182"
FT                   /db_xref="GOA:A8LYH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH1"
FT                   /protein_id="ABV96182.1"
FT                   /translation="MPARVHTFVDPGFPAELARIRGASGMSIRDVARRIFYGKSYVHDL
FT                   ETGRTRPTAEIAQQLDDMLQAGGRLAAMVVDTPPVTTPDDEQRIACAVAEPTRLDGTTV
FT                   RLLAEVLANQRRLDDTLPALLLLPAVIPQWNTVRRLTAHASGRHAAGLHEVTAEWTQFV
FT                   GWLHAEARHDGEAVRVLVEAADEADAVDSGPLAAQVENFRGYLERQRGNPRGIVRHFLA
FT                   AYHTPGAAALQRVGDAVQAAHGYALLGDRAPAARLLGEANDLTTAAESQPPPGLAYWLT
FT                   PTFSRMSLGLAYLALGDRTTSVDNLRAGLEGLPADQRDAEWTQEYRDALLAAAG"
FT   gene            277309..277581
FT                   /locus_tag="Sare_0251"
FT   CDS_pept        277309..277581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96183"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH2"
FT                   /protein_id="ABV96183.1"
FT                   /translation="MKAATTDRSQVWQEIHQLQKDVLRLQREMRLLRKQMLCRPMTVDQ
FT                   RRLMEIHLRDQLNAELEGARRKGYAKGYVTGVLDRLSRGSGESAK"
FT   gene            complement(277664..277748)
FT                   /locus_tag="Sare_R0009"
FT                   /note="tRNA_Ser4"
FT   tRNA            complement(277664..277748)
FT                   /locus_tag="Sare_R0009"
FT                   /product="tRNA-Ser"
FT   gene            277831..277920
FT                   /gene="ffs"
FT                   /locus_tag="Sare_R0064"
FT   ncRNA           277831..277920
FT                   /gene="ffs"
FT                   /locus_tag="Sare_R0064"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            278085..280589
FT                   /locus_tag="Sare_0252"
FT   CDS_pept        278085..280589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0252"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: stp:Strop_0213 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96184"
FT                   /db_xref="GOA:A8LYH3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH3"
FT                   /protein_id="ABV96184.1"
FT                   /translation="MALALYRKYRPRTFAEIIGQEHVTEPLSQALRSGRLNHAYLFSGP
FT                   RGCGKTSSARILARSLNCEHGPTPEPCGTCGSCRALATDGAGSIDVIEIDAASHGGVDD
FT                   ARELREKAFFAPAQSRFKIYVIDEAHMVSSAGFNALLKLVEEPPEYVKFIFATTEPEKV
FT                   LGTIKSRTHHYPFRLIPPKVLRPYLEQLCQAEGVQVEPAVFPLVVRAGGGSARDSLSVL
FT                   DQLIAGAGPEGVTYARAAALLGVTDSALIDEMCDALAAGDGAAAYATVDRIVGAGHDPR
FT                   RFAADLLERLRDLIVLQRVPDAAPKGLVDGPDDQIERMTAQAQRLGPGTLSRCADIVHD
FT                   GLVEMRGATAPRLLLELICARMLLPGADDSAGGLLQRLERLERRLTLAGTDALPAAPAP
FT                   SAGAAPAPSAGAAPALSAGAASASDDSPRRPPAAAVPASAEDPAGSLAMSGTSSGLAAA
FT                   RAAAAPAGSRADQPPGQPDRPGPDASDASRRASARPAVMPDPVTPEPPRPGTTDRGTLD
FT                   AAAVRRHWPEVVGLVGRKSKKAAAWAREATVHEVDGETLVLAFRYPFHAQALANEPDLL
FT                   IESLYEELGERWQIRCEVAGERVGGPGAGPRAPGPARPVTAPARPEPSTAPVEPARSPT
FT                   GGGVADSGSRRSGGPAAEEEWPEPARPGGAASEPVGSAAGDWPETARPGASATAPAAPS
FT                   AAGPVGSASGGGPASGAGVAPAVPDATRPTAARGAPVSSGLAAARAAAAGGGRAQRSAA
FT                   PSRRMAEPDWAGEPPYDPDYDGAPRGGAPSAAVVHEGFDPGDEPLDEVIDERTARQSSE
FT                   EQAVRLLRDAFGAEKIDEVEAR"
FT   gene            280715..281068
FT                   /locus_tag="Sare_0253"
FT   CDS_pept        280715..281068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   stp:Strop_0214 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96185"
FT                   /db_xref="GOA:A8LYH4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH4"
FT                   /protein_id="ABV96185.1"
FT                   /translation="MRSKEPFVRPGGQPNMQQMLKQAQKMQQQIAKAQAELAEAELTGT
FT                   AGGGLVTATVAGTGELKSVTIDPKAVDPDDVETLEDLVVAAVHNAAEAARELTDQKMGP
FT                   VAGGMGGLGLPSF"
FT   gene            281077..281670
FT                   /locus_tag="Sare_0254"
FT   CDS_pept        281077..281670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0254"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: stp:Strop_0215 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96186"
FT                   /db_xref="GOA:A8LYH5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH5"
FT                   /protein_id="ABV96186.1"
FT                   /translation="MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLADV
FT                   LRKVKELVRFCTSCYNVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYH
FT                   VLGGAINPLEGVGPDNLRVRELLTRLGGGAVRELILATDPNTEGEATATYLALMVKPMG
FT                   IAVSRLASGLPVGGDLEYADEITLGRAFEGRRSV"
FT   gene            281946..283610
FT                   /locus_tag="Sare_0255"
FT   CDS_pept        281946..283610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0255"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: stp:Strop_0216 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96187"
FT                   /db_xref="GOA:A8LYH6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH6"
FT                   /protein_id="ABV96187.1"
FT                   /translation="MRASRPKVAVAAVAVAALAVSGCAESDRDDSSGDSNNDTLVFGVA
FT                   GDPKVLDPSFASDGESLRVSRQIFETLVRPEEGGTKVSPGLAESWTPDAAGTTWTFKLR
FT                   SGVKFHDGTDFDAEAVCVNFNRWYNAKGLMQSPDVTTYWQDVMNGFAQNENDTLSESLF
FT                   KSCTATDATTVDLAFTRVSSKIPAALMLPSFSIHSPKALEQYDASNVGGTATDVKYPEY
FT                   ATGHPTGTGPFKFKAWDIANKTLTIERNDDYWGEKAKLKTLIFKTISDENARKQALRSG
FT                   DIQGYDLVGPADVEPLKAEGFNVLTRPAFNILYLGMNQKGNPKLADLKVRQAIAHAINR
FT                   QALVDSKLPPGAKVAMNFFPDTVEGWNGDVTTYDYDVDKAKRLLAEADAADLTLRFHYP
FT                   TEVTRPYMPNPKDLFELVSADLQAVGITVEPIPLKWSPDYLNATTSGSEHDLHLLGWTG
FT                   DYGDGYNFIGIMFDRQKDEWGFDNPALFAQFTDADTTADRASRVEKYKGLNKTIMDFLP
FT                   GVPISHSPPAIVFGKDVIGVKASPLTDERYANAEFKS"
FT   gene            283686..284690
FT                   /locus_tag="Sare_0256"
FT   CDS_pept        283686..284690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0256"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_0217
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96188"
FT                   /db_xref="GOA:A8LYH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH7"
FT                   /protein_id="ABV96188.1"
FT                   /translation="MFRFIVRRLLQLIPTLFGLSLLLFIWLRRLPGGPETAILGERGTP
FT                   EMRAAIRRNMGLDEPILVQYGRFVRRLVRLDLGTSTSTKRPVLEEFLERFPGTVELTIT
FT                   ALVIAIGVGIPLGYLAARRRGRLFDHFSVGGSLIGICIPIFFLAYVLKAIFSENLGWFP
FT                   SSGRQDPTLDATRITNFFVLDGLMTREWDAAADALWHLVLPGLALATIPLAIIVRITRA
FT                   SVLEVLNEDFVRTAEAKGLTERTVRGRHVLRNSLLPVVTSIGLLTGGLLSGAVLTETVF
FT                   AFTGIGAFIYEAINHRDYPVLMGFIMIISVVYVLVNLLVDLSYSLIDPRVRVR"
FT   gene            284687..285652
FT                   /locus_tag="Sare_0257"
FT   CDS_pept        284687..285652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0257"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_0218
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96189"
FT                   /db_xref="GOA:A8LYH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH8"
FT                   /protein_id="ABV96189.1"
FT                   /translation="MTIGTGKKERLDRLAELVARDDERGVSLWQEAFRRLRRNPAAIIG
FT                   AVILTIFILVALIGPFFVPYGPKDTIGIREGLVRSGQGIIPGASAEHWFGYDHQGRDVF
FT                   SRMIVGARQTLLVGVVATLIGLAVGALIGGVAGAAAGLGGRWGRAVDNVLMRFIDMMLA
FT                   LPSLLLAVSIAALLGASLSTVMIAVGMVSVPVFARLLRVSMIAQANSDYVLAATSLGVR
FT                   KPKIALVHIVPNSLAPVIVQATLTLATAIIEAAALSFLGLGNPDTAVPEWGVMLADAQP
FT                   YLGIRPALAIFPAVAIIITALGFTLLGEAMREALDPKLRK"
FT   gene            285720..286829
FT                   /locus_tag="Sare_0258"
FT   CDS_pept        285720..286829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0258"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: stp:Strop_0219 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96190"
FT                   /db_xref="GOA:A8LYH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYH9"
FT                   /protein_id="ABV96190.1"
FT                   /translation="MALLEVDDLTVTFARRGQRTVNAVDGVSFSVDAGEVVGLVGESGC
FT                   GKSVTSLAIMGLLPRHPGTRIDGTAVFDGSDLLQLDDRARRDIRGRDVAMIFQDPLSSL
FT                   NPVIPIGLQVTEVLARHRGLTGDAARREAVGLLDRVGIPDPDRRLKEYPHQLSGGMRQR
FT                   ALIAMAVACRPRLLIADEPTTALDVTIQAQILELLKELVRDSGTALVMITHDLGVVAGM
FT                   CDSINVLYAGRVVETARRRPLFREPRHPYTAGLLGSVPRLDSGRGEPLNPIPGSVRDVL
FT                   SWPDGCAFAPRCARRTDACLDAAPSMVRTHDGRSYRCVHPMPLPGATAEQARGTGSVNP
FT                   ERGIVPAQAGSGDQPVASGPERREEDNRG"
FT   gene            286822..287937
FT                   /locus_tag="Sare_0259"
FT   CDS_pept        286822..287937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0259"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: stp:Strop_0220 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96191"
FT                   /db_xref="GOA:A8LYI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI0"
FT                   /protein_id="ABV96191.1"
FT                   /translation="MADNDILVEVRDLKVHFPIKRGVLFDRTIGHVKAVDGVDLQIPRG
FT                   KTYGLVGESGCGKSTLGRALLQLTAPTSGEVVFDGVELTTLPSARLRSMRRRMQMIFQD
FT                   PMSSLDPRQNVESILTEGLHTHGIGSDRDERRTIIGEALDKVGLPRWALSRYPHEFSGG
FT                   QRQRIGIARALVLGPELIVADEPVSALDVSIQAQVVNLLDELQDSLGLTYLVIAHDLAV
FT                   VRHISDTVGVMYLGALVEEASSDRLYTEPLHPYTRALMSAVPVPDPDVEDRRERILLAG
FT                   DLPSPANPPAGCRFHTRCPWAQPTRCADERPVLRDIGGTRVACHWAERIASGELRPQQV
FT                   GVRAARPVDGGEAPRPVSTPAPTDEVDSGEA"
FT   gene            complement(287992..288465)
FT                   /locus_tag="Sare_0260"
FT   CDS_pept        complement(287992..288465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96192"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI1"
FT                   /protein_id="ABV96192.1"
FT                   /translation="MGEHPVTGSGTSPNPDRTPKADDSAASTRGPDPGSAGMTADGAAG
FT                   SAVPSAGMSADTTSAPAGGTPGSGMRADSGTWARTVDIVPGPGGVMTDEVGVVTGELTL
FT                   RTEYLDGQVTLRVQYREADEWYVVTGGRAPLPDPASLDTVHSIAVALLDRPDG"
FT   gene            complement(288447..289091)
FT                   /locus_tag="Sare_0261"
FT   CDS_pept        complement(288447..289091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96193"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI2"
FT                   /protein_id="ABV96193.1"
FT                   /translation="MRGTRSQSLLAAALALSLAGCVSVSTPDPTPATDGGNVTEKLAEL
FT                   TVASAGSMRGYSRDRFPHWRGTGKNCDVRDTVLKRDGEAIKLSGCNVVGGRWESVYDGR
FT                   VLTDPSEVDVDHMVPLANAWRSGANRWTDAKRGDFANDIQLPHLFAVSRTANRSKGDQD
FT                   PSQWRPANRSYWCRYAENWVTVKHHWQLTVNTAEKAALTEMLGGCTWASTP"
FT   gene            289200..290702
FT                   /locus_tag="Sare_0262"
FT   CDS_pept        289200..290702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0262"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0223 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96194"
FT                   /db_xref="GOA:A8LYI3"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI3"
FT                   /protein_id="ABV96194.1"
FT                   /translation="MTPPSLRLRTPAGVGTLLAAVLASGMVFLDATVVNVALPRLGDDL
FT                   DATVSDLQWTVNGYLLMLAAFVLLGGALGDRFGRRRVFLLGVVWFTVASVLCGLAQDTG
FT                   QLIAARLLQGAGAALLTPGSLSVLQASFHPDDRGRAIGAWAGFSGVSTALGPFVGGWLI
FT                   DELSWRWIFFLNVPLAVLVVLAALRWVPESRDEDVSRTRTGESGRRRFDVLGALLGAVA
FT                   LAGVTFALIDAPARGVASRSVLLAIAAGVLGSVAFVLVERRRGETAMLPTGLFSSRLFS
FT                   VLNIFTVVIYAALGGFTFFVAVYLQNVAGWSALGTGLALLPVTVLLLVGSPLAGDLATR
FT                   IGPRLPLVVGPVVSAAGLILLRQVGADASYWRDVLPGVVLFGVGLTLVVAPLTASVLAA
FT                   VADRFAGVASGFNNAASRAGGLLAVAALPLLVGLSGTDYERPDELTSAYRGALAWCAGL
FT                   LLVGAVLAAVFVHRPRRVPPPSQPCQSLPAATGPERRGGESS"
FT   gene            complement(290768..292522)
FT                   /locus_tag="Sare_0263"
FT   CDS_pept        complement(290768..292522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0263"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: stp:Strop_0224 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96195"
FT                   /db_xref="GOA:A8LYI4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI4"
FT                   /protein_id="ABV96195.1"
FT                   /translation="MAHPAVTPDAETDPIARQQPSRMPYHRYQPYQQQFRTDLPDRSWP
FT                   NRRVETAPRWCAVDLRDGNQALIDPMSPERKRRMFQLLVQLGYKEIEVGFPSASQSDFD
FT                   FVRQLIEQDLIPDDVTIQVLTQCREHLIDRTFAALRGAKRAIVHFYNSTSTLQRRVVFG
FT                   LDRDGITDIATTGARLCQKYAEIHTPDTDIHYEYSPESYTGTELDYALEVCAKVIEVVD
FT                   PTPDHRLIVNLPATVEMAMPNVYADSIEWMHRHLPRRDSLVLSLHPHNDRGTGVAAAEL
FT                   GLLAGADRIEGCLFGNGERTGNVDLVTLGLNLFSQGIDPMIDFSNIDEIKRTVEYCNQL
FT                   PVHERHPYVGDLVYTAFSGSHQDAIKKGFDALSADAATAGVPVEKHSWAVPYLPIDPKD
FT                   LGRTYEAVIRVNSQSGKGGVAYVMQTEHQLDLPRRLQIEFSGVVQQVTDNDGGEVDPQT
FT                   MWEIFAGQYLLDHQTNPSVTLTDYTLATVDGKVEFEAVVGYDGERHTVTAVGNGPVDAY
FT                   VNALQSLGVNVRVLDYHEHALSSGGDAQAAAYVECEVDGRTVWGAGVDANIVTATIRAV
FT                   TSAVNRTR"
FT   gene            complement(292734..293297)
FT                   /locus_tag="Sare_0264"
FT   CDS_pept        complement(292734..293297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0264"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: stp:Strop_0225
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96196"
FT                   /db_xref="GOA:A8LYI5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI5"
FT                   /protein_id="ABV96196.1"
FT                   /translation="MTDLTPLIAFRWSPRSFDPGADLSPTEVDLLLEAARWAPSAANRQ
FT                   PWRFAVGHRDGETWKRIMVNLPERDQRWAGRASMLLLAAHLVSAVDPTEDPAYDLGHAV
FT                   AQLTVQATALGLHLRQLRDLDRAGIAADLDLPSDVRPAVVVAIGRLGDPLDLPTDLIDS
FT                   EIGFRRRRPVADLLLASAAATPVS"
FT   gene            293533..294798
FT                   /locus_tag="Sare_0265"
FT   CDS_pept        293533..294798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0265"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: stp:Strop_0226 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96197"
FT                   /db_xref="GOA:A8LYI6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI6"
FT                   /protein_id="ABV96197.1"
FT                   /translation="MALVVQKYGGSSVDNAERIKRVAERIVAARKAGDDVVVVVSAMGD
FT                   TTDELTDLANQVSPLPPGRELDMLLTAGERISMALLAMAIHNLGYEARSFTGSQAGVIT
FT                   TSVHGRARIIDVTPGRLKGALDEGAVVIVAGFQGVSQDTKDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVFSADPRIVPDARHIRQITYEEMLELAACGAKILALRAVEYARR
FT                   AGLPVHVRSSYSTSTGTMVTGSMEDLPVEQALITGVAHDRSEAKVTIVGVPDEPGSAAS
FT                   IFDTVAGAEINIDMIVQNVSTEGTGRTDISFTLPKTDGPTAMAALSKIQDNVKFKGLLY
FT                   DDHVGKVSLIGAGMRSHPGVAAGFFAALGQAGVNIEMISTSEIRVSVVCRDTDLDAAVR
FT                   AIHEAFELGGETEAVVYAGTGR"
FT   gene            294802..295863
FT                   /locus_tag="Sare_0266"
FT   CDS_pept        294802..295863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0266"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: stp:Strop_0227 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96198"
FT                   /db_xref="GOA:A8LYI7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI7"
FT                   /protein_id="ABV96198.1"
FT                   /translation="MASQPTLAVVGATGAVGTVLCELLTGRRNVWGEIRLVASRQSVGK
FT                   TVRCRGEDLTVRGLTPEVFDGVDVAMFDVPDEVSAQWVPTAVDRGAVVVDNTGAFRTDR
FT                   DVPLVVPEINPEQVRNRPKGIIGNANCTTLAMIVAVAPLHREYGLRELVLSSYQAVSDV
FT                   GQAGVDTLHTQLVKIVGDRGLGSRPGDVRQAVGDDLGPFPAPLALNVVPWTGVSSDGGW
FT                   SSDEVTLRNDSRKILELPDLKVTATCVRVPVVTGHSVAVHAVFGTEVDAEGAREVLRNA
FT                   PGVIVVDDPAAGEFPMPIDAVGTDPSWVGRLRRALDDPRALDFFVTGDNLRKGAALNAA
FT                   QIGEILAGELTQP"
FT   gene            complement(295867..297369)
FT                   /locus_tag="Sare_0267"
FT   CDS_pept        complement(295867..297369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0267"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG:
FT                   stp:Strop_0228 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96199"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI8"
FT                   /protein_id="ABV96199.1"
FT                   /translation="MGRPDLLATLDHGTGTPGPPPTWDNIHVDHERVIRDGTARLSMAS
FT                   NVTEACQWTVAALARYAPATISVLLEVHDRLRCIAATGSWQVFSTVPPATGVVGRVHTT
FT                   GHTVVATDVAADPDHLPVRPDVTSEVCVPVPGPSGRPVGVLDLLWSEPADLAAWRNTAE
FT                   RLAERLGARIVALGGPPTETRGEKLLRHAAALATAPTEWELRHAAVTAAREVSTLSAAV
FT                   LVLAGHRGPRLAEPTTTPSELEARIRASLSEAGSGALGRMVDLAHRYGAGYTLGETGQP
FT                   TGDDHAALARAGVRTLVAVPVGSADDAGLLLVADERRLRPDPTTVNLMELLAGQACSAL
FT                   DRLHAVARLREQASSDPLTGLRHTGPFGERIAAATPGRTALLAIDVDGFKSVNDTYGHQ
FT                   AGDRVLVDLARALEGALRQNDELYRTGGDEFVAVIEVNRPEEAVRVAERLTEAARRIGR
FT                   TISVGVALPHPDEPADRTLHRADQALYRVKREGRDGVRMAAA"
FT   gene            297577..299280
FT                   /locus_tag="Sare_0268"
FT   CDS_pept        297577..299280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0268"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: stp:Strop_0229 5'-nucleotidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96200"
FT                   /db_xref="GOA:A8LYI9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041831"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYI9"
FT                   /protein_id="ABV96200.1"
FT                   /translation="MAIPGMRRAVIGLTALAVTAFGAVATTPEQADAGPKPVDVTLLAL
FT                   NDFHGHLEPPGGSSGTIDGQPAGGVEYLATHLAELREANKKKNTITVAAGDLIGASPLL
FT                   SAAFHDEPTIEALSKAGLDYASVGNHEFDEGSDELLRIQHGGCHPVDGCADGTPYRGAG
FT                   FQYLSANAFVTETGRPLLPPYAIHKVRGVKIGFIGMTLEGTPEIVSPDGVAGLTFADEA
FT                   RTANRYARELRRKGVEAIVVLLHEGGTQAGAGGINDCVDFTGPVVDITNRMDPSIDVVV
FT                   SGHTHQAYNCEVNNKLVTSASSYGRLITDIDLKIDRRTGDVLSATAENLVVTRDVAEDP
FT                   AQTALIDRYQAVLGPVAGREVGETTEAITRTQETLFDSVRGESPLGNLIADAQHWATDG
FT                   DQDAVAAFMNPGGVRADLDAGPVTYEEAFTAQPFSNNLVTLDLTGEQLYCLLEQQFVTG
FT                   RVLYPSDTVRYVADPAGSTAPADDPCAGTRVVRGSLTFADVPVDTGSTYRITVNNFLAG
FT                   GGDGFSVLTDGTNRATGQIDLDALVAYLTATSPVSAPTLDRIRTTVEAGR"
FT   gene            complement(299357..301585)
FT                   /locus_tag="Sare_0269"
FT   CDS_pept        complement(299357..301585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0269"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART: AAA
FT                   ATPase; KEGG: stp:Strop_0230 helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96201"
FT                   /db_xref="GOA:A8LYJ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ0"
FT                   /protein_id="ABV96201.1"
FT                   /translation="MADVTAAPRPALATLEAVLERLTYVNEETGYTVARVATDGGGDLL
FT                   TVVGALLGAQPGESLRLHGRWSSHPKYGRQFEVDSYTTVLPATIQGIQRYLGSGLVKGI
FT                   GPVFAERIVAHFGLDTLRIIEEEPGRLVEVPGLGPKRTAKITAAWEEQQAIKEVMVFLQ
FT                   GVGVSTSLAVRIYKQYGDTSTDVVTKEPYRLAADVWGIGFKTADTIAQAVGIPHDSPQR
FT                   VMAGLQYTLSEATDNGHCYLPEPELVTDATKILDVPADLVARCLDDLVADEGVVRDTLP
FT                   GSDAESVRAVYLVPFHRAERSLASSLLRLLSDGNDRLPHFVGVDWAKALAWLRARTGND
FT                   LAPEQEQAVRLALTSKVAVLTGGPGCGKSFTVRSIVELAAAKKAKVTLVAPTGRAAKRL
FT                   SELTGHPAATVHRLLQLRPGGDASYDRDNPLDVDLLVVDEASMLDLILANKLVKAVPPG
FT                   AHLLLVGDVDQLPSVGAGEVLRDLLAAPTVPRVRLTQIFRQAAQSGVVTNAHRINAGRP
FT                   PLLQGLPDFFLFACDDTEAAAARTVDVACTRIPATFRLDPRRDVQVLTPMHRGPAGSGT
FT                   LNTLLQQRLTPHQEGLPERRAGGRVFRVGDKVTQIRNNYDKGQAGVFNGTLGIVTDLSA
FT                   EEQTLTVRTDEDESIDYDFDELDELAHAYAMTIHRSQGSEYPAVVIPLTTSAWMMLQRN
FT                   LLYTAVTRAKQLVVLVGSRRALSAAVRTVGAGRRHTALNHRLDAATDR"
FT   gene            complement(301801..302100)
FT                   /locus_tag="Sare_0270"
FT   CDS_pept        complement(301801..302100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0270"
FT                   /product="Domain of unknown function DUF1905"
FT                   /note="PFAM: Domain of unknown function DUF1905; KEGG:
FT                   stp:Strop_0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96202"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ1"
FT                   /protein_id="ABV96202.1"
FT                   /translation="MIVTFEAELWNWSARRADSWTFVSLPTDVSEEIRELSGPPRRGFG
FT                   SLRVQVTVGDSTWATSIFPDKERSCYVLPVKRAIREAESIEAGDVATVRIELLE"
FT   gene            302363..303637
FT                   /pseudo
FT                   /locus_tag="Sare_0271"
FT                   /product="hypothetical protein"
FT   gene            303878..304822
FT                   /locus_tag="Sare_0272"
FT   CDS_pept        303878..304822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0272"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-70 ECF type; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: stp:Strop_0232 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96203"
FT                   /db_xref="GOA:A8LYJ2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ2"
FT                   /protein_id="ABV96203.1"
FT                   /translation="MLLSSHEVELFEHSRARLEAIAYRLLGSASDAEDAVQDTFLRWQA
FT                   ADRRHVQTPEAWLTKVLTNLCLNQLTSARARRETYVGTWLPEPVLAGDRMLGPVDTVER
FT                   RESVSMAVLALMERLSANERVVYVLREAFGYSHGEIAEILDLTESNCQQIYRRAKQHIV
FT                   TDRVRTEADASSTRKIVEEFLVAATNGKIQRLVELLADDATSIGDGGGKIPARTTPITG
FT                   ALTVARFLRGLFKPTKAKRDLIGGRPAVYAGVVNGGPAVVFVIGDRVVGVMSLHVTSEG
FT                   ISAIHTQVNPDKLARVTRLWSGSEHGEPLLEAW"
FT   gene            304904..306091
FT                   /locus_tag="Sare_0273"
FT   CDS_pept        304904..306091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0273"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: stp:Strop_0233 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96204"
FT                   /db_xref="GOA:A8LYJ3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ3"
FT                   /protein_id="ABV96204.1"
FT                   /translation="MKHRIVVLGAGYAGATAAGRLARRLHPDGTEITVVNADAEFVERV
FT                   RMHQLATGQRLSPRQLRDIYGGTGVRLRLARVTAVDVDQKIVTLVDEHGADEIAYDTLV
FT                   YALGSTAADHGVPGVAEHAHDVAGKQSALRLRDRLAGLGAGENILVVGGGLTGLEVATE
FT                   IAEARSDLTVAIATRGGLGDWLDAGARRHLRRVFDRLGIAVHEHTDIARVEATSAITGD
FT                   GRTVPARVTVWTTGLAVHPIAAATTLELAETGQVIVDATMRAISHPDVYAVGDAAIADG
FT                   PGGKPLRMSCASGIPMGWQAADAIAARLTDREVPKVSLRYFNQCISLGRRDGLIQFVTA
FT                   DDQAKTSFITGKMAARYKEAVCKGAAWSIVHPTLLLPTRRRLTTTTRKEWRTATA"
FT   gene            complement(306216..306512)
FT                   /locus_tag="Sare_0274"
FT   CDS_pept        complement(306216..306512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0274"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   stp:Strop_0234 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96205"
FT                   /db_xref="GOA:A8LYJ4"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ4"
FT                   /protein_id="ABV96205.1"
FT                   /translation="MSIVKINAIDIIEGHGDEFVERFSARPQKIEHADGFEGFQVLRPT
FT                   DGRTTWLVVTQWRDTEAYDAWYATRPHRAPESVTYADKWELLSFDVLTAADPA"
FT   gene            complement(306509..306877)
FT                   /locus_tag="Sare_0275"
FT   CDS_pept        complement(306509..306877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96206"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ5"
FT                   /protein_id="ABV96206.1"
FT                   /translation="MKSLHELGQELLTRAHEASSGRAAATINEDHRTLKQLVLALRAGS
FT                   ALSEHENPGQATLQLLSGTAVVSTAEAAWRGSAGDYLVIPDRKHDLRAESDAVVILTFV
FT                   KDTDRPEPPAATDSKEQQ"
FT   gene            complement(306892..307548)
FT                   /locus_tag="Sare_0276"
FT   CDS_pept        complement(306892..307548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0276"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: stp:Strop_0236 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96207"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ6"
FT                   /protein_id="ABV96207.1"
FT                   /translation="MYIWLVTSRRTALRQVLHRATGAMTAQQVADEVGWPVETTRLHLE
FT                   ELVGAQLAERVPGAPRGRGRPPMTYRATIGMDTTGPTQYRLLAGLLARTLRDRPNGRAL
FT                   ARDAGQAWAFEHPTDAVDGAPLTRATTALTSRFGAHEFAPTATRTRDRADITLWHCPFL
FT                   DLIADYGDVICSLHDGMVDGITRVAAGTSVTAHLTAFPRPDSCRITLTRRTRREQ"
FT   gene            307774..309033
FT                   /locus_tag="Sare_0277"
FT   CDS_pept        307774..309033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0277"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   stp:Strop_0237 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96208"
FT                   /db_xref="GOA:A8LYJ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ7"
FT                   /protein_id="ABV96208.1"
FT                   /translation="MERLARRLGVTDAVVIGVGAMLGAGVFVVFAPAAAAAGGTGLLIA
FT                   LTLAGFVAFCNATSSARLAARYPESGGTYVYGREQLGPLAGFLAGWGFAVGKTASCAAM
FT                   ALTIGAYLWPGQARLVAVLAVAAVTAVNLRGVGRTALATKALVGVVLGVLTLVAVVGLT
FT                   SGGFALDRIGGPGGVGAHGVLTAAGLLFFAFAGYARIATLGEEVRDPRRTIPRAVPLAL
FT                   GVVLAIYLVLAVVTLGVLGPDRLAASAAPLADVVTAVGLPGLAWVVRVGAAVAVTGVLL
FT                   SLLAGVGRTLLAMARRRDMPFALAAVHRVHQVPYRAELMVAMVVAAVVLVGDVREAIGF
FT                   SSCTVLVYYAITNASALTLGRDPGRRLPVRLFAALGLVGCVTLAVSLPPASVLAGFGVL
FT                   AVGAGWYLLRRRYRDRAERR"
FT   gene            complement(309034..310218)
FT                   /locus_tag="Sare_0278"
FT   CDS_pept        complement(309034..310218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0278"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain; KEGG: stp:Strop_0238
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96209"
FT                   /db_xref="GOA:A8LYJ8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ8"
FT                   /protein_id="ABV96209.1"
FT                   /translation="MAVYSARQLHGLRVIVTGGGTGGHTYPALTTIRTLRARLAEAGAE
FT                   PDVLWVGVAQGLEARVARQEGLPFRAITTGKLRRSPNRQELWRNVSDAFRIPIGVLQAM
FT                   ATVLRVRPHVVLSTGGYVSVPIGLAAWLARRPLVMHEQTLTLGLANRILALVASRVLLS
FT                   HASTLRRLSKRAQARAVVTGNPVRPDMLAGDPAAGRAAYGLEPDLPLVFVTGGAQGAVQ
FT                   VNTMVAEVLPDVLQRCQVLHQCGEYSLARMRQVAAELPTHLRDRYRVVDYIHGQLPDVL
FT                   AAADIVVARSGAGTVAELTALGRPAILIPLVPTSGDEQRQTARHLAESGAARVLTGPDA
FT                   TGDALRAELLTLLDDAQRRHALAEAARHHGRPHAAAAAVAELIDAARRGRPPRN"
FT   gene            310485..310973
FT                   /locus_tag="Sare_0279"
FT   CDS_pept        310485..310973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96210"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYJ9"
FT                   /protein_id="ABV96210.1"
FT                   /translation="MQTFLPYPDFLASARSLDQRRLGKQRVEAIQVLRGLTRPGYGWRH
FT                   HPAVKMWAGYEEALTRYGLDVCAVWCAQGRADTCAATLVADFATARGVSAVPIRTQAEL
FT                   ADAGELPPWLGRDDLHLSHRSSLLRKDPDHYRPQFGDIPPDLDYVWPRSDRSGNSEAR"
FT   gene            complement(311083..311526)
FT                   /locus_tag="Sare_0280"
FT   CDS_pept        complement(311083..311526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96211"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK0"
FT                   /protein_id="ABV96211.1"
FT                   /translation="MYPGYGDRLTWSMDRDGEFTLDGDGQELGRCTTTIHGDRPKTYRI
FT                   QVLTFMRPLSFQQTLIHELTHALTHEFGIGDKPMIEGFCNYVAYLYLEHVRTSDFVRAA
FT                   EAARAIQRMTENPNQAYGVNFRHIRDQLRLDPTQALDWFKSNG"
FT   gene            313021..313818
FT                   /locus_tag="Sare_0281"
FT   CDS_pept        313021..313818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0281"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   stp:Strop_0240 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96212"
FT                   /db_xref="GOA:A8LYK1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK1"
FT                   /protein_id="ABV96212.1"
FT                   /translation="MAVVDAELLVQVAGPVATVVIHNPTRRNAMTPAMWRRLPGLLDQL
FT                   DADPAVRAVVLTGADGTFCAGADLGDLDDLLDAGDASVAVKAEERLAAFAKPTVAAIQG
FT                   ACVGGGCQLAVACDLRIAADDARFGVPPARLGLVYPAPTTRRLARLVGPSTVKHLLFTG
FT                   ELIDAGRALRVGLVDEVLPAAGLDARVGEVTAAVTARSRLSVTAAKEIVDGRADDDRIA
FT                   WWHGQVRASGEAREGVAAANERRPPCFPWSPPTAEPGDRGATG"
FT   gene            complement(313837..315363)
FT                   /locus_tag="Sare_0282"
FT   CDS_pept        complement(313837..315363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0282"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: stp:Strop_0241 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96213"
FT                   /db_xref="GOA:A8LYK2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK2"
FT                   /protein_id="ABV96213.1"
FT                   /translation="MALSQLVGRLIGVREHVVDPGGRGAPRVPHPVPAVVVGGGIAGMS
FT                   AAVVLAERGVPVTVLEAAPTVGGRLGAWPEASPDGTRMNEHGFHAFFRQYYNWRNILRR
FT                   ADPTLGFLRRIPGYPVLSARWPTEEFGTLPPAPPANLLALLLRSPSLRLGDLRAMNREA
FT                   ALPLLSYDPIRTYAEFDDTTADALLTSLRLPDRARAMLFEVFSHSFFNHEAEMSAAEMI
FT                   AQFHFYLLGNPEGLAFDSPGEDHATAIWQPLTRHIERHGGRVVTGTAATAVHRDAAGWQ
FT                   VASTAGTYPARHVVLALDPPALAALVADSPVLAEVAPDLVARMPAFGRPGPPYAVARYW
FT                   CAGDVAPGRAVFSGVSRQPTLDSVTLYHRLERESRRWAERTGGSVVELHAYACEPGVPA
FT                   EELAGRMWTELTALWPEVGRLRICDLRARVAAQAPAFPPGGHAWRPGVRTDADRLYLAG
FT                   DGIRTDFPSALMERSAATGILAANHILRAEGGATEPIHSVRPRGLLSRRG"
FT   gene            315471..317390
FT                   /locus_tag="Sare_0283"
FT   CDS_pept        315471..317390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0283"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: stp:Strop_0242 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96214"
FT                   /db_xref="GOA:A8LYK3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK3"
FT                   /protein_id="ABV96214.1"
FT                   /translation="MRHMTRPFDRAWWTGRRFRGTNDPWAHYVVCGHDALAYWVVKALL
FT                   AAEPQLTRIRITLVVPEYPRTDSPDGRDIDGIEVIRANRLDEATFRDAHLERAEGLALL
FT                   HQDDIGNMQAALCAQEVQPNLRLVVRMFNTGLADAIRQIFPDPAVLSDASMAAPAFVAA
FT                   ALGEIAPAHFRHGGRTLYVARRDDVRPQDVVCSVANTQDPQEVRVLPADETSADVVLAE
FT                   ATGAPPGTEVAARRLRRARRWRQPVVLLLRAIRGFATRKIGAAVLVLLAVIAVLGGLYA
FT                   STADISWGKALYLTLVTALSGQDPDVAKPPGEQILQVVLNLSGLALIPLITAVVVDGIV
FT                   NARLALHARRTLPERSGHVVVIGLGNIGTRVTAQLRDFGVEVVAIDKNPDARGVTVAHR
FT                   LGVPLIVGDAAAEETLHAASVGTCQALVVASTDDGANLRAALTARALNADVQVVLRLFD
FT                   GHFAERVQRSFGIGVSRSVSYLAAPSFAGALLDRAIIATISVGRHALLVTEVPVAEGSA
FT                   LDGQPLAAVGQAGSVRLLAHARAGQRHEWAFDGRLVIVAGDRLTVVARRAGLNALLRKA
FT                   GPRPPGPRPSGPRSPGPSPSGPSPSGPPTGSPPPGPSPPGPPPPRVPEGDLGGAAGRRP
FT                   TPSE"
FT   gene            complement(317051..318118)
FT                   /locus_tag="Sare_0284"
FT   CDS_pept        complement(317051..318118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0284"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   stp:Strop_0243 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96215"
FT                   /db_xref="GOA:A8LYK4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK4"
FT                   /protein_id="ABV96215.1"
FT                   /translation="MRLRPVRPAGWWFDGLLLTGVVALTAVLAAGHLFDLDRAVVDWSD
FT                   AHRPAAAYWIAWTLNYLGQGSPLALIAAGLGVLLAVRLRSARPLLPPVVGYALINLTVG
FT                   ALKVGTARPAPSASTREPFLPPEQTLLLFQHELPLLFTRSYPSGHVVNAIVWYGVIVLL
FT                   LARLLSTYGRTLPPRLAVAARVVPPLVVLTTTTYLGWHWLTDSIAGVLLGLLLDRMLHR
FT                   VPWDDVPLPGRIDQGGRPFISYSEGVGRRPAAPPRSPSGTRGGGGPGGDGPGGGEPVGG
FT                   PDGDGPDGDGPGERGPDGRGPGGRGPALRSRAFSPARRATTVNRSPATITSRPSNAHSC
FT                   RWPARAWASSRTLPA"
FT   gene            318207..319472
FT                   /locus_tag="Sare_0285"
FT   CDS_pept        318207..319472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96216"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK5"
FT                   /protein_id="ABV96216.1"
FT                   /translation="MPNHARRRSGGEGRRLDAVRITSALVDPALLDLPWSTPLVEWPAQ
FT                   HLVALPQGISRHVVRFVRLGGYVYAVKETGERVAEREYDLLRALERIDFPTVEAVAIVA
FT                   DRQTDTGEPLDPVLITRHLQFSLPYRALFSHTLRPETMQRLLDALAALLVRMHLTGFFW
FT                   GDCSLSNTLFRRDAGAFAAYLVDAETGALHRSLSNGQRGEDLEIARVNIFGEALDLQAA
FT                   GLLHESIDPEAVCEEVVQRYERLWHEITYEQQIEREARHDIEGRIRGLNELGFDVAEIA
FT                   VSTIDDGRYLVRPKVVDAGYHTRRLLRLTGLDAEENQARRLLNDLDAYRAESDLTDEQQ
FT                   AAHRWLTEVFEPVVRAVPAHLRRKLEPQEIFAQIIEHKWLLSRRAGRDVGMGPAVQSYL
FT                   ADVLVHRPDEQAVLGVELPTTS"
FT   gene            complement(319652..320764)
FT                   /locus_tag="Sare_0286"
FT   CDS_pept        complement(319652..320764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0286"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: stp:Strop_0245 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96217"
FT                   /db_xref="GOA:A8LYK6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK6"
FT                   /protein_id="ABV96217.1"
FT                   /translation="MTVRVTGKVVTPAGVIRQGCVEINGERITAVAEYPSVRDGYWILP
FT                   GFVDMHTHGGGGHTFTTGDADQARAAAGFHLRHGTTTLLASLVSSPFELMRAATTAYRP
FT                   LVTEGVLAGIHFEGPYLAAARCGAQNPAYLRDPSTDELTELLGLGHGTIRMVTLAPERD
FT                   GATAAIKLLAAHGVVSAIGHTDATYEQTQAAIAAGASVATHLFNGMRPVHHREPGPVVA
FT                   LLEAPSVVCELVADGVHLHDGMLGYVTTTAGVDRAALITDAMAAAGMPDGEYELGGQTV
FT                   TVTTGVARLANDGAIAGSTLTMDAALRHAVATGIAVAEAARMVSTTPARAIGLGDRVGA
FT                   LAPGLRADLVVLDDDLNVVRVMRAGSWLDQ"
FT   gene            complement(320761..321723)
FT                   /locus_tag="Sare_0287"
FT   CDS_pept        complement(320761..321723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0287"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: stp:Strop_0246 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96218"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK7"
FT                   /protein_id="ABV96218.1"
FT                   /translation="MGHAATTSAADREVVVALDVGGSGMKCALVRRDGTVTHTEHHLTG
FT                   AARGPAAVIDTILDVAEALADTARREGLAPVALGLAVPGVIDEAQGVAIWSANIGFRDV
FT                   PLRKLAAARLGMPAALGHDVRVGGLAEARLGAGRSARHVLFVAIGTGIAAAHVIDGAAA
FT                   AGAHGAAGELGHVLVRPGGPRCGCGRDGCLEAVASASAVARRYAELASTAPDAPEASAA
FT                   EVATRAAAGDPLAQQVWTDAVEALADGLATGQALFDVEAVVLGGGLARAGAQLLDPLRA
FT                   ALHDRMTFHREPRLVPAALGAEAGCLGAALLALDDLEKP"
FT   gene            complement(321741..322670)
FT                   /locus_tag="Sare_0288"
FT   CDS_pept        complement(321741..322670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0288"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: stp:Strop_0247
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96219"
FT                   /db_xref="GOA:A8LYK8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK8"
FT                   /protein_id="ABV96219.1"
FT                   /translation="MSYVDAEIASQPDCWRTAAQLASSKADRLPRPGERVAVVGCGTSW
FT                   FMAMAYAARREHAGHGETDAFQASEFPTGRRYDRLIAITRSGTTTEVTDLLAALRGTLP
FT                   TTVLVGDPAAPAAGLADTAVPLAFADERAVVQTRFATTALALLRAHLGDNVAALSADAE
FT                   VAVRAPLPIDPTHIEQVTFLGRGWTVGLAHEAALKCREAATFWAEAYPAMDYRHGPISV
FT                   AAPGRLVWAFGDLPDGLPEDVAATGAAFVHSRTHGCRSVIGNWAAGRTPLDPMADLILA
FT                   QRFAVTLATSRGLDPDAPRHLARSVVLA"
FT   gene            322859..323644
FT                   /locus_tag="Sare_0289"
FT   CDS_pept        322859..323644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0289"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; KEGG: stp:Strop_0248
FT                   transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96220"
FT                   /db_xref="GOA:A8LYK9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYK9"
FT                   /protein_id="ABV96220.1"
FT                   /translation="MDRYARWNALLEMLTDSGRVSVEGAAERLAVSQATIRRDFDQLAQ
FT                   QQMITRTRGGAVANGVSYDLPLRYKTAKHSAEKQRIGAAAAALVSPGTVVGLNGGTTST
FT                   EVARALAVRPDLNTNAEGAQLTVVTNALNIANELLVRSRMKVVVAGGVVRPKSFELVGP
FT                   LGGALLREVTLDVALLGVDAVDPQLGAAAHHEGEAAMNSLMVARAKRVVVIADSSKLGG
FT                   HAFARICPVDRVETLVTDSGAAPEVVAAFRAADVRVVCA"
FT   gene            323772..324191
FT                   /locus_tag="Sare_0290"
FT   CDS_pept        323772..324191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96221"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL0"
FT                   /protein_id="ABV96221.1"
FT                   /translation="MESDTAPTAAEPSGDGWTGDRRGRCAVPPPRSAPDAEAVAAADLE
FT                   TDVAASDDVASPAAGTPTTGLTGRERDILDFEQQWWRHPGAKEQAIRDRFGLTATRYYR
FT                   LLNTLLDNPAALAAEPLLVGRLRRLRSARARDRRR"
FT   gene            complement(324305..324520)
FT                   /locus_tag="Sare_0291"
FT   CDS_pept        complement(324305..324520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96222"
FT                   /db_xref="GOA:A8LYL1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL1"
FT                   /protein_id="ABV96222.1"
FT                   /translation="MLQRLHETGLRAEHAYVAGFVSIGLSFTSWFLSRHLERAGMDRAD
FT                   RWGIFIGEWAPTFFAIGNGLRMIEKR"
FT   gene            324739..325248
FT                   /locus_tag="Sare_0292"
FT   CDS_pept        324739..325248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0292"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0253 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96223"
FT                   /db_xref="GOA:A8LYL2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL2"
FT                   /protein_id="ABV96223.1"
FT                   /translation="MASDVRLEPVSERNLESLLSVAAAEADPTDVMPPVEAPAGWSHAR
FT                   REAFREFHRASFAGMPGPTRTRMYAVLAAGEVVGVIRMTRCDEPGAVETGLWLGRSARG
FT                   QGIGSAALRELLNEAAAAGMRRVVAETTPDNRGALSVLASCGAKLRETDGQVHAELCLD
FT                   ATPPAR"
FT   gene            complement(325269..327515)
FT                   /locus_tag="Sare_0293"
FT   CDS_pept        complement(325269..327515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0293"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: stp:Strop_0254 microtubule-severing ATPase;
FT                   PFAM: AAA ATPase central domain protein; ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96224"
FT                   /db_xref="GOA:A8LYL3"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL3"
FT                   /protein_id="ABV96224.1"
FT                   /translation="MGGPDLVLTASLRPAALDARRGIVRLHPEVLTALGLRPGDPVGLA
FT                   GRRVTAAIAAASEPEGAPGLLHADDLTLGNLGVRDGGEVTAGPVPVTAADRVVLAGPPQ
FT                   VVAAVSPELLRLALLGKVVTTGDDVSLLPQDVLPDAAARGLLTAARQSLANRVGYAWTS
FT                   TLLTVITAEPASPTRVTMDTIVGWEHGPATHGSAAPRAPSPARDTPPPRAAAPTWAEPA
FT                   ALARTTDTPAPSVEELPGLRSQAEELTELLDLGFHHREVLRRLGTTVALGVLLDGPSGS
FT                   GKSALVHAVAARVGARVRSLWGPELAALTNTAAAEQLRAAAAAVRTDGPAVLLVTDVEA
FT                   LAPADVPGPVATVFRQVVAETVAAGAAVVCTTGRLDAVDSALRTPDMLSLRITVPLPDA
FT                   ALRREQLEMLTRRVPLDEDVQLDEVAARTPGFVAADLAALVREAGVRAALRQKTVERPS
FT                   MTMADLHTALEVVRPTTMAASTLELASVTLDDVGDLVEVKQTLTESVLWPLTYPDTFAR
FT                   LGVQPPRGVLLYGPPGCGKTYLVTALAGSGRANVLSVKGSELLSKWVGESERAVRELFR
FT                   RAREAAPTLVFLDEVDALAPVRGQATDGGTADRVVAAMLTELDGVEALRNVVVVGATNR
FT                   PDLIDPALLRPGRLERLVYVPPPDAAARADILRAASRAVPLAPDVDLDALAGDLDGFSA
FT                   ADCAALVREAALAAMRESLTAATVTTAHVTVARTRVRPSLDPAQVAWLAAYAAR"
FT   gene            327697..328332
FT                   /locus_tag="Sare_0294"
FT   CDS_pept        327697..328332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0294"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   stp:Strop_0255 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96225"
FT                   /db_xref="GOA:A8LYL4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL4"
FT                   /protein_id="ABV96225.1"
FT                   /translation="MTDLDSIFTAAFWDQRYSSAGQVWSGDPNRMLVEEVATLVPGTAL
FT                   EVGCGEGADAIWLAEHGWQVTGVDFSAQALARAAERTPASLAGRLTWQQTDIRDWQPGD
FT                   DTRYDLVTASYMHFREALRRSVFAALATRVAPGGHLLIIGHHPSDLDTAVPRPPEPDLF
FT                   YTADEVAEALPAGDWTVLTSAARPRAGTTPDGAPVTVHDAVLTARRIR"
FT   gene            328524..329267
FT                   /locus_tag="Sare_0295"
FT   CDS_pept        328524..329267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0295"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KR domain protein;
FT                   KEGG: stp:Strop_2373 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96226"
FT                   /db_xref="GOA:A8LYL5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL5"
FT                   /protein_id="ABV96226.1"
FT                   /translation="MTTSNSATRVAIVTGGSRGIGRAIVERLASDGYHVVVGYRENRTE
FT                   AEAALQVIREADGNAIAIAADVTDETSVVELFDGAEREFGGVDVVVHAAGVMALAPLAD
FT                   LDLDQLDRLLRVNVRGTFAVDQQAARRVRPGGAIINLSSSLTRFARPGYAAYTASKGAV
FT                   SAITLILARELRGRDVTVNAVAPGPTATALFLEGKDEQTLAQIAAEAPLERLGTPQDAA
FT                   ELVAFLAGPARWINGQVLFANGGAI"
FT   gene            329313..332162
FT                   /locus_tag="Sare_0296"
FT   CDS_pept        329313..332162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0296"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: peptidase S15; ABC transporter related; X-Pro
FT                   dipeptidyl-peptidase domain protein; SMART: AAA ATPase;
FT                   KEGG: stp:Strop_0256 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96227"
FT                   /db_xref="GOA:A8LYL6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL6"
FT                   /protein_id="ABV96227.1"
FT                   /translation="MRSPSAAGWVRRALPTRRRALAAAAAVVLLAAGVAWAVRPTEPDL
FT                   RTEAGLVTVRSGPAGDEPVDLDTTLYLPAEARADAPVPAVLLAHGFGGTKESVRADAEE
FT                   FAGQGYAVLTWSARGFGRSGGQIHLDHPDYEVRDAQRLLDWLAARPEVATDAPGDPRVG
FT                   VVGGSYGGALALLLAATDQRVDAIVPMITWNDLARSFLPESSGKGPGQGVFKQGWAGLF
FT                   FGSGGAAGSGSVGGSSGSVGGSSGSVGGSAPAGSRSADGPTAAGAVDPSCGRFAADVCA
FT                   AYLRIATTGRADQGAVDLLRRSSPAGVLDQIEAPTLLVQGAADTLFPLTEADANARGIA
FT                   AAGTPVRVAWFTGGHDGGDGPKTDSDRVRFLTVQWLDHYVRGEGPAPDDDFTFSRIAGF
FT                   DALDRGLVATGFRTTDYPGVTGTDQRTVPVTGPAQPIANPPAGNPAAITSVPFAGELAS
FT                   LFGGVAVDIPGQHARFESAPLSEAVDVVGTPTVSIRAASPTGEAVLFVKLYDVDGGGAA
FT                   TLPNGQVAPIRLVGLPAAIEDAAPVTVTLPAIVRRIEAGHRLRVVVATSDQAYATPVEP
FT                   AVHTVALATGAVTLPTVTSAPIPTAAVVWRWVLAGLLATIVVGLVVVLAVLRRRHRRRE
FT                   SDIHPAYANVPLAVRELRKEYADGFVAVSNVDFEVHPGQVVGLLGPNGAGKTTTLRVLM
FT                   GLTQPTAGEVYVFGHRLVPGAPVLSRIGALVEGPGFLPHLSGLDNLRAYWRATGRPWAH
FT                   ARFDEALEIAGLGASVHRKVRTYSHGMRQRLAIAQAMLGLPELLVLDEPTDGLDPPQIA
FT                   EMRRVLRRYATGGRAVLVSSHLLAEVEQTCTHAVVVNKGQIVASGPVEEIVGESPSVLV
FT                   EVTDPVAARDVLDRLAGVRVLPDGDGHLVVDTNGTARSEVVAELVRAGIGVDRVVPRRR
FT                   LEDAFLALVGENSRGSGDR"
FT   gene            332162..333061
FT                   /locus_tag="Sare_0297"
FT   CDS_pept        332162..333061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96228"
FT                   /db_xref="GOA:A8LYL7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL7"
FT                   /protein_id="ABV96228.1"
FT                   /translation="MTRTTVAPGAGDSGGTPSGAAAGYRPLATLPFAAEFRRQASRRRT
FT                   QLALGFMALLPLIILIAFQFGSGDDDNGRGEFGSLVEFATSGGLNFTLFTLFVSASFLL
FT                   VVVVALFCGDTVASEASWGSLRYLLAVPVPRARLLAMKLLVALAYSALALLLLAGTALL
FT                   LGTLRYGWGPLRSTVAAQLEPGEGLLRLLAVLGYLAVVLLVVAGLAVLLSVSTDAALGA
FT                   VGGAVLLWILSSILDQITALGVLRTFLPTHYSTAWLGLLSTPIQTDDVVRGTISAVSYA
FT                   TLFWGLAFWRFTRKDVVS"
FT   gene            333060..333245
FT                   /pseudo
FT                   /locus_tag="Sare_0298"
FT                   /product="hypothetical protein"
FT   gene            333402..334571
FT                   /locus_tag="Sare_0299"
FT   CDS_pept        333402..334571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96229"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL8"
FT                   /protein_id="ABV96229.1"
FT                   /translation="MGDGVGQTAAFLYLRRRPQTNRRPVTPKKETSSYSRRGMITGPIA
FT                   GVGMAAGVSILGLGTPAHAAVAGPVALAPSGDTSGESDHRAIQDALTPGGAQVILAPGD
FT                   FHINAPIAMYSNQKLVGSGAGATKIYQVGTSHGISSTSAGSVNYVVIAGITLIGARAAG
FT                   SSGIHLTPDTNPSTAAAFANITNITIEDCVLTNWGDCGVYLGAPIASRITRVQCVNNGG
FT                   DGFYVTKAHLDSDPAVVKAATSLAFDACYALGNAKNGYELDTVSYSSLTGCACDGGRRG
FT                   YALFGCKAVTLTSCGAEVFTTEGFLMKNCTSCSLFGAYAYGGSTAGIHIAGTTTHQTIG
FT                   GAVQSQPGSLTEHFIWTETGTSSVVWGVSRADATANTLNGHVVNLDGTA"
FT   gene            complement(334936..335298)
FT                   /locus_tag="Sare_0300"
FT   CDS_pept        complement(334936..335298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96230"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYL9"
FT                   /protein_id="ABV96230.1"
FT                   /translation="MPGSGRYATRGRAGRPRPPRCRTRPNPYRKDVTAMIHRARRLFSS
FT                   QVRAATFARRRWRGLDPDQVYAYLDRVADELERLTREATTAHAEGELIRQALRQWQSRH
FT                   ADCQHAAATSNSWWHR"
FT   gene            complement(335344..335904)
FT                   /locus_tag="Sare_0301"
FT   CDS_pept        complement(335344..335904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96231"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM0"
FT                   /protein_id="ABV96231.1"
FT                   /translation="MVLVTVSKMSSEASAASAGWAIEQLTAELREMYLAVASATVLLER
FT                   TSAGCAHPAIRQARRSGDDALDLAADAERQLSEGTNRLRAEAGHNAPATIADLVDVLDA
FT                   TRHQLDTAAERIRRLPERITATVRQLADTHGVNQPDPTVETVTGQWSRATEQLTLMAAS
FT                   LSTAVVALSSYTSALSGADAPTA"
FT   gene            complement(336481..337062)
FT                   /locus_tag="Sare_0302"
FT   CDS_pept        complement(336481..337062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96232"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM1"
FT                   /protein_id="ABV96232.1"
FT                   /translation="MSYRGRGYRDGSRREDGYLRNLRYEAPKEGLGKLAERLSEWAGAA
FT                   VGLVAATAIARQGVSVPPTVLAGSGLALGAVSGAAAKATVAAAFDTVKERRRQPRANRT
FT                   ASTGTVAGSVSSEIEKIICMIDKNHQALIGVIDRIGTNHAWLLTTLAGASPSLLQQVNG
FT                   QLADARRAVEEACTLLRLSNDKIRSYLRLV"
FT   gene            complement(337059..337700)
FT                   /locus_tag="Sare_0303"
FT   CDS_pept        complement(337059..337700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96233"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM2"
FT                   /protein_id="ABV96233.1"
FT                   /translation="MPRVIIPVGFSLGPQHRYVRPADPTPESWEVHLGGDILELSEAEV
FT                   GVYGTAFLHIEDHSQLKVNRARLIQELRTAPHPQPDAQRLVDRLIDRGLLLEFDPEGPL
FT                   EELFRRYRLFPTAEGMGSTPEEPEYHRMGHGNRPLVAVHNDAYVMWAFSFLHANLWEAC
FT                   AYFAKADQEELEEGEQPIGLTADRVAREVAVNLPMMIATQCAFLDPVAAL"
FT   gene            complement(337915..338403)
FT                   /locus_tag="Sare_0304"
FT   CDS_pept        complement(337915..338403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96234"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM3"
FT                   /protein_id="ABV96234.1"
FT                   /translation="MIHPAAVPKHRSAGPTAAVVSSSPLSDFPSCTAAPCRKGSAHRHP
FT                   QAGLPQAELTWIVSASTHSVRAVNAAGGRVLVASIEQVKAALGQAADQGTINAQQIRTA
FT                   IEATDQTLARLRAVGAGTNHPLIAEAIARTEQSRQRLVEATALLQSSAQAARNYLNAL"
FT   gene            338620..339906
FT                   /locus_tag="Sare_0305"
FT   CDS_pept        338620..339906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0305"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: stp:Strop_0263 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96235"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM4"
FT                   /protein_id="ABV96235.1"
FT                   /translation="MSSTLAPSGIDPATSPARALVCRACSARYPLVAQHACYECFGPLE
FT                   VDHDTAALAAVTREQIEAGPRNIWRYAGLLPVGQDPATRVTLDPGFTPLVAAPRLAAEV
FT                   GLTAPLWVKDDSANPTHSFKDRVVSVALTAARSLGFTRFACASTGNLANSVAAHAARAG
FT                   VPSVVFIPSDLEQGKVVTTAVYGGDLVAIDGSYDDVNRLCGELVETDEFEDTAFVNVNV
FT                   RPYYAEGSKTLGYEVAEQLGWRIPAQVVIPMASGELLTKVDKAFAELVEVGLVESPAGG
FT                   WRVFGAQSAGCSPIAAALHAGSDTIEPVKPTGIAKSLNIGDPAAGPYALEAVRRTGGWM
FT                   AAADDDEIRAGIRLLARTAGVFAETAGGVTVAVLRTLVESGRLDPTAETVVFNTGEGLK
FT                   TLDAVAGQAGPSHRIKASLRAARDAGLLG"
FT   gene            340146..341144
FT                   /locus_tag="Sare_0306"
FT   CDS_pept        340146..341144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0306"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0264 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96236"
FT                   /db_xref="GOA:A8LYM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM5"
FT                   /protein_id="ABV96236.1"
FT                   /translation="MSISVLPFGPSDDRAIAEAVRIGLASVAEDLPDFPIFCPQRFTGS
FT                   VRHPRPGDAPVHLLAHIDGQAAGLLELELPQLDNTENAAVDLMVHPAYRRRGVGRALLD
FT                   RAVEVAREHRRKRLTAMTVDAVPAGTAFARQLGADSALLDVRRRLDVDRLDQAALAALL
FT                   AEARGPATGYQVVLWRGHTPEEDLADIAYLEGRLLADAPMGDLAWEPERFDAERVRATD
FT                   VALDARGRRRYHAGVRHQASGRLVGWTMLDVGATFDWHALQQITIVDPEHRGHRLGLLT
FT                   KLENLRHLLAHESAVRAIDTFNAAANDHMITINERLGFRVMDRWTNWQLTI"
FT   gene            341197..342870
FT                   /locus_tag="Sare_0307"
FT   CDS_pept        341197..342870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0307"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: aldehyde dehydrogenase; KEGG: stp:Strop_0265
FT                   phenylacetic acid degradation protein PaaN"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96237"
FT                   /db_xref="GOA:A8LYM6"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM6"
FT                   /protein_id="ABV96237.1"
FT                   /translation="MTETPHPLYDRHADTLNRALTAISQRGYWSAYPESPSPRVYGETA
FT                   AADGKAAFEAYLGRDFPLDQAGDGSTVATEVSPFGVDLGVRYPHAAADQLTTAATTALP
FT                   SWRDAGPQTRAGVCLEILDRLHRNIFELANAVQFTSGQAFVMAFQAGGAHALDRALEAL
FT                   AYAYAEMSRHPGTAGWEKAAGKGDPLRMTKTFHVVPRGVALVIGCNTFPTWNSYPGLFA
FT                   SLVTGNPVVVKPHPRAVLPLAVTVRYARQVLAEAGFDPNLVQLAPEAPDEKLASALARH
FT                   PAVRIVDFTGSTEYGDWLEANARQAQVYTEKAGLNTVVVDSTNDFVGMCRNLGFTLSLY
FT                   SGQMCTTSQNILIPRDGIETDQGRKSFDEVAAGIAAAVGKLTADPARGVELTGAIVNDG
FT                   VLERLDEVTKVGEPVLESRTVQHPAFPGAVVRTPTIVRLNADDTATYAREWFGPISFVI
FT                   GTDSTEHSLAILRDTVGEKGALTAAVYSTEDAVLDAAETAAIEVGVHLSANLTGGVFVN
FT                   QSAAFSDFHGSGANAAANAALTDGAYVANRFRIVQSRRHV"
FT   gene            complement(342950..343783)
FT                   /locus_tag="Sare_0308"
FT   CDS_pept        complement(342950..343783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0308"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_0266 protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM7"
FT                   /protein_id="ABV96238.1"
FT                   /translation="MRDGSEAMATQQQTSSSPIDNGMPHSARIYDYWLGGKDNFAADRA
FT                   VAEALMTAIPTVRSMAAENRHFVHRAARYLAGKAGVRQFLDIGTGIPTRPNLHEVAQQV
FT                   APETRVVYVDNDPIVLAHARALMISSEQGRSEYIHADMRQPEMILNHRTLREVLDLDQP
FT                   VALTMIAILMLLQDADDPWRKVRVLMDALPSGSYVAITHPTGDFNPEAVKTAVASAVDS
FT                   GMTLVPRSRDEVARFFEGWELVEPGIVPVMAWQPDDGEPADPHAAYYWAGVARKP"
FT   gene            complement(343940..344449)
FT                   /locus_tag="Sare_0309"
FT   CDS_pept        complement(343940..344449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0309"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0267 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96239"
FT                   /db_xref="GOA:A8LYM8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM8"
FT                   /protein_id="ABV96239.1"
FT                   /translation="MAVRRARVRRVRPTDAARARALRLEMLADSPLAFLETIADAAARP
FT                   HADYTARVAYTSAGVATAQFVADPGGRLVGQAGGTVTPEEPGLTVVYAVYVTPPWRGSG
FT                   LLADLIDAVAGWSRACGRPELMLEVVVGNERAYRAYRRLGFVDTGVRLPHPTIPTLTEL
FT                   QMRRPA"
FT   gene            344699..344902
FT                   /locus_tag="Sare_0310"
FT   CDS_pept        344699..344902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0310"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: stp:Strop_0268 putative cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96240"
FT                   /db_xref="GOA:A8LYM9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYM9"
FT                   /protein_id="ABV96240.1"
FT                   /translation="MAQGTVKWFNAEKGYGFIAVDGGQDVFVHFSAIEMDGYKALDDGQ
FT                   RVEFEIAQGQKGPQAERVRVVA"
FT   gene            345675..347297
FT                   /locus_tag="Sare_0311"
FT   CDS_pept        345675..347297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0311"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: stp:Strop_0269 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96241"
FT                   /db_xref="GOA:A8LYN0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LYN0"
FT                   /protein_id="ABV96241.1"
FT                   /translation="MAKMIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAMVREGLR
FT                   NVAAGANPMALKRGIETAVASVSEELLKLAKDVETKEQIASTASISAGDPSVGEIIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISAYFMTDPERMEAVFDDPYILIVN
FT                   SKISSVKDLLPILEKVMQSGKPLLIIAEDIEGEALATLVVNKVRGTFKSVAVKAPGFGD
FT                   RRKAMLGDIAILTGGQVISEEVGLKLDAVNLDMVGRARKVVVTKDETTIVDGAGDAEQI
FT                   QGRVNQIRAEIDKSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVPGGGVALVQAGKTAFDKLDLTGDEATGAQIVKIALDGPLRQIAVNAGL
FT                   EGGVVVEHVRGIEAGHGLNAATGGYVDLMAAGIIDPAKVTRSALQNASSIAALFLTTEA
FT                   VVADKPEKTPAAPAAPGGGEMDF"
FT   gene            complement(347358..347558)
FT                   /locus_tag="Sare_0312"
FT   CDS_pept        complement(347358..347558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96242"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN1"
FT                   /protein_id="ABV96242.1"
FT                   /translation="MTTDDEQPGPLPFDRLDFGDAEQRAEMDGIDDPPADEPVTLVDEP
FT                   VRVRQPYDQTQKRRNQRPLPT"
FT   gene            complement(347646..348575)
FT                   /locus_tag="Sare_0313"
FT   CDS_pept        complement(347646..348575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0313"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0270 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96243"
FT                   /db_xref="GOA:A8LYN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN2"
FT                   /protein_id="ABV96243.1"
FT                   /translation="MNLTITELAPDRLPAVVELCGRALDLPDDSAEAAPIVDTLWPRAA
FT                   ANRPVVPVGAYRDDQLVGVLLGSVTALGGPPGHVDLIAVDPAHRRRGVARALLARAEQR
FT                   LAGLGATEVLLAGNPPFYAWPGIDVRYTPAICAAEALGYARDSTAWNMTADLSDDGSPA
FT                   LRTTAPAEERLAGQGVTVRRAESADLPALTTFASGAFGGTWAAELAGSVGRDRAGCHLA
FT                   ERDGDLLGFAAWGSSRPSWFGPMGTAPAAEGSGIGGVLLRRCLADQRAAGITLAQIGWV
FT                   GPVRFYSGSAGARIERVFFGYRRTLRDR"
FT   gene            complement(348670..351087)
FT                   /locus_tag="Sare_0314"
FT   CDS_pept        complement(348670..351087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0314"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: stp:Strop_0271 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96244"
FT                   /db_xref="GOA:A8LYN3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN3"
FT                   /protein_id="ABV96244.1"
FT                   /translation="MRPGHPQDPAVPSPTGPERSSPGPVVLAVLIGLWIAGLTVVTQFG
FT                   GWLIDQFLLLTGLDRLVWLWPVATVGLVALAGTPTLLLALLPRSRTVRTVGQFWLAATL
FT                   AFGALSLPRALPPVQHEAYLATLAGVAGLAMLLAHRLVGRRVVPSDPGDGSNRSRAARP
FT                   TPVTLLGLAGGLALLLPWVWVGALGGLLETLLAALAATAVGGLAAALLPAAFWSRFASG
FT                   TPPRPGRLVLVGGLVAGVALLLLGAGVGQSGAQLPLLLTLPPAGFALAALAAAARRTAT
FT                   GGAAATAWLVGLSVFGPLAWTDPEEVGLVLAGTRETPFWVAVAAGAGFAVAAVLAVAYG
FT                   VTLARPQGARPGRAVAGVAAATLLVTTGVVAVGLGQPGLHGERLFVVLREQADLSGVPA
FT                   TTGRAGRDNRATEVYQRLVETAERTQADLRRELRRFRLDHTPYYLVNAIEVDGGPLVRT
FT                   WLADRPEVDRVLVSQRVRPLPVPAPVTQGDAPAPRGADWNVRLIGADRVWSELGVTGAG
FT                   VTVGSSDSGVDGGHPALAAGFRGGDDSWFDPWNATSAPSDRGGHGTHTLGSAVGRDGVG
FT                   VAPGAAWTGCVNLDRNLGNPALYLDCLQFMLAPFPPGGDPLTDGRPQRAPDILTNSWGC
FT                   PELEGCDPGALRPATAALAAAGILVVFAAGNTGPRCRSIEDSPAFHPDVLTVGAVDRQR
FT                   RVTDFSSRGPAPGGGAKPDLVAPGADVLSAMPGGGYGVLSGTSMATPQVAGVAALMWSA
FT                   NPALIGDLPRTRRILTATASPVPVSGESCGDEAHVVGAGLVDAYAAVRAAQG"
FT   gene            351370..353181
FT                   /locus_tag="Sare_0315"
FT   CDS_pept        351370..353181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0315"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   stp:Strop_0272 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96245"
FT                   /db_xref="GOA:A8LYN4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN4"
FT                   /protein_id="ABV96245.1"
FT                   /translation="MSRANASQLSPLRRAADLRRLATEHFDVLIIGGGVTGAGAALDAA
FT                   SRGLKVALVEARDYAAGTSSRSSKLIHGGLRYLEQLEFHLVHEALTERGLLATRLAPHL
FT                   VRPVPFLVPLLGGGLRDLPARMLRRSYYGAGVAAYDVFAGVFGGGRGMPLHRHLTREGA
FT                   RRTFPSLKAEGLAGAIRYFDGQVDDARLVVTLARTAASLGATVVSSARAVGLIRQAREV
FT                   TGVRVRDLEAPADSPDAEFEVRARTVIAATGVWSDDMSRMLDDVGLRPRVRVRASKGVH
FT                   LVVPRSAITGETGLLLRTATSVLFVIPWGGHWIIGTTDTDWRLDRSHPAASARDIDYLL
FT                   AQVNTVLDRPLTTADIEGVYAGLRPLLAGEADSTSKLSREHAVIEPMLGLLLVAGGKYT
FT                   TYRVMASDVVDRAARRLGAVRPSRTADLPLLGADGYSAMWRDRADLARRHGVPVGVVEH
FT                   LLERYGSLTLDLLALIGADPLLGSPLAGAPEYLAAEVTYATRAEGALHLEDVLTRRTRI
FT                   SIETAHRGLESAEHTAELMGAVLGWNAEVRAREVAHYRARVAAERNSQLMPDDATADTA
FT                   RLGAPDVRGFPADRGDDDPVESASPSR"
FT   gene            complement(353317..354711)
FT                   /locus_tag="Sare_0316"
FT   CDS_pept        complement(353317..354711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0316"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   stp:Strop_0273 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96246"
FT                   /db_xref="GOA:A8LYN5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN5"
FT                   /protein_id="ABV96246.1"
FT                   /translation="MDPLLDELRAALGTDAVLTDPDLLRAHQRDEADLCAAGAPLVITR
FT                   PRDTAQVAAVVGAAARHHVPVVPQGARTGLAGAANAVDGAVVISTSAMTDILEIDPVSR
FT                   IAVVQPGVVNATLAAAVAEHGLWYPPDPGSWESSTIGGNVATNAGGMCCVKYGVTTEYV
FT                   LGLEVVLASGDVLRTGRRTAKGVAGYDLTRLFVGSEGTLGVLTEVTVALRPAPAESLTM
FT                   VAVFPATTAAGAAVAEIATRGLSPSLLELLDQTHLRAIEAYRPMGLRRDAAALLLAAVD
FT                   TGARAADDLAALAAVCTAAGADEVYAATDAAEAAALLQARRLAHPAMERFAADTYPDGN
FT                   GGLIIDDVAVPRGSLAVMLDGVTRIAAECDVPIGVVGHAGDGNLHPNIVIDRADPASLA
FT                   RGRRAFDEIMQLGLDLGGTCTGEHGVGLLKREWLAREIGPVGLRVHQAIKSALDPTGLF
FT                   NPGKVL"
FT   gene            354844..356121
FT                   /locus_tag="Sare_0317"
FT   CDS_pept        354844..356121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0317"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: stp:Strop_0274 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96247"
FT                   /db_xref="GOA:A8LYN6"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN6"
FT                   /protein_id="ABV96247.1"
FT                   /translation="MWVVPAVARDERPSLVRRLVRRDGGMDIDGARIANAMQQLHHRGR
FT                   ATLHDRLHRVRATFVLSVQAGLAAGLSWLVAHELLGSPQPVFAPISAVGTLAVSVGQRF
FT                   RRTVELIVGVAVGVAVGDLLIFLLGTGPWQLCLVVTSAILLTVFAGGSVAILIQAAATA
FT                   VLIVTLSPAGHNLEIPRFLDALIGGSAALLVTALLLPLNPVRVLNRAARPAMDLLADEL
FT                   DETANGLRERDRDKVQRSSERLRDHKEELATFDEAIQGAKETATLSPARWHRRDELTHY
FT                   AEAADPVERAMRNSSTLARRAVTLIEDAEPIPESMPDSMVHLAESVRLLRHEFAVGEEP
FT                   RRARERSLRAVSEAGRAYKEGVGFSGSVVVAQVRTTASDLLVAAGVAQEEANRLVRDAF
FT                   GELKHGKRPAESEQRTREPPSPPPVG"
FT   gene            complement(356142..357386)
FT                   /locus_tag="Sare_0318"
FT   CDS_pept        complement(356142..357386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0318"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; KEGG: stp:Strop_0275
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96248"
FT                   /db_xref="GOA:A8LYN7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN7"
FT                   /protein_id="ABV96248.1"
FT                   /translation="MTCALAPAPTVTGPLDVLGVPGQINLDYAASAPCAQVAADAVTEL
FT                   LPWYASVHRGAGALSQRCTLAYERARQSVGDFLGARPDDHVVFTRNTTDALNLLARALP
FT                   TGTTVVTFGGEHHANLLPWPRGPVRLPVPDHPAGAVRALDAALGELRRGCDREPPVLVA
FT                   VTGASNVTGERWPLAELARVARRHRARIAVDAAQLAPHAPVDVRTLDVDYLAVSGHKLY
FT                   APFGAGVLVGRADWLDAAPPYLAGGGATGHVGVATHDVRWVTGPARHEAGTPNLLGAVA
FT                   LAAVCDALADADRAALHHTEQQLLSRLRDGLAELPHAVELHAFGPDAPRVGIVSFVLAG
FT                   RDSAEVAARLARQHRIGVRDGLFCAHPLARRLLTEASTRSGRRDLPATALRASIGLGST
FT                   REHVDRLLAALTTLD"
FT   gene            357575..359083
FT                   /locus_tag="Sare_0319"
FT   CDS_pept        357575..359083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0319"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: stp:Strop_0276 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96249"
FT                   /db_xref="GOA:A8LYN8"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN8"
FT                   /protein_id="ABV96249.1"
FT                   /translation="MVWPARRVGGDYADGMADTPPGVPPPSPTAAAPPAAPRMPSRPRN
FT                   WRRFLILAGVILLIAACAVFMVWTLGESLGGEALLIGVIAAVLPVPVLVSCFLWLDRYE
FT                   PEPLRYLVFCFAWGAFVSTAASLAVNSFAADRFEAAQLPTSLTAVLVAPFIEELTKALG
FT                   PILLLIFRRREISGITDALVYCGLSAIGFAMVENILYLGGYGYRTGVEEYGPATGTQQV
FT                   IAIFIVRILLFGFAHPLFTSMTGVGLGIAARTADRRVRVLAPAAGLLLAMMLHGTWNLL
FT                   PTLTQATGQLLILLYGFIGVMVPIFFGMVGLAIWLRSWEGRLTERILPDYVRSGWLTPP
FT                   EVAALSSLGRRHAARVWAKRVGGDPGRKAMRGYQFAATRLALLRDGMRRGLDDRPAERE
FT                   RSVAEERYLLELISGYRAFFVGRDPRAPAGVWDGHQYHLRFPDGSQRAVSAPDEPVVPI
FT                   PVVLAPPPPPPAFPPGYPPPGWHGPPAPGPSGWHGPPTSGPSGR"
FT   gene            complement(359126..359293)
FT                   /locus_tag="Sare_0320"
FT   CDS_pept        complement(359126..359293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96250"
FT                   /db_xref="GOA:A8LYN9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYN9"
FT                   /protein_id="ABV96250.1"
FT                   /translation="MPVLLKKLLFWGFIAFLIYFMAFRPEGAAEMVRAIGAVLMALAQG
FT                   LGDFLTSLMA"
FT   gene            complement(359352..359690)
FT                   /locus_tag="Sare_0321"
FT   CDS_pept        complement(359352..359690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0321"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: stp:Strop_0278
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96251"
FT                   /db_xref="GOA:A8LYP0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP0"
FT                   /protein_id="ABV96251.1"
FT                   /translation="MTNDEDLESGLPIRLLHDRVLVRMEGSEGERRSTAGIVIPATAAV
FT                   GKRLAWAAAVAVGPNVRSIVSGDRVLFDPDDRSEVELHGRGYVLLRERDVHAVAAERVE
FT                   PDSTGLYL"
FT   gene            359707..361170
FT                   /locus_tag="Sare_0322"
FT   CDS_pept        359707..361170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0322"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   stp:Strop_0279 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96252"
FT                   /db_xref="GOA:A8LYP1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP1"
FT                   /protein_id="ABV96252.1"
FT                   /translation="MSRSAVGPWFPSGGDSGHRVTEFPTGLGQRRILSDLTGAAGTLRR
FT                   QEVRLSRFERIRGQFRRAYESLRSRRESAGLRAGTPGSAAWVVPDPTPSAPQPPPASAA
FT                   PSAQPVGVEASAPLHSSTSSRDDADVPHALRVGAAWSWRLLAIGIVAWALLKIVGQIRI
FT                   VIIPLAIALLLSALLAPAVGWLFRARFPRSLATAVVLVGGLAAVVGTLTLVVNEFIQGV
FT                   PELSEKSSQGVRQIQDWLRTGPLHLDDRQLDNYINEAEKWINDNTAGLTSGALSTAATL
FT                   AEVLTGTILVLFATFFFLRDGGRIWRFLVRLLPVNARWKVDDAGRASWQTLGAYVRATV
FT                   LVAFIDALGIGIFLVIFEIPFAFPLAALVFLASFIPIVGATLSGGVAVLVALVDSGPIT
FT                   ALIILGVVIGVQQLEGHVLQPLIMGRAVAIHPLAVIVGIAAGVVLAGVTGALIAVPLIA
FT                   VLNTAVRRLAARSVPETPSDAVVVVSKDH"
FT   gene            complement(361249..363348)
FT                   /locus_tag="Sare_0323"
FT   CDS_pept        complement(361249..363348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0323"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; KEGG: stp:Strop_0280 helicase
FT                   C2"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96253"
FT                   /db_xref="GOA:A8LYP2"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP2"
FT                   /protein_id="ABV96253.1"
FT                   /translation="MPDRDDAEPPGGGPAVSADRYRRTVTLPHTASLTSRTSRRSGGGV
FT                   TGTDLLAAAVNAVPGGAARPGQQEMTTAIEAAVSAREHLLVQAGTGTGKSLAYLAPALT
FT                   VDGPVVVSTATLALQSQLVDHDLPRLADAVEPLLGRRPTFAVLKGRHHYLCLARLDNAT
FT                   EEEPGDTLFDQPTPSGTTWLGEAGRLGRQVQRLRDWAEKTDTGDRDELDPGVDDQAWRL
FT                   VSMPARECVGAARCPFGAECFADASRARAREADIVVTNHSLLAVDMLAGRHIVPPHQLL
FT                   VVDEAHELADRVSSAAQAELVPELIDRSTRRARPLLRPETAEALTTAGDALAVGLAEAP
FT                   AGRLTAGLPAPLQEACTLLDAATRAALDAIGEIKADDPDPVRKQQVKAVLDELSGTAQR
FT                   LLDEADHDVAWVERNDVTGRRALVVAPLSVAGTLATHLYEDRTVVATSATLTLGGRFDS
FT                   VARALGLEAPAEAPVTSGPGWQSLDVGSPFDYARQGILYVAAHLPRPSASGLPDAAGAE
FT                   LLGLVEALGGRTLGLFSSRRAAQQAAELLRARTDLPVLLQGEQALPLLVRRFREEQSSC
FT                   LFGVMSLWQGVDVPGDACQLVVIDRLPFPRPDEPLAAARAAAVDADGGSGFAAVSVPIA
FT                   AVRLAQGVGRLIRATGDRGVVAVLDSRLETARGYGPFLRRSLPPFWYTTRPDVARGALE
FT                   RLARA"
FT   gene            363415..363921
FT                   /locus_tag="Sare_0324"
FT   CDS_pept        363415..363921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0324"
FT                   /product="protein of unknown function DUF402"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   stp:Strop_0281 protein of unknown function DUF402"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96254"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP3"
FT                   /protein_id="ABV96254.1"
FT                   /translation="MPSDVVRVIYRKYDGSAHRDYPARRLTEDDLGVWLGVSVGTPSVY
FT                   HGRPSVEQIPFVLLVPHHAWWTGMFNPPPRTSEVYCDIASPARWEDDDTVHLVDLDLDV
FT                   VRRRGSGLVELLDEDEFADHRKQFGYPDEVATEAYAAAHWLFGALGDGTEPFATSYRKW
FT                   LALVV"
FT   gene            364413..365039
FT                   /locus_tag="Sare_0325"
FT   CDS_pept        364413..365039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0325"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   stp:Strop_0282 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96255"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP4"
FT                   /protein_id="ABV96255.1"
FT                   /translation="MKFSFRPNEGAFYELFTRAAQNLVRGTELLNELALPGVVVQSVSE
FT                   RLTEVEHDSDQITHELYKKINSTFITPFDREDIYRLGSLLDDVMDHLEAVGNLLYLYGL
FT                   TQLPSLPREMHELVNVLDQQARLTAAAMPRLRSMRDLEDYWIECNRLENDGDQAYRMLL
FT                   VRLFSGEYDALTVLKMKEVADELEAACDAFEHVANTVETIAVKES"
FT   gene            365043..366047
FT                   /locus_tag="Sare_0326"
FT   CDS_pept        365043..366047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0326"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: stp:Strop_0283
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96256"
FT                   /db_xref="GOA:A8LYP5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP5"
FT                   /protein_id="ABV96256.1"
FT                   /translation="MTPELVAVLAVITVALVFDYTNGFHDAANAIATSISTRALTPRVA
FT                   LAMAAVGNFIGAHFGAEVAKTVGSGLVKLPTGTPSLAIVFAGVIGAIVWNLITWYYGLP
FT                   SSSSHALIGGLVGSTVAASGTVLWTGIGRSVVLPMILSPMVGFLLGYIVMLAVQWIFRR
FT                   GHPGKLNRGFRWAQSASAAAMSVGHGMQDAAKTIGIVVLALFVGGFQDDPSFIPEWAFW
FT                   TSAAVLAAGTYAGGWRIIRTLGRKIIDLRPPEGFAAETVASSVLYFNALVLGAPISTTH
FT                   TITSAIMGVGATKRLSAVRWGVAGNIVGAWVLTFPAAGSIGALMYFLVRPLFS"
FT   gene            complement(366107..367075)
FT                   /locus_tag="Sare_0327"
FT   CDS_pept        complement(366107..367075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0327"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   sma:SAV5916 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96257"
FT                   /db_xref="GOA:A8LYP6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP6"
FT                   /protein_id="ABV96257.1"
FT                   /translation="MTRWGILATGHIAGRFAEDLKRVPGAELMAVGSRTAESAERFAGR
FT                   HGARRWYASWSELAADPDLDVVYVATPHAAHHAAALTCLRAGRAVLLEKPFTLDLATSR
FT                   DLVETARDAGVFLMEAMWMRTNPLVRRMCELVADGAIGTVVNVRGDFGVAGPFSPEHRM
FT                   RARALGGGALLDLGVYPVSLAHLLLGVPDHVSAWAKVSPEGVDENTGIVLGYDTGAIAT
FT                   LSCGIMATTAITAAITGTKGRIDLSDPFFRPSSLTLHRDATAPETIHADIVGNGYQDEA
FT                   AEVQRCLAAGMLESPLVPHTATLEVMALLDRIRAQIGVDYS"
FT   gene            367147..368040
FT                   /locus_tag="Sare_0328"
FT   CDS_pept        367147..368040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0328"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: stp:Strop_0284 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96258"
FT                   /db_xref="GOA:A8LYP7"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP7"
FT                   /protein_id="ABV96258.1"
FT                   /translation="MTSDGDGFPVPPVVVEHARRFREQGGNPAVPRVAATVLLLRPTGG
FT                   AAVAGGGADRQGGSATVVSASPDGFEAYLIRRVAAMAFGGVYAFPGGGVDPSDSTAHVD
FT                   WAGPTPAQWGARLRLAPTAAQAVVCAAAREVFEEAGVLLAGPDADTVVGDVSGDDWESA
FT                   RAALERREVGFAGLLAERGLTLRSDLLLPWSRWITPEFEPRRFDTYFFVAQLPVGQRTR
FT                   DVSGETDRTLWITPADACAAGELTMLPPTLVTLGQVAACQNLAGVVAAAATRDSASPVT
FT                   PRLEDTGTGPPRFLLR"
FT   gene            368240..368884
FT                   /locus_tag="Sare_0329"
FT   CDS_pept        368240..368884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0329"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   stp:Strop_0285 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96259"
FT                   /db_xref="GOA:A8LYP8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP8"
FT                   /protein_id="ABV96259.1"
FT                   /translation="MVRSGYDEQLDRLTGALAVMSREATAAIRGAGTALLDVDQEAAES
FT                   VVQNDAVLDQLRWDIEAAVPELLARQQPVASDLRLVLCAIRIAGDLERMGDLAVHIAKI
FT                   VQMRYPNMVVPPPAAAVVAEMAEAAARIAEKASTVLATRDPLTAMQIGLDDDEVDTAQS
FT                   RLLSLLLSGWQYGVESAIDLALVGRYYERYADHAVNVARQVVYLVTGTIRL"
FT   gene            369171..370127
FT                   /locus_tag="Sare_0330"
FT   CDS_pept        369171..370127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0330"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   stp:Strop_0286 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96260"
FT                   /db_xref="GOA:A8LYP9"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYP9"
FT                   /protein_id="ABV96260.1"
FT                   /translation="MNRNVLSRRVIAGAALAALALTGCSSNNDTASDGDKLSGEVKVNG
FT                   SSTVAPLSEAAATFYKETQSDVNVSVGTSGTGGGFERFCKGETDISDASRPIKDSEKEA
FT                   CAAAGIEYKELVVANDALTVVVSKDNDWADCLTVDQLKTIWEPDSKVTNWKQIDPTFPD
FT                   EPLKLFGPGTDSGTFDYFTDEINGEEGASRTDYTASENDNVVVQGVAGTKGGLGYFGFT
FT                   YFEENADKLKALKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYVSDAGVKKEQVADFVT
FT                   FYIERIDDIVLEAQYVPLTEEQKSTLKTEFDALKAAA"
FT   gene            370129..371076
FT                   /locus_tag="Sare_0331"
FT   CDS_pept        370129..371076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0331"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: stp:Strop_0287
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96261"
FT                   /db_xref="GOA:A8LYQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ0"
FT                   /protein_id="ABV96261.1"
FT                   /translation="MATSTSNAGSTAGSALRRGRRRPVDSTVKVLLVVAALVSVVTTIG
FT                   IVIALVQPTIGFFRQVSIIEFVTGTSWTPTFAQKAYGVLPLVAATFVVTGIALAIAVPL
FT                   GLGSAIYLSEYANPRTRRVLKPIIELLAGVPTVVYGFVALFALNPLLQKWWPTDTGPAF
FT                   QNLLIAGIAMGIMIVPTIASISEDSMAAVPRSLREGAYALASTKMQVSTRVVVPAAISG
FT                   IVAAVVLGISRAVGETMIVTIAGGLTSDRIVLNPLEGAATMTAFIANISSGDIPVGSLD
FT                   YDSVFAVGALLFLITFALNAVSIRMVRRFREVYE"
FT   gene            371073..371996
FT                   /locus_tag="Sare_0332"
FT   CDS_pept        371073..371996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0332"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: stp:Strop_0288
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96262"
FT                   /db_xref="GOA:A8LYQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ1"
FT                   /protein_id="ABV96262.1"
FT                   /translation="MSTPTLTTTTTRPDPSAPGNALTQRRSRPGEVAFRLAMQACLLVA
FT                   FGVLTALLAWVLVKGWNRLDSRLWTEMPTGLVSRLDTAGVQSALVGTLWIISLVAVICL
FT                   PIGILSAIYLEEYADNTRWYNRLLELNIQNLAGVPSIIFGILGLGIIARALGLGFTVIT
FT                   AAIVLSLLVLPVVIIATREAIRAVPQSIRHASYALGATKWQTVSRQVLPSAVPGIATGS
FT                   ILALSRAIGEAAPLIVLGAVTFITFNPDGLDSGYTALPIQIYTFITRSQSEYTELAAGA
FT                   IVLLLAIVLAMNSIAIFVRNRFEKRW"
FT   gene            372005..372925
FT                   /locus_tag="Sare_0333"
FT   CDS_pept        372005..372925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0333"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: stp:Strop_0289 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96263"
FT                   /db_xref="GOA:A8LYQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ2"
FT                   /protein_id="ABV96263.1"
FT                   /translation="MTDHRLPRPTPSDSEVSTVNPTDTTSRPGVSIAGVGAQPTTAPLS
FT                   EAADPVMELSGVSVYYGAYEAVRDTTMPIQEKQITAMIGPSGCGKSTILRSLNRMNDLI
FT                   PGARVAGSVSYHGQDLYARDVDPIEVRRRIGMVFQKPNPFPKSIYDNVAYGPRVTGMKV
FT                   SNMDDLVEKALRDAALWDEVKDKLKTSGLALSGGQQQRLCIARTIAVRPEIILMDEPCS
FT                   ALDPIATAKIEDLMSELSNDYTIVIVTHNMQQAARVSHYTAFFTAEVDEQQERHGRLVE
FT                   FSQTGKLFTNPADKRTEDYITGRFG"
FT   gene            372943..373668
FT                   /locus_tag="Sare_0334"
FT   CDS_pept        372943..373668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0334"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: stp:Strop_0290 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96264"
FT                   /db_xref="GOA:A8LYQ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ3"
FT                   /protein_id="ABV96264.1"
FT                   /translation="MNNLVESTTGDYRAEGRFLLLVVDDDETAGPALVTELSTLRVQGR
FT                   YYPHAAEALLAAGALQPDAAVVSAGLTTMASTDLVRLLVGQAGIPTLVGVGDDDGSVVV
FT                   GALRAGATACVRRPYRLDEVVPILRGIRPETAGTLDPPVELGGLRMEPATYEVTLHGRP
FT                   VPLPLKEFRLLYFFMTHADRTVSREQLLSAVWGGSTGESSNTLTVHIKRLRKRLETEGE
FT                   QQPLIITVRGLGYRFTPSE"
FT   gene            complement(373890..374813)
FT                   /locus_tag="Sare_0335"
FT   CDS_pept        complement(373890..374813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0335"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0291 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96265"
FT                   /db_xref="GOA:A8LYQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LYQ4"
FT                   /protein_id="ABV96265.1"
FT                   /translation="MNSTEPDSARVTRTDRLDPPEIADVLTLARAAGDADGADPFDEHT
FT                   LLRLRDPHAPAHHLTVRAADGILAGYAHLDSTDPAAGTGVELAVHPTYRRQGIGRALAR
FT                   AVRATVTGPLRAWAHGDHPSAAALAVDLGYRRARVLWQLRRPLSAPIPQPPLPEGVTLR
FT                   AFRPGTDDDAWLALNARAFADHPEQGRWTSADLRARRDEPWFDAAGFLLAVDPAGHLRG
FT                   FHWTKVHERPGSPRIGEVYVLGVDPQAHGGGLGKALTAAGLAYLRDRRGLDRVMLYVDE
FT                   SNTAAVALYERLGFARWSAHVNYQRS"
FT   gene            complement(374839..375693)
FT                   /locus_tag="Sare_0336"
FT   CDS_pept        complement(374839..375693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0336"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   stp:Strop_0292 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96266"
FT                   /db_xref="GOA:A8LYQ5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ5"
FT                   /protein_id="ABV96266.1"
FT                   /translation="MCGGTAVQTKGGRASRSLALKALVVTAILGSAFAFGRSLAPDRAS
FT                   VTTAATPLPTAEALAPRAPTTGDDPTTAGSPESPVVDGSHSYDVRRVTGTSTVALTFDD
FT                   GPDPRYTPQILRTLREFGVTATFCVVGRKAHAHPELIRAIVADGHTLCNHSWDHDIALG
FT                   SRTPDQIRADLLRTGDAIHAAVPGVPIAYYRQPGGAWTYPIVSTARELGLIPLHWTVDP
FT                   WDWQAPGADAIAASVLDHVGPGAIVLLHDSGGPRQGTVDALYQILPELTAWYYVAALPP
FT                   GTT"
FT   gene            complement(375767..376486)
FT                   /locus_tag="Sare_0337"
FT   CDS_pept        complement(375767..376486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0337"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: stp:Strop_0293 putative two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96267"
FT                   /db_xref="GOA:A8LYQ6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ6"
FT                   /protein_id="ABV96267.1"
FT                   /translation="MIVEILLLVTARAGEPSAVLPALDLLPHSIRTAPRDVRTLVAGPS
FT                   PDAVLIDARSELSEARATCRMLHATGLNAPLLAVVTEAGLIALNADWGVDDVVLASAGP
FT                   AEVEARLRLVVGRRNDTVARADSSVRAGELTIDPETYAAKLKGRPLDLTYKEFELLKFL
FT                   AQHPGRVFTRDQLLREVWGYDYFGGTRTVDVHVRRLRAKLGSEYESMIGTVRQVGYKFV
FT                   VPPSRALPEKEPAPASV"
FT   gene            376730..377758
FT                   /locus_tag="Sare_0338"
FT   CDS_pept        376730..377758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96268"
FT                   /db_xref="GOA:A8LYQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ7"
FT                   /protein_id="ABV96268.1"
FT                   /translation="MLPSSRPETGREPWPDQPPGGPPAPRAGDDEGRPERGGPRRGRHE
FT                   GEPGHRSAGDPDDGDQDEEETPPVEVRRSLALAVAGFAALLGTGLVLAAQTSGPGHRLP
FT                   FTAVVLGVQLLSVLAWTMAARPPALLTVAGVGAVAAIVADTVAVRSDPARLMPLVQVLL
FT                   VGLVAAVLGQLVRRVDRAQVTDSLRGTLLIVAGAVSFATMIVLTRIPMGTQAITVCLAA
FT                   AGVALAVARSIDAFAAWPRLAPQVPRGAAGVVSGAMVGTLFSAALGSYLVTPFTPTRAA
FT                   IMGLVAAVVAVLADLAVGYAEAGRLMAGESSPRWAATHMQGPLTGFALAAPAAYVMCKL
FT                   VL"
FT   gene            377843..378631
FT                   /locus_tag="Sare_0339"
FT   CDS_pept        377843..378631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96269"
FT                   /db_xref="GOA:A8LYQ8"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A8LYQ8"
FT                   /protein_id="ABV96269.1"
FT                   /translation="MTEEHPYQGERPQRQRGRRVLVVLLVLLLVLIGLLVTADRVAAGM
FT                   AERALADQVRTEIAQQNVEAGPPEVEIGGFPFVTQVLDGRYKRISIGLREVRGSVQGDV
FT                   LALPTLDIDAHDVTASLDTLRSGQGEVVAGSVTGTGTVSYDSLAARLDQEGLRLGERDG
FT                   KLVVTAPVDILGERLPVTGTADLKVDQGRVALRFTNLTAEGMPSGPLARVLLNNFAQGI
FT                   SVDVPLPELPFDLTVREVRPLPEGLQVTAEAAEVPINAAG"
FT   gene            378990..379838
FT                   /locus_tag="Sare_0340"
FT   CDS_pept        378990..379838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0340"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: stp:Strop_0296
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96270"
FT                   /db_xref="GOA:A8LZA4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA4"
FT                   /protein_id="ABV96270.1"
FT                   /translation="MSRDTALVSADWAEKNLDTPGVVFVEVDEDTSAYDTGHLPGAIKL
FT                   DWKTDLQDQVRRDFVNKDQFAALLSERGIANGDTVILYGGNNNWFAAYAYWYFALYGHR
FT                   EVSLLDGGRKKWELDARPLTKEVVSRPATRYVAQEPDNTIRAFRDEVVAAIGTKNLVDV
FT                   RSPDEYAGRLLAPAHLPQEQAQRAGHVPTAISVPWSKAANEDGTFKSDQELRKIYADAG
FT                   LDDGRETIAYCRIGERSSHTWFVLQELLGHQNVKNYDGSWTEYGSLVGVPVALGDEPGE
FT                   E"
FT   gene            379835..380170
FT                   /locus_tag="Sare_0341"
FT   CDS_pept        379835..380170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0341"
FT                   /product="protein of unknown function DUF1416"
FT                   /note="PFAM: protein of unknown function DUF1416; KEGG:
FT                   stp:Strop_0297 protein of unknown function DUF1416"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96271"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010814"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA5"
FT                   /protein_id="ABV96271.1"
FT                   /translation="MIVMTASPAAGCAAPDQAAPLPASLDLEKETVITGVVRSAGGEPV
FT                   PGAYVRLLDATDEFTAEVITSPAGQFRFFAAPGTWTLRALSRHGNGDIAITASRGINEA
FT                   AVTVAVE"
FT   gene            complement(380196..380522)
FT                   /locus_tag="Sare_0342"
FT   CDS_pept        complement(380196..380522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96272"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA6"
FT                   /protein_id="ABV96272.1"
FT                   /translation="MTATEVDDRPRFVVHLTLHADNLAGARLLARSLARSLTFLPELVL
FT                   GETTISVNGAPDVHHQVFCDRLLDGGWRCLLRPDHDGDCSRRFLQPITGRARHDRTTAA
FT                   RNRR"
FT   gene            complement(380519..380923)
FT                   /locus_tag="Sare_0343"
FT   CDS_pept        complement(380519..380923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96273"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA7"
FT                   /protein_id="ABV96273.1"
FT                   /translation="MVDMRNPFRRFRRWKNRPAPRHPTARGSALISGNVGHHAVDASHV
FT                   DGRRQAVGNAGGHYRSAARWPLSPGQVRGRQFTPARRGIDPTEVELFLSRVADDLAALH
FT                   AELGRTRDENVRIKRALRDWQSRFTPGVRV"
FT   gene            381125..381364
FT                   /locus_tag="Sare_0344"
FT   CDS_pept        381125..381364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0344"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   stp:Strop_0299 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96274"
FT                   /db_xref="GOA:A8LZA8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA8"
FT                   /protein_id="ABV96274.1"
FT                   /translation="MPATPDYIRISDEIIADIRSGRYKAGDKLPSIAQLCQQYLVSPST
FT                   IQLVNVRLEALGVIDRRQGKGIFVTDPKTWLRKP"
FT   gene            381999..382235
FT                   /locus_tag="Sare_0345"
FT   CDS_pept        381999..382235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0345"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   stp:Strop_0299 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96275"
FT                   /db_xref="GOA:A8LZA9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZA9"
FT                   /protein_id="ABV96275.1"
FT                   /translation="MPAVPDYLRISNQIMSEVESGKLKPGEKLPSIAQLCELHQVGAST
FT                   IRQVFIRLEALEVIDRHQKGVFATDPKTWLRKP"
FT   gene            383168..386074
FT                   /locus_tag="Sare_0346"
FT   CDS_pept        383168..386074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0346"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   nfa:pnf2310 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96276"
FT                   /db_xref="GOA:A8LZB0"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB0"
FT                   /protein_id="ABV96276.1"
FT                   /translation="MATQDVFSAEELSRLRGFPEINRAELVRYFTLTGADEAFVRRFRM
FT                   GRNVLGVAVQLCTLPWLGFVPDEVPTAPAAVVGRLSQQLGIAMGELRGYGEREQTRTDH
FT                   LREVAGYAGWRSMGAAEWKDLDEFLFARAMEHDSPKLLFRLACEYLLSSRVIRPGVILL
FT                   LRRVAAARARARTQTWARVRHLLTDRRCAELDLLLVPDANLGRTPLAWLGVGPSSSSPA
FT                   AVRAELEKLAYLRRLDAHTLDLSMLPAERRRFLAGVGRRLTGQALQRREPERRYPILLT
FT                   LLAQSAVDVLDETLLLFDQAISGREAAAEQKVAAALAERAKGGENRQALLDEILTIVLD
FT                   TGIGDEQVGTLLRTSVGLDRMRAAWAERRERLPRDHGQLSMMDASMSYLRQFAPAVLAA
FT                   VRFAGGPGTEQLLQAVSLLAGLYATGARKVPAGAPVGFVPATWAGYLVAAEQAGDVTAY
FT                   RRYWELAVLVGLRDGLRSGDVFVPGSRRYADPASFLLTPEAWAPQRVEFCHLVGKPVEA
FT                   VDALVQADEELHIALADLESQLAKGDPGEVRLTDDGELIIPPLTAEDVPAEADAVRAEL
FT                   AGMLPRVPIASVLVEVDARTGFTEHLVHAGGKVNRPAELKRNLLYVLIAEATNMGLSAM
FT                   AESCGVPYDMLAWTAEWYFRPETLEAANAAVVNYHHRLPFTQAFGAGTLSSSDGQRFPV
FT                   KGRSITARHLSRYVPRGQGDSTCTHVSDQHSTVDPKVIVATAPEAHYVLDGLLGNATDL
FT                   PVSEHATDTHGATLANFALFDLVGKQLSPRIRDLGKITLYRTGPNADVLARYPRAGGLL
FT                   TRRLNTDLITSTWDDLLRVAASVQGGHATAALVVGKLCSSKRQQNALTSAIKEYGALRR
FT                   TVYAARYLADETYRRRISRQLNKGENLHALRRCLAYAGEGALRRHHEQQTEQMWCRTLV
FT                   TNAIVCWSTEYHSLAAGALRRDGRQVDDEVLARLHHPT"
FT   gene            386471..387451
FT                   /locus_tag="Sare_0347"
FT   CDS_pept        386471..387451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0347"
FT                   /product="secreted protein"
FT                   /note="KEGG: sco:SCO6610 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96277"
FT                   /db_xref="GOA:A8LZB1"
FT                   /db_xref="InterPro:IPR019026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB1"
FT                   /protein_id="ABV96277.1"
FT                   /translation="MRRRSIQRIGMALLAAAAVSLTLSTPTAAKPDAGTPMQWREVFSP
FT                   DGTITKMYLPREQTATQLAPADVVAQADVVTIQYSGLSSQRFDMVFIGDGYTATEMDTL
FT                   RKHAQAKWDEIAASAPWNKYKSFINVWLVNVISNESGVDNDPSPGVNRDTALDMYLWCN
FT                   NIERLLCLNEAKARQYANQAPGVDAIVAVGNTAKYGGAGYRDLSTVSGANVLSGQIALH
FT                   ELGHSVGGLADEYYTPGTTYSGGELLAPNATTDSTGQKWASYLGRSTPDGGVIGAYQGG
FT                   EQYEYGIYRPSQDSLMRSLNKPFNLVGLDVMDRAISAKISGGSTG"
FT   gene            complement(387564..390491)
FT                   /locus_tag="Sare_0348"
FT   CDS_pept        complement(387564..390491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0348"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: sma:SAV2729
FT                   LuxR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96278"
FT                   /db_xref="GOA:A8LZB2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB2"
FT                   /protein_id="ABV96278.1"
FT                   /translation="MRHLSASLVGRDNVLQDLAGVLTAARTGRGTAVFLAGESGIGKSR
FT                   LTAAITELAYTSGMSLMRGRASAIGPTPPFRPLTEAVLSHLRVDPVEPAKLGPYGPILG
FT                   RLVPEWSLPESSRDDESLVVLAEAVLRLTGLVGRDRGCLLSLDDLHDADPETLAVLEYL
FT                   VDNVELQPMMLLGALRDEGPAMSMVRAAARRGACQLIDLDRLSRAELAQLAGACLDVEP
FT                   DLVPASAVDLLWAGSSGNPLVAEELISTMVDEGILVGDEHGWQVSGYPEASMSAGLACP
FT                   LSRRVAQLGARARELLSVAAVFGQQFPLNVIQHVTGLADRDLLGLLQNDVAGRLVAPDE
FT                   QAADWYAFHHQLSREAVLAQLDRDEHARLAGALATAVEAIHPGLPREWCEAAARLRVDA
FT                   GDRATAGTLFTEAGRRALALGAANSAVAVLDRALEYLPHDDVATRAGTLELLLQALAEA
FT                   GLVERALASVSELDQAGGLGPRRRAALHTRLAWAATIAGRTEDGLAQVETARALLGSEG
FT                   SAEDLAPIDVVAAHLLLDAAGPDQLAAAERLARQAAEVAESAPLPVVACQAWQLVGGLA
FT                   RHRDPQEATSFLERARTLAVRHGLPICEIHTLIRLGNDDALRVGDLTRLERARAQATQM
FT                   GAVTAQYQAEASIALHTVLHGDLAAAASLTDQVLAATTRLKLLETTQYVLLTRAVLAGH
FT                   RGDRHQMEAELAGFEQWGGDLTLHAPRAYGLAAAFCALLEEDLPRARADLARAVAAEEH
FT                   GSSVYFLSGRHGLHVLLQALAGQAEWPDLEAVAVNPASTLRWDRQFTFFAHAVLHGRSG
FT                   HHDRAAKAMTDALAAGEPYETSRHLGLRLVSEAALTDGWGEPVSWLRIAEDHFHRTDVP
FT                   AVAGACRALLRRAGATVRQRRDGAQGIPNELRSAGVTVREYEVLGLVVKRLGNREIANR
FT                   LHLSPRTVERHVHSLMTKTGLPNRIALAEFGAEFVDSPHAATSGD"
FT   gene            complement(390871..393861)
FT                   /locus_tag="Sare_0349"
FT   CDS_pept        complement(390871..393861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0349"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   ava:Ava_B0238 lanthionine synthetase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96279"
FT                   /db_xref="GOA:A8LZB3"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017146"
FT                   /db_xref="InterPro:IPR025410"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB3"
FT                   /protein_id="ABV96279.1"
FT                   /translation="MPAAGGEVETEPGFAARLADLGMPQDPRLGESPAELAARIRRPAW
FT                   AVLVEDVLAAARPLPSDARPAADWREAFARVLAPFVDAALTQIRRHDGRHVDLDRVAAT
FT                   VGDTLGPRLVGIAARALVTELHRWRAEGRLAGGDSQARFHDFVRQLTAPTGLGEVLARY
FT                   PVLARLLAQDTATTADATVELLDRFGLDRDALIATLLGGTDPGPVTSVLTSRGDRHAGG
FT                   RSVAFVDFDDGRRIVYKPRDLAPHTQLTVILEYLSTATPGLFPRTPRTLARTGYGWAEH
FT                   IAALPLFTWEDADLFYRRQGALLALLHLVRAADVHYENLVAHGDQPVLVDVETLFHPGL
FT                   TPGGSGDPAADALAASVHRTALLPLVFVGEQGVADVSGLGGDPSASPSTVVDWLDAGTD
FT                   RMRLTRRAADMAAAANRPVLNGRLVEPHEHDRAIVGGFRHAYDTFIAHRDALTALVRDC
FT                   ADLEVRVVVRATWMYQTLLDETTHPDVLRDAVDRDRALSVLYHGRTEQPLLAQLLRPEL
FT                   AALWAGDIPMFTASVGTGRIRTTSGAEMPELLPQPGLAAALATLASLDEVSRRGQEWII
FT                   SATLASRARVAPHPDAAPIAAQPEGAAAHPDELLAAACAVADQLVAEANAGGGRVNWLG
FT                   LEAVEDHRWLVLPLGASLGSGYLGVALFLAQLAAVTGIHRYAEQARAATADLPQLVAAL
FT                   DKRPDLVAVIGCGGLDGLGGIAYGLARIGTLLDDSALTDAAARTVPLAMAAATPGASLG
FT                   WSAGLAGCLAALTAVHTELKLPEAADAARRCADLLVAPLTESDGVPGLMYRTHHGVSTD
FT                   RAGGAWPASGGFADGLAGVGWALTTIGPDDHHHAAGRRLATLLGDRGEQVAAGWCRGTA
FT                   GAVLARTALSAATGPRSLAGCVETLANAPVRRDLSLCHGELGVTEVLAQLAGSDRRTLA
FT                   AQALRRRAGLVLDVLRRHGSLCGVPGGARSPGLLTGLAGIGYGLLRHAAPQRVPSVLLL
FT                   QHTMLAP"
FT   gene            394183..394791
FT                   /locus_tag="Sare_0350"
FT   CDS_pept        394183..394791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0350"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: mjl:Mjls_0940
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96280"
FT                   /db_xref="GOA:A8LZB4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB4"
FT                   /protein_id="ABV96280.1"
FT                   /translation="MGEPVRVSVAALDPMLEVGATAALRGSPDMEVVPRSEQARVTVIV
FT                   VDGVDECVLDIVRHTRATASCPEVVLVATDLEPSAALQAIVAGARGVVRRREADPARLA
FT                   RTVLATADGDCILPLDILDQLPEGGAGPLPASSTDPRLSERERAVLRLVADGHETGEIA
FT                   KQLCYSSRTVTSVVHDITRRFRLRNRAHAVAYTLRAGLL"
FT   gene            394788..395375
FT                   /locus_tag="Sare_0351"
FT   CDS_pept        394788..395375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0351"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: mjl:Mjls_0940
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96281"
FT                   /db_xref="GOA:A8LZB5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB5"
FT                   /protein_id="ABV96281.1"
FT                   /translation="MKVQVEAPDSALRADVVTKLRTAGINAVDRPFQVPVVVAAADTVG
FT                   RAIRSCPQPYRTGDYRLLVLADAFDPADVSFALRAGVRAMLSITSEPEKLAAAVHATNQ
FT                   SEGRMPSEVLLKLLHSRVAGNPVSTPSPSPLTPRQTAVLNLMADGHPNVAIATALSCSE
FT                   HTVKNVIYDMMMRLQVNNRAHAVARAIRAGLI"
FT   gene            complement(395561..395752)
FT                   /locus_tag="Sare_0352"
FT   CDS_pept        complement(395561..395752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0352"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: sma:SAV3644
FT                   putative MbtH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96282"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB6"
FT                   /protein_id="ABV96282.1"
FT                   /translation="MTDEDVYRVVLNDEEQYSIWLADRDLPLGWRAEGTAGSKQECLDR
FT                   IQQVWTDMRPRSLREQMP"
FT   gene            395910..399074
FT                   /locus_tag="Sare_0353"
FT   CDS_pept        395910..399074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0353"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; KEGG: pap:PSPA7_2859
FT                   linear gramicidin synthetase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96283"
FT                   /db_xref="GOA:A8LZB7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB7"
FT                   /protein_id="ABV96283.1"
FT                   /translation="MNTASGGVPVDSVGEVSFAQERLWFLDQLRPGTPDYLLPLALRIR
FT                   GPLDVTALTEAFQAIVDRHEVLRTRYVEVDGRPVAHVDAHTKVTIAYTTDHHVLERELA
FT                   RAIDIAEDLPFRLSLARLGDDHLLVFVVHHIAFDGWSWGVLARELAAGYAGRTAEVSKQ
FT                   APQYDGFARWQRERFTDERSRRQLDYWRAQLVGAPAIDLPTDRPRPRTWDGTGDVVRVD
FT                   LSATLLREVDALARSRRVTRFMVLLAAFQIVLARASGQTDFAVGTPVAGRTRVADEDLI
FT                   GLFVNSIVLRADLSGSPTFEELLIRVRDTALGAFSHAETPFERIVTELAPERDLSRNPL
FT                   FQVSFSLLDVRAPMSLPGLDVELVEPPLTGSPLDLFLDINVRTDGTAVARLQYATALFD
FT                   HARVERLARGFVDLLRTIVAEPEISVSGLATRLELGPDGERDRLLHAWNGTAEDLPDGT
FT                   VDGLIAVQAQSTPDAVAVRTTAEDITYAELDTRVNRLAHHLRALGVRSGSLVAVLLDRG
FT                   PDLLTALLAVLRAGGAYVPIDPEYPDARVAFIVVDSAAEVVITRSTLADRVGDTDGKLV
FT                   LLDRDRAAVAARRADAVGPTATADDLAYLIYTSGSTGTPKGVMVHHRALTNFVTSIVRR
FT                   PGLTASQSVVALTTISFDPSLLELYVPLLVGATVVLADTEQARDPQRLTDLVALTRPAV
FT                   LQATPAMLRALLDTGWVPPARLTVLSGGEKLPSELARRLATDGAQVWDLYGPTETTVWV
FT                   TSARLDPAGRVVDWSPQANCTVHLLDRHAEPVPIGSVGELYVGGTCVALGYRGQPALTA
FT                   ERYVPDPYSTTPGGRLYRTGDLARRHQDGSVEILGRADRQVKIRGHRMEPSEIEAALLG
FT                   HDEIRAVAVHPTSTPAGEQQLTAYIVPRGNTPPPVEGLRTFLRRTLPDYMVPAAYVPME
FT                   ALPLTPNGKVDYNALPEPTIRVAVERVSPRTTEERVVAGIWQEVLGSSTQIGVNENFFD
FT                   IGGHSLLATRVAVRLRAQLGIDVPVRGLFDHSTVASLAAALTDYPQVSQRAAMPTLTAR
FT                   RRRVTR"
FT   gene            399086..400378
FT                   /locus_tag="Sare_0354"
FT   CDS_pept        399086..400378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0354"
FT                   /product="diaminobutyrate--2-oxoglutarate aminotransferase"
FT                   /note="TIGRFAM: 2,4-diaminobutyrate 4-transaminase;
FT                   diaminobutyrate--2-oxoglutarate aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: pau:PA14_35890 putative
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96284"
FT                   /db_xref="GOA:A8LZB8"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB8"
FT                   /protein_id="ABV96284.1"
FT                   /translation="MTIALEPITPRETAAPFATFENLESQVRSYCRKFPVVFHHARGAD
FT                   LYSEDGRRFIDFFAGAGTLNYGHNNPFIKRRLLDYLNSDGVVHGLDMYTVAKRQFLTAF
FT                   NETVLQPRGLDFKVQFCGPTGTDAVEAALKLARKATGRAGVIAFSGAYHGMSRGSLAVT
FT                   GSRRARRAGGVSGGDVTFVPYENGPRGSFDSIGLIEHMIDDPSSGVEVPAAVIVEPMQM
FT                   EGGVYPASADWLRRLRRLTEQHGILLIFDEIQAGCGRTGTFFCFEHSGVVPDVVTVSKS
FT                   IGGYGLPLSMSLFRRDLDVWEPGEHTGTFRGNQLAFVAATAACELWGDPKFRTDLAVAS
FT                   RRLERFRTELTSLDSRLTVRGRGMALGIDLGQVGGPERAERLQRYAFDHGLIVELCGRH
FT                   DEVVKVLPPIAIDIVRLNRGLELLRDGLLAA"
FT   gene            400432..401364
FT                   /locus_tag="Sare_0355"
FT   CDS_pept        400432..401364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0355"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /note="PFAM: aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain; KEGG:
FT                   sma:SAV3641 putative ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96285"
FT                   /db_xref="GOA:A8LZB9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZB9"
FT                   /protein_id="ABV96285.1"
FT                   /translation="MANRRHLISIDDLTDADLREIVTRGAEFAAGDAEDARSLADLVVG
FT                   VLFRKTSTRTRTAFSAGALRLGARLITYGPGDLQENTGETVEDTAAVLSRMIDVLVART
FT                   AGPEAELRAYAQQHRMAVVNAMSAAEHPTQALADLTTVVRHFGQVEGLRVLYLGEGNNT
FT                   AAALTLALSRYADTELYLRTPPGYGVHPNVLDRAQASAKRSGAFVEQRHDSTDLPSVDV
FT                   VYTTRWQTTGTTKPTPDWRTVFTPYRVDEAVMASSPGAVFMHDLPAHRGEEVTAAVLDS
FT                   PASIAFTQAENKYHSARAVLEWCAGSAPV"
FT   gene            401385..403721
FT                   /locus_tag="Sare_0356"
FT   CDS_pept        401385..403721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0356"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   mxa:MXAN_3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96286"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC0"
FT                   /protein_id="ABV96286.1"
FT                   /translation="MSGYVELPTGGWRLWSQFALRGPGFPAAGVLALAPAGLAEGADKF
FT                   EVGTDLSGADWTAFETLFSEAMVATAQELQRIAAMPTFRAALAWQNRQLLDSGIAPFLA
FT                   WTPSAAGRTSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGRWDLSTRGITVDPGTGL
FT                   VDASQVYFSSWAIDQVARTVEADPALRPWIPPRRMSFVRRVGRTVTMPGRPPQQILRFH
FT                   GEVLDLCDGVRTAAEIADTLTTPLPAVEEVLAELLRRRWIARRLEVPTSAHPERWLRSA
FT                   VGRVTDRTVRDRALAKLAVVERARDRVHEAGMNVDALAGALADLETDFAALTDHAAARA
FT                   KGARVAPCRSLLYGDARRSATATIGTAILDELTPLGLFLTAARWMTNRFAERVGARIRA
FT                   AYERLRDEHGSVDLGALWFACLPVPHPESAADISAVQAELRERWAQIVDAPPDARRVQV
FT                   NAADVADRVNELFAEPGRGWNIARYVSPDVLVCADDPDAVERGEFSLVLGELHVAMNTV
FT                   GASLFVMQHPDVDSLLAETRRDFPGPRVLPMLPKEQPPRWSARSRPALVRPEDYVVALV
FT                   DHTGDPSRSRNVLAADVRVEDHAGRLVLVLPDGAEFDVLDVFGNALTNRVMDRFTLRGD
FT                   SAHSPRITIDRMVVARESWRVPAAEVQFAHDKSEARRFVRARWWCAGLGLPRFVFVVLP
FT                   TEPRPFYVDFDSPVYVNILAKAIRRLARQDPDARFTVTEMLPTPEHAWLTDDVGDRYTS
FT                   ELRFVAVDQTVGADDTVTGTVGGPQ"
FT   gene            403718..405190
FT                   /locus_tag="Sare_0357"
FT   CDS_pept        403718..405190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0357"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: bbt:BBta_4110
FT                   putative non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96287"
FT                   /db_xref="GOA:A8LZC1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC1"
FT                   /protein_id="ABV96287.1"
FT                   /translation="MTSFLDELVAHGRRRPGAPAIVTPDTVITYGDLVSRIDRLARVLV
FT                   ARGIGPEQVCAVAVERGPQAVVAMAAVLRAGAAFLTLDVELPGPRLETMVRSGQARCLV
FT                   TTSALAGQLGFAFDGLRVHTDEPAPAGAVSLPPIAARSLAYVSHTSGSTGTPNAVLVEH
FT                   RGLNNYLRCVVRDYDLGADTVVLQLAPLGYDASIRDTFAPLVAGGRLVLVPRSTLLRAD
FT                   EFIAAVRRFDVDTILSATPTFLTFVSAHDLPPLRLTVSSGESLRPFLTAGGRARLPGRL
FT                   VNQYGPTEATMTSTRFVVPPDPDTTVDLVGAPIEGVTIHVLDDDLAPVPDGAVGQVWIG
FT                   GIGVTRGYGGRPDLTAERFVPDPLGGPGERMYRTGDLARSRDGILEYLGRADRQIKIRG
FT                   YRVDPAEIEGALLSHPAVAGAAVSTATDDRGRVFLIAHVAGELAEVTDAALRHHLAATL
FT                   PPYMMPRRFARIARVPTTTSGKADRRALTVGL"
FT   gene            405190..406146
FT                   /locus_tag="Sare_0358"
FT   CDS_pept        405190..406146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0358"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: aav:Aave_3217
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96288"
FT                   /db_xref="GOA:A8LZC2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC2"
FT                   /protein_id="ABV96288.1"
FT                   /translation="MATIETTARSGLGIADVRVAAERISRLVRRTPLLALGPDLLLKGE
FT                   HRQHGGSFKLRGAANAMLVLRPTEVVTGSSGNHGIAVATIGAACDVPVTVVMAAGTSEA
FT                   KARAIRARGAQVVRVDGGVAERERRARSIADQSGAVYLPSSDHGLVVAGAGTVGLEVAE
FT                   DAPGVTTIFVPTGGGGLLAGVCLAVDALDHPVRVVGVEPAHTRRYALSIAAGAPVELPP
FT                   STTIADGLRGQRPGAVPLPIVRRRVDELIGVTDDAIVQALGVLRGVGIAAEPSGAVALA
FT                   GAMQSRYVGRTVAVVSGGNTPEALSAGSQAREERKAE"
FT   gene            406143..406376
FT                   /pseudo
FT                   /locus_tag="Sare_0359"
FT                   /product="hypothetical protein"
FT   gene            406388..408598
FT                   /locus_tag="Sare_0360"
FT   CDS_pept        406388..408598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0360"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   mxa:MXAN_3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96289"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC3"
FT                   /protein_id="ABV96289.1"
FT                   /translation="MDNTSVPLGAGWRLWSQFALRGPGFPASGVLRLAPAGLAEAADKF
FT                   GADAVLSGADWTAFEELYGEAAVGTAHELQRVAALPAFQTAVAWQNRPLLSTGIVPFLA
FT                   WTPSAAGRTSMPRQREELVAHYWQRFCVKNDTIGFFGPVGWGHWDMSASGISVTPGIGL
FT                   VESSEVYFSSWAVDAVAKLVNADPELRPWIAPRRVPFVRVDHGSVTVPGRRPQLLPSEL
FT                   LDVLARCDGVRPAREVGSAEQLEELVRRRILVWRLEVPADTRPEVWMRHWLTSVDAAGG
FT                   RAAELLEVLTRGRSRITAAVGPDELKAALSDLESQFVTLTEETAVREKNAKTAPCRSLV
FT                   YSDARRSARVRLGADLRDALAPLELLLTAGRWLTSTIAERVMARAREVFDGPTDLASFW
FT                   FACMPVLHGEAGGIAAQVQEEFWRRWRSVLPPLTGSRVQVSTSRIAAAVREAFAAVDGG
FT                   WTAARYLSPDVLVSDEGELVLGELHVATNTLGASLFVNQHPDPESLLAQTARDHPEPRL
FT                   LPLLPKEHRARLSARIRQTLVRPEDYYVALVDQTADPARPRTVRSADVMVRAHDERLVA
FT                   VLPDGAEFGLVDVFSHVLTTLVMDLFRLVPEADHTPRVTIDRMVVARESWRFPAGAMPF
FT                   VEEKQEARRFVRARRWRRQAELPRFVFVVSPAEPRPFFVDFDAPVYVNILAKAVRRMSR
FT                   QGDPEARLVITEMLPTPEQTWLVDDQGERYTAELRFVAVDDS"
FT   gene            complement(408768..409283)
FT                   /locus_tag="Sare_0361"
FT   CDS_pept        complement(408768..409283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_0282 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96290"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC4"
FT                   /protein_id="ABV96290.1"
FT                   /translation="MERAVVWEVYTSHTESTVTVGGLSAPPASLARVFATVARLGVEPR
FT                   TVVGSGAGVTLVVPRPRGRAIAATLAAKGTPVQLSDSVARVGVRGIGLRVDSAVATTFC
FT                   RAVNAVGVPLAVVSVESTDVSVVCAEHRAEDVAGALAKTFGTATCDVARDHDHRPEPTL
FT                   VVAGGAPH"
FT   gene            complement(409289..416341)
FT                   /locus_tag="Sare_0362"
FT   CDS_pept        complement(409289..416341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0362"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; Thioesterase;
FT                   condensation domain protein; phosphopantetheine-binding;
FT                   KEGG: sma:SAV3642 putative non-ribosomal peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96291"
FT                   /db_xref="GOA:A8LZC5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC5"
FT                   /protein_id="ABV96291.1"
FT                   /translation="MTRTIDRAALRTALLRKRLSGQAGVSPEDAVARVSRGGQLPLSPA
FT                   QRRLWILDRLRPGSAEYLMTTAVRLRGQLCLPALQTALDGLVARHEVLRTRYVDVDGEP
FT                   AQVIDGPEPVALHRRDGLEGLDAVLSTELPTIDLATGPVFRPTLVRLGEDEHALVLTLH
FT                   HIAGDAWSEEVVARELGERYAAAVAGREPEFADLPVQYADFAVWQRERSSGEASTGDLA
FT                   YWREQLAGLSPLELPTDRPRPPVRDGAGALVQVGVSALIATRFARLARDRGVTPFTAFL
FT                   AAFKVLLARYTGQADIAVGTPVAGRSRPETQDMVGLFLNTLVLRTDLSDSPSFLDVLDR
FT                   VRETVLDAQSHQELPFEQVVDELAPVRDPSRSPLFSTMFLTTDRVTGAPSFGDLAVEPL
FT                   PVGEVAAKFDLTLSVIERADGTLGVGVNYATALFEPETMTRLAGHYAHLLQAIVSDPET
FT                   PVGHLELLSAAEREQVVTGWNDTAVDYPSGTLPGLVADQVRRTPQREAVRFDGASLTYA
FT                   ELDARANQLAHHLRSLGVGPESVVGVCLPRSLELVVALLGVHKAGGAYLPLDPDHPAER
FT                   LRYLREDSGATTMIDTDTFAALADRPSHDPGVVVAPAHPAYVIYTSGSTGRPKGVVVEH
FT                   RGIVNRLHWMQQAYGLDATDRVLQKTPASFDVSVWEFFWPLITGATLVVARPGGHRDPA
FT                   YLARVIDSERITTLHFVPSMLRAFLTEPFGGLPSLRRVICSGEALTSDLVASVHDRIGC
FT                   ELHNLYGPTEASVDVTATRCHPGEPVTIGVPIANTRAYILDRDLQPVPVGVPGELTLAG
FT                   VQLARGYLRRPALTADRFVPDPFNPGGRLYRTGDLARRRPDGRIDYLGRLDHQVKINGV
FT                   RVELGEVEHALTEHPTVRAAAVTVDDGQLVAHLVGDPDLSMLPDFLRATMPEVMIPAHW
FT                   LVYEGLPMTSSGKVDRKALSAPDRNRATIDGYVAPRTPLERMIASAVANALNIDKVGIE
FT                   DRFFALGGDSMRAIRVVGTLRAAGVELAVHDLFTHQTVAGLATLAGGAAAEDPLVERFA
FT                   QLSDADRRLLPDSLVDAYPLSETQAGMVYEMLAASDRTVYLNVSCYRIHDELPFDVDTL
FT                   RAAATILVARHEILRTSFDLSTYSETMQLVHAEAELPVTYTDLTGLEPQAQRTTVDEFL
FT                   VAERGRPIDIARPPLLRYHVHDISKNEWWLTHTECHAILDGWSHTSVVNELVSIYRRLR
FT                   TGREPDLTPPPEVRFADFVAAEKRALATTGDREFWATTIGRYDKLELPEGWASQGRDEK
FT                   ATIIDVPWADLAPGLRRLATTADASMKSVLHAAHLKAISIVTGRRRFFGGLVCNGRPEV
FT                   LRGDEVFGMYLNTVPFAADVTAATWRTLVADVFAGEAKLWPHRRYPMPAMRREWSPGGP
FT                   LVDVAFGYLDFHVLDWKADAVGMVDDFSPSELPLEVWTFPGLLRLGGRPSRISRENLEL
FT                   LGRTYRHVLEAMAADPHAGTDISLTTADHDHALRAGGDSARDYPTDELVHQLVERQARS
FT                   TPDAVAIRQAGHTLTYAELDAAANRLAHRLRALGAGPGTLVGLFLTRSPDLVVGMLATL
FT                   RAGAAFLPLDPAYPAERLRYLITDAEVGLLLTEPDLPLPAKVTATVEVVTDHPDLPCTR
FT                   PAVTPSLEDLAYVIYTSGSTGRPKGVGVPHRGALNLRHAQREHLDVRPGDRVLQFASPS
FT                   FDASVWELLMSLTNGAELVLPPRGTDPGDLRQQAGLVTHMTLPPSLLERLSPEDFPHLR
FT                   VLVSAGEACPVDQVVRWSGHARFINAYGPTETSVCATLTEVAPTVTAPPSIGRAIGGVA
FT                   AYVLDSDLRPLSAGVRGELYVGGAGLARGYLGRPELTAERFVPNPYGPAGARMYRTGDV
FT                   VSRNPDGTIQYHGRTDHQVKVRGHRIELGEIEEALNGHPAVASAVVAVHRPGTTDATLV
FT                   AYTRAVDTPPSTAELREYLRTRLPGHLLPAHWIAVDEFALTPAGKVDRAALPAPDGARP
FT                   ELDSTYVAPSTEVERALAGAWREALAVDRVGVHDDFFELGGHSLAMMRIIATLRARDGI
FT                   ELTFRSFIVHRTIAALAATIADEPAGRAMMWLRRSGSAAPLFCVHPGGGSAHWYLRLVP
FT                   HLAPDIPVAAFEWPATHDEIPTAEQMAERYLAELRAAQPRGPYRLFSWCGGSSIATEMA
FT                   RSLTEAGEEVTFILLDPGLDAHTRAEGWQELDYIRRLETLIEHIVADPQADTTDRRTEI
FT                   LALLDHLVDDVDPAVGITLPAQGVGDVWPRSVRIWREVMELDLAYRHNPYSGQLHLVVS
FT                   DELERGEHEVAIGQTFGDYVARWRELVEGGVTVHRVPGDHFGVMKPPHVAELGALLGSL
FT                   TGPS"
FT   gene            complement(416338..422715)
FT                   /locus_tag="Sare_0363"
FT   CDS_pept        complement(416338..422715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0363"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; KEGG: mxa:MXAN_3636
FT                   non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96292"
FT                   /db_xref="GOA:A8LZC6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC6"
FT                   /protein_id="ABV96292.1"
FT                   /translation="MATGDGGFSLSFAQEQLWFLDQLRSGAATEYLLHEAFQVRGPLDT
FT                   GALAAAFTRVAERHEVLRTRYETVDDTALQFIDDPVAVPMEIVDLAEAEDTDAELQRIR
FT                   LAQRIPIDLRTQPPWRVTLVRLGRSESVLLVTVHHIAFDGWSWSILARELGELYGELTG
FT                   GDAAELAEPPVQYADYAHWQREWWASAEDVRNNQLGYWRDTLAGLPPLELPTDRSRPSQ
FT                   WNSDGDSFDFTVPAAMTDEVTLLARAAGATPFMVYLSAFQALLGRYAGQDDVAVGVSVA
FT                   GRNDVQVEPLIGAFVNTIVLRTSLAGAPSFAELLAMVRETTLDAYGHQDVPFDRVVHDL
FT                   APDRDPSRNPVFQVGFAMHNAERIRLTLPGLEVTKLPATWTNSAFDLSLHLSERPDGTV
FT                   HARLMYVTALFDRARIERMAANYLRLLSRALAEPTRPVGRVELVAEPELRQLHEWNRTD
FT                   EPTPRLSLPELFTAQARRTPDAVAVAGAEGELTYAELASRVSALTSFLVSQGVTTEKSV
FT                   GVSLPPGADLVTTLLAVLAAGGVYVPLPPEHPAERLALMVADAGVELVVTNSVLRDQLP
FT                   TVHTVALDSDQALIAAAPPAAPPAVHPGNAAYVIYTSGSTGRPKGVTITHDGIRNRVLW
FT                   SVHRYGMTARDRVLQKTTIGFDASVWEFLSPLVSGGAVVTPPPGVHRDPAAMVEAVSTH
FT                   GVTMLQLVPSVLRLLVDVPQLAGCSSLRLVCSAGEPLPVSLCERLLEVLDVEVVNTYGP
FT                   TECAIDSTAAGFRSGEQGDIVPIGTPLRNMRAHVVDRWDELVPLGVPGELCVSGVGLAR
FT                   GYVGRGDLTAERFRPNPYARVPGERWYRTGDLVRWRDDGVLEFVGRVDEQVKIRGVRVE
FT                   PAEVEAAVRTHPDVGEAVVAARRGELGDLELVAYTVPANGTPVSLESLAAHLADVLPAP
FT                   MIPSNHVGLDVLPLTPNGKVDRAALPEPGVAPASPTSDHVEPTTPTERAVAALMAEVLG
FT                   LERVGAEDDFFSYGHSLLAIRFVLRLRRAFDVELTVGELFTARTVAKLAARIDVAAADA
FT                   AVIPLVPRDGVLPLSFAQQRMWFLDQLEPGSVEYLVPLALRLRGPLDVEALRGAVDAVA
FT                   ARHEMLRTRYVSAGEDPVQVIDPPGPVQFELVDLTGAPESAARALVDHSCSRPFDLAQD
FT                   RPLRVTVVRTGVEDHLVAISLHHVAFDAWSMDLFMRDLRTAYAAIRGGADAPLAPPAVQ
FT                   YADFAAWQRSREAELADQLDYWRERLGGLEPAELPTDRPRPAVRDPRGDTVSVDVPDEL
FT                   AAALHELAGKHGATLFMTLLAGFQLLLGRYTGRTDLAVGTPVAGRTRPETEELLGFFVN
FT                   TLVMRHDLSGDPSFVELLDQVRRCSLDAFANQDVPFEHLVDALAPDRDLSRNPLFQIMF
FT                   ELAHLDRFPTALGDAAIEPLHAGVPVAKFDLTLTVKQRAGGRLRCTFEYATALFDRSTV
FT                   ERLAGHYLTLLTAVVSSPTARLSSFAVLSNAERDVLVREWSDPASTRLPQLDPAGERHL
FT                   TVPELFERQVRRTPEKVAVVFGEQHMTYRELNERANRLAHHLRSLGVGPEVVVGSCLER
FT                   GPDAVVVLVAVLKSGGVYVPFDPDHPAERLDFMLTDANAHLVVTTQAFAHRLAGRRVVT
FT                   VDDDRLAASATTDPGTLPRPHNLAYVIYTSGSTGRPKGVMIEHRSYAHHCRVIGDAYGI
FT                   GSDDRVVLLSALTFDVAMDQTAATLLAGATVVISDPVFWTPSELPARLAEHGVTIMEIT
FT                   PAYYRELLEADVGRLTALRLMNVGSDVVTVADARRWAATGLPARFLCNYGPTEATVTCV
FT                   LHPVAGLDADERDEAAMPIGRPVSGTRGYVLDAKLMPVPVGVPGELCLGGVRLARGYLN
FT                   RPELTADRFVPDPHSGERGARLYRTGDLVRWRPDGTIEFIGRIDQQVKVRGFRIELGEI
FT                   EAALAEHPAVQASVVAVREVGPGEKQLVGYVVPRVGPVPDVAGLRAHLRDRVPEYMVPA
FT                   RWVTLDALPLTASKKVDRKALPAPSAADGERALTAPRDETEAALAAIWAEVLDVEQVGA
FT                   HDNFFELGGHSLLATRVLARIRAAFAVDLPLRRLFEATTVAELAVEIGAAVEADVALLT
FT                   DAEIEALLSEEKGAR"
FT   gene            complement(422746..423726)
FT                   /locus_tag="Sare_0364"
FT   CDS_pept        complement(422746..423726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0364"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: sma:SAV3636 SyrP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96293"
FT                   /db_xref="GOA:A8LZC7"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC7"
FT                   /protein_id="ABV96293.1"
FT                   /translation="MKTSPFPEPPRAAPDAEPVLPFVLTAPDPGTAATSFLATSRDRVR
FT                   QQLREHGAVLLRGFDVGGVDGFDRVVRSVSGPPLSYAERSSPRSTIKGQVYTSTDYPPG
FT                   EEIFLHNENSYQANWPLTLFFYCITPPATLGATPLADTRQVLRSIDPTVRDEFARRGWT
FT                   VVRNFSDGLGVPWQQAFNTDKHAQVEAYCAGNGVEVEWVGRNGLRTTGRRQAIHRHPVT
FT                   GEAVWFNHLTFFHVTTLAEEMCAGLREMFDEVDLPTNTYYGDGARVPDEVVAHLRDCYR
FT                   AAQRRFDWQRDDVLLVDNMLAAHGREPFTGPRRIAVAMAEPFSNA"
FT   gene            424082..425365
FT                   /locus_tag="Sare_0365"
FT   CDS_pept        424082..425365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0365"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV3640 multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96294"
FT                   /db_xref="GOA:A8LZC8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC8"
FT                   /protein_id="ABV96294.1"
FT                   /translation="MTTTAQPRPGTPVPPLRHNRDFLLLWSGTAVSLVGLTVSTIAYPL
FT                   LILAVTGSKAAAGVVGFFSLLPSLLFQLPAGVLVDRWNRRRLMIWCDVIRALGAASVVL
FT                   ALALDELTLAHVVVVGFVEGTMSVFFNLAAHAAVPNVVHPDHLSTALSRNEARSRAATM
FT                   LGTTLGGVLFGLSRALPFALHAVTHVISLVTLLFIRSDFQSDRQVRTRTTGMLAEVGEG
FT                   TRWLWRQPFLRTAALLVAGSNLLFRALFLVVVVMATDVGASPAAVGVLLSVAGAGGVLG
FT                   SLVAGWCQRRLPLSALVVGANWVWAVLMGVIVLTDSLYLLAAAYAAMWFVGPVWNVAVA
FT                   THQLRVTPDRLRGRVLGAMGLLASGALPVGALIGGLLLEWSDARTAALVLAGWMVLLAL
FT                   VATIAPSLRRAIAPVETTTTPDAEPAVR"
FT   gene            425362..426384
FT                   /locus_tag="Sare_0366"
FT   CDS_pept        425362..426384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0366"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: sma:SAV3648 putative cystathionine
FT                   beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96295"
FT                   /db_xref="GOA:A8LZC9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR023927"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZC9"
FT                   /protein_id="ABV96295.1"
FT                   /translation="MIGPVDQGGSSVPGVLSTIGATPIVELTKLNPDNPFRTFAKLESH
FT                   NPGGSIKDRSALEMLRDRIRDGRLVPGKSTVIESSSGNLGIGLAQICAYYGIRFICVVD
FT                   PRTNRQNIAIMRAYGAEVEVVTDIDPNSGEYLPVRIRRVRELVDSITHAYCPNQYANPL
FT                   NPQAHHSTVREVLDALPTLDFLFCATSSCGTLRGCAEYLRRRQLPVQIVAVDALGSAIF
FT                   GSPVGGRLIPGHGASVRPSLYADGLADVVIRVDDLDTVVGCRRLAAREAILAGGSSGAV
FT                   VSALGTMRDRIPPGATCALVFPDRGERYLDTIYDDDWVATHFGDVAHLWKESEVEAASC
FT                   "
FT   gene            426378..427379
FT                   /locus_tag="Sare_0367"
FT   CDS_pept        426378..427379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0367"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   sma:SAV3645 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96296"
FT                   /db_xref="GOA:A8LZD0"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR023866"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD0"
FT                   /protein_id="ABV96296.1"
FT                   /translation="MLILGAREVRAVLDGAEQDVLAAVREAYELHALGRTAVPHSVFLR
FT                   FPPEERNRIIALPAYLGSRTPVAGVKWVSSFPGNLQMGLDRASAAMILNSTRTGLPEAF
FT                   LEASAISAQRTAASAALAAATLGSSDPESGVSQIGCGPISFEVLRYLQVVKPELDRVTL
FT                   YDLDRARAESFAGRASAVWPQLKVEVAERVEDALAAHKLVALATTASVPHLDGEHLRPG
FT                   ALVLHLSLRDLSAETIQASVNIVDDADHVCRAATSLQLAEQRSGGRDFIAASLGEILVA
FT                   GHRYTRDDTTPTVFSPFGLGCLDLAVAAMVRRVAEDRGLGTTLTGFMPSGDA"
FT   gene            complement(427521..431882)
FT                   /locus_tag="Sare_0368"
FT   CDS_pept        complement(427521..431882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0368"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: stp:Strop_0305 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96297"
FT                   /db_xref="GOA:A8LZD1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR033857"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD1"
FT                   /protein_id="ABV96297.1"
FT                   /translation="MFVRPSARSRLGRLAVALGALMLGLTAQPALAASPSDTPERATVA
FT                   PELLDTTDTTTFLVYLRETAPLASTATLQEPDDRARAVHQLLTDTAERTQRGLRQLLDA
FT                   RKAEHTPYWIANAVQVRGDQALVKEIASRPEVAQIEPIRSHPLIQPTPAETAQARTAAA
FT                   EWGIAEIGAPQVWDEFGDRGEGIVIANIDTGVQYDHPALVNSYRGNLGDSFDHAYNWFD
FT                   PAGICPGSEPCDNNDHGTHTMGTMVGDDGAGNQIGVAPGARWIAAKGCEARTCSDPSLL
FT                   AAGQWILAPTDANGENPRPDLRPDIVNNSWGGPSGDPWYQQTVDAWRAAGIFPVFSAGN
FT                   SGPGCGSAGSPGDYPNSYAVGAYGSNGAIANFSSRGSGTDPIKPNVAAPGVAVRSSVPG
FT                   GGYAAFNGTSMAAPHVAGTVALIWSVASSLRGDLTATEALLDRTARDVDDTTCGGTAED
FT                   NNVFGEGRLDAYAAVNEAPRGPVGRVTGTVTSADDGDPIAGVTIDDGTRSTVTGTDGRY
FT                   ALTVPAGETTVTVTAYGYQTQSDTFTVDEGSAVTRNFALVASPVVTVGGHVTDDSGHGW
FT                   PLYARIDIAGKPGDPVFTDPVTGQWSTTVAGDSTYSITATPQYPGYHTVTREVPVGADA
FT                   TTVDLAVPVEQACTAPGYTASYGDPLLTEDFAGTTAPEGWSVVNRTEEGGWVFEDLGQR
FT                   GNLTGGTGGFAIIDSDELGPGNSQDTDLVSPSVDLSGTTAPVLRFSSDWRALGLGDTAD
FT                   IDVSTDGGATWTNAWHQTSSLRGPRVEEVPLTAAAGASDARVRFRFGGSFAWWWQVDDV
FT                   ALLNRNCTPTPGGLLVGTTTDQNTGTPINGVTVTSVNQPEDRADSAATPDDPAESDGFY
FT                   WLFSGLTGTHPFTATRTPYPPATQDVTIVADDVRRADIALAAGRLTVTPTEVESHQPYG
FT                   STRNTRVTVKNTGTAPATVEVLERAGQFELLNAPGAPLREVTLKGISTARTGTTYGDAP
FT                   ADAGPSADDAWTRVADLPAAVFDNSATTLDGKVYSIGGGSGTGTENKAWVYDPDADAWS
FT                   ELPELPSSRAKPGVAAVGGKIYVTGGWGADGNPVATVDVFDPASETWSVLDGATSPAPA
FT                   AAAGTAVAGGKIYLVGGCTDSGCTATDEMVVFDPQTGAFTTAASYPHPVSWTSCGGIGA
FT                   QVYCAGGSGDSAYTDAYRYDPAADTWSQIADMPLDLWGSSHTTAGGMLVLAGGVTDDSN
FT                   SLTNQTVGYDPASGSWQDLPNAEFTRYRGAAACGAYRLGGSPAPFVGSVESERLGGLEL
FT                   CADEADLPWLSTSPSSFTLEPGESLRVQVTLAATAEAGVDQPGRYSGELAFAADVPYSV
FT                   PPVKVEMNVSPPRSWGKLQGTVTGVTCGGETVGVPATVRVNAAGSGAGYTLTADASGQY
FT                   AWWLPKGRYDVIVAKDGWIPEVERTKVKAGFVGTLDFSLEPLSNCTKATGI"
FT   gene            432092..432592
FT                   /locus_tag="Sare_0369"
FT   CDS_pept        432092..432592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0369"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: stp:Strop_0306 putative two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96298"
FT                   /db_xref="GOA:A8LZD2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD2"
FT                   /protein_id="ABV96298.1"
FT                   /translation="MSEGKGPIVVCVSPDMAVRERVLRQLDGVGPVVSCADLAELRVML
FT                   FAEPPADEGRGVNPPLAPVSYGDLVIDPPGHVVTWRGRPLALTRTERMLLARLVTPPVR
FT                   LWSYERLFASVWGGAYLGDTAILHSAMKRLRRKLRLLTGGPRVQTVRGVGYRLIPTSDD
FT                   TGG"
FT   gene            432649..433497
FT                   /locus_tag="Sare_0370"
FT   CDS_pept        432649..433497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96299"
FT                   /db_xref="GOA:A8LZD3"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD3"
FT                   /protein_id="ABV96299.1"
FT                   /translation="MSVVHPGYAPPSGPDRPPSRSRVRRWLLAATAAWAVLLAALAWWS
FT                   ARTDEPTVREQRTIGQAVPVVDDAVGRLVAALDGTAWAMTPSRVEQGCRVTPFSAGTEL
FT                   TRGIDVLVAEGGERDLLARVADSLPERWRAGVRVSSDGPLLRADAGEFVLVEGESRSPG
FT                   RVRFTVLTGCRPTDVEFAGPLPENPPEPALRAALQALGRPVPERSDEVAAPCPGGAKAW
FT                   TQRVAAGAGPAPLSALAPLAAGVVMIDTPEAYAYRLGSGLVVADATGDQLHLAFSTGCA
FT                   D"
FT   gene            433646..434416
FT                   /locus_tag="Sare_0371"
FT   CDS_pept        433646..434416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0371"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   stp:Strop_0308 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96300"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD4"
FT                   /protein_id="ABV96300.1"
FT                   /translation="MSGENLQFTVLGCATPYPSVDNPCSGYLVSGGGARVWVDAGSGTL
FT                   AQLQRHVRLDELDAIWVSHLHADHSADLLTAYYGALYADIQLAAPIPLYGPPGIADRLA
FT                   HFLTNTATRSPIESAFAVEELHDGHRVAVGALTLTSHAVAHGIPAFALRVDVGGRSLAY
FT                   SGDTAPCPGLTSLARGCDVLLCEAESAQAPSKGERVHHTPEDAGDTARVAEARRLIVTH
FT                   IGRFLTPQQAVARASTRFDGPIDFAAPGATHSID"
FT   gene            complement(434571..434945)
FT                   /locus_tag="Sare_0372"
FT   CDS_pept        complement(434571..434945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0372"
FT                   /product="peroxiredoxins-like protein"
FT                   /note="KEGG: stp:Strop_0309 peroxiredoxins-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96301"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD5"
FT                   /protein_id="ABV96301.1"
FT                   /translation="MLAPVGRNLVVKVTAGADSPERCAQAFTVAATAAAAGVDVSLWLT
FT                   GEATWFALPRRAQEFELPHSAPLGELLHVLLTTGRVTACTQCAARRDIGPGDVLPGIRI
FT                   AGSAVFVEEVMAEETRALVY"
FT   gene            435214..435804
FT                   /locus_tag="Sare_0373"
FT   CDS_pept        435214..435804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0373"
FT                   /product="Domain of unknown function DUF1794"
FT                   /note="PFAM: Domain of unknown function DUF1794; KEGG:
FT                   stp:Strop_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96302"
FT                   /db_xref="GOA:A8LZD6"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LZD6"
FT                   /protein_id="ABV96302.1"
FT                   /translation="MSDENPLQPPWLNAPPVDPYPYEESHDLRTGPKLHPALDGLLPYV
FT                   GVWRGRGRGGYPTIEDFDYGQEIRISHDGRPFLCYESRAWLLDEQSRPIRPAGREMGWW
FT                   RPVLAGDRATGEWEALMTTPTGVMELHLGKRTGTQLEFATDAVVRTPTAKEVTAGHRLF
FT                   GIVEGALLYAQEMAAVGHGLTPHLSARLIRVGG"
FT   gene            complement(435807..436670)
FT                   /locus_tag="Sare_0374"
FT   CDS_pept        complement(435807..436670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0374"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   stp:Strop_0311 aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96303"
FT                   /db_xref="GOA:A8LZD7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD7"
FT                   /protein_id="ABV96303.1"
FT                   /translation="MVTARIAVLGHGQVPVTEPVLRGDDLGVLHGDGLFETMHLRAGRP
FT                   WLREAHLGRMRRAAQAVELALPPTGALVALLDEISDGWPIDVEGALRLVCTRGAEGGGP
FT                   PTTYATLAPVPPSARAARRDGITVATLPLGVPARARAGLDWLPTGNKTTSYAVNNAARR
FT                   WASRSGVTDALWISTDGYVLEGPTANVLWLAAGVLGTVPATTGILPGTTAAWLLANADQ
FT                   VGLAAEERLATPAELHTADAIWFSSSVRGLVEVRALDGVRRPRSAYTKRLQALLGFPVP
FT                   PDEQPG"
FT   gene            436800..437231
FT                   /locus_tag="Sare_0375"
FT   CDS_pept        436800..437231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0375"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: stp:Strop_0312
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96304"
FT                   /db_xref="GOA:A8LZD8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD8"
FT                   /protein_id="ABV96304.1"
FT                   /translation="MVSESSLAELLRARGLRLTAQRQLVLQAVLDLGHATPEQVHTAVR
FT                   EVAAGVNITTIYRTLELLERLGLVTHTHLSHGSPTYHAAGEDQHVHLVCRECGAIDEID
FT                   PTLLRPLADQLAEQRGFRVDIGHVSLFGRCERCWNGDQE"
FT   gene            437228..438337
FT                   /locus_tag="Sare_0376"
FT   CDS_pept        437228..438337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0376"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   stp:Strop_0313 glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96305"
FT                   /db_xref="GOA:A8LZD9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZD9"
FT                   /protein_id="ABV96305.1"
FT                   /translation="MIDIAGAVSVESIDETSRDQPEPAHAAAGVRPVAAHYGDPLREQR
FT                   TLETAVGLVDRSHRGVIAVPGEERLGWLHTLTTQHLAELPAGQGTELLVLSPHGHVEQH
FT                   AMVAEDGGTTWLDTEPGDTGGLLGYLERMRFFSKVEPRDVTPDHALLALVGPAAVEAAA
FT                   TLGVSGLADPDVLEVPGPKFRAGSVPPRPTVRYDVRPLPVGGWARRGPLGVDLLVARDT
FT                   MGQVVTDLRAAGVPVAGLWAYEAVRVGARRPRVGVDTDHRTIPAEVDLVGPAVHLEKGC
FT                   YRGQETVARVHNMGRPPRRLVLLHLDGVTTDEPPSAGTPVMREGRAVGFVGTAVHHHEL
FT                   GQIALAVVKRNVPDDARLLVGETAAMIDR"
FT   gene            438449..439291
FT                   /locus_tag="Sare_0377"
FT   CDS_pept        438449..439291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0377"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   stp:Strop_0314 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96306"
FT                   /db_xref="GOA:A8LZE0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE0"
FT                   /protein_id="ABV96306.1"
FT                   /translation="MTTGTLITVAPTGAESAKVEVPALPVTLDELLLTAKECEALGASV
FT                   IHVHIRDDEAQPTLDQGRLRDTVAALRERTDLVVQLSSGGSVSDPEADRLAVLDAVPDM
FT                   ASCTMGTVNFGDDVFLNRWEFIVELHTRMQERGIVPEYEIFDLGHLTALQRLLSKHGLP
FT                   AGGHVHVDFVMGVPGGMPGTPAALIAAQHMLRDLPAGTTFSATGVGRTTIPVLLASLSA
FT                   GGHLRVGMEDTVTYAKGQPVESNMQLVARAVGFAQLAQRLPLTTAEARELLGVPATRR"
FT   gene            439365..440345
FT                   /locus_tag="Sare_0378"
FT   CDS_pept        439365..440345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0378"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: stp:Strop_0315
FT                   L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96307"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE1"
FT                   /protein_id="ABV96307.1"
FT                   /translation="MSGNVHAVGKTYEGGVPLAEVVRSGFVEGVHRGSVVALDATGVSV
FT                   ARAGDVTSPIFPRSSNKPLQTVGMVSAGLLLTDPADLALVSASHAGEDFHLDRVGALLA
FT                   RAGLDESDLHCPPELPAGERAQAAVLRAGGGPTRIQMNCSGKHSGMLLTCHAAGWALDG
FT                   YWRTEHPLQGRLRTAVEEFTGEPVTSVGIDGCGAPVLAVSLSGLALAYLRLVEAEPGSP
FT                   ARAVADAMRAHPEIVGGTQADDTRLMRTVPGLLAKIGAEGIIAAAVPGAGAVALKIDDG
FT                   ASRARIPVLVSALRRIGVTGPALAEFVEVPILGGGRPVGAVRSLW"
FT   gene            440462..441037
FT                   /locus_tag="Sare_0379"
FT   CDS_pept        440462..441037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0379"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   stp:Strop_0316 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96308"
FT                   /db_xref="GOA:A8LZE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE2"
FT                   /protein_id="ABV96308.1"
FT                   /translation="MATGKDLPNIGGFIRDLRRNAKISLRQLSEQAGVSNPYLSQIERG
FT                   LRKPSAEVLQQLASALRVSTPAMYLRAGLLDDREGQGVLAAIAADPDLTMAQKQSLTQI
FT                   YETFRRENARLAEATAAADTAPVTTGPTTGPVTTESTTGPTATEPTTGPSATEPTTGPS
FT                   TPPGSAADLANIAVTGPTTTEGTPTGGA"
FT   gene            441138..441725
FT                   /locus_tag="Sare_0380"
FT   CDS_pept        441138..441725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96309"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE3"
FT                   /protein_id="ABV96309.1"
FT                   /translation="MTSQPKTSRIPAPIYAAAGAGELAYQQLRKLPAVVSDLRNRVAAD
FT                   LGGVNGAELRQKANETLHTATVAAENLRRAASDLDLNRLREAATRNAAVVAASAQAAQE
FT                   RAVATYGALVGHGERVVGAGVLEAADTVNTDIETTEKVPAPVEAPTPADVAEAAEVKPA
FT                   AVTKRATKSAGKPASPSAKSPRATKRTRPAGD"
FT   gene            441817..442134
FT                   /locus_tag="Sare_0381"
FT   CDS_pept        441817..442134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96310"
FT                   /db_xref="GOA:A8LZE4"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE4"
FT                   /protein_id="ABV96310.1"
FT                   /translation="MAIAAPIFAFAVRDVIELILLVFALIVQGVALVHVITQRSDAFAA
FT                   VGTLPKGAWVAILAICLVLTLLGFGPISLFGLVGIAAGLIYLLDVRAGLRDLSDGRGTS
FT                   W"
FT   gene            442131..443036
FT                   /locus_tag="Sare_0382"
FT   CDS_pept        442131..443036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0382"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   stp:Strop_0319 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96311"
FT                   /db_xref="GOA:A8LZE5"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE5"
FT                   /protein_id="ABV96311.1"
FT                   /translation="MRGFRWPPPPDGGPRTWGPGPSAPRTGRPALPEPETDLVSTPHGV
FT                   HLEQLVTGAGDPVTVFAHGLGSGIATTRPFGSGVTGRRLFFQFRGHGRSDAPPGPWSYL
FT                   DLARDLRAVADQGLATRAFGASLGAGALCRLLADNPVRFDRLVFYLPAVLDRPRGEVAR
FT                   RRFVALLGAVGSGDAAQIAEAVQAELPPAVRNTPAGWAYLRQRLDQLMRDGLAPGLVDL
FT                   PGSVPVRDVAKLAAVTAPALVIGCVGDELHPVEVAEQLAAALPQATLHVYDRPGVLWTK
FT                   RADLRERISAFLNEDSTLDE"
FT   gene            complement(443179..444660)
FT                   /locus_tag="Sare_0383"
FT   CDS_pept        complement(443179..444660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_1619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96312"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE6"
FT                   /protein_id="ABV96312.1"
FT                   /translation="MNHRYHTHEPDRPDRNLATSRRRWWVAGLAGTTGLALATTIAPAP
FT                   TPASAASASAAAASAAAASAAAAAAAAAAAAAERTIPVPFTVADSRTAKPPADSYRGEA
FT                   KHDDKGKGTKGQAGKGKESTRAVLVPCDADRLITAITLANARGGAVLNLAKKCAYTLTA
FT                   DLGGAGLPAITAPITLNGGTHTTITRAAAAPQFRIITVDTGGDLTLNHLTITGGQTTDD
FT                   GGGILVNQGGALTTNHSTITRNITSNNGGGISSNGTVHMKTSTVSHNTADSIAAGILSL
FT                   GILDISKSQVHANTAVAGGAGVIAFGATRIKHSSITANHGQNGTVGGLFVSGTGTVTDS
FT                   NISGNTALEAAGVLTDTSTQLTLRSVTLADNTAVAGVGGGLAINPGSSVVTEGGIIANN
FT                   TATTEGGGIFNLGELVSRNTKVIGNRSDLGGGISNASNTATANLFGTQVIKNIAITDGG
FT                   GIVNNGGTVELNTATGTIVVKNRPNNCVGVPECSG"
FT   gene            444997..445839
FT                   /locus_tag="Sare_0384"
FT   CDS_pept        444997..445839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0384"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   stp:Strop_0322 protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96313"
FT                   /db_xref="GOA:A8LZE7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE7"
FT                   /protein_id="ABV96313.1"
FT                   /translation="MNASRDLVAPLTGAAGRFLAGVGLFLRGIGLYLRSPGLMLLGVVP
FT                   ALISGAFFLTAFGALVYFVDDLAALITPFADDWSAAWRGLVRVVAGLALLGLGGLLTVV
FT                   AFTAVTLIIGDPFYEKISERVEDGLGGTPNAVEVPFWSSLRHSVADSLRLVGLSVAFGV
FT                   PLFAAGFIPVVGQTVVPALAATIGGWLLAVELIGSPFYRRGLRLPDRRAALRADRPTAL
FT                   GFGVAVFVSFLIPLGAVLLMPAAVAGAALLARRVLGQPITAGTGAGQDGKVTERREAQ"
FT   gene            complement(445843..446742)
FT                   /locus_tag="Sare_0385"
FT   CDS_pept        complement(445843..446742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0385"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0323 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96314"
FT                   /db_xref="GOA:A8LZE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE8"
FT                   /protein_id="ABV96314.1"
FT                   /translation="MRIRPAHPDDAPAVVSLRTRVLPYLVRGVAPTRQMIIRPPRGQHW
FT                   TAFVAEVDGEIIGWVSAFRNASSTRRVGEISLLHVHPEHRGRGIGGGLLTAALDHLTPL
FT                   RLPLLRGRALPESLPYARRRGFLPSREERFSALALTALPPPAVPPGARLVALSEVDPHH
FT                   VYEVERDASTDEPGDVATDALTYEHWQADTWDNLGLDREASTGVEVDGVLAAISLVNRD
FT                   GTRMWSDYTGTRPAHRGRGLATAAKLAALRRAAASGVTVAYTGNDEANAPMLAINERLG
FT                   YRPVAAQWSCLRETGRLA"
FT   gene            complement(446739..447137)
FT                   /locus_tag="Sare_0386"
FT   CDS_pept        complement(446739..447137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0386"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: stp:Strop_0324
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96315"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZE9"
FT                   /protein_id="ABV96315.1"
FT                   /translation="MPQLRHVSTLADADYAYVTTVEPSTRLVFTAGACPLDANGRTVAP
FT                   GDHAAQARQVMANLETALAAAGARLTDVAKTTVYVASAHQSDLVTVWQVVRDTFDDHDP
FT                   PSTLLGVAVLGYPDQLVEVEAVAAVAAA"
FT   gene            complement(447147..447782)
FT                   /locus_tag="Sare_0387"
FT   CDS_pept        complement(447147..447782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0387"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO5068
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96316"
FT                   /db_xref="GOA:A8LZF0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF0"
FT                   /protein_id="ABV96316.1"
FT                   /translation="MSRDDTRQTERSLRVDAARNRERILEAARHEVARSGADTSLEQVA
FT                   RRAGLGSATVRRRFPNRRLLLEAVQWDQVMTLCAEAADQARAADPHQALRSWLTSVTRY
FT                   VTSSSAMAASLTPLGRTERGESCFAKVAAAGQPLVERAAAVGAVHPGATAADLITVVTG
FT                   IVLVTRDEPDADSRARQLINLAWAGLMPARTGQRIPTGNQVEGSPGRH"
FT   gene            447892..448803
FT                   /locus_tag="Sare_0388"
FT   CDS_pept        447892..448803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0388"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: mxa:MXAN_2144 NmrA-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96317"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF1"
FT                   /protein_id="ABV96317.1"
FT                   /translation="MTNPTAPVLVTGATGRQGGATARSLLARGVPVRALVRTPDSDAAR
FT                   SLVRLGVDVVQGDLLDIHTVRSAAQGTRAVFSIQMPDMNDLDGDGELRQAQNLVSAAQD
FT                   AGIDTVVHTSVSGAGQHHQAPGWAEGRWKHMEHYFEMKEQAQSLVRQAGFTHWTLLKPA
FT                   FFMENFLRPSSLFAHGTEDRLATIIKPDTQVSLIAVRDIGEAAAQAITNPDRFHAVELE
FT                   LAGDVRTMNEIAADLGAALGVHLAAPDMTVEEAMSQGMPTFGAAYEWHNAVGQPAHPAL
FT                   AQELGLTVTTFAEWTKANRERI"
FT   gene            complement(448824..449831)
FT                   /locus_tag="Sare_0389"
FT   CDS_pept        complement(448824..449831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0389"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   stp:Strop_0325 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96318"
FT                   /db_xref="GOA:A8LZF2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF2"
FT                   /protein_id="ABV96318.1"
FT                   /translation="MTTAQRPTLEAVARRAGVSRATVSRVVNGSTTVAEPIREAVHRAV
FT                   AELGYVPNLAARSLVTQRTDSVALVMPEAATRVFSDDQVFPGIIRGAALELEAADKQLV
FT                   LMLAGSRAGHERVERYTTGRHVDGVLFASLHGADPLPGRLTRLGIPVVCSGRPLGDASV
FT                   PYVDVDHVGGVTRAVQHLIDGGRRRIATIAGPQDMVGGIERLAGYQAAVTSAGLPEWVA
FT                   YGDFTRESGVAAMRRLLAEHPDLDAVFAASDLMAHAALRTLRTAGRRVPDDVAVVGFDD
FT                   IETAAYTEPPLTTVRQPIQEIGRRMTRQLLRLAAGEPIEPAVVLPTELVLRDSA"
FT   gene            complement(449845..451248)
FT                   /locus_tag="Sare_0390"
FT   CDS_pept        complement(449845..451248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0390"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   stp:Strop_0326 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96319"
FT                   /db_xref="GOA:A8LZF3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF3"
FT                   /protein_id="ABV96319.1"
FT                   /translation="MSELRFPDNFRWGAATAAYQIEGATRDDGRGPSIWDTFSRTPGKV
FT                   HQGQTGDVACDHYHRFADDVELMAELGLGAYRFSVSWPRVQPDGTGPINPRGLDFYDRL
FT                   VDALLGRGIDPIVTLYHWDLPQTLQDRGGWVTRETAEHFAGYAAAVHGRIGDRVASWTT
FT                   LNEPWCSAYLGYGNGVHAPGIQDPGAAFTAVHHLLLGHGLAARALRTAGAGTVGITLNP
FT                   ADVRPADPDSAADAAAVRLVDGLQNRIFLDPLFRAAYPVDVLEHIARIVPPAFIRDGDE
FT                   KLIATPIDLLGVNYYTPTYVAGRPDGAGGGGAFPGTDGAVEFLPPTGPLTDMGWMIEPA
FT                   GLTRMLERLAADYPGVPLLITENGAAFPDRAGAEGVGADRTEAEGAGPVADTDRIAYLD
FT                   AHLRAAHTAIARGVDLRGYLVWSLLDNFEWAEGYRKRFGIVHVDYLTQRRTPKASARWY
FT                   QEVISRNGL"
FT   gene            complement(451493..452326)
FT                   /locus_tag="Sare_0391"
FT   CDS_pept        complement(451493..452326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0391"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_1559
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96320"
FT                   /db_xref="GOA:A8LZF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF4"
FT                   /protein_id="ABV96320.1"
FT                   /translation="MSRLWRASPLTYAALVVATATSIFPIWWMFVVASRSSDAMGQLPP
FT                   PVTPGGNLGANISRLFANNDAYFLTGLINSAIVATTVTVSVVLFSSLAGFAFAKLRFRG
FT                   RNALLMIIIATMMVPTQLGVIPLYLLMTKLNWNDRLPAVIVPALVTGFGVFMMRQYAAQ
FT                   AVSTELIEAARVDGCNTARVYWNVVLPALRPAAAVLGLLTFMTMWNDFLWPYAVLNDPE
FT                   NPTVQLSLRALSDGYYQDMSQVFTGTALATLPLLLVFVLFGRQIIGGIMEGAVKS"
FT   gene            complement(452323..453309)
FT                   /locus_tag="Sare_0392"
FT   CDS_pept        complement(452323..453309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0392"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_1558
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96321"
FT                   /db_xref="GOA:A8LZF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF5"
FT                   /protein_id="ABV96321.1"
FT                   /translation="MSVQLDARPPTPAAPPGRTTRLHRLSRLDLRWSPYLLIAPFFLLF
FT                   AVFGAYPLGYTLWVSLHDWDLLGSDPTFVGADNYTALLADSDFWHAVVNTLGIFVLSTL
FT                   PQLLAALWLANLLNRQLRARTGWRMAVLVPNVTSTAAVAIVFGVLFGREFGMVNWLLDL
FT                   VGVDAIDWKSNRYASWFAISTMVDWRWTGYNALIFLAAMQAIPRDLYESAAIDGAGRIR
FT                   QFWSITAPLLTPTIIFVAIVSTIGGLQLFTEPRLFHSGPNPIRGGPLRESQTMTMYMFE
FT                   NAFAPYYNFGYGSAVAWLLFVLIAAVATVNVLVIRRLGNGGRKGGRG"
FT   gene            complement(453427..454731)
FT                   /locus_tag="Sare_0393"
FT   CDS_pept        complement(453427..454731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0393"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tfu:Tfu_0934 putative solute binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96322"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF6"
FT                   /protein_id="ABV96322.1"
FT                   /translation="MGATNRRRLAAVALAAATTLLVTTACGNGDDAGDGTITLTVDVFG
FT                   QFGYDELYQQYMDDNPGVTIVERGTGGNLDEYSPKLTQWLAAGKGAGDIVAIEEGLLVE
FT                   YKANPDNFVNLLDHDAGELQGNFLDWKWNAGLTADGAHLIGLGTDVGGMAMCYRTDLFA
FT                   EAGLPTERDAVSALWPTWADYIRVGERFTAAKTGAAFLDAATNTFSTIVLQTAGNTNGY
FT                   HYYDTNDELVVDTNPAVRQAWDTTMDIIDSGLSGRYSAWSEEWVSAFKQATFATIACPA
FT                   WMTGVIEGNTGTAGAGKWDIARVPGDGGNWGGSYLAVPKQSRHQAEAVKLAMFLTSAEG
FT                   QIGAFKAKGPLPSSPQALGDPAVAEATNAYFSDAPVGQIFAAGAKGLKPVYMGPKNQAV
FT                   RTEVENAVRTVELGQRTPEQGWSDAVTNAKKAAAK"
FT   gene            complement(454949..455710)
FT                   /locus_tag="Sare_0394"
FT   CDS_pept        complement(454949..455710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0394"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   stp:Strop_0327 protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96323"
FT                   /db_xref="GOA:A8LZF7"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF7"
FT                   /protein_id="ABV96323.1"
FT                   /translation="MSRSHGTKDFWIGALRVEGPAFAAAIAEAPADTPVLSCPGWTVTD
FT                   LTRHLAGVYRWVHGNVSTDAVTPPPRRSEPVEPGPGETVLQLWQQAYDELMVCFDALDP
FT                   EAPAWNWAPQPKKAGFWPRRIAHETAVHRWDAQLAIGAGDPIETKLAADGVSEVLDTCL
FT                   PAGRRPAHSQWHGVVHLSASDAGQEWFLRLRGEGVALLDTATILDDHDHHARVQVVGTA
FT                   SDLLLALWGRISFDTLTVAGERDLLAGLRTG"
FT   gene            455781..456872
FT                   /locus_tag="Sare_0395"
FT   CDS_pept        455781..456872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0395"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: stp:Strop_0328
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96324"
FT                   /db_xref="GOA:A8LZF8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LZF8"
FT                   /protein_id="ABV96324.1"
FT                   /translation="MSEVPQSTSDVHPDAECHLSRYTTLRLGGWATRVVTATSADDLVR
FT                   GVREAGDRGERILVLAGGSNVVIGDAGFPGTVVLVRSRGLKVIETDTDTVTVRVEAGEP
FT                   WDELVAHTVANEWSGLECLSGIPGSTGATPIQNVGAYGQEVAETITGVQVYDRVTGTTA
FT                   RIEARDCGFSYRSSIFKRSDRWVVLSVDFRLARSPLSGPVRYAELARALDVAVGDRVPL
FT                   AKARAAVLRLRAGKGMVLDAADPDTWSVGSFFTNPVLDRAGYERLRERAADVGEPPSWP
FT                   GTDGTVKVSAAWLIDKSGFGKGHPGPAGVVTISTKHTLALTHRSGTARTEDLVRLAREI
FT                   RRGVQARFGVTLHPEPVLVNCAL"
FT   gene            complement(456882..457670)
FT                   /locus_tag="Sare_0396"
FT   CDS_pept        complement(456882..457670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96325"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZF9"
FT                   /protein_id="ABV96325.1"
FT                   /translation="MPAGRPLGVVTRGTTNPNRLRRVDNWIVATCGDTLRAAADPLVVD
FT                   LGFGATPITAVEMRSRLADAVRADVRVVGLEIDPVRVAAARSAADPPRLAFARGGFELA
FT                   GLRPALVRAFNVLRQYDEGAVAGAWATMAGALAPGGLLVEGTCDELGRLGGWVLIDEGG
FT                   PRTLTLSARLTTLDTPARFAERLPKALIHRNVEGEPIHALLGAMESAWRAAAPYASFGP
FT                   RHRWLRTVIAVRDAGWPVAYQPRRWRQGLVTVDWAAVAPS"
FT   gene            complement(457685..458449)
FT                   /locus_tag="Sare_0397"
FT   CDS_pept        complement(457685..458449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0397"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: stp:Strop_0330 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96326"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG0"
FT                   /protein_id="ABV96326.1"
FT                   /translation="MTSVAVVTGASSGIGAATVRRLAAEGFHVLAAARRTDRLADLVKE
FT                   VETSGGSATAVSCDVTSDESVASLAAAAATAPGPVTLLVNNAGGARGLDPVETGRVGDW
FT                   QWMYDVNVLGTLRVTQALLPALVASESGTIVIVSSTAGFTVYEGGGGYAAAKHAQTAVA
FT                   GTLRLELCGRPVRVVEIDPGMVQTEEFALVRFGGDADRAEAVYAGVPEPLVAEDVADCV
FT                   AWCATRPHHVNVDRLVVRPLAQAAQHKVHRVG"
FT   gene            458617..459963
FT                   /locus_tag="Sare_0398"
FT   CDS_pept        458617..459963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0398"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   stp:Strop_0331 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96327"
FT                   /db_xref="GOA:A8LZG1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LZG1"
FT                   /protein_id="ABV96327.1"
FT                   /translation="MAEQHTGVGRQRGARPWPRPRRVATLSVHTSPLHQPGTGDAGGMN
FT                   VYILEVARRLAEADVEVEIFTRATSADVPPVVEMMPGVHVRNIISGPLGGLTKEELPGQ
FT                   LCAFTAGVLRAEASRAAGHYDLIHSHYWLSGQVGWLAKERWGVPLVHTAHTLAKVKNAQ
FT                   LAAGDRPEPKARVIGEEQVVAEADRLVANTKTEAGDLIDRYDADPTRVEVVEPGVDLAR
FT                   FTPAAGDRSRAQALARRRLGLPERGYVVAFVGRVQPLKAPDVLIRAAAALRQRDPALAE
FT                   ELTVVVCGGPSGSGLDRPTHLIELAASLGVTDSVRFLPPQTGDDLPALYRAADLVAVPS
FT                   YNESFGLVALEAQACGTPVVAAAVGGLVTAVRDQVSGVLVDGHDPAVWARTLSRLLPDT
FT                   GLRATLAQGARRHACNFSWDRTVSGLLEVYGEAVAAYGPQSSELATCSC"
FT   gene            460036..460590
FT                   /locus_tag="Sare_0399"
FT   CDS_pept        460036..460590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96328"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG2"
FT                   /protein_id="ABV96328.1"
FT                   /translation="MSGRSDLGALIESVCGERGLVWESTGPNSYAVTLPGTHKLRTICN
FT                   LIVGEYALRVEAFVMRQPDERREELWAWLLQRNARMYGVSFSIDAVGDVYLTGRVNPAG
FT                   VDADELDRLFGAVLTYADESFDTMLEIGFGSSIRREWEWRVRRGESTANLAAFAHLVEP
FT                   AGGGAGPEAGNTTVAGGSDRS"
FT   gene            460658..461449
FT                   /locus_tag="Sare_0400"
FT   CDS_pept        460658..461449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96329"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG3"
FT                   /protein_id="ABV96329.1"
FT                   /translation="MAQRSSSGRGGTATRTRGQAGNQARGAPRVSEAEISRMRVDEIRG
FT                   QLRRHGVSGISALRKPDLVRTLAKTLRAERRSGGSARTGTGPAGRATATKRASGRAAPT
FT                   GKKVGRSEKAGRAGKAAAKKAPARGVTGTARPAQSAAVRTGPGTSRSVRSSQVIVSLAD
FT                   RPERPGRSLVTTNHDVIRRWARQRDAKPATIRGTEREGRVGVLTFNMPGYRESSRVREI
FT                   TWNEWFRTFDLRQLNLIYQEQLRDGRTSNFFRTESPDREDG"
FT   gene            complement(461832..463184)
FT                   /locus_tag="Sare_0401"
FT   CDS_pept        complement(461832..463184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0401"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0334 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96330"
FT                   /db_xref="GOA:A8LZG4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG4"
FT                   /protein_id="ABV96330.1"
FT                   /translation="MRTMRGWLHDTAGGLPRTFWYLWTGTLINRLGSFVIIFLAIYLTQ
FT                   ERNFSASQAGLVLGLWGVGGAAGTTIGGTLADRWGRRPTLLTAHLGATSMMLALGFARD
FT                   LWSVALGALLLGLFAEAARPAFGAMMIDVVPDKDRLRAFSLNYWAINLGFACAAVLAGF
FT                   ATEAGYLLLFVVNAATTLTTALIIFVKVSETRKPLVTAAGRPTAPPRALRTILADRVYL
FT                   GFVALNLFAALVFLQHISMLPIAMGDSGLSPATYGSVIALNGVLIVVGQLFVPRLIKNR
FT                   SRSHVLALSAVVLGVGFGLTAFAETAWFYGLTVLIWTLGEMLNSPSNATLIAELSPSEL
FT                   RGRYQGVFSLSWQVAGATAPVLGGVVRERAGDDILWLGCALIGGLVAAAHLISGPTRER
FT                   RVTALRAANQSVQPAAVGGRRAAEAEEAVTTAPAESLPTGSAESTAAGRVQ"
FT   gene            463329..464096
FT                   /locus_tag="Sare_0402"
FT   CDS_pept        463329..464096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0402"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: stp:Strop_0335 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96331"
FT                   /db_xref="GOA:A8LZG5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG5"
FT                   /protein_id="ABV96331.1"
FT                   /translation="MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTGKGETEAR
FT                   RGGELLREHNLLPDVVHTSLLRRAIRTAELALETAERNWIAVRRSWRLNERHYGALQGK
FT                   NKKQTLDEYGEEQFMLWRRSYDTPPPPIADDDEWSQVGDPRYRLLPTELMPRTECLKDV
FT                   VERMLPYWYDSIVPDILAGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRY
FT                   DLDPQLRPMTLGGTYLDPTAARDAAAAVANQGR"
FT   gene            464255..465532
FT                   /locus_tag="Sare_0403"
FT   CDS_pept        464255..465532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0403"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: stp:Strop_0336
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96332"
FT                   /db_xref="GOA:A8LZG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG6"
FT                   /protein_id="ABV96332.1"
FT                   /translation="MEWAVVVALAVGLAVGVLLTRVVVARRGRSTVTGSRQSDSNRPGG
FT                   RPAIADDPQSGFGRRTIDSLRVGVVVLAADDVPVLVNPAARAMGLLRAGGVPGAVAAHP
FT                   LIRTLAGQVRRTGVRREIQLDLPRGHDGAAENPLGVHLRAVGLGSGHVAVEAVDVTESH
FT                   RLARVRRDFVANVSHELKTPIGALQLLAEALLDATEPAGAERPDLSEDLVAARRFAERI
FT                   RHESTRLGRLVQELLELTRLQGAEPQPAPEPVAVDWVIGEVVDRTRTGASARRIDVVVD
FT                   GERGLTVYGSDTQLATAVSNLVENAINYSGEDTTVRITAGLDDEHVTIAVTDQGIGITP
FT                   GDVDRIFERFYRADQARSRATGGTGLGLAIVKHIASNHGGRVEVASTLDEGSTFTLRLP
FT                   ARPPDDLSVIPPSVEIEAGPAEFRQV"
FT   gene            465594..466277
FT                   /locus_tag="Sare_0404"
FT   CDS_pept        465594..466277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0404"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: stp:Strop_0337 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96333"
FT                   /db_xref="GOA:A8LZG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG7"
FT                   /protein_id="ABV96333.1"
FT                   /translation="MSRVLVVEDEESFSDALSYMLRKEGFEVSVAATGTSALTEFDRTG
FT                   ADIVLLDLMLPEMSGTEVCRQLRQRSYVPIIMVTARDSEIDKVVGLEIGADDYVTKPYS
FT                   PRELVARIRAVLRRQSTEAAEPGAPTLAAGPVRMDIERHVVTVNGGPVQLPLKEFELLE
FT                   LLLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKLEPEPSAPRYIVTVRGLG
FT                   YKFEP"
FT   gene            complement(466341..467138)
FT                   /locus_tag="Sare_0405"
FT   CDS_pept        complement(466341..467138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96334"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG8"
FT                   /protein_id="ABV96334.1"
FT                   /translation="MTGQIELRVLPEGPRSREVALDFPREWIEFVDPADDTHLIRADLT
FT                   WLLSRWTCVYGRGCHGITAGRPADGCCSHGAFFTDSDDEKRVRSAVRRLTPQTWQHHRR
FT                   GFKNWTEDDTADGKAPARRTATRADGPCVFLNDARFAGGGGCALHAQALRDGVHPLEYK
FT                   PDVCWQLPIRRDQEWVQRPDNTRVLLSTLGEFDRRGWGAGGHDLDWWCTSSSDAHVATE
FT                   PMYLSYGPELTALIGESAYARLVTLCAARARHGLVAPHPADPD"
FT   gene            467211..468155
FT                   /locus_tag="Sare_0406"
FT   CDS_pept        467211..468155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0406"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: stp:Strop_0339
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96335"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZG9"
FT                   /protein_id="ABV96335.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGAHPWPAHSEKAVLRLAEQIGPD
FT                   GALTTAGADSLVKAVAAAKESAVGLDTDDLMAFATSAVRDATNSAEVLTRVQDETGVRL
FT                   EVLTGADEARMTFLAVRRWFGWSAGRLLVLDIGGGSLEIAAGIDEDPDAAVSLPLGAGR
FT                   LTRDHLQVASGSPTPPQAEQVEKLRAYVDGQLDAVAGRLIEVGWKRPVATSKTFRTLSR
FT                   LAGAAPSGAGLWARRRLTRAGLRQVLGFIRHIPPAQLVELDGVSVGRAHQLLAGAVVAE
FT                   AAMRRLDIDTLDICPWALREGVILRRLDQLAPM"
FT   gene            468231..469118
FT                   /locus_tag="Sare_0407"
FT   CDS_pept        468231..469118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0407"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: stp:Strop_0340 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96336"
FT                   /db_xref="GOA:A8LZH0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH0"
FT                   /protein_id="ABV96336.1"
FT                   /translation="MASRVPVLLSTSSVFPERTAAAFQLAATLGYDGVEVMVWTDAVSQ
FT                   DVGALAGLAKHYDVPVLSVHAPCLLVTQRVWSADPWERLRRSGEMAEALGAPTVVVHPP
FT                   FTWQRDYARNFAEGLNEIDERFGGVRFPVENMYPVRMAGRQFVPYVPSWDPTVTGYPSY
FT                   TLDVSHCAASHVDALELADRMGAGLAHVHLGDGTGEGRDEHLVPGRGTQPCAELLRSLA
FT                   GRGFTGSVAVEVSTRGAKSRAVREADLRAALAFARKHLDTPPTADVGPVSVPMVDRDTE
FT                   EQTADRSGERPAVS"
FT   gene            complement(469111..469698)
FT                   /locus_tag="Sare_0408"
FT   CDS_pept        complement(469111..469698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0408"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   stp:Strop_0341 protein of unknown function DUF1470"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96337"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH1"
FT                   /protein_id="ABV96337.1"
FT                   /translation="MNFDAYARIGVALVNARLDDLDDLRSLFPDDSSWMPEALSERDLA
FT                   NCRRAQKRLRDVFEYGTSGRDVQAVAELNVLLEAYPVQPRISGHDSSDWHMHVTSRGAS
FT                   VSAEYLAGAVWGLSVWLCEYGSARFGVCADERCGNVYLDTSSNCCRRFCSERCATRSHV
FT                   AAHRARKRAAIGGRLAVAAQPTTPADSLTPVS"
FT   gene            469796..470716
FT                   /locus_tag="Sare_0409"
FT   CDS_pept        469796..470716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0409"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: stp:Strop_0342
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96338"
FT                   /db_xref="GOA:A8LZH2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH2"
FT                   /protein_id="ABV96338.1"
FT                   /translation="MLRTVILAAARSSRCEQFVATAPYTRDIVRRFVAGARTDDALRVT
FT                   RALVQDGLAVTLDNLGEDTVTPEQATAVRDEYLNLLELLAAAGLTPATEVSVKLSALGQ
FT                   TFDEQLAYDHARAICVAADTAGTMVTLDMEDHTTTDSTLDILLKLREDHPSTGAVLQAY
FT                   LRRTESDCRQLAGAGSRVRLCKGAYREPESVAYQSAHDVDRSYVRCLNILMSGAGYPML
FT                   ATHDPRLIAIGEDRARWFDRGPDRFEFQMLYGIRPEEQARLVGDGYTVRTYVPYGDQWY
FT                   GYLMRRLAERPANLAFFARALMHQG"
FT   gene            470765..472195
FT                   /locus_tag="Sare_0410"
FT   CDS_pept        470765..472195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0410"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   kra:Krad_1868 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96339"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH3"
FT                   /protein_id="ABV96339.1"
FT                   /translation="MSSIWLRREGQERYRARSMGRVRRTGSPRLPAAPRLLIAGLAVVV
FT                   LTATTAAACDREQTPVALAAAGRSSVVETIDAPATVIARSAATLTAPADGTLASLRVQP
FT                   GQRVKRGQVLAVIDSPPAQERLRQAKEALAAARRASRGGGGDLAGGLRGTDRAADETYE
FT                   AARAAAGKISDPELREALLRQVREAQRRYERAAHAADRAVRAVQRGVNDLRAAVAALAT
FT                   AQRLQAQQAYDLATAAVDALTLRAPVAGIVQPGGPATGGGVSSDALAGLLAGGAPVGVD
FT                   PGALGPAPPPGVDVAVGAGGLVAAGTPVLTIVDTSQLGLLAEVDETDILLVRAGLAATV
FT                   ELDAVPGATYQARVRSVDILPTTSARGGVGYRVRLSLGPGRSAEAEAAPTPRPGMNAVV
FT                   RLQAREAVDAVTVPASAVFTADGRDVVWVVREGRAERASVTVGVQGQELVQIVRGVRAG
FT                   DRVVVRGTDQVRDGQELG"
FT   gene            472192..473055
FT                   /locus_tag="Sare_0411"
FT   CDS_pept        472192..473055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0411"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: kra:Krad_1869 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96340"
FT                   /db_xref="GOA:A8LZH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH4"
FT                   /protein_id="ABV96340.1"
FT                   /translation="MTAPAVEAVDVSRTYRLDGFSVPALRGVSLTVAAGDHVALVGPSG
FT                   SGKSTLMHLLGGLDRPTSGRLAIGGRDVGSLSAAELAALRNETIGFVFQAFHLLPRTSA
FT                   VDNVALPLVYRGVGARQRRERAAAMLGRVGLGHRLGHRPNQLSGGEQQRVAIARALVND
FT                   PAVLLADEPTGNLDSVTGEAVLKLLERLNAESGVALVLVTHDDEVAMRAGRRIAMRDGV
FT                   IVADSVVDGSHDLPVSGPGGLPDTLVPAPSTEPRSASGSGPGRMSGGTGGATRATGRRG
FT                   HGAERP"
FT   gene            473052..474236
FT                   /locus_tag="Sare_0412"
FT   CDS_pept        473052..474236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0412"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   kra:Krad_1870 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96341"
FT                   /db_xref="GOA:A8LZH5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH5"
FT                   /protein_id="ABV96341.1"
FT                   /translation="MRLAEAGRVALAALRANRLRSGLTMLGVIIGVASVVILVAIGAGT
FT                   KQQVEQQVEGLGSNLLLVVPGRIDVGSAPALSPLTLDDVDVVARVVGDPDRVAVTVTSG
FT                   ATVRAGTRSQFSTVQGVLETTPVVFTREVTRGRYLTESDVDTSRRVAVLGASVSRALFP
FT                   DRDPVGQQLTVSGVRFRVIGVFAPLGQSLGVDRDDEVHVPVTAAQRLYGTQRVDGIAVK
FT                   APDRERIDALGERIVVELTRRHPGTEFSAVTQEQILGVLGDILGVLTGVLAAIAGISLL
FT                   VGGVGVSNIMLVSVRERTREIGLRKAVGARPRDIGVQFLLEAVLLTSIGGLTGIAIGIG
FT                   AALTVAAVSPVPAAVTWWSLALAFGVSAAVGIVFGVVPAQRAGRLDPVVALRSE"
FT   gene            474427..474636
FT                   /locus_tag="Sare_0413"
FT   CDS_pept        474427..474636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0413"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: stp:Strop_0343 DNA binding domain, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96342"
FT                   /db_xref="GOA:A8LZH6"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH6"
FT                   /protein_id="ABV96342.1"
FT                   /translation="MAGSQSDGRLSEVRFLTVAEVATVMRVSKMTVYRLVHSGELAAVR
FT                   VGRSFRVPEHAVHEYLRGAFQETA"
FT   gene            474740..474940
FT                   /locus_tag="Sare_0414"
FT   CDS_pept        474740..474940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0414"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713; KEGG:
FT                   stp:Strop_0344 protein of unknown function DUF1713"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96343"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH7"
FT                   /protein_id="ABV96343.1"
FT                   /translation="MCSAARPAGPVRCPQADAGVIRSAPHVASKGCRMGSVVKKRRKRM
FT                   AKKKHRKLLRKTRVQRRRLGK"
FT   gene            475061..476137
FT                   /locus_tag="Sare_0415"
FT   CDS_pept        475061..476137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0415"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   stp:Strop_0345 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96344"
FT                   /db_xref="GOA:A8LZH8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH8"
FT                   /protein_id="ABV96344.1"
FT                   /translation="MTPGGPSGAPGVVVVTGVSRYLGAHVAARLAADPRIGRVIGVDPP
FT                   ESGGELTGLLDRVERVRADAGSIGGLLADLDVDAVVHLALVSAPDPQHGGRAAMKEQNV
FT                   IGTMQLLAAAQHAPRLNKLVVRSSTAAYGASFRDPAVFTEETEPREVPRGGFGRDILDI
FT                   EGYVRGFRRRRPDVTATVLRFAPFLGSTADTTLTRYFAQPLIPTVFGRDPRLQFLHFED
FT                   ALEVLHQSIVMAHPGTYNVAGPGVLALSQAIRRAGRVGVPVLEPGLSGAAALARALGFG
FT                   RYGLDQVDLFVHGRVVDTTRLEREFGFTPRSTATAFDDFIRAHRGGVVLTRERLAAAER
FT                   LVLDGVRQVRSAAARERP"
FT   gene            476134..477006
FT                   /locus_tag="Sare_0416"
FT   CDS_pept        476134..477006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0416"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   stp:Strop_0346 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96345"
FT                   /db_xref="GOA:A8LZH9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZH9"
FT                   /protein_id="ABV96345.1"
FT                   /translation="MSGGAVPEQPGDQWDRKVASGLAFLRERLAGDYEVDEFGFDPQLT
FT                   ESVFHPLLRLLYRDWFRTEVLGLEHVPDVGAGLVVGNHSGTVALDALILSAVLHDQHPR
FT                   HRFLRLLGADLVFRMPVVSAVARKGGGTVACNPDAERLLDSGELVSVFPEGFKGVGKLY
FT                   AERYKLQRFGRGGFVSAALRTGTPIVPVAIVGGEETYPMLADVKPLARLLKLPYFPVTP
FT                   TFPWLGPLGMVPLPSKWLIEFCPPIPTQHLTDSADDPLVVFNLADQVRETIQQTLHRLL
FT                   EQRPDPFGP"
FT   gene            477160..478422
FT                   /locus_tag="Sare_0417"
FT   CDS_pept        477160..478422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0417"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0347 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96346"
FT                   /db_xref="GOA:A8LZI0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI0"
FT                   /protein_id="ABV96346.1"
FT                   /translation="MSSVVEAFVPARLGNRFRWLLASSWVTNLSDGIAVAAGPLLVASL
FT                   TTNPILVSLAALLRWAPPLVFGLWAGVLSDRLDRRRIVLVANTVRLVTLVVLAGALVTD
FT                   RVSVSAVLLMLALLATAEVFADNTTGTLTPMLVRREDLALANARVLAGFITLNTLAGPA
FT                   VGAALFAAGRSLPFATNAVLIAAGLVLVSRLSLPPREPAAENRGVRRDIVAGIRWTVRH
FT                   PAVRTLCLTTLVFNITYGAAWSILVLYATERLGLGAVGFGLISTATAVGGLLATVGYGW
FT                   LTRRMSLGGIMRAGLVIETLTHFGLAVTTAPWVASAILFVFGAHAFAWGTTSMTIRQRA
FT                   VPAHLLGRVNSIHTISAYGGLVIGSAIGGPLVALLGVTSPFWFAFAGSAVLVVLLWREF
FT                   AHIAHTDDPAPTPAPAGSTAA"
FT   gene            complement(478452..479390)
FT                   /locus_tag="Sare_0418"
FT   CDS_pept        complement(478452..479390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0418"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: stp:Strop_0348 HAD-superfamily subfamily
FT                   IB hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96347"
FT                   /db_xref="GOA:A8LZI1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI1"
FT                   /protein_id="ABV96347.1"
FT                   /translation="MRARLGGPPGYPRQVAHGAPVERRGELGSQKVTVSTDAHSHTSGW
FT                   AEAGAPPPAPDRAAAAFFDVDNTMMQGASIYWFARGLAARNYVTTGDLLRFAWQQLRFR
FT                   VLATEHVGDMSQIKEAALAFVEGWRVDDVERLAEEIFDELMAPRIWTGTRRLAQGHLDA
FT                   GQRVWLVSAAPVEIGRVIADRLGLTGAIGTVAEVVDGAYTGRLVGDLMHGPAKAEAVIQ
FT                   LAAVEGLDLSRCTAYSDSSNDLPMLDAAGRGVAVNPDAALLREARRRGWEVRDFRTGRR
FT                   AVKIAVPSTAAVGLLAGAVTAGVARHRRRAS"
FT   gene            complement(479475..480359)
FT                   /locus_tag="Sare_0419"
FT   CDS_pept        complement(479475..480359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96348"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI2"
FT                   /protein_id="ABV96348.1"
FT                   /translation="MESDLFFSRRRAERFAQLLDEANGGRRHHVRSRVDSGLTDLVAVG
FT                   RALRDSAPPVEANADFRTGLRAMLLATAEREGIGQPTPAATADRTARRPAANRSFVLPA
FT                   VTARRARARGAILIGIAAGAVAVSGISAASENAVPGDALYGMKRSTERAQLALSGSDHS
FT                   RGQLFLGFARTRLGEAAELHGDRAGYGSVLDDMDADTRHGVRLLTATAAHHADPTALDV
FT                   VNTFVTAQRTAVEALLEAGNRADRDRTRGSLALLDDVHRRSDALRAAIDCGLPVPVGSD
FT                   ALGPTPASCPATG"
FT   gene            complement(480619..481551)
FT                   /locus_tag="Sare_0420"
FT   CDS_pept        complement(480619..481551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0420"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-X type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: stp:Strop_0350 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96349"
FT                   /db_xref="GOA:A8LZI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI3"
FT                   /protein_id="ABV96349.1"
FT                   /translation="MTTFGYMERPVGLSDIPSRSAVNERSTPGPREQGQLSTWGESGVR
FT                   SRPHHNEAPPRPSIPGGNAKPVGTRVASPARPTMPVQGRRATDPPATADPATTDTAVLP
FT                   ALPASTPATGFPSRPDPSDPATEIWTLVERAQAGEAEAFGLIYDRYVDTVFRFVYFRVG
FT                   NRQLAEDLTSDTFLRALKRIGSFTWQGRDLGAWLVTIARNLVADHFKSGRYRLEVTTGD
FT                   VLDAEREDRGPEGSPEAAVVEHITNVTLLSAVKQLNPEQQECIVLRFLQGFSVAETARA
FT                   MGKNEGAIKALQYRAVRALARLLPDGFRM"
FT   gene            482450..482701
FT                   /locus_tag="Sare_0421"
FT   CDS_pept        482450..482701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0421"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: stp:Strop_0351
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96350"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI4"
FT                   /protein_id="ABV96350.1"
FT                   /translation="MREPRLALITRPGCHLCDDAKVALERVVSVTGDRWLEKDVTGDLE
FT                   LEREYGDRLPVVLLDGKEHGYWRVEEERLLRDLTTPQL"
FT   gene            482724..483371
FT                   /locus_tag="Sare_0422"
FT   CDS_pept        482724..483371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0422"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: stp:Strop_0352 haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96351"
FT                   /db_xref="GOA:A8LZI5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI5"
FT                   /protein_id="ABV96351.1"
FT                   /translation="MSSAHPHLVWDWNGTLLNDLDLVVASTNAAFASIGGPAVTAAEHR
FT                   VRFRRPIADYYAEVLGQAVDDAAFGQLDKIFHDVYKDGLTTCALAHDAVDAMSSWSGSQ
FT                   SLLSMWFHQDLVPTVRTYGLTSHFLRVDGLRAEVGGDRKAESLSRHLAELGLDGRDVVL
FT                   IGDSLDDADAALSVGGRAVLYTGGFTDAARLRESGHPVADSLTQAVALASVR"
FT   gene            complement(483470..484111)
FT                   /locus_tag="Sare_0423"
FT   CDS_pept        complement(483470..484111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0423"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: stp:Strop_0353 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96352"
FT                   /db_xref="GOA:A8LZI6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI6"
FT                   /protein_id="ABV96352.1"
FT                   /translation="MRIVIADDAVLLREGLVRLLTERGHQVVAAVGDGTALVEAVVTHH
FT                   PDVSIVDVRMPPSHTDEGLRAAVEARALAPAAPILVLSQYVEVSYADDLLATGGGVGYL
FT                   LKDRVAAIHEFLDALDRVAAGGTVLDPEVIAQLFARRRRDDPLRGLTPREREVLGLMAE
FT                   GHSNTAIARILVVTDGAVEKHVRNIFTKLDLPPDIEQHRRVRAVLTYLRT"
FT   gene            complement(484122..485438)
FT                   /locus_tag="Sare_0424"
FT   CDS_pept        complement(484122..485438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0424"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: stp:Strop_0354 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96353"
FT                   /db_xref="GOA:A8LZI7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI7"
FT                   /protein_id="ABV96353.1"
FT                   /translation="MTAARVAATPAPSPSRNLFRQLLRDSGYVLSGLPLAIVGFVVAVT
FT                   GFSLSLGLLVTALGLPVLAGTLYAVRVLADVERIRLPAVLGVPRIRPVYRVPDSGASFW
FT                   RRTLTPARDLQSWLDLLHAFCKMPVATVTFSVLLTWWALAVAGVSYGAYDRAIPYGPND
FT                   QSLSALLGMGNGSGARIFLNTAIGVFALLTLPLVARACARIEGSLSRSLLTGVAEMRNR
FT                   ITILEEQKRAAASAEANALRKLERDIHDGPQQRLVRLAMDLSRAREQLADDPVAAGHTL
FT                   DEAVGQTRETLTELRALSRGIAPPVLVDRGLPSALAALAGRGLIPIELRVDAGLGEPGG
FT                   RPDPTVESTAYFVVAEALTNVAKHSRATECRVTVERAGERLRVGIDDDGQGGAHLAKGH
FT                   GLVGIADRVRAVGGQLSVTSPAGGPTEVCADLPATPGPW"
FT   gene            485801..486571
FT                   /locus_tag="Sare_0425"
FT   CDS_pept        485801..486571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0425"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: stp:Strop_0355 CoA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96354"
FT                   /db_xref="GOA:A8LZI8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZI8"
FT                   /protein_id="ABV96354.1"
FT                   /translation="MSQHRPPGEPDRPVAVPALPDLPEATVARLPEYLRALHNLAENNH
FT                   ETVSSDWLATAAGVNSAKLRKDLSHLGSYGTRGVGYDVALLIEQIEYVLGLTHRRSVAL
FT                   VGVGNLGHALAGYDGFATRGFRIAALFDADPVRVGEEINGLVVRHVDELSRVASEESIA
FT                   IGVIATPAAAAQRVADLLVAGGVTSILNFAPCVLAVPDGVDVRKVDLAIELQILSFHEH
FT                   RKASLTALPAAGESPLTALSGGLAATDPQEAIGT"
FT   gene            486568..487935
FT                   /locus_tag="Sare_0426"
FT   CDS_pept        486568..487935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0426"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: stp:Strop_0356 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96355"
FT                   /db_xref="GOA:A8LZI9"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LZI9"
FT                   /protein_id="ABV96355.1"
FT                   /translation="MKLLVVGASYRTAPVAALERLAVAPADLPHALARLVAQPYVSEAV
FT                   LVSTCNRVEVYAAVSGFHGGLGDICAVLAESTGVPPAALADHLYVHFDAAAVKHAFRVA
FT                   TGLDSMVVGEAQILGQLRDAYHWASGADTTGRLLHELMQQALRVGKRAHSETGIDRAGQ
FT                   SVVTAALGLATELLNSDLAARPALVVGAGAMGSLGVATLSRLGAGPVAVTNRGADRAVR
FT                   LAESYGATAVPIADLTATLSTVDIVVAATAAPEAVLTREVVTRALADRKPSRGPLVLLD
FT                   LAVPRDVEPGVADLPGVQVIDIDRMAALVANGPAAADAAAVERIVATEVDAFLNWLRGA
FT                   DVAPTVAALRGRADNVVTVELGRLAQRRPDLTDDQRDEVARTVHRVVQRLLHQPTVRVR
FT                   QLAAEPGGDQYAALLRELFDLEVPQTSPVGTVPEVVVPEAVPPLGGAAEDPSTGGQ"
FT   gene            487935..488903
FT                   /locus_tag="Sare_0427"
FT   CDS_pept        487935..488903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0427"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: stp:Strop_0357 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96356"
FT                   /db_xref="GOA:A8LZJ0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ0"
FT                   /protein_id="ABV96356.1"
FT                   /translation="MSVPLRLGTRGSALAMAQSGQVAQALTAATGNPVELVEVVTAGDR
FT                   SAAPVHRLGVGVFVSALRDALTARTIDFAVHSFKDLPTAAAPGLHVAAVPPRQDPRDAL
FT                   VARAGRTLAELPPGARVGTGALRRIAQLHALGLQLDVQPIRGNVGTRLARVLGPEADLD
FT                   AVVLARAGLARLDRTDTITETLDPMLMLPAPAQGALAVECRSDDSDLVELLAVLDHAPS
FT                   RATVVAERALLATLEAGCSAPVAAYAELAEGDVGEEIYLRGAVISPDGTRDLRLSRTGT
FT                   PADAVEIGKALAADLLELGADSILGQEGHFGPGTQQFGSTV"
FT   gene            488900..490480
FT                   /locus_tag="Sare_0428"
FT   CDS_pept        488900..490480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0428"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: stp:Strop_0358 uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96357"
FT                   /db_xref="GOA:A8LZJ1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ1"
FT                   /protein_id="ABV96357.1"
FT                   /translation="MTRSRKPVGRIAFVGAGPGDPGLLTRRGYDALVNADQVVYDRGVP
FT                   ESLLDVVRAQAKQDAQLTLAEGGSGDVAKVLISAARSGLNAVHLVAGDPFGHGSVVKEV
FT                   QAVARTAGHFEVVPGVGQAEGVATYAGVPLPGVRTAADVEDVNTLDFEALAAAVTRGPL
FT                   ALAADAGDLAAIRDGLLAAGVDDTTAVGVTGDGTGETQYTTTSTVDSFVAAALGFTGRV
FT                   VLTLGDGVGQRDKLSWWENRPLYGWKVLVPRTKEQAGVMSARLRAYGAIPCEVPTIAVE
FT                   PPRTPAQMERAVKGLVDGRYAWVIFTSVNAVRAVWEKFAEHGLDARHFGGVKIACIGDA
FT                   TADAVRAFGIRPELVPAGEQSSEGLLAEFSPHDEVLDPVGRVLLPRADIATETLAAGLT
FT                   ERGWEVDDVTAYRTVRAAPPPAEIRDAIKSGGFDAVLFTSSSTVRNLVGIAGKPHARTV
FT                   VSVIGPKTAETATEFGLRVDVQPPHASVPDLVEALAGYAVELREKLAAMPAKQRRGSKV
FT                   QGPTALRFR"
FT   gene            490495..491478
FT                   /locus_tag="Sare_0429"
FT   CDS_pept        490495..491478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0429"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   stp:Strop_0359 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96358"
FT                   /db_xref="GOA:A8LZJ2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ2"
FT                   /protein_id="ABV96358.1"
FT                   /translation="MPYPEIRPRRLRRSTALRRLVAETRVDPAELVVPLFVKEGLTEPR
FT                   AVASLPGVLQHTRESLRKAAVAAVQAGVGGIMLFGVPATRDERGSGGADPNGILNAAIR
FT                   DVVSEVGDATVVMSDLCLDEFTSHGHCGLLTPDGSVANDATLAAYAEMAVAQAEAGVHV
FT                   VGPSGMMDGQVGAVRQALDAAGHRDVTILAYTAKYASAFYGPFRDAVESTLDGDRRTYQ
FT                   QDPANLRESLREVALDVAEGADIVMVKPALPYLDVVAAVRAAVDVPVAAYQVSGEYAMV
FT                   EAAAANGWIDRERVMVETLTSIRRAGAQIILTYWAVEAAQLLRERY"
FT   gene            complement(491656..494934)
FT                   /locus_tag="Sare_0430"
FT   CDS_pept        complement(491656..494934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0430"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   stp:Strop_0360 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96359"
FT                   /db_xref="GOA:A8LZJ3"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ3"
FT                   /protein_id="ABV96359.1"
FT                   /translation="MRPRRALAALATVTTAASLTAVAVTPNAASAAPTDLFISEYVEGS
FT                   SNNKAIELFNGTGAPVDLAAGGYQLLIYFNGATTPTTFSLTGTVTADDVFVFAHSSANA
FT                   AILAQADQVTGAGLFNGDDAIVLRRGGTVLDAIGQVGTDPGAEWGTGLTSTANNTLRRV
FT                   GGVTSGDTEPGDDFDPAIQWAGFATDTVDGLGAHSLDGGGPVDAPATVVCGDALVTPAG
FT                   TAASREVTATDPDDEIVDLAVTSVTPAPDTGTISRTAVTPAGTVGGTARATVSASADLA
FT                   AGAYSVLVTATDADGTTATCTLPVQVTRELTVGEVQGQTTDAEAGAADRSPLAPASGNG
FT                   TSSLRYEVRGVITQRTLARDSSGRDQHGFFLQSRADATDGDPTSSDGIFVFMGSYTSLI
FT                   GGYVPTVGDEVVLQARVSEYYNMTQLSGASLVRRIATGLDVEQVVTVTDAVPPADLADA
FT                   QRFWERHEGARLRVRAGSTAVSGRDVFAATADAETWLIDRDDPLLDRDEPDTRRVFRDA
FT                   HPLDNDPSRVFDDGNGQRVMLGSLGVKAAAGDNTALLPPARTFDALTDDAVGGLYYSFR
FT                   KYGVQVESAAFAAGTDPSTNNPPQPARRSTEYAVAAYNVENLYDFRDDPFDGCDFAGND
FT                   GCPGVRPPFNYVPGSEQEYQDQLTALADQITNDLHSPDLILVQEAEDQDICTVEGAELV
FT                   CGDTNDADGAPDSLQELALTITGNGGPAYAAAYDRTGADNRGITSAFLYRTDRVALAEA
FT                   TADDPLLGSSPTVQYRAPGLPSNADVQNPKALNAVLPPDVDTSTGQDGDNVFTRAPQLG
FT                   RFTMAAAPGSREGFTLWAASNHYSSGPDRRVGQRREQAAYGAAIVSAIEASDPDARVVF
FT                   GGDLNVFPRPDDPIATAADPTPSDQLGPLYEAGLRNLWDDLLAAAPSSAYSYSYAGQAQ
FT                   TLDHLFVTEALHDDLVQMRAAHINADWPAEYAGDGSRGSSDHDPQVARFRSRATLTVAD
FT                   TSVVEGDRGRAELAFAVTVSRPLSEPTLVCALTFGKTARPAIDYRSYAGCQTLAAGQTT
FT                   LTFPVSVRGDRRQEADEKLALLVAGGPGLRLADPLGTGTIVDDD"
FT   gene            complement(495025..496038)
FT                   /locus_tag="Sare_0431"
FT   CDS_pept        complement(495025..496038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0431"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_0361 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96360"
FT                   /db_xref="GOA:A8LZJ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ4"
FT                   /protein_id="ABV96360.1"
FT                   /translation="MVRECDLRTASSAEIASLRDTLNAVLAADLPQDPPWQERSLREYL
FT                   TEMMPGERRIAWVAEADPGEDGGVTTAGMANVLLLGSIGVLEVLVHPSARRSGVGRELV
FT                   LTAARRVYQEGFQTIGVEAVGDTPSIAFFEALGFTKEYVETRSVLDLAGVDWAGLDKTA
FT                   EGVSAGYHVQFHPGGLPDQLIDAYARAKAEARDVEDEELRPSSYDPQRLRDSLDCLHRR
FT                   GMTPYIVLAVHEHTGEVAGLTEVVVPAQHPTRADQYDTIVVPDHRGYGIDRAIKARMLL
FT                   ELRSAEPQLTEVQTWNAQANEAMLKVNAELGYRPDREWCEYSVDVPELVHRLDAIH"
FT   gene            complement(496109..497374)
FT                   /locus_tag="Sare_0432"
FT   CDS_pept        complement(496109..497374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0432"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: stp:Strop_0362 membrane-bound lytic murein
FT                   transglycosylase B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96361"
FT                   /db_xref="GOA:A8LZJ5"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ5"
FT                   /protein_id="ABV96361.1"
FT                   /translation="MVDGQDNQTFRPLRPAAPAGGRQSGFGDDAGQQPALVPRPRRPWL
FT                   KPEPSPATEPTGTTVSESEVDAAPDDSTTTESAARTGAGPTVPATDCDGTTPTDADPTA
FT                   GVDPPDTDDPTEPTRAARAQRRRIPFAHAVRASPARLAARAARSVRRWSRRPSGQLTLP
FT                   GVFLLFLVAATVAAGAVLLPATVRSRPGAVAAEGTTTPTPTSVPGGGLPTGTLPPPGAT
FT                   MPVPPPGLGRPADTLATWAAEIGPKVGIAPVAVQAYGYAELVLAQTNRSCGLSWTTLAA
FT                   IGHVESAHGQANSARLGSDGRAVPEIIGLPLDGQDGRMLIRDTDRGTLDQDTTYDRAIG
FT                   PMQFIPTTWQEIGADADNDGRKDPHDIDDAALAAARYLCKGGRNLTIAGDWWNAILSYN
FT                   DVRRYAQDVYDKADQYGQASRT"
FT   gene            497431..497643
FT                   /locus_tag="Sare_0433"
FT   CDS_pept        497431..497643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0433"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   PFAM: Putative regulatory protein FmdB; KEGG:
FT                   stp:Strop_0363 putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96362"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ6"
FT                   /protein_id="ABV96362.1"
FT                   /translation="MPRYEFRCRACGDTFEVNRPMARAAEPARCPQGHDDTAKLLSTIA
FT                   VTGRSGVGGIAPTAGGGCCGGGCGC"
FT   gene            497794..500517
FT                   /locus_tag="Sare_0434"
FT   CDS_pept        497794..500517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0434"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: stp:Strop_0364
FT                   adenylate cyclase family 3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96363"
FT                   /db_xref="GOA:A8LZJ7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ7"
FT                   /protein_id="ABV96363.1"
FT                   /translation="MSPRIHLPTGWVTFVFTDIEGSTRLAQLLGPDYRPLLREHRRLLR
FT                   RTVAATEGAELLTEGDSFFLAFADASAALTACLTAQRALISHDWPTPDATPRVRMGLHT
FT                   GWAEPRDGEYASPEVHRAARIAAAAHGGQVLCSAATVHHADPMPGGASLLDLGLYRLRG
FT                   FDDRERLFQLIAPGLERQFPRPRTAEAAAHNLPTQVSSFVGRQAEWAELRRLVESSRLV
FT                   TVLGAGGTGKTRLAVELAADLVESHPDGVWFVDIATVADPGLVAFAVADVLGLRPEPGR
FT                   PMVDTLVEYAAARRMLVLLDTCDAQPAASAEAISRLLAGGVGVRVLATSRESFGLPGEV
FT                   VWRIPPLSVDPPVAGGESDAVALLLDRATAARGGRRPDPVESADLRRVVRRLDGVPLAI
FT                   ELAAARLRVLSVGQLAERLDDVLGTLDAGRDSLEPSASERHRTMQATLTWSYRTLNPRA
FT                   ARLLRWLAVFAGPVDLSTVEWLLEDDQLDPLSVLVDKSMVLAEPDVGGSTYRMLDPIRA
FT                   YAARRLAAAGEEQAARNRHVAWSAHALRRLRLGPDGRPVTLSLYALDPLVGELRAALRW
FT                   CATGGSAQAGLALASGLDQWWRERGLAWKGRHWLSRLYDRTVETGESIPDAELAAAYHM
FT                   HSLHAGADGEFAEELRYSQRAEAVARQVRDAGLLARVLAGRAAPLVDLGQFAEAEQVCR
FT                   EVIDWAHRQDVVGDALFAVFSLAELLWRRGALDEAAELLGAARPVEAGRPSERGRRTVD
FT                   MLLGLVALARGDLIAAHEHLLVALRSRMAHGFHRRACDTLEAIAVRCAAGADPLTAARL
FT                   FGAARATRAALRSAPGIYGEYFARWQAQVRETLGDVTFDGAYGEGAGWGMEEAAAVALG
FT                   VEHPDLAAGSTRFAAGVAQPTIASPLGPATAHPDHA"
FT   gene            complement(500551..501276)
FT                   /locus_tag="Sare_0435"
FT   CDS_pept        complement(500551..501276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0435"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   stp:Strop_0365 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96364"
FT                   /db_xref="GOA:A8LZJ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ8"
FT                   /protein_id="ABV96364.1"
FT                   /translation="MVALTLTPPSAERLRAVDEFLTEAWADQARHDSRLRDLAVEVGFD
FT                   RGVAHLTGEVGEPDDLRLVRDRVGRLAGVLGVWCRVRVGGREPVVVDLGCGATKQWPGN
FT                   LGLDICPAAGVDTLADLSSTLPLADGSVDVLFAVHILEHLIDFLPLVDEAHRVLRPGGT
FT                   LHVMSPWWGHVNAVADPTHVRLLDVQTIKGICLQRPPGAPRWHPLHAGCDGASIFADLT
FT                   PLPPDAPPPTQAHLARFFA"
FT   gene            501443..501805
FT                   /locus_tag="Sare_0436"
FT   CDS_pept        501443..501805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0436"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   stp:Strop_0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96365"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZJ9"
FT                   /protein_id="ABV96365.1"
FT                   /translation="MDLLAEYRRATLFFEAGDPTGAARLLEPILAAEPGNAAVRQLLAR
FT                   AYYSSAQLNRAEKHLRELVDRDPSDHYAHHVLGRTLERLNRHVDALRHLRIAAAMHHSN
FT                   DDYQAALRRVATRVGR"
FT   gene            501906..502160
FT                   /locus_tag="Sare_0437"
FT   CDS_pept        501906..502160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96366"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK0"
FT                   /protein_id="ABV96366.1"
FT                   /translation="MKLKLDLHDIYNRGTDIDRALREIMDEAVAKKATLVEIIPGKGSG
FT                   QLKKRVLRFLDQKDVKALYHRVEKDSKNFGRLFVHFRWK"
FT   gene            complement(502235..502861)
FT                   /locus_tag="Sare_0438"
FT   CDS_pept        complement(502235..502861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_4174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96367"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK1"
FT                   /protein_id="ABV96367.1"
FT                   /translation="MVLSGKLWFGRLRRTVGLTLAVALLGAAFGAAPARANTTDGLIVN
FT                   LSVNYSGFTTGFYPESGWRVKDGPDGVAVAFPQEWGYTYGPDGRIAAYPRSSGWRVKDG
FT                   PDGRAIAFPQEWNYTYGGDGRLVPYPRSGWRIDERSDDRRIAFPDEWFTWGQIIPSPAS
FT                   GDLSLMFPSASSQALLMAAEASLTPEEFSNYLIVQYIQQVIVGRD"
FT   gene            503289..504542
FT                   /locus_tag="Sare_0439"
FT   CDS_pept        503289..504542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0439"
FT                   /product="low temperature requirement A"
FT                   /note="PFAM: low temperature requirement A; KEGG:
FT                   sen:SACE_1900 low temperature requirement A"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96368"
FT                   /db_xref="GOA:A8LZK2"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK2"
FT                   /protein_id="ABV96368.1"
FT                   /translation="MGSRSEGANRPRRTAGLRRLRKRLWQPPRPHGQVRAGRRVSFLEL
FT                   FYDLIFVVVIGRAAHALAADVSWRTVGEFVVVFGLIWIAWMNGTIYQDLHGREDVRSRS
FT                   YVFFQMLILTVLALYTEHAGGEDGRAFAVVYSVLLLVLTWLWYVVRRHDPPELRPVPAL
FT                   YLIGMVLSVATVSGSAVLRPQHRLLVWAVLVVAWMIGLMLLHRPDRSIEDIGVRPSPAL
FT                   AERFGLFTIIVLGEAVLGVVVGILDAGRTPRAIATGLTGLLIAYAFWWTYFDLVGRRLP
FT                   GVTGGWFGRWVSLHLPVTGAIAAAGAGMESMVEHATDSHVPLATGWLLAGAVALLNLGL
FT                   IMLIRTLNDYRRLLPVYRPVNVALAVGAGVALLIGWIRPPPWMLALSLVAVLAAVWWVG
FT                   VNRMLHLPDPDEALPKPE"
FT   gene            504804..505616
FT                   /locus_tag="Sare_0440"
FT   CDS_pept        504804..505616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0440"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: stp:Strop_0369
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96369"
FT                   /db_xref="GOA:A8LZK3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK3"
FT                   /protein_id="ABV96369.1"
FT                   /translation="MTENLFDDVGALLRAVADRVVLPLFRRLDDDDVEEKAPGDLVTTA
FT                   DRQAEEMISAGLRRLRPDSVVVGEEAVAEDPALLRHLDRPGHVWLVDPIDGTANFAAGR
FT                   RPFALMVALLMDGEPTAAWVFDPLGDTLAVARTGVGTYVDGRRVRTTGAPADPGRLRGA
FT                   AMSHYLPPAFRRRVEAAGERLGEVLPGQHCAGREYLDLLLGEQQFVLFWHTLPWDHVPG
FT                   ILLVRAAGGVARRFDGTDYHPVVEGKGLLVAADERVWSAAWEALFGGA"
FT   gene            505793..506794
FT                   /locus_tag="Sare_0441"
FT   CDS_pept        505793..506794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96370"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK4"
FT                   /protein_id="ABV96370.1"
FT                   /translation="MRTGLPRGCRSPLITLTVAVAVLLGAAPAQAEPAEGGTEKLRNAL
FT                   TATAKKHLDATNKLKESKRRQQELTTELKAVEVRLVDLTAQVGEVAAQSYRLGRLTPVA
FT                   TLLEATSPGEFLDRSMSLDAMAQRDSRKVRELTDTRDTASDAKQAIDAEVREQEKQLAV
FT                   LAKNKKAAEAALAAVSSGSGSGFGGLSANATPAPRNSNGSWPSESCSVNDPTTSGCITP
FT                   RTLHMLKQSQAAGFKRHVSCYRSGGGGEHPKGKACDFSAASGGFEDVTATGGDKTYGDR
FT                   LAAYLKSNASRLGVMYVIWYRQIWMPSTGWRSYSGGGSPAADHTNHVHVSMY"
FT   gene            506831..508384
FT                   /locus_tag="Sare_0442"
FT   CDS_pept        506831..508384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96371"
FT                   /db_xref="GOA:A8LZK5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LZK5"
FT                   /protein_id="ABV96371.1"
FT                   /translation="MNSASSHITVRPARLDSATGRALPRGLAAFLVFFSSGAVLVLETA
FT                   ALRLVGPYVGVTLQVTSSVIGIALAAIAYGAWAGGWLADRRDPRTLLAPALVLAGIATA
FT                   VTLPVVRYAGEVLRGGAASAILLLVALAVFVPAMLLSAVTPMVVKLQLADLRRTGQVVG
FT                   RLSSIGTLGAVTATMVTGFVLVAALPSTVILLGLAVSLGLTGLALGWWLRRTAGRQVTG
FT                   PARVSAGLAALGLLGAGLTTVAPNPCDIETAYHCARVEVDPGRASGRTLLLNSARHSYV
FT                   DLADPTHLEYAYTKWIGAVADVIAPAGRRLDALHLGGGGFTVPRYLTATRPGTDNVVFE
FT                   IDGGLVELGEEKLGVRQGPDLRAVVGDARTLVAAESAESRDLVVGDAFGHLVVPWHLAT
FT                   REMAAEIRRVIRPGGGYVQNVIDYPPLRFIRSEVATVAAEFRHMALIAPQAALAGEQGS
FT                   NFVIVASDEPIPLTALRERLSAVDPGATVLDGAALAGFVDDALVLTDDYAPVDQLLATA
FT                   "
FT   gene            complement(508433..509101)
FT                   /locus_tag="Sare_0443"
FT   CDS_pept        complement(508433..509101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0443"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: stp:Strop_0372 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96372"
FT                   /db_xref="GOA:A8M051"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8M051"
FT                   /protein_id="ABV96372.1"
FT                   /translation="MSARRNPHSGVIVVGLGRFGSHVADTLVHLEHEVLAIDHDAERVQ
FT                   RWANRIDRVVQADATEEGALSQLGAADLERAVVAIGASMEASVLSVLALVELGIPQIWA
FT                   RATSAEHAKILASVGAHHVIFPEAETGERLAHLIVSRMLDFIEFGDDFAIAKVRTPESL
FT                   TGRPLAELAPEDRHGVRVVGVKLAGERFQAATDDSVLTPGSMLIVEGSIEQVQLFAALT
FT                   "
FT   gene            complement(509091..510425)
FT                   /locus_tag="Sare_0444"
FT   CDS_pept        complement(509091..510425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0444"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: stp:Strop_0373
FT                   H(+)-transporting two-sector ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96373"
FT                   /db_xref="GOA:A8M052"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A8M052"
FT                   /protein_id="ABV96373.1"
FT                   /translation="MHWLMQRPVRLVPIGFGTTILIGTLVLMLPWATGQQRHTPFVTAF
FT                   FTAASAVSVTGLAVVDTPNYWNDFGLVVITVLTQVGGLGILAGATLIILVVSHRLGLRN
FT                   RLLVQAETAEFGLGDVRRLLFRIAAISLAVEATIAVILTLRLWVRYDYAFGEALWAGVF
FT                   HAVQAFNNGGFALYTDGLIGLSSDAWLILPMAFGALIGGLGFPALFEAIRCWRRPAGWS
FT                   VATKLTLWGSAALLMAGFLALLAAEWSNPYTLGIRPWPDKLLAAFAQNAFFRTGGFNVI
FT                   NIEALGEEGIPVIIALMFIGGGSASTAGGIKVSTFFLLAFVIWAELRGEPDVTVRHRRI
FT                   ATASQRQAVTVALLGVALVVAGTVTLILLTEGVPHHFALFEVTSAFSTAGLSLGLARDL
FT                   PASGQIVLIALMYIGRVGSLTLGSALALNTRRRLYRYPEEQPLVG"
FT   gene            510611..511357
FT                   /locus_tag="Sare_0445"
FT   CDS_pept        510611..511357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0445"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: stp:Strop_0374 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96374"
FT                   /db_xref="GOA:A8M053"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M053"
FT                   /protein_id="ABV96374.1"
FT                   /translation="MGERLAVVSGGGTGIGAAIARVLAVDGFDVLVVGRREEALRATTA
FT                   RISWDIARPGAVRAVVADLADPEQVSRVAETVEGRAVDAVINNAGSYRGGDSGTLAGVA
FT                   HQWRANLDANILTAVLLTEALRPALRRPGGRVILVSSIAAQQGGGGPYSAAKAALHGWA
FT                   YDLAAQLGPEQITVNVVSPGYVTDTEFFGGRMTPQGHARRVAATLVGRAGTPDDIAEAV
FT                   RYLAGPAAGYVTGQVLGVNGGSVLGR"
FT   gene            complement(511385..512176)
FT                   /locus_tag="Sare_0446"
FT   CDS_pept        complement(511385..512176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96375"
FT                   /db_xref="UniProtKB/TrEMBL:A8M054"
FT                   /protein_id="ABV96375.1"
FT                   /translation="MTQRTCATTPVRRFAVGSATVVAAGILLAGCGAGGDPPPPPDPKD
FT                   TLLSAVPNETTPAFRFTGTDASGTVTGSVDPAGKGMELTVVQQDAEAEFALTISFRVVD
FT                   QRSWMRVDFEDAVELSTLLELPRQWMELDQSKLTKPEVYGGADVGNAAAIIRTAVAVQQ
FT                   QTDGSYAGTVDLTGGPEVAEAVDGVDVTAMGEAATAIPFTAVVGANGNLGTLALDLPAV
FT                   GEQQAVEYVVRYYDHGNTPAVAPPTGDVAPAPAAAYDLLNG"
FT   gene            512289..514415
FT                   /locus_tag="Sare_0447"
FT   CDS_pept        512289..514415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0447"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="KEGG: stp:Strop_0376 ATP-dependent DNA helicase,
FT                   RecQ family; TIGRFAM: ATP-dependent DNA helicase, RecQ
FT                   family; PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96376"
FT                   /db_xref="GOA:A8M055"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8M055"
FT                   /protein_id="ABV96376.1"
FT                   /translation="MAVREQAETVLRRLAGEHARLRDDQWRAIEALVVDRRRVLCVQRT
FT                   GWGKSAVYFVATALLRAAGEHGPTVIVSPLLALMRNQVDSAARAGIRARTINSANLDEW
FT                   DEITGEIHAGTVDVLLISPERLNNPDFRDTVLPKLAATTGLLVVDEAHCVSDWGHDFRP
FT                   DYRRLRTFLGNLPVGTPVLATTATANARVTQDVAEQLGDSSRPGVGPEALVLRGSLDRE
FT                   SLRLGVVDLPGPAYRLAWLADHLEDLPGSGIVYTLTVAAAAETAEFLRSRGYAVASYTG
FT                   QADDADRRAAEQDLLDNKIKALVATSALGMGFDKPDLGFVVHLGAPPSPIAYYQQVGRA
FT                   GRAVVHAEVLLLPGGAEDAAIWRYFASLAFPPESQVRTVLAALPTDRPLSTQALEPMVD
FT                   LRRTRLELMLKVLDVDGAVRRVRGGWVATGAPWTYDEARLRRVAAARTAEQAAMREYAT
FT                   TPGCRLRYLRECLDDVAATDCGRCDRCAAPTFQADVSDDALRAAEAFLGRPGLGIPPKK
FT                   LWPTGLAAVGVPLKGRIALPEQALPGRAVGRLSDLGWGGRLRELVGPDAVDADVPDDVV
FT                   AAVVEVLRAWAHGADPWPRRPVGVVAIGSHRRARLVASLAGRIAAVGRMPLFGTVAVAA
FT                   DGGPRGNSAQRVRALHGSVALPPELAGALAGLDGPVLLVDDLVDSGWTMTMVARELRRA
FT                   GATDVLPLALAVAG"
FT   gene            complement(514420..514833)
FT                   /locus_tag="Sare_0448"
FT   CDS_pept        complement(514420..514833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0448"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   stp:Strop_0377 putative transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96377"
FT                   /db_xref="GOA:A8M056"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8M056"
FT                   /protein_id="ABV96377.1"
FT                   /translation="MASEDVTPQAAFARFVRRAIDDARAERGWTVTELATHTGIGRSTV
FT                   FRWLAGDWHDYPELAKVRSFCAALGLPVAAAFRALGLPDTGPVPRGRDDGPVEADVRVI
FT                   LQHLADPTVPVEEKHHIRDLLRYLAQRPIRRIG"
FT   gene            complement(515046..516224)
FT                   /locus_tag="Sare_0449"
FT   CDS_pept        complement(515046..516224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96378"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8M057"
FT                   /protein_id="ABV96378.1"
FT                   /translation="MPEPLHAALAEVRALLLAPGLSRAVGAGHRRGLRPTVHRAELRPV
FT                   TLKSGPRLQITTSDGSRPHTRNVGWDGEADAAVDALLAEPFGNWHVETAETTLQLRVTK
FT                   SGAAQVHRAAAQPVAEPAAHDRTKAHLLDPGDPIFTVIGASAAKRRQVDAFLRALAATL
FT                   PDDLAGPLHVVDLGCGNAYLTFAAYHWLTQRGLDVHLIGVDVREDQRQRNTELARRLGW
FT                   TDRVRFVAGTIADAPVGSAPDLVLALHACDTATDEALARAVRWRSRWVLAAPCCHHDIA
FT                   AQLRSRPTPPPYELLTRQGILRERFADVLTDAVRAGLLRLHGYRAEVVEFVDSRHTPRN
FT                   LLIRARRTGAIPTGERWTEYRTLVDGWRVTPRLAMLLDEPPAGTSTGAAVAD"
FT   gene            complement(516394..518040)
FT                   /locus_tag="Sare_0450"
FT   CDS_pept        complement(516394..518040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0450"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   stp:Strop_0379 DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96379"
FT                   /db_xref="GOA:A8M058"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8M058"
FT                   /protein_id="ABV96379.1"
FT                   /translation="MSELTHNLMDGTELAATAPVSPEAPTFAELGARQETVDALAAAGI
FT                   TRAFAIQEYALPIALRGVDLIGQAPTGTGKTLGFGVPLLEQVLAPAEGGDGTPQALVVV
FT                   PTRELGIQVAKDLQAAGSTRGVRVLPIYGGVAYEPQIEALRSGVEILVGTPGRLLDLAK
FT                   QKHLKLDRVRALVLDEADRMLDLGFLDDVERILAILPEDRQTMLFSATMPDPIVALSRR
FT                   FLRRPVTIHAGHTAETGPSPQTQQLAYRTHSLNKIEIVARILQARGRGLTMIFTRTKRA
FT                   ADRVAADLDFRGFAVAAVHGDLGQGARERALRAFRTGKIDTLVATDVAARGIDVSGVTH
FT                   VLNYDCPEDQDTYTHRIGRTGRAGASGVAVTFVDWDDMPRWRIIDKTLGLDMPEPPETY
FT                   HTSPHLYADLDISPEVTGTLPTGARTRAGLSAEVEEDLGGRARRGDSRGTRRGAGRNRR
FT                   RDRGGDAGRGAAATTEPAEATETAERPPRRRQRRRGGEVVSSGQPAVTTAETDEPAVVD
FT                   PQGAAAPKPRRRRRRRGGGSGTGAAAGTTTD"
FT   gene            complement(518649..518876)
FT                   /locus_tag="Sare_0451"
FT   CDS_pept        complement(518649..518876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96380"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:A8M059"
FT                   /protein_id="ABV96380.1"
FT                   /translation="MEVKIGVQYAPRELVLESAQSPAEIERIVTDAIASDGGTLSLTDE
FT                   RGRRVIVPVDKVAYVEIAEASPRAVGFTAR"
FT   gene            complement(518941..519579)
FT                   /locus_tag="Sare_0452"
FT   CDS_pept        complement(518941..519579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0452"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_0381
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96381"
FT                   /db_xref="GOA:A8M060"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8M060"
FT                   /protein_id="ABV96381.1"
FT                   /translation="MTAVGNGAQTAGRPTRLPRSARRRQLLAAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKMELYLALLDTHCDAIVAKVQEAMRSTTDNKERVSASVRA
FT                   YFDFVDHESEAFRLVFESDLRNDPAVRQRVERVEQGCIAAITDTIISDTGVSRAHAELL
FT                   ASGLVGAAETAAQFWLARGRRVAKAEAESLVAALSWRGIASFPLQGESA"
FT   gene            519725..521992
FT                   /locus_tag="Sare_0453"
FT   CDS_pept        519725..521992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96382"
FT                   /db_xref="UniProtKB/TrEMBL:A8M061"
FT                   /protein_id="ABV96382.1"
FT                   /translation="MSDAGQPGAATPGEHGDGTGPRPDRPRSGIPWAPATGGWSSDSTP
FT                   PWHRSDPPASWANSSSRHGDLPAPSPGVPDSTSRPRLNGFRVNGHSYPEPEASAGRPGP
FT                   VSAPPQDAAGVGSAVTAPAVEQPPVPAEPYPVPGRRASDESAGPPRRSEPGSVPPTVRV
FT                   SPHDTAAKGFEVPPGFHPSASGWKTESAGGGGSDHPADTGPTPLPEPDWSDPSWNRPSW
FT                   GSEWAPPWADGESTSFGGQAVAEPDPTGWDDAESRGRRFRGGMERDESAEQSETTGRRF
FT                   RPDPDVTEAGEGRRVRAERPAWAVEPQRAYQPIPAHRSPEVPAAGAAEQPAGPAEAAPA
FT                   ESGPGGWDRVPSGSVPTSTPPYTARRSAPEPAPTAQSAQADRLPDSASAMLPQRVPAKP
FT                   DVPVVPEPPAVEPPAQTPELARIATHLRQADEPPSLRERPEGFDVDAILGAVRGVAGVR
FT                   DAALRRTPAGAHSLRLDLADGADPAEVSRHVARLLQERMGLAAAPQTMSDEHPEPVPRA
FT                   RRWAAEPARDEPGPATTGWSPGGLPSRTERRGAALSEPPRRRRHPGGTHRGRAVVDALT
FT                   DTPGGATDGPTTLEASYTGGQVSTTETAPSRPLDTGGRPGPRVVLDHVQVSTFGLDATV
FT                   EVRLVSAGSPAAGYATGPAVDGYVLRLCAAAAAAAVDELLREPGPKPDRGRCFVEHATL
FT                   VPLGTCEVATVVVLLVCDGWVEQLAGSALVAGDPRQAVVRATLAAVNRRLEALLVETGD
FT                   LG"
FT   gene            522140..523321
FT                   /locus_tag="Sare_0454"
FT   CDS_pept        522140..523321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0454"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Rhodanese domain protein; MoeZ/MoeB domain protein; KEGG:
FT                   stp:Strop_0383 UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96383"
FT                   /db_xref="GOA:A8M062"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8M062"
FT                   /protein_id="ABV96383.1"
FT                   /translation="MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGVEGQKRLKNARVLC
FT                   VGAGGLGSPALMYLAAAGVGTLGIVDFDTVDESNLQRQIIHGVSDVGRAKAESAAATIR
FT                   EINPLVAVEIHDVALDRDNVKDIFARYDLIVDGTDNFATRYMVNDAAVLLGKPYVWGSI
FT                   YRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPSCAEGGVLGVLCASIGSIQVNEAIKLL
FT                   AGIGEPLVGRLMVYDALEMSYRKIKVRKDPNCALCGENPTVTDLLADYEDFCGAVSAEA
FT                   QEAVIDATITAGELKAWQDAGKDFLLVDVREPAEFEIVRIPGATLIPKGEIISGEALVK
FT                   LPQDRQIVLHCKSGVRSAEALAALKAAGFRDAVHVQGGVLSWIKQVDPSLPAY"
FT   gene            523338..524273
FT                   /locus_tag="Sare_0455"
FT   CDS_pept        523338..524273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96384"
FT                   /db_xref="GOA:A8M063"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A8M063"
FT                   /protein_id="ABV96384.1"
FT                   /translation="MAGARHGGYGTHEFRRTPGSGRSIPLGRIRICPGSVAAVVDTDAA
FT                   IGYVVAHGDVVERARLGCLRTGTPATVEALDVAEGGQLPDGGWPAYLEGKVASVDATCF
FT                   RLGELDDLGALGRPAARRALDWLAFRQLPEGGWEEDTALAGTAPEWARPGDPAAGIYLT
FT                   ANAAFWLSVAGLDARAAGPLDARVGGVYANVVHAAALFLAGRVSPDGTWPSFLAAGWLG
FT                   AAVLFRQEMFQESARIQVALAERIGDMSPANVAWLAATLRRVGVDAQDRVLVRARRRLA
FT                   ETQRSDGGWESDDGHQFDVHATLTAIRACR"
FT   gene            complement(524343..525584)
FT                   /locus_tag="Sare_0456"
FT   CDS_pept        complement(524343..525584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0456"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   stp:Strop_0385 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96385"
FT                   /db_xref="GOA:A8M064"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8M064"
FT                   /protein_id="ABV96385.1"
FT                   /translation="MSVVEQAQRARTAAAELAVATRSVKDAALHAMADALVARTPEILA
FT                   ANGADLAAGREGGLNAAVLDRLALDTGRVAGIADALRQMAALPDPIGEVVRGSTLPNGL
FT                   ELRQVRVPFGVVGIVYEARPNVTVDAAGICLKSGNAVLLRGSSSAAQSNAALVAVLRDA
FT                   VAGAGLPADSVQLLDATTRDSVKELMRARGLVDVLIPRGGAALIRTVVEESTVPVIETG
FT                   VGNCHVYVDAAADVSKAVAIALNAKTQRLSTCNTAESLLVHAAVADAFLPPALAALAAA
FT                   GVTVHGCPEVARYSAAVLPATDEDYATEYLSADISVAVVDSLDAAVAHIRRYGTGHTEA
FT                   IVTDSQPAAREFVARVDAAAVMVNASTRFTDGGEFGFGAEIGISTQKLHARGPMGLPEL
FT                   TSTKYVVTGDGQLR"
FT   gene            complement(525640..526749)
FT                   /locus_tag="Sare_0457"
FT   CDS_pept        complement(525640..526749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0457"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: stp:Strop_0386 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96386"
FT                   /db_xref="GOA:A8M065"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8M065"
FT                   /protein_id="ABV96386.1"
FT                   /translation="MRDRVTAARRVVVKIGSSSLTTATGGLDDGRVDALVDTLGGLAAQ
FT                   GREVVLVSSGAIAAGLAPLGLTRRPRDLATQQAAASVGQGLLIGRYAAAFARHHLTVGQ
FT                   VLLTVDDMTRRAHYRNAYRTLRKLLDLRAVPIVNENDTVATEEIRFGDNDRLAALVAAL
FT                   VDTDLLVLLSDVDALWTGDPTRPGSTPIAEVHDARDLSGVAIGGAGRSGVGTGGMVTKV
FT                   EAARIATGFGIPVVLTSADLAAEALDGKPVGTLFHPSPRRPAARLFWLAHATSPRGRLH
FT                   LDPGAVEAVVDRRKSLLAAGISAVQGAFTAGDPVDLVDTEGVPVARGLVNYDAVELPGL
FT                   LGRSTSELATALGPAYEREVVHCDDLVLL"
FT   gene            526811..527146
FT                   /locus_tag="Sare_0458"
FT   CDS_pept        526811..527146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0458"
FT                   /product="Methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase DNA binding"
FT                   /note="PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: stp:Strop_0387
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96387"
FT                   /db_xref="GOA:A8M066"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8M066"
FT                   /protein_id="ABV96387.1"
FT                   /translation="MGPEEYVEAVLELVERIPPGRAMSYGAVADALAERSGRTSPRLVG
FT                   SILARHGGGVPWHRVVTSSGRLPPGHEHQARARLLAEGTPLRGDGVDLRAAGWSPESGC
FT                   DRRHKCE"
FT   gene            527158..528603
FT                   /locus_tag="Sare_0459"
FT   CDS_pept        527158..528603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0459"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0388 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96388"
FT                   /db_xref="GOA:A8M067"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A8M067"
FT                   /protein_id="ABV96388.1"
FT                   /translation="MDASPAGTGPPVAGPTAALASAGAAAGPPPAGVLPRRVHVGYASG
FT                   SLATGAFGTVPGLLLLPYLTDTLGVTAGIAALLVLLPKAWDVLVNPVAGRISDRTRSRW
FT                   GARRPYLFGAGIALGLFFAAIFAAPFGTGAAAGGYVALTFLAAATAFAFFQVPYVAMPA
FT                   ELTTGYAERTRLMTWRIAVLALAILVSGAVAPLVRDAGGGGLAGHRWMGFFVAGLIVLG
FT                   ALGAFVGTRSAPVGAVAENEPTLRAQLAVAGRNRAFRALLACFVIQSAGVATILAGVNY
FT                   FATQILRDPEGGPTILFVCFVGPAILVMPVWSRVGRRFGKLTGLVAAALIFAAGALALV
FT                   TAEILPAAGIYLLVALVGVGYAGQQVFALAMLPDCIAYDEARTGRRQAGVFTGVWTAGE
FT                   TFGLALGPGIFGLVLQLSGYLPSDTGAAAAQPDSARLGILLGFTVLPALLVAAATLLLR
FT                   PYSLTPAELGAATGPPPGARDAR"
FT   gene            528644..530146
FT                   /locus_tag="Sare_0460"
FT   CDS_pept        528644..530146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0460"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: aminotransferase class V; Pyridoxal-dependent
FT                   decarboxylase; KEGG: stp:Strop_0389 pyridoxal-dependent
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96389"
FT                   /db_xref="GOA:A8M068"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8M068"
FT                   /protein_id="ABV96389.1"
FT                   /translation="MIDEDGLPVRGLPAERVLEEVRALRAGDRPTHGGRLFALVFDPAV
FT                   PGLDALTASAHAESAHVNGLDPTAFPSLVAMENALVGAAARLLGGGPGTDAPEVVGAVT
FT                   SGGTESLILAVKTARDAHPEIAEPRIVVPATAHAAFAKAGHYLRVAVDMVPVSAETLRP
FT                   DPAAVAAAIRPETVLVGASAPGYAHGVIDPVAEIAAVAADAGVRCHVDACFGGWTLPWL
FT                   RRLGEPVPAFDFALPGVTSISVDLHKYAYAPKGVSILLHRDPELRKPQYFAHADWPGYT
FT                   MINPVIASTRSGGPIAAAYATLRHLGEDGYLRLAAATRDAVNGLADAVRATPGLRLLAE
FT                   PESTVICVAATDPELDLFVLVDELDARGWHTQPQLAYAGLPRNVHLSVTASVAPLVAGF
FT                   GADLADAVAATRAAGPVRLPVELLALARSLTPEGLTPDRVAGLTAGLGVGSGDAADDAS
FT                   PALVPSRMAVVNTLLEAAPAALRERLLVEFVGLMQRPTWSRH"
FT   gene            530270..530836
FT                   /locus_tag="Sare_0461"
FT   CDS_pept        530270..530836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0461"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: stp:Strop_0390 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96390"
FT                   /db_xref="GOA:A8M069"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8M069"
FT                   /protein_id="ABV96390.1"
FT                   /translation="MQVPAVLGEPIRFVLNWGRRYSLWVFNFGLACCAIEFIATSMSRH
FT                   DFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGACSNCGGP
FT                   YWDSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEGAGVGGVSRPDALA
FT                   SPTGGAAPRSADSLTAPLVRPPTPS"
FT   gene            complement(530969..532015)
FT                   /locus_tag="Sare_0462"
FT   CDS_pept        complement(530969..532015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0462"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: stp:Strop_0391 alcohol dehydrogenase GroES domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96391"
FT                   /db_xref="GOA:A8M070"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M070"
FT                   /protein_id="ABV96391.1"
FT                   /translation="MRAVTVSPRVRDSLRLVEDWPEPAAEEGAILVEALAVGVCGTDLE
FT                   IVEGQYGEAPPSQERLVIGHESLGRVLEDPTGTLHPGDLVAAVVRHPDPVPCPNCAVDE
FT                   WDMCRNGRYTEHGIKGLPGFARDRWRVQPRFAVPLDTTLARVGVLLEPTSVVAKAWEHI
FT                   ERVGHRAQWDPRIALITGAGPIGLLAALLATQRGLTVHVLDRNTTGPKPDLVRALGATY
FT                   HTGSVNDVDVEPDVLVECTGAPTVVLDAMCKVGPTGVVCLTGVSTGGRIIDFDAGALNR
FT                   TLVLENNAVIGSVNANRRHWGQAADALARADRSWLESLITRRVPMSDFATAYAISDGDI
FT                   KVVLDLTA"
FT   gene            532159..532866
FT                   /locus_tag="Sare_0463"
FT   CDS_pept        532159..532866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0463"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 30 kDa
FT                   subunit; KEGG: stp:Strop_0392 NADH dehydrogenase
FT                   (ubiquinone), 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96392"
FT                   /db_xref="GOA:A8M071"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A8M071"
FT                   /protein_id="ABV96392.1"
FT                   /translation="MNLDEVGQRMAALLAPVEVTTSVSGGQAHARATVDVPSASWPDAL
FT                   RAARDDSDLACDYFDWLSAVDELEAGFDVVVHLWSTAHRHGLLLRTRVPRTAPRVASVV
FT                   TVYPGAAWHERETHEMFGIDFVDHAGLKPLLLPPEFEGHPLRKDFVLASRVAKPWPGAK
FT                   EPGESRAGGGRRPIRPPGVPAPGEWGAVPTPAGAAGVGEGPRGGTPARPNRDRSGGRGS
FT                   GVTGQPSEGGGTV"
FT   gene            532866..533828
FT                   /locus_tag="Sare_0464"
FT   CDS_pept        532866..533828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0464"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: stp:Strop_0393 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96393"
FT                   /db_xref="GOA:A8M072"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A8M072"
FT                   /protein_id="ABV96393.1"
FT                   /translation="MPLWVELVLRVGGVLVAFLTLPLLVGQAEHKIMAHMQGRLGPMYA
FT                   GAFHGWAQLVADGVKFVQKEDVTPRGADRLVFRFAPVVALVPYLLVLLVIPLGPGDLVA
FT                   QPLDIGLFFVLAVVGVGVVAVLMSAWASANKYSLLGGLRGAAQLLGYELPLVLAAASVA
FT                   MAAGTLSLPGIVEAWQPWWLLWQAPALVVFFVAGLAEIRRPPFDMPIADSELVFGYLTE
FT                   YTGLRFAFFLLAEYVGVVVIAALTTVLFLGGWQGPFADAQLGWLWTLLKVAAVSFVIIW
FT                   LRVSYPRLREDQLQRLCWLVLVPASLAQLVLTAAVRIAF"
FT   gene            533948..534439
FT                   /locus_tag="Sare_0465"
FT   CDS_pept        533948..534439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0465"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   stp:Strop_4392 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96394"
FT                   /db_xref="GOA:A8M073"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8M073"
FT                   /protein_id="ABV96394.1"
FT                   /translation="MFTLIRDDGYLISTDPERLDLDRVHHWLTTDAYWARGRDRATVQR
FT                   AFATSIGFGVYRPVDGCQVAVARVITDRATFAWICDVYVDRAERGQGLGTWLAGAVRDQ
FT                   LTELGIHKILLATNDAHGVYAKVGFVPLQQPDLWMQLDQRVSPVTSKESSHKSPLTVTA
FT                   "
FT   gene            534439..535389
FT                   /locus_tag="Sare_0466"
FT   CDS_pept        534439..535389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0466"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   stp:Strop_0394 RarD protein, DMT superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96395"
FT                   /db_xref="GOA:A8M074"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8M074"
FT                   /protein_id="ABV96395.1"
FT                   /translation="MPHKLGYLYGIGAYLIWGFFPLYMKLLQPASPLEILAHRIVWSVV
FT                   FVALVLAAMRNRSFLRALLRRPRALAAVGIAAALIALNWGTYIYGVNSERVVETSLGYF
FT                   INPLVVVLLGVFVLRERLRPAQWAAMGVGGTAVVVLTVDYGRPPYLALVLSFSFAGYGL
FT                   VKKRLGLPAAQGLFVESAVLALPALAYLAWLGGTGQAAFGAVSAGHTALLVSAGAATAI
FT                   PLLMFAGAANRLPFTSLGMLQYLAPILQLGCGVIIFHEPMPPARLAGFTLVWLALAIFT
FT                   ADAVRAARRLAPRRDQGVLAAVRPGTSSQPELQDR"
FT   gene            complement(535479..536540)
FT                   /locus_tag="Sare_0467"
FT   CDS_pept        complement(535479..536540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0467"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="KEGG: stp:Strop_0399 glutathione S-transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96396"
FT                   /db_xref="GOA:A8M075"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8M075"
FT                   /protein_id="ABV96396.1"
FT                   /translation="MTEDGAASGGDESPGRTGGRYVEPGGEFTRDQRYIATRITVDGGD
FT                   GWPVEPGRYRLAVSRACPWASRLVIVRRLLGLEGAISMAIAGPTHDERSWTFDLDPGGR
FT                   DPVFGIERLAEAYFARFPGYDRGITVPAIVDVPTGQVVTNDYAQMSLDLSTQWTEYHRD
FT                   GAPDLYPQRLRDEIDEVNEVVFTDVNNGVYRCGFAGSQQAYDRAYRRLFDRLDWLSDRL
FT                   AGRRYLVGETITEADVRLFTTLVRFDPVYHGHFKCNRSRLTEMPVLWAYARDLFQTPGF
FT                   GDTVDFDHIKRHYYEVQRDINPTGIVPLGPDLSAWLTPHDRGALGGRPFGDGTAPPPPA
FT                   PAERVDPAHTPLH"
FT   gene            536698..537348
FT                   /locus_tag="Sare_0468"
FT   CDS_pept        536698..537348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0468"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: stp:Strop_0400 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96397"
FT                   /db_xref="GOA:A8M076"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8M076"
FT                   /protein_id="ABV96397.1"
FT                   /translation="MVGMTDPSERSGPADGGRGLPGAGLVKGLAVTLKTMTRRSATQQY
FT                   PDVAPALPPRSRGVIALLEENCTVCMLCARECPDWCIYIDSHKEEVAVPGATRPRQRNV
FT                   LDRFDIDFSLCMYCGICIEVCPFDALYWSPEFEYAEYDIRDLLHDKEHLSEWMGTVPPP
FT                   PAHDPNGEPAKEETAAARKAAIPASPADRPGAPPGRPEHRPTGNTATGEGPPR"
FT   gene            537345..537947
FT                   /locus_tag="Sare_0469"
FT   CDS_pept        537345..537947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0469"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: stp:Strop_0401 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96398"
FT                   /db_xref="GOA:A8M077"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A8M077"
FT                   /protein_id="ABV96398.1"
FT                   /translation="MTAADALLLALGALAVGSGALVVATRHLVRAGLYLVLCLAAVAGM
FT                   YLVLTAELVAWVQVLIYVGAVVVLLLFAVMLTRAPIGASTDLDRPGWPAALIGGGTGLG
FT                   LAALLVDAYRWSTVQLPTAGTAERIGEQVFQSWVLPFEVLSMLLLAALVGAIILSRPDI
FT                   GRPPVDRDGQGRPGRAGDAADATGGVDGKPGEGRRFP"
FT   gene            537944..538300
FT                   /locus_tag="Sare_0470"
FT   CDS_pept        537944..538300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0470"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   stp:Strop_0402 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96399"
FT                   /db_xref="GOA:A8M078"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A8M078"
FT                   /protein_id="ABV96399.1"
FT                   /translation="MRPVIPYVTAALLFGLGTYGVLRRRNAVLVLMAVELMLNAVNLIL
FT                   VTADTTVRAQLPHGGQVFALFVIVLAAAEVGVGLAIVLQLYRLRASVAVDEVPLAEPPA
FT                   LTSSTTATAQEGHR"
FT   gene            538297..540237
FT                   /locus_tag="Sare_0471"
FT   CDS_pept        538297..540237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0471"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: stp:Strop_0403 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96400"
FT                   /db_xref="GOA:A8M079"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A8M079"
FT                   /protein_id="ABV96400.1"
FT                   /translation="MTAPILLGTLLPVVPLVAGLIGLLLPPAPQATGGGEPRARRMAIV
FT                   LGTTGATLSLVLAIALLATLDAPAEASRTWIDFGGLVVTLGIRLDPTVALVAVAVAAVA
FT                   LAVQVYSVGYLRRGPHDAVDVDHRYPPYAAQISLFTAAMLLVVVAGDLILLLVGWEVMG
FT                   LCSYLLIAHDRRLSEAPAAAMKAFLVTRVGDVGFLLGIALLGVSAGSFRIADVLGHDHN
FT                   TGILTAACLLLLAGVAGKSAQFPLHTWLPDAMAGPTPISALIHAATMVAAGVYVVTRLF
FT                   PLFEQVPVALAVLGVAASLTLLLGAFAAAAQDDLKRVLAWSTVSQLGYLTGALAVGAPA
FT                   AALFHLLTHAAFKALLFLAAGAVIHAVGSTLMSQLGGLRQTMPVTFWSMLIGLGALAGL
FT                   PPLSGFFSKEAVLYAAEEAALHGGPAPAWVGWSVWLAGLAGVALTAWYATRLLLRTFLG
FT                   EPRSPVLQPHDPPAVMRWPVLLLTVPAALLGLAGFSGDFAGRLQPSLDEPSANLLPPDP
FT                   LVQLGPTVLLPLALLPLGAGLAWARWRRDPTGDPATMLGRLRPLFARAFRLDDLQHTLV
FT                   VRPVTGLAAGTRAADEVVVDGVVTGSGRAAWRLGGVLAAWHRATLPRAATGVLAGALLL
FT                   GLVAVLIGGVA"
FT   gene            540234..541745
FT                   /locus_tag="Sare_0472"
FT   CDS_pept        540234..541745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0472"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: stp:Strop_0404 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96401"
FT                   /db_xref="GOA:A8M080"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A8M080"
FT                   /protein_id="ABV96401.1"
FT                   /translation="MSGIVGQVLLVAVLAVPTVGAAVVVALRHDRAARLVGTVAAGLTL
FT                   LATLPLVAGHDDSGVGTDSTPAVRPWHQVDLPWVPGLDLRFHLGVDGISWPLVVLTALL
FT                   TLLCCGYTLGRVPSGGSGRALVALLLLVEVGILGTFLALDLVLFFVFFEVVLLPMYAII
FT                   AGWGGPDRHRAARKFALYTLFGSVLLLVGVLVVVTTAGTADVVALTGGTGLSRGPQLAA
FT                   FTLLALAFAVKSPLWPLHSWLPDAHTQAPTVGSVILAGVLLKMGTYGLIRIAVGVAPEG
FT                   ADWAAPVLGVLAVAAILVGSLVCLAQTELKRLIAYSSVGHMGFVLLGVATLTGTGLQAA
FT                   LIGNVAHGIITGLLFFLAGAVKDRAHTGDLVDLSGLRETAPRLAGVLGFAAVASLGLPG
FT                   LAGFWGEAFAVVAAVRVGGPLWLTLAVLAALGGALTAAYLLRLLRQVTHGRPSPAVASV
FT                   RPGVAGVELVTWAPLVLLTLAVGLAPILVLGVAHAPVDALLAGLP"
FT   gene            541765..543309
FT                   /locus_tag="Sare_0473"
FT   CDS_pept        541765..543309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0473"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: stp:Strop_0405 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96402"
FT                   /db_xref="GOA:A8M081"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A8M081"
FT                   /protein_id="ABV96402.1"
FT                   /translation="MSVVQTVDNVALLPAYLAAGTAVLVLLADLLVARTRVTVSAAALG
FT                   AVATAAGAVLVGSGGERRTFCVGADCSYVFGGRAALVAVLAALLTLGVLGLSGPLLRAG
FT                   AMPAGEYCFLLTASMTGGVALGAAGDLITLIVALETLTLPLYVLVGLRRSSLASIEAAM
FT                   TFFVVSVVATTLTLLGAALLYAATGALHLGRLGVVFAEQPELLDVPLTTVAVALVVVGL
FT                   AVKVTAVPLHAWAPTTYDGAPLPVAAYLSTVSKLGGVVALLAVVQHALPGRITGPVLAL
FT                   LAVLTMTVGNLVALRQRRTVRLLAWSSVAQAGYILAPLGALALAAGRTGDARAAAYAAA
FT                   VAYAIFFVVLELAAFAAVVALRPTGADGGTLDELRGAGRRRPWAAAGLALALVGLAGLP
FT                   PGLAGLFAKVTVVRSLLDGGAVWLALVVAVNAVLGLAYYLRVAAALWSTDRSTAGPIEP
FT                   EPPGSAAGAGPVGRPAATGPASVVRAWPVAAVLAAATVAALVIGLAPQLVLDLAAR"
FT   gene            543429..544298
FT                   /locus_tag="Sare_0474"
FT   CDS_pept        543429..544298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0474"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: stp:Strop_0406
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96403"
FT                   /db_xref="GOA:A8M082"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A8M082"
FT                   /protein_id="ABV96403.1"
FT                   /translation="MHHNRLKTAALLGLLTALILAVGYWFGGSGGLVIAVFISLAMNGV
FT                   SYFYSDKLALRAMRAQPVSEAQFPELYQMVRELAVEARQPMPRLYVSPTNQPNAFATGR
FT                   NPQNAAVCVTQGIVEILDYRELRGVIGHELSHVYNRDILISSVAAGLAGIITALANLAF
FT                   FIPLGGDDEDGRNPAVLLLTIILGPIAATLIQLAIGRSREFQADASGAQLTRDPLALAS
FT                   ALRKIHKGTQARPLPPQGQLTSAAHLMIDNPFKGGGVAALFSTHPRMEERVARLEQMAG
FT                   NTGPIQYR"
FT   gene            complement(544660..545403)
FT                   /locus_tag="Sare_0475"
FT   CDS_pept        complement(544660..545403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0475"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   stp:Strop_0407 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96404"
FT                   /db_xref="GOA:A8M083"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A8M083"
FT                   /protein_id="ABV96404.1"
FT                   /translation="MRAVGARDAEFVRPALSRRAVARLLVVLSASSGCLDVFCVTQLGG
FT                   FFASVITGNLVQLGHSLVAVDSRLLSGGAVAVGGYAVGVAGGTLPLRHAGLGWRSRTEL
FT                   VTAAQVLMLTGVAGGWWATGGRPGFAATLVLLFIAATASGVQSVVTISSGIPHAATTYL
FT                   TGSLTSIVRGVVFDPHRFAAGAAGAARLLGLLGGAVLGAVVLRVAPLWAPALAAMLVAG
FT                   VLITAIAVSRPRRRARARSEDAGSR"
FT   gene            545664..546077
FT                   /locus_tag="Sare_0476"
FT   CDS_pept        545664..546077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0476"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: stp:Strop_0408 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96405"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M084"
FT                   /protein_id="ABV96405.1"
FT                   /translation="MNLDGLRVAVTGAGRDSGRLLATAFADHGAHVFVSARNEAAAEHT
FT                   AESIRQRGRGTGEAFACDLASPDSVCAFAAALADRTDHLDVLVNNGAGYLHGENVDDVE
FT                   DNDIITTIGGTATGTGRGLCAVHGEPTTGLLHS"
FT   gene            complement(546260..546754)
FT                   /locus_tag="Sare_0477"
FT   CDS_pept        complement(546260..546754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0477"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   stp:Strop_0409 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96406"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:A8M085"
FT                   /protein_id="ABV96406.1"
FT                   /translation="MAANPSFDIVSKVDRQEVDNALRQAERELSTRFDFRGTGAAISWS
FT                   GEEAISLQAETEERVRAALDVFREKLVKRNISLKSLDAGDPRASGKEFKVDCKVIQGID
FT                   SDKAKAISKKIRDEGPKGVQAQIQGDQLRVTGKKKDDLQAVIAMLKGEDFGVALQFTNY
FT                   R"
FT   gene            546902..546985
FT                   /locus_tag="Sare_R0010"
FT                   /note="tRNA_Tyr1"
FT   tRNA            546902..546985
FT                   /locus_tag="Sare_R0010"
FT                   /product="tRNA-Tyr"
FT   gene            547253..547501
FT                   /locus_tag="Sare_0478"
FT   CDS_pept        547253..547501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96407"
FT                   /db_xref="UniProtKB/TrEMBL:A8M086"
FT                   /protein_id="ABV96407.1"
FT                   /translation="MAPAPIDQSRPDLTTGPIGTVTYVSTPNNLLNTGPKGLDLFPVVP
FT                   AGAEAADASAARAAPHTADRAVVPAGGAYGLTGISSE"
FT   gene            complement(547471..548535)
FT                   /locus_tag="Sare_0479"
FT   CDS_pept        complement(547471..548535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0479"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; DNA polymerase III
FT                   beta chain; KEGG: sco:SCO1180 DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96408"
FT                   /db_xref="GOA:A8M087"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8M087"
FT                   /protein_id="ABV96408.1"
FT                   /translation="MESDMRSIGETAEASGLSVSALRFYDRGGVLVPAMVDPGNGYRWY
FT                   SDPQVDQARLVAGLRRVGMPVAGIVAVLGADRVAAHQLVDAHLRRLEDGLADARRELSR
FT                   VHALLDTQENPMTTVTLSRAVLAAALDSVRFAVGSDPELPMLAGVLVDAEADGVTFVAT
FT                   DRYRMAIHREPATVDGPATRMLAPVSWVDRLRDQPGRHEPVILHLDSVEIEAAGDGWTI
FT                   KDTPLAYDYPDYRRAIQARTADGSPRCAPVDAAALQARVGGAPRVVHRHEGVDHELTVL
FT                   AIGTAGGIDVVGAQEWRAGQDRHVAVNRQFLLEALSAGGEGQLVLELAGPIRPLAIRRP
FT                   ADDRAYSLLMPVKP"
FT   gene            complement(548936..549817)
FT                   /locus_tag="Sare_0480"
FT   CDS_pept        complement(548936..549817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96409"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8M088"
FT                   /protein_id="ABV96409.1"
FT                   /translation="MDRHILEFYSRSSEMSTVGRHLATLDRLPSDLDTLVRTVQHLVVY
FT                   DAVAGDFYRAEIPEERQDEIHIRPVERKLDQILALDHRPLTVERPPGRRLAGRCHHYTL
FT                   LLVALLRANGVPARARCGFGAYFIPGRFEDHWVCEYWNADQERWVLVDAQLDEVWQAKL
FT                   SFPHDNLDVPRDAFLVAGDAWQRCRAEGVDPELFGIGLANLRGLWFVAGDLMRDLAALN
FT                   KVELLPWDVWGAQPGPDEQLDDEQLTLFDRIAALTRDPDASFDEVRELFADQRLHVPQK
FT                   VFNSLRQRTEQL"
FT   gene            550180..550983
FT                   /locus_tag="Sare_0481"
FT   CDS_pept        550180..550983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0481"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rrs:RoseRS_4077
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96410"
FT                   /db_xref="GOA:A8M089"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8M089"
FT                   /protein_id="ABV96410.1"
FT                   /translation="MHAIVLVGGKATRLWPRTRSQPKALVRIGQYPILEIIIRRLRDCG
FT                   FDRITLCIAHLGEMIKREFGDGRHLGVTVDYCTEESPLGTAAPLHLVPDWTTPAVVMNG
FT                   DILTTVDFADLYRRHTTSGNLLTVAFHQSVLCAGVGVLHVRDGLVQQIWEKPQVEWNIS
FT                   AGVYVADPRVLDYIPRSDAADMPGLINALLADGRQVTGYGFRGQWYDIGTPFRYQKAMK
FT                   EFLAHPDRYLTADASRRANGSGHRVEVALEPDGDRLSVAELSPWS"
FT   gene            550989..551987
FT                   /locus_tag="Sare_0482"
FT   CDS_pept        550989..551987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0482"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: nfa:nfa40960 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96411"
FT                   /db_xref="GOA:A8M090"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A8M090"
FT                   /protein_id="ABV96411.1"
FT                   /translation="MALDPYTEGVRRLMSAAYPDVGGAVTDAAEARRRHERARFPRGPN
FT                   LGEVRDIVIPGTPDVSARVYRPAAAGPTPPVVVYLHGGGFVLCDLDSHDGICRILADGT
FT                   PAIVVSVDYRRAPEHPYPAAVDDAFAAVRWMHAVGAAALGGDPDRIAVAGDSAGGNLAT
FT                   VCCLRARDTGGPPIRFQLLVYPVTDCLADWSDDPDGQLMTSRHMRWYVEQYLTERAHGE
FT                   QAYASPLRAGSLAGLPPAFVLTVEHDPLRPEGEAYAGRLAADGVPVQAHRVTGLFHGAF
FT                   GLGALLPAARRCEDLACDALRAALSAPHDPTTPTPTGPEADRMSQPRRVGR"
FT   gene            551984..553330
FT                   /locus_tag="Sare_0483"
FT   CDS_pept        551984..553330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0483"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: swo:Swol_0617
FT                   UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96412"
FT                   /db_xref="GOA:A8M091"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M091"
FT                   /protein_id="ABV96412.1"
FT                   /translation="MNPHSDPGPVAVIGLGYVGLTLAVSLAREGTPVIGVEADPAVRAA
FT                   LAQRRTVLFEPGVDDLLTTLPADRFTVTDRLPDTPVRAVVVCVGTAVDPHTRLPDLRHL
FT                   SAAVEQIAAHLNEETLVVLRSTVPVGTTRSLVLARLRERGIARPLLAVCPERTIQGRAL
FT                   TELAALPQVIGGVDDRSARRAADLFGRLAPDQVIVSGLEAAEMVKLVCNAHTDLIYGFG
FT                   NEVALMAHSLGVDAHEVINAANLRYPRPDLSRPGFVGGSCLTKDPYLLMSAADRAGYHP
FT                   PMVAAARAVNERLPLFAVEQVLDGLATTGRDVGQARVLICGVAYKGSPETDDIRGSASV
FT                   EVARVLRGRVAQLRGHDFVVAPERIGQAGFTPVGLDDGLTDADAVVLLVDHPGYRQALS
FT                   RGALRERLRRPAVVFDMWGVLADELADAGDIDYRRLGVPGRMRGTPVSA"
FT   gene            553418..554350
FT                   /locus_tag="Sare_0484"
FT   CDS_pept        553418..554350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0484"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0757 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96413"
FT                   /db_xref="GOA:A8M092"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A8M092"
FT                   /protein_id="ABV96413.1"
FT                   /translation="MTALEEVSAHLPAERAPVAQILTELDHSPAQIGLYQRYYGFAEVR
FT                   RDSRATVGDLLLAAARKLEHLRGREEQVRYLAYAPTIQLAAPYPNDVLGQVRDALGLAH
FT                   AAAFSLTQHACASALLAVDACGKLLAADGDPDALALVLAGEKTFTRVTRLMPNSAVMGE
FT                   ATAAVLVRPGGDRDRVLGYATQMYSEFHVGPFEPPDLAARFDELYPTALAEVIEAALDV
FT                   SGLTAADLALVLPHNVNKMSWYRVARMIGLPVERILLDNVAVLGHCFGADPFINYRTAQ
FT                   ELGRLDPGDHYLMTSVGVGATFSAMVLRR"
FT   gene            554350..555711
FT                   /locus_tag="Sare_0485"
FT   CDS_pept        554350..555711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0485"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   cac:CA_P0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96414"
FT                   /db_xref="GOA:A8M093"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A8M093"
FT                   /protein_id="ABV96414.1"
FT                   /translation="MTMTEDFRTTLRTAVTGRPDTPLVLIGNFEVEDEWARTERGLPRL
FT                   TVSGSGRAVANRMDELALLLAAEGDRVVLKDAPDPDHLAQLAGLGLTLPHILVPRAQDP
FT                   QRTVSADALADNALITTLGTLGDAGFRLAPHGVSAVEEELSARSGLPLATPTAATCKAV
FT                   NSKIYSRLLATDLALRQPPGRTCVTLDELADALAWAARLIDAGGRVVVKDAFGVSGKGI
FT                   TVVDTGRRLDQVRRMVHSRAARSGRTDVALVVEEWVAKRADLNYHFVVGRDGTVSFDFV
FT                   KEALTDNGVHQGHRFPARLSATQVGDLAAAAETIGGRLARDGYFGVVGVDAMVDPDDGL
FT                   YPIVEINARNNMSTYQTVVQQRLVPPGAEVLARHYPLRTPEPLPFAALRRLLDGVLLTP
FT                   GGRTGLVVTAFATVNAAPPDGRLYALLVADTAARLTALDAEVARRLTTVTEETR"
FT   gene            555708..556961
FT                   /locus_tag="Sare_0486"
FT   CDS_pept        555708..556961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0486"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   atc:AGR_C_3079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96415"
FT                   /db_xref="GOA:A8M094"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8M094"
FT                   /protein_id="ABV96415.1"
FT                   /translation="MTDHAALAEEYGTPLFVYEADTVAAQYTGLRQRLHPAMDIFYSLK
FT                   ANPNLALCGHLRSLGAGAEVSSLLELTTAREAGVPPGDIVFPGPGKSREEITACLDAQI
FT                   YAIICESFEELELVNDLARERGVRARVALRVNPAFAVKGSGLTMGGKPRQFGIDEAHLF
FT                   ALPGLRLAHLRVVGVHVYLGTRILDETVIAENTRRILELAERLAAHLDFPLEFVDVGGG
FT                   LGVAYFDGERDLAVERLTDLVNPVVADFHDRHRDTRLIMELGRYLVAPAGTYLIRVRYV
FT                   KSSMGERFAVTDGGTHQHMAAVGIGSFVKRDFPLRLLGRPTDGPLVRWTVTGPLCTPND
FT                   TLVRAAELPDLRRGDLLGVLRSGAYGPSASPTLFLGHGHPAEVLVRNGVGCLVRHRDQV
FT                   ADLLRQQRSLVTTGGDPR"
FT   gene            556958..557224
FT                   /locus_tag="Sare_0487"
FT   CDS_pept        556958..557224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0487"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: ttj:TTHA0414
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96416"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8M095"
FT                   /protein_id="ABV96416.1"
FT                   /translation="MTTTDMDRHQLAERTVRVLAGVVQREPQTLHQDTRLFADLGMDST
FT                   NALELLMMLEDEFGFEFDPETLESRHLETVGSLTDYIIEQAGG"
FT   gene            557228..558115
FT                   /locus_tag="Sare_0488"
FT   CDS_pept        557228..558115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96417"
FT                   /db_xref="GOA:A8M096"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A8M096"
FT                   /protein_id="ABV96417.1"
FT                   /translation="MYVTGDHARPDAHRPAVVDAGTGRSTGRVGPTTPLRLARVIADPA
FT                   DTTGSGGRYTPALAGYLADLARLHGMRRGPDDFAGVARTTFTDLVRPLVAEVADAPVDL
FT                   IVLAHVTPDAEPGWPASFLTGALPGEPLAFAVADQGVVAPFTALRVAAAYARADRIERV
FT                   LVVLLDQGTFLTAGPLPEVGVGLVALVLARDGTLGELSTQVVTGVTPPQARSVLASSLA
FT                   DFAGTSATGAALSPATGPQGTARHPGELPATGLWRGLTGRAAGAGPVALADYEPAARCL
FT                   GICVVAPPVGEPAS"
FT   gene            558112..558708
FT                   /locus_tag="Sare_0489"
FT   CDS_pept        558112..558708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96418"
FT                   /db_xref="GOA:A8M097"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A8M097"
FT                   /protein_id="ABV96418.1"
FT                   /translation="MSAHDWRRCRQVARTGTVADALREIGSLQAGRGSFVVVPAGPDAP
FT                   ATVADPLLAAEGIAVLRRPAGRHPSGAPAPASVAREVTLATAWLRLGLSERLLDDCLGY
FT                   LHGRATGGEPLIGQQLVRGELAEIRMDHLEVAAVLDAAPPSDAQLLDVHRQITGADRAL
FT                   LRLLGASGFVADGPGRVAYVSELLADTYAGGHRDV"
FT   gene            558701..559852
FT                   /locus_tag="Sare_0490"
FT   CDS_pept        558701..559852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0490"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   plu:plu0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96419"
FT                   /db_xref="GOA:A8M098"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A8M098"
FT                   /protein_id="ABV96419.1"
FT                   /translation="MYELDGRLTALRTRAAEWAGDLAAVGADLDHDPDAVHRVLDTPVM
FT                   RYLATARYAPSADTPSLTSGGHRFSLDSVLEQVVFFEELAVVDVGAVLAAPGAPMAGPL
FT                   VDLLGDEEQREWFFAQLRSAPTWVFFALTEPAHGSDAAGLTTRLDPDGDGFRLTGTKRY
FT                   VGNAPRARLGVVFARVRPGPLGLRAVLVTAPAPGLTIEALPTIGLRGAALGAITMSSVA
FT                   IADDRVLGRHLPATRRGVLSWVHVFNRIRPRVAAMGIGIARAAFEYVRVHRRTLRPAAR
FT                   DRLDALCRRVEAVRQLNLAAARAVDADPADGRLASAAKARAARLAEDVTVACLEYFGPG
FT                   ARLDHPLLGKLARDARGVEFMEGASNVQKLIVSQDLIRRGRPT"
FT   gene            559849..561234
FT                   /locus_tag="Sare_0491"
FT   CDS_pept        559849..561234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0491"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: plu:plu0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96420"
FT                   /db_xref="GOA:A8M099"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8M099"
FT                   /protein_id="ABV96420.1"
FT                   /translation="MTQQTWDVPGANGASVRRAIVRLAVPMALAEVAGLVVLVGVMALM
FT                   GRMGEETLYVRALYLPIGHLFIAVYVAFGFSNQVAAAISRGRGRPEDVAPMAMSFVRMW
FT                   AVASVVLVAATLLAAPLLAAAFDVPDASRSEFMAFLRWMAAAELLQVVAILCASGLRGY
FT                   GHAGAGAAVVVVSAAVQFAGVALLGLAAGMGAMSVPLSIAVGSVVGALLGVWLMRRHGL
FT                   IRFGAELTRWHPESARHIRSVGLPVATTQLILFGANFGLLWVLGDFGPRVIAGFSSAVT
FT                   LQFLVLMPAIVLGSATAIVLNQQRGAGRADWLPGTMHNGLAITVGAYLLLSVVMWAGSD
FT                   LFGRLMTDSPSIADQTALYLSTVGLTYVLMGPVLTSLTVMEQIGSGLLAVVLNLAYFAA
FT                   IVVIGALVVAAVPEPVALYRTIAWCNLAGVIVVLAGLHAVRRASRLPAPTGAAPVPVGG
FT                   GPA"
FT   gene            561297..562064
FT                   /locus_tag="Sare_0492"
FT   CDS_pept        561297..562064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0492"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   gvi:gll1951 phosphopantetheinyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96421"
FT                   /db_xref="GOA:A8M0A0"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A0"
FT                   /protein_id="ABV96421.1"
FT                   /translation="MPPDGVVHLWPIALDQPPSVVAALHAVLAPQERRHAAGRGDAVLS
FT                   RRFVVARAVARAVLGAYLDRPAASLRWSTGRWGKPVLADAATLCFNLSHTADVAVLAVS
FT                   GGRPVGVDIERRRPGLSAARYFPVVERDLVRAGGPDVFLRLWTRKEAWIKAAGDRVGRA
FT                   LALPVAGAGPVLPVRDRTGRIPGSWLLHDVPAPPGHAACVALAGTRPVRPLWPATRVSA
FT                   RPFWHSNIPDRCFSYVADSFGRRDDSLSGWQDW"
FT   gene            562066..562968
FT                   /locus_tag="Sare_0493"
FT   CDS_pept        562066..562968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96422"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A1"
FT                   /protein_id="ABV96422.1"
FT                   /translation="MALRYLGNGPYCTANSLSIIFGDDAPGPATIEVLTGSPYGISIHG
FT                   DDEHTYFTPDRWNPELGMTTALDLLGWECDRSAGSADDAVAVLRRASRESPVLVGPVEM
FT                   GMLPYIPGLGRAIGADHNVVVVGMEGDLVRAHDVQGWPFVTMPLESLLKAWQADTFAYR
FT                   VEAYAVRSNFRRFRPVDPHTALRRSLPTAIELLDGPGSAAAAERSAQVVEAGLTNMQYK
FT                   YLVEYQVQAGARRLADATVLLDAIGCRRAAAVTDRQALLIGSLQLQLVTHQSAQAAATF
FT                   RELAPTYARLRRALIEDLD"
FT   gene            563024..563305
FT                   /locus_tag="Sare_0494"
FT   CDS_pept        563024..563305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96423"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A2"
FT                   /protein_id="ABV96423.1"
FT                   /translation="MSTSMAQDYAALSAAIGKVMGEVLQRGALAPNDDFFDSGGDSLRA
FT                   IEVLQRMVAADGIPPAVGSNDMQAILLEEIFEKPTPSALAAVVREHLR"
FT   gene            563347..565743
FT                   /locus_tag="Sare_0495"
FT   CDS_pept        563347..565743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0495"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   AMP-dependent synthetase and ligase; O-methyltransferase
FT                   domain protein; KEGG: msm:MSMEG_0607 methyltransferase,
FT                   putative, family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96424"
FT                   /db_xref="GOA:A8M0A3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A3"
FT                   /protein_id="ABV96424.1"
FT                   /translation="MFIEPRDAHASAVRAATPGGAGVDTSWAALRDTAAAVTDRARRLR
FT                   RDAPVVVVVDGTAESIATVLGLVEAGVDVLLLEERTSHLADPQSPVHRLASPAVIGPPS
FT                   MPDASTPHGPVRLSYEAARQPGRLPAEAVDGSATGATAPGRPGEILQLTSGSTGQPRIA
FT                   RQTLDNVLAGARAYCELFRITGADIVLVAVPVAHSYGLAGTLAALLSQALLVTLPRFSV
FT                   RSLVAGLDDGATVLLGTPLLYKLLVPVLAARRRPTRVRTALSAGGPLAADTAARVGDLL
FT                   GSPIRQIYGITEAGLVACVPQATTDWPAGSVGPAAPGVTLRIDGEVGTTDTTAVDAAPA
FT                   RTGRLLVRTPALFRGYWGTPEQGLTADGFYDTGDIVRLDTDGHLFVLGRKDSFVNVGGR
FT                   KVNPRRVEQVLAGHPHVREAFVYGAERPDGEQEMHAAVVLDPATTVNEVLAHCRAASLM
FT                   PYEVPHHVHTIDRLPRSGMGKVDRQRLLALVEQSRSARPHTSTRETHLPGGDPMTTTAS
FT                   REPRSIDGVGETALWMAAARARESRRPDRLFEDPYAEKLAGPRGPDLLRYYHTSRGADT
FT                   GNPYLAIRHRWFDEFLLESATPGCQVVGLGAGLDTRSYRLDWPADTVLYEMDQAAVLAY
FT                   KAEHLSAGDDAARCERRVVPADLSEDWLAALLKAGFDPERPSVWFAEGVFFYLPEEKAA
FT                   RILREVQRVSAPGSRIAIDVIGTGIFRFPYTQDYLQRLSDAGAPWRWGTDDPAAWMRAC
FT                   GWTTDAVLEPGNKGASFGRWSEDASPPDVPNLPRIYLISARPGTD"
FT   gene            565768..566916
FT                   /locus_tag="Sare_0496"
FT   CDS_pept        565768..566916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0496"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: rxy:Rxyl_2999 FMN-dependent
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96425"
FT                   /db_xref="GOA:A8M0A4"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A4"
FT                   /protein_id="ABV96425.1"
FT                   /translation="MAHEPAVAHEPAVAHEPAVAAGIASVDDLRRLARARLPGPVWDYV
FT                   TGGAGEERTVRANRDAFRRLTLLPRVLVDVAARDPRTTVLGTGVAAPVGIAPTSYQSLA
FT                   HPDGELATARAAGSRGLLDVVSVFSSVSLEDVAEVATGPLWFQLYCLRDRGVTRELVQR
FT                   AAAAGYRALVLGVDLPVIGYRDRDIRNRFQLPPSVAPVNLPTRVAPGGSVLVELNRALV
FT                   DPALTWRDVEWIREISPLPVVVKGIVAADDADRAARIGADAVLVSNHGGRQLDGAPASI
FT                   TALPDVVSVVADRCEVYLDSGVRRGTDVLAAVARGARMAFVGRPVMWGLAAGGADGVRA
FT                   ALDLYLTELDLAMAVCGCPDVPSIGPHLLGPIDRPGDRPADR"
FT   gene            566967..569039
FT                   /locus_tag="Sare_0497"
FT   CDS_pept        566967..569039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96426"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A5"
FT                   /protein_id="ABV96426.1"
FT                   /translation="MDPFVRTADKAPYHRLWTEQNQSQPPETAIDSPLLTLAHTSDVNP
FT                   LEPEQVTEARRVLRQRRALVDEGRAELREAVVQGQRDVVERFLAGRRARFGIEQSRPLD
FT                   DVPALVREGRDTFIVVKFMDERPHLAATMASLVHQRDVDLGRVVILAVDGNSTDGSDAV
FT                   VTDAITSNPSAVRIEYRNQSMPGAGNAARLGIDTCIATVYEMCRADGRWDRLQTATIAV
FT                   SDGDTVYHPSMVGTIRRMLDEDPTVDAVMPFLTYKFTAALRLFQDYRPAVPEELHRCAA
FT                   AIEPVPLNVDLSDLHAHRALPRAGRRPDGEAVLLTGDDGTTVSVPLSAVDPYGRRFGVL
FT                   VDRAGRRGYLFQDRNLVLAEAPVSGFDAALVFLESGGVRPDEKWRWHTVIGHDLFLYWS
FT                   FAGMGLPESMVFPDTSDALKTARVWSLAIGGQHQLRRPGLRIATGSDYQSGRVLQAVGC
FT                   AVRLGPAEVFTETETDRLIKMIRNFVRRQSVFYGETRSAALERATGLYVHMTRIQNEIE
FT                   RELRDDYDDEVFAQTAFPERVIFPLRWMLQNAVRYAAHGEPEHETVRARVLRVMFRPDT
FT                   AARIDRDILTPVALSAVADATFHRKQELAERVAETIITDHYVEIMEFYQATLRDFFAAH
FT                   DVPERCWSWLLDGMAESRNALREQPPKVDPAAVWEGAEFDIDVARGQVVGLRERR"
FT   gene            569092..569277
FT                   /locus_tag="Sare_0498"
FT   CDS_pept        569092..569277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96427"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A6"
FT                   /protein_id="ABV96427.1"
FT                   /translation="MKAVVTAEPDGTREVHDVSPPGLVSGQVRITVPAGVYPVVEVVDR
FT                   AADAPVSCPAVPGGRW"
FT   gene            569274..570209
FT                   /locus_tag="Sare_0499"
FT   CDS_pept        569274..570209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96428"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A7"
FT                   /protein_id="ABV96428.1"
FT                   /translation="MTGMAVRYVGDGPNCYADALTMVLGPAGPGPAAIEVLTGSPYGLS
FT                   LHGPDLPIFCPSGWTPEIGIAAALDLLGWTCERTSGSVDEAVARIARATPTDPVVTGPL
FT                   EMGLLPHHPSLGQAIGTEHYFVVLGLEGDVVRMHDPRGFPYATLPLDSLLAAWQTDAFV
FT                   YPVEPFITRSRFRRVREVDLATALRDSLPAAVRWLVGPDAASTAERIARIVEDGLTDSQ
FT                   YKYLVEYTVSGGAGRLGDAAVLLAEIGCAGPARVLEHQARLVGALQHPLMAGDRAAAAA
FT                   LWRELAPTYPRLRDELSLVLREGPAVPVPS"
FT   gene            complement(570345..570995)
FT                   /locus_tag="Sare_0500"
FT   CDS_pept        complement(570345..570995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0500"
FT                   /product="nucleoside phosphorylase-like protein"
FT                   /note="KEGG: stp:Strop_0412 nucleoside phosphorylase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96429"
FT                   /db_xref="GOA:A8M0A8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A8"
FT                   /protein_id="ABV96429.1"
FT                   /translation="MTDVLVVTAVPAEAEAVRAGRGPTVTVAPVGVGPAVAGAATARLL
FT                   ALAEAAGHPYRVVVSAGVAGGFPGQVQVGGTVVGTSAIAADLGADSPTGFIPVDQLGMP
FT                   AELLGGGTTIIADPTLVAALRAALPSAVAGPVLTVGTVTGTVAGTDALLHRHPDAVAEA
FT                   MEGHGVAVAAAHAGLPFVELRTISNPVGPRDRNAWRLREALTALTQAAAALPF"
FT   gene            complement(570992..572581)
FT                   /locus_tag="Sare_0501"
FT   CDS_pept        complement(570992..572581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0501"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0413 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96430"
FT                   /db_xref="GOA:A8M0A9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0A9"
FT                   /protein_id="ABV96430.1"
FT                   /translation="MPSSLRSERSFLGRTVGTGIKAVRLLLRGSVSGGRWMTQSAGRAR
FT                   ARGAGREIGMVRLFDLHAVSCAGDTLIAIGLAGTIFFNVPLGEARSKVALYLLVTMIPF
FT                   ALLAPVVGPLLDHFRHGRRYALATSMLGRAFLAWLISDYIHGFGLYPAAFGVLALSRAY
FT                   GVARSAAVPRLLPEGLGLSQVGARASVYGTLAGALVAPIGLAAFWFGPQWPLRVASVIF
FT                   LVGMVVALRLPPKADSEPPERVPRPLRAFRRGSGDRPLGRGRPHGRLVIATLIGAATLR
FT                   AVYGFLLLFLAFAIKAGDLTTVVLGRDLSDEAALGLVGGALAIGSFLATAIGTRLRIHR
FT                   PATLQSSGMVIIAGVAVLATLKFSLLMVALLCLVAALMSGIAKLAVDASIQERIPERLR
FT                   ASSFAHSETVLMLAFVAGGGLGLVPFDGQLGIAVAAGVATLATARGIVVAGRLRAERLA
FT                   GRPLADDELTEGDTDPAEPASGDPAPTSPAPTPEAEGGDDLAPPGFHIYRPSSAVGGPG
FT                   GTDEETRQGPIP"
FT   gene            572667..573506
FT                   /locus_tag="Sare_0502"
FT   CDS_pept        572667..573506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96431"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B0"
FT                   /protein_id="ABV96431.1"
FT                   /translation="MGNNGRVTRSTSARAPRLDQVCAAAVEVARDAVTEVGPADVGDHL
FT                   QVVAEGDRLVTHYFECRLAGYRGWRWAVTVARAPRSRTVTVCETVLLPGPGALLAPGWL
FT                   PWQERLKPGDLGPGDLLPSPPDDDRLQPGYLLSDDPAVEEVSWELGLGRARVMSREGRG
FT                   EAAQRWYDGDRGPTAPIAAAAPVAARCGTCGFYLPLAGALRQSFGACGNLYAPDDGQVV
FT                   SADHGCGAHSEILVEAPETPVEELPTVYDDSAVEAVPVSGAAGTVEVAEVTEPNGQP"
FT   gene            complement(573525..573770)
FT                   /locus_tag="Sare_0503"
FT   CDS_pept        complement(573525..573770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96432"
FT                   /db_xref="GOA:A8M0B1"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B1"
FT                   /protein_id="ABV96432.1"
FT                   /translation="MSKQQPPRPEPLDPPMVPFALAGMAGWALAGLVLLFFRDQLVESG
FT                   RESWLWICLAGFLWGLPGLAVMMRHDANRRRRRAGQ"
FT   gene            573860..575332
FT                   /locus_tag="Sare_0504"
FT   CDS_pept        573860..575332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0504"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   stp:Strop_0416 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96433"
FT                   /db_xref="GOA:A8M0B2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B2"
FT                   /protein_id="ABV96433.1"
FT                   /translation="MAVAPPDDGTPSATPRNGFDRYFEISARGSTLGREVRGGLATFFT
FT                   MAYIVVLNPLILGSAVDGAQERLPIPALAAATALIAGLMTILMGVVGRFPLALAAGLGV
FT                   NALVAYEIAPEMTWADAMGLVVIEGVIIAVLVLTGLRTAVFRSVPTQMKAAIGVGIGLF
FT                   LTIIGLVDAGFVRRIPDSANTTVPVGLGIGGKLVSWPMLVFVVGLLLTLVLVVRRVKGA
FT                   ILIGILASTGLALVIEALGNIGPSVVDGVSNPKGWSLTVPELPSTVLDVPDLSLLGRFN
FT                   VLDSWSRAGWLVVLMFIFTLLITDFFDTMGTMVAVGQEGGMLDEQGTPPRAKEILLVDS
FT                   IAAASGGAASVSSNTSYIESAAGVAEGARTGVANLVTGVLFLLAMFLAPLVLVVPFEAA
FT                   STALVVVGFLMMTAVRTIDWTDFEIAIPAFLTIVLMPFTYSISNGIGAGLIVYVVMKLA
FT                   RGKAREVHPLLYAVAALFVLYFMRGPIESVVL"
FT   gene            575449..575898
FT                   /locus_tag="Sare_0505"
FT   CDS_pept        575449..575898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0505"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: stp:Strop_0417
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96434"
FT                   /db_xref="GOA:A8M0B3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B3"
FT                   /protein_id="ABV96434.1"
FT                   /translation="MTERTVTAKSVPPAQLAVQLRDAITRLNRRVRQARPVGDLTVTQL
FT                   SALTSLRLAGALTPRELADIERVQPPTMTKIVAKLEERGLVQRTPHPTDGRQVILAATE
FT                   GGGAVLDQFERARDEWLAHRLAELSVEERDTLRQAAEILQQLTRA"
FT   gene            575961..577241
FT                   /locus_tag="Sare_0506"
FT   CDS_pept        575961..577241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0506"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: stp:Strop_0418 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96435"
FT                   /db_xref="GOA:A8M0B4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B4"
FT                   /protein_id="ABV96435.1"
FT                   /translation="MQAKLSTMFQSLQVRNYRLFASGQLIKLIGVWMMFIAQDWLVLEL
FT                   SDNSATALGIVTALQFAPVLLLTLISGRLADRYDKRVLLFAANLFWTVLSLAMSLLVIT
FT                   GLVQLWHVFAFAALLGVANAVETPVRQAFVSELVGTPLLANALSLNAATFNSARIVGPA
FT                   LAGLAIAAVDVGPVFLVTAVSSIAPLVNVIRIRTGELHRETLPPREERSSARVIDGLRY
FT                   VRARPDLLLPMFLISIIATSLFNFQLTLAALAKTVFNTGAASFGLFSSALAVGALAGAL
FT                   AGTGRRSRPSVWLVLSAAIACAILGTLVGLAPTYWLVVLLLLPTGFATVFFAQACNQRI
FT                   QLGTDAAFRGRVMALWVLVFLGTNPVGAPIIGWVAETYGAGASIWMGGLISLAAALLAL
FT                   AWQLRRSGARLRFQVLPMPRFYVTERM"
FT   gene            577330..577833
FT                   /locus_tag="Sare_0507"
FT   CDS_pept        577330..577833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96436"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B5"
FT                   /protein_id="ABV96436.1"
FT                   /translation="MGRALLLTVMVAAVVCLPMVIALIFCADELVDRLACRCAQWRSRH
FT                   RERRTIARLDRAVEADALTRNIDLSSFDRPDRQPLERLATDLRRLGGQRVGGYGRSAVW
FT                   YEAALRAYDDRLRLACVALGVTQHLDGLTGVDREIERVRVEGALHRAGLILPSAQPEYR
FT                   QRHR"
FT   gene            577868..578446
FT                   /locus_tag="Sare_0508"
FT   CDS_pept        577868..578446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0508"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: stp:Strop_0420 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96437"
FT                   /db_xref="GOA:A8M0B6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B6"
FT                   /protein_id="ABV96437.1"
FT                   /translation="MRLFVALYPPPEAVDHLNAQVARLRVGEAAADGVGVRVADAAQAH
FT                   VTLAFLAAVPTEQLMAVEGSLDQVARWSRDSWPAPPRLRLGGGGTFGQGRSTVLWVGLR
FT                   GDLAELTELGQVVRSRLRANRLPYDEKPWHPHLTVARPGDRLPPADVAADVAALDAYGG
FT                   PQWPARELVLTRSHPGHRPTHDRLAAWPL"
FT   gene            complement(578448..579518)
FT                   /locus_tag="Sare_0509"
FT   CDS_pept        complement(578448..579518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96438"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B7"
FT                   /protein_id="ABV96438.1"
FT                   /translation="MRPVRFVALSEDGQALVLTDEVGRLLALPIDERVSTALHTEPGAA
FT                   PLAVASTSGADPTPSLSPRDIQARIRAGESAEDVARIAGVPVDRVLRYAGPVLQERAML
FT                   AQHARRTRLRGAEKPTPLAEVVNGRLAQHGIDTEKISWDAWRRDDGAWRIVATWPSGKA
FT                   TAQAVWDLEKTRQSVTPHDDMAQYLCAERPTPILGQEPAPERGGHGLPGPARAEPGRGG
FT                   HGLPSPAEPNRPSRDPIRAGRDALLASLDRPLGGASGRGLEPRTPASPEAPRSRPVGGG
FT                   AAALLGGGPGSAFDDDSDAPKEVPAVPSLAVLRPRRTGTATAGGTEQGEGSKPRKRLPS
FT                   WDDVLFGSAPAARESS"
FT   gene            complement(579705..580832)
FT                   /locus_tag="Sare_0510"
FT   CDS_pept        complement(579705..580832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0510"
FT                   /product="putative phosphoserine aminotransferase"
FT                   /note="TIGRFAM: putative phosphoserine aminotransferase;
FT                   PFAM: aminotransferase class V; KEGG: stp:Strop_0422
FT                   putative phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96439"
FT                   /db_xref="GOA:A8M0B8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B8"
FT                   /protein_id="ABV96439.1"
FT                   /translation="MADASTIRIPDDIKPADGRFGCGPSKVRPAAVAALADVATSYLGT
FT                   SHRQRTVRDQVARLRRGIAEFYSLPSGYEVVLGNGGTTAFWEVAAFGLIRDRAQFASFG
FT                   EFGAKFAKSVRDAPFLGEPTVHQSPAGSAPRLVAEAGVDVYATPHNETSTGVSVPIGRV
FT                   PGADEGALLLVDATSGAGGLEVSVGETDVYYFAPQKSFGADGGLWLALMSPAALERAAE
FT                   VKASGRYIPAFLDLVTAIDNSRLEQTYNTPALATIFLAAEQTDWMNAQGGLAWATKRTA
FT                   ESAGIVYGWAERSAVATPFVTDPALRSNVVATIDFVDEVDATAVAKVLRANGIVDTEPY
FT                   RKLGRNQLRIALFPAVEPADVEALTAAIDYVVERL"
FT   gene            complement(581066..582172)
FT                   /locus_tag="Sare_0511"
FT   CDS_pept        complement(581066..582172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0511"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; KEGG: stp:Strop_0423 citrate
FT                   (Si)-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96440"
FT                   /db_xref="GOA:A8M0B9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0B9"
FT                   /protein_id="ABV96440.1"
FT                   /translation="MADFKPGLEGVVAFETEIAEPDREGGSLRYRGVDIEDLIGQVSFG
FT                   NVWALLADGRFGPGLPPAEPFPVPVHSGDIRVDVQSAVAMLAPYWGLHQLLDISDEQAR
FT                   EDLARVSVTALSFVAQSARGLGLPAVPQKEIDKASTIVERFMKRWRGEPDPRHVKAVDA
FT                   YFISAAEHGLNASTFTARIVASTGADAAACISSGIGALSGPLHGGAPSRVLNMLEAVER
FT                   SGDAEGYVRGVLDRGERLMGFGHRVYRAEDPRARVLRRTAKELGAPRFEIAEALEKAAL
FT                   TELHSRKPDRILATNVEFWSAVVLDFAEVPAHMFTSMFTCARMGGWSAHILEQKKLQRL
FT                   VRPSARYVGPGPRRPHEVEGWDQVPHGV"
FT   gene            582413..583078
FT                   /locus_tag="Sare_0512"
FT   CDS_pept        582413..583078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0512"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: stp:Strop_0424 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96441"
FT                   /db_xref="GOA:A8M0C0"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8M0C0"
FT                   /protein_id="ABV96441.1"
FT                   /translation="MDVTGDTVPPANLRNEYAADLGLTESNLAGDWYTQFDRWFTEVVA
FT                   AGLPEPNAMVLGTADRAGRPSARTVLLKGYDPDGFVLFTNYGSHKGTELAANPYASLVF
FT                   PWFMLQRQVVVTGRVDRLDRAETEAYFASRPRGSQLGAWASEQSRVLPNRSALDDAYRA
FT                   MAERYADGVPIPAPPNWGGFRLRPDGVEFWQGQASRLHDRLRFRSTDGGDWVVERLAP"
FT   gene            583075..584367
FT                   /locus_tag="Sare_0513"
FT   CDS_pept        583075..584367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0513"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0425 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96442"
FT                   /db_xref="GOA:A8M0C1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C1"
FT                   /protein_id="ABV96442.1"
FT                   /translation="MTEVRQARRAGSRWAIDLRPLAVPAFRRMWLGNSMAMFGFQLTSV
FT                   AVPVEMYSLTGKSSWVGLLGLAGFLPLLIFGLWGGAVADARDRRRVLLAGSALLWATML
FT                   GLLAHAWLGVGSPVVLLVLVAVHSVGFAISAPARTAALPRLLPAGLVPAAATLNYTTFM
FT                   VASVVGPLAAGLIFAVCGTQPGLPIAYAADMLLFTGLMVAALRLPAMPPEPLREGEVRR
FT                   GGLAGISDGLRYLTTTPVLLLSFAIDLIAMVLALPRALFPEIAEERFGGGAAVGWLFSA
FT                   IAIGSLLAGLTSGWIGRLRRQGLGLVAVVVGWGLAVAAAGLAQQLWLMVLLLAVAGAAD
FT                   LVSAVLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAGGFGSGVAWVGGG
FT                   LLAAVLALGLAVAFPALVRYRAATMSSGQRA"
FT   gene            584385..585368
FT                   /locus_tag="Sare_0514"
FT   CDS_pept        584385..585368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0514"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: stp:Strop_0426
FT                   aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96443"
FT                   /db_xref="GOA:A8M0C2"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C2"
FT                   /protein_id="ABV96443.1"
FT                   /translation="MNSPGQRSPSGAQWTIAAAGHEAVVVEVGGGLRTYRVEGVDQLDG
FT                   YASDELCPDSAGQVLAPWPNRIRDGRYHFGGRDLQLSISDPAHDAAFHGLVNWVPWRLL
FT                   ERSTDAVTLGYELAPTPGYPWSLRLRSRWCVGADGLRAEHEVTNSGGEPAPFGLAAHPY
FT                   LRVPDVSVDDAVLRLPARSRLQVDARQLPIAECSVVGTEYDWTVPRRIGRAVLDHTFGD
FT                   IVRDGDGGSAVDLTARDGGVGTRVWADGQFRWWQVFTGDTRPGSRRRRSVALEPMTCPP
FT                   DAFRSGRDLITLRPGDTWRGAWGVRPADSRRCDGVRRGGTASSDGS"
FT   gene            585325..585927
FT                   /locus_tag="Sare_0515"
FT   CDS_pept        585325..585927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0515"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: stp:Strop_0427
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96444"
FT                   /db_xref="GOA:A8M0C3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C3"
FT                   /protein_id="ABV96444.1"
FT                   /translation="MEFVEVVRRRRMVRNYDPDRPVPPEVVDRLLEHATRAPSAGFSQG
FT                   WGFLVLEAAEDRDRFWAATTPDTGGRDNWLAGMRRAPLIIVPHANQSAYLDRYAEPDKG
FT                   WTDRSTERWPVPYWHIDTGFAALLMLLTAVDEGLGACFFGIPPQQWDGYRAAFGVPGEY
FT                   EPVGAVTIGYRADDQRSPSLRRGRRPVDEVVRRGRWT"
FT   gene            586115..586450
FT                   /locus_tag="Sare_0516"
FT   CDS_pept        586115..586450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96445"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C4"
FT                   /protein_id="ABV96445.1"
FT                   /translation="MIFRAVRDGRPYPEHHLTLKQWAEIPPRPLRLDQLITTKRELALD
FT                   KLLAEDSTFYGDLFPHVVQWNGGLYLEDGLHRALRAALQQRNQIHARVFVFSAAVDGTA
FT                   PTEVSLG"
FT   gene            586455..587615
FT                   /locus_tag="Sare_0517"
FT   CDS_pept        586455..587615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0517"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: stp:Strop_0429
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96446"
FT                   /db_xref="GOA:A8M0C5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C5"
FT                   /protein_id="ABV96446.1"
FT                   /translation="MSPFDLLDVDSSLSAEERQIRGVVRQLVDDRVRPNVAGWYEEGRV
FT                   PARELAREFGKLGLLGMHLTGYGCAGASAVAYGLACLELEAGDSGVRSLVSVQGSLAMY
FT                   AIWRYGSAEQKQRWLPAMAHGEAIGCFGLTEPDHGSDPASMATRARRDGDDWVLHGTKM
FT                   WITNASVADVAVIWARTDEGVCGFAVPMDTPGVTVREIRHKMSLRASVTGEISLDDVRL
FT                   PAAARLPEAVGLKAPLGCLTEARHGIVWGALGAARDCLETALDYATGRTQFGRPLAAFQ
FT                   LTQAKLADMAVEWNKGYLLALHLGRLADARRLRPHQVSVGKLNNVREALAIARQCRTIL
FT                   GANGVSGDYPVMRHANNLESVLTYEGTSEIHQLVIGQRLTGLSAFS"
FT   gene            587811..589208
FT                   /locus_tag="Sare_0518"
FT   CDS_pept        587811..589208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0518"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: stp:Strop_0430 L-serine dehydratase 1;
FT                   TIGRFAM: L-serine dehydratase 1; PFAM: serine dehydratase
FT                   alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96447"
FT                   /db_xref="GOA:A8M0C6"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C6"
FT                   /protein_id="ABV96447.1"
FT                   /translation="MISIFDLFSVGIGPSSSHTVGPMRAARTFVTGLKADGLLTETVRI
FT                   RAELFGSLGATGHGHGSDRAVLLGLAGETPETVDTDAAEAWIGLVRAEQRIALLAAHEI
FT                   DFDPDRDLVLHRRRSLPYHPNGMTFAAYDLTGGEIRARTYYSVGGGFVVDEAAAGAGRI
FT                   SSDTTAVRHPFSTGAELLAVTRETGLSISEVMLANELSWRSEREVRAGLLEIWRVMREC
FT                   VARGCEREGVLPGGLRVRRRAAELYRGLMVDADPMRSAAGLGMVDPLRAMDWVTLFALA
FT                   VNEENAGGGRVVTAPTNGAAGIIPAVLHYYDRFGPGATPDGVVRFLLAAGAIGVLFKEN
FT                   ASISGAEVGCQGEVGSACSMAAAGLAEALGGSPEQVENAAEIGMEHNLGLTCDPVGGLV
FT                   QIPCIERNAVASIKAITAARLALRGDGVHHVSLDKVIKTMRETGADMKVKYKETARGGL
FT                   AVNVIEC"
FT   gene            589263..590090
FT                   /locus_tag="Sare_0519"
FT   CDS_pept        589263..590090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0519"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: stp:Strop_0431
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96448"
FT                   /db_xref="GOA:A8M0C7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C7"
FT                   /protein_id="ABV96448.1"
FT                   /translation="MTSGVGTLWSHRRALRILVRRDLAVKYQQSALGYLWSLIEPLGFG
FT                   ATYWFVFGVLYERDTGRYLGEAADSYPLFLFTGIFAWMWTSSALGEATNALTGQARLIT
FT                   TMNLPRQVFPIGRVAGRVAEYLAGLPLLVLVAAAYAVAGRIDPGWSVLALPLAVTVQGI
FT                   LLVGLALLLSAANVLMRDVERIMRLVIRVIFYATPIIYPFGLVRDSALPSWLKAGYELN
FT                   PLVGIFQLHHAVWYPDEFPDARLLGTTIAGSLLVLVVGWWTFRRLEPAVLKEL"
FT   gene            590092..590841
FT                   /locus_tag="Sare_0520"
FT   CDS_pept        590092..590841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0520"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: stp:Strop_0432 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96449"
FT                   /db_xref="GOA:A8M0C8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C8"
FT                   /protein_id="ABV96449.1"
FT                   /translation="MADPIIEAAGLGIRFVRNRRRQLRLRDLALHRGRRGDHADGRFWP
FT                   LRDLTFSIEAGDTVGVIGRNGTGKSTLLRLIAGVLIPDEGWITVRGAVAPLLELSAGFS
FT                   AELTGRENLHLVGGLHGLSPSYLRRRVEEIVSFAGKQVEQALDTPVRHYSSGMKVRLGF
FT                   AIISHLPHPVLLVDEVTAVGDAEFRQRCYATIDRLLGEGRTLVLVSHNEQDLTRFCRRG
FT                   FYLDAGRMVVDGTMAEALAAYHRAVAR"
FT   gene            590838..592805
FT                   /locus_tag="Sare_0521"
FT   CDS_pept        590838..592805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0521"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   stp:Strop_0433 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96450"
FT                   /db_xref="GOA:A8M0C9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0C9"
FT                   /protein_id="ABV96450.1"
FT                   /translation="MTLAIVLTTDETAGLADRLAGQCRRAGIDEVRQVGDLATLADLAE
FT                   SAAGPVLVTGADLVAHTAVLRHLATSPAEPTVALVLAGPPGPGRTAVREDRGQVVAAGS
FT                   PEALDGEATGVFGGALRVDPVNLPVLVAAARSIAAEVVPVGAAAAQGVVDDEPAIDKLF
FT                   ADLVSRDAVTFAHRVRLLVARRVADDDDRAAAEAAVAAVDADRAELRLSVKERDDFFTT
FT                   VFVSTWSPYVTKLAARLRLSPTTVTMISVAFAVTAALLFGAGGRPALVTGAVLLYLGFV
FT                   LDCVDGQLARYTRTFSAWGGWLDTMADRAKEFIVYAGLGFGATQAGFRYGWALAIAAMA
FT                   VQTVRHMTDTWYGALHDEAARRPRATTGGGLGDRLSAASNRVQADVGSVTYWLKRTVVF
FT                   PIGERWALTALVVALFDQRAALLAVLTGMVLAFGYTAALRLLRARSMRVGVLNTVETTL
FT                   HRDDGPLARALPTPRWTGPLGLAASAVLVVAVLLGLALIGGDALPRWSALVALGGLLLA
FT                   AAGARASHGGALDWLVPAALRAAEYLFAIAVGVLGGAPAWLIFGYVFVLTLHHYDLTAR
FT                   LEKRKLAPPWHEATLGWEGRSVVLTLSAITGIAAVSMATLGMYLLVVFVGSVALAWVIQ
FT                   PARAARAAGSVGGVGGRPPG"
FT   gene            592814..595003
FT                   /locus_tag="Sare_0522"
FT   CDS_pept        592814..595003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0522"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: stp:Strop_0434
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96451"
FT                   /db_xref="GOA:A8M0D0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D0"
FT                   /protein_id="ABV96451.1"
FT                   /translation="MALISFVVPAYRVQGYLRECLDSILGQPVAEIEVIGVDDCSPDGS
FT                   GEILTEYAARDQRVRVLRLPANRGLGPARNAGLDQATGDYVWFVDGDDWLVSECLTEVA
FT                   GRLRETRPDVLVVDHLRAWWVGNATPSGMCEVFPDPPGSETFRLRDRPETIRLLHTVWN
FT                   KVLRREFLLEHGLRFAPGWYEDVSFSYPVLLRAQRIGVLDRACVNYRQRRAGAITRTSG
FT                   DRHFEVFAQWRRVFRFLDEGEPVGDDLRRLIFERMIWHYLTVLGNGERIPRDLRPAFFG
FT                   RITADYARWVPAQGLPPPEGIEGLKHRLVAAGRWRTFSALRGAVRMRDAAARRPARRVL
FT                   RRAVPAIRRARDVGLRELYRAELLRPVDPQLAVYAAYWYRGYACNPAAIYEAARRLAPH
FT                   VRGVWIVQRDRVDTVPAGVDYVVAGTLAGYRALAQARWLVNNVNFPNSVRKRPGTVHVQ
FT                   THHGTPVKVMGLDQQFHPAGADMDFVGLLRRVDRWDYSITSNSFSTQMWERAYPAGYTT
FT                   LEMGYPRNDRLVNATAGDVLRIRAELGLGVDEQVVLYVPTHREHLPGYRPPFDPDRFLA
FT                   VLGPAGQLLMRSHYLYDRDRRRSRPASRERLRDVSGYHRVEDLYLAADVLVTDYSSAMF
FT                   DYAILDRPIVVYAPDWPAYRLTRGVYLDVVAEPPGAVATDFVGLLELFRSGAVRDRRAD
FT                   EARRRFRDRFCRLDDGHAAERVVQRVFLDGVARAG"
FT   gene            595137..595601
FT                   /locus_tag="Sare_0523"
FT   CDS_pept        595137..595601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96452"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D1"
FT                   /protein_id="ABV96452.1"
FT                   /translation="MSIDSSQVAAGMLAAVPFARTLGLEFVEVAAEADGAVQAVVRLPD
FT                   TTATHNHVGGPHAGAMFSLGETASGAVVVAAFAHVLDRATPLAVNADIAYRKLAMGSVR
FT                   ATARLARPVADVIAELDAGQRPEFPVHVDIATEEGKPTGEMTILWTLRPH"
FT   gene            595661..596416
FT                   /locus_tag="Sare_0524"
FT   CDS_pept        595661..596416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0524"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   stp:Strop_0437 beta-phosphoglucomutase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96453"
FT                   /db_xref="GOA:A8M0D2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D2"
FT                   /protein_id="ABV96453.1"
FT                   /translation="MLGLPEHVTACLFDLDGVLTQTARVHNAAWTTTFDEFLRRRAADT
FT                   DEPFQPFDPDEDYRRYVDGRPRYDGVRTFLASRDIVLPEGTPDDPPEADTVHGIGNCKN
FT                   IRLLQELRTHGVDVYPGSMRYLKAATAAGLHRAVVTASANGREVVAAAGLEELLEVRVD
FT                   GLVARSEKLRGKPEPDTFLAGAERLGVAPGNAAVFEDALAGVAAGRAGKFGYVVGVDRV
FT                   GQAEALLAQGADHVVRDLAELLENREPSA"
FT   gene            596413..598788
FT                   /locus_tag="Sare_0525"
FT   CDS_pept        596413..598788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0525"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   stp:Strop_0438 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96454"
FT                   /db_xref="GOA:A8M0D3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D3"
FT                   /protein_id="ABV96454.1"
FT                   /translation="MIRERAYPVEPWHVRETRLDMDVLAQSESVFALSNGHIGLRGNLD
FT                   EGEPYGLPGTYLNSFYELRPLPHAEAGFGFPESGQTIVNVTNGKLIRLLVDDEPLDVRY
FT                   GELLSHERVLDLREGTLHRTVHWRSPAGREVCIRSTRLVSFRQRSAAAINYEVEVVDNK
FT                   PLRLIVQSELVANETLPAQSKDPRVAAVLESPLLAEEELTTDDGGLLIHRTKVSGLRLA
FT                   AAMAHEVRTTARTNIESEGYEDWVRTTTACVLKPGETLRVVKYLSYGWSSRRSLPALRD
FT                   QVGAALAAARLDGWDGLLREQREYLEEFWDSADVLVEGDPEVQQAVRFGLFHVLQAGTR
FT                   AERRPISAKGLTGPGYDGHAFWDTEMFVLPVLTYTHPTAVRDALYWRHHTLPAARDRAR
FT                   TLNLAGAAFPWRTIDGPESSGYWPAGTAGFHVAADIADAVRRYVYATKDTSLEREIGLE
FT                   LLVETARLWRSLGHHDRHGQFHIDGVTGPDEYTAIKNDNIYTNLMAQRNLITAADTAMR
FT                   YRDEAGHLGVTDEEAAAWRDAAADIHIPYDEEIDVHEQVEGFTRFQEWDFLHTPPEKYP
FT                   LLLHYPYFDLYRRQVIKQADLVLAMHWRGDAFTREEKLRNFLYYERRTTRDSSLSACTQ
FT                   AVLAAEVGYPELAHTYLREAALMDLHDINENTRDGVHIASLAGAWIALVAGFGGLRDHD
FT                   GTLRFAPRLPHRLGRLEFSLQWRGTQLRVDIQPHQTTYELRHSDPDEALELVHHGERIR
FT                   VTCAEPVTRPTPPPGKPGPTPEQPPGRDPLIRLPERAP"
FT   gene            complement(598847..599206)
FT                   /locus_tag="Sare_0526"
FT   CDS_pept        complement(598847..599206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96455"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D4"
FT                   /protein_id="ABV96455.1"
FT                   /translation="MRPVHRRDPSLAEHRGRRPEDALWTARPHRLAFARGGRWVRGRRP
FT                   QTVPARTAPRRIARITMAQQQESRQQAAERNRQKRDAKRKRDWADEAAQARTADDPRAM
FT                   APHDAAGRPSQGRQL"
FT   gene            599248..599895
FT                   /locus_tag="Sare_0527"
FT   CDS_pept        599248..599895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0527"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: stp:Strop_0439
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96456"
FT                   /db_xref="GOA:A8M0D5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D5"
FT                   /protein_id="ABV96456.1"
FT                   /translation="MDVRNEVQIPAGDVQLTADLRVPPEPAGVVLFAHGSGSSRRSPRN
FT                   VAVAQVLNRRALCTVLVDLLSPAEEAVDARTRQLRFDIGLLAGRLAAIVDWLATAGPCG
FT                   SAPIGLFGASTGAAAALVSAAERPDVVRAVVSRGGRPDLAGAALDRVTAPTLLLVGGLD
FT                   DQVLALNEQAREALPESAELTVVPGAGHLFEEPGALAQVSDAAATWFTDHLG"
FT   gene            600058..600240
FT                   /locus_tag="Sare_0528"
FT   CDS_pept        600058..600240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96457"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D6"
FT                   /protein_id="ABV96457.1"
FT                   /translation="MKKFMDQAREYVEKQDEQIDQGMEKAGDMVNERTGGRYKEQVDRG
FT                   VDMMQARTGEGDQVG"
FT   gene            complement(600317..600973)
FT                   /locus_tag="Sare_0529"
FT   CDS_pept        complement(600317..600973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96458"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D7"
FT                   /protein_id="ABV96458.1"
FT                   /translation="MNPIAQKGGLSIAGLLVAGGCLVGPAATAQAAPTVASTTQPTFER
FT                   SSLADDPAEQLVDVEYQAQPNFYYCGPAATRMALSALGKALPQDEVARLLGTTQAGTDS
FT                   ALDVTRVLNELAGAGYRTTEIPDATARPAEVDQFREDTRRALAQGRPVVANVKGTVVDN
FT                   DGTPHSYEGGHYLTLVGYRADGDLLRIADPAASKGVYWMAVAKVANWVAERGYSS"
FT   gene            601271..602011
FT                   /locus_tag="Sare_0530"
FT   CDS_pept        601271..602011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0530"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: stp:Strop_0442
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96459"
FT                   /db_xref="GOA:A8M0D8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D8"
FT                   /protein_id="ABV96459.1"
FT                   /translation="MNCPGTPDTQPGSHPVSSSGIGGSRSGPVGPEQALAELYDGNRRF
FT                   AVGVPIRPHQDIDRRVALADGQQPFAVIVGCSDSRLAAEIIFDRGLGDLFVVRTAGHTV
FT                   GPEVLGSVEYAVTVLGAPLVVVLGHDSCGAVQAARTADATGAPASGHLRAVVDGVVPSV
FT                   RRAGARGVTEIDQIVDIHIEQTVEAVLGRSEAVAAAVAGGRCAVVGMSYRLTAGEVHTV
FT                   TAVGLAAPTTPPAAPETRPSAGPA"
FT   gene            complement(602090..603106)
FT                   /locus_tag="Sare_0531"
FT   CDS_pept        complement(602090..603106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96460"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0D9"
FT                   /protein_id="ABV96460.1"
FT                   /translation="MTAPLRRWLTPVAAVLAALAMLAGPVPASAAPTSPPQPSGHDEEP
FT                   ELLGDLIEVRNREYVKASAQLKKSKERQAALEQEVKKAQAELDALTPQVAQIATQSYRT
FT                   GRVGAISMLLEADNPDSFIARATALDELNRVNDRRLNTVNAVKIRAEQAKLAVDAEVRK
FT                   QQKLENDLERGKIEAEKALRLVGGQGLTGGLVDAESPVARIAPGRTSDGGWTSLGCTED
FT                   DPTTGGCITARTLHMYQEVKRAGFNRFVGCYRSGGPYEHPKGRACDWSLQNSGFRSWYN
FT                   NDMRMYGNNLTAFLVRNADRLGVYYVIWNRQIWFPATGWKSYSGPSNHTDHVHVSML"
FT   gene            complement(603405..604754)
FT                   /locus_tag="Sare_0532"
FT   CDS_pept        complement(603405..604754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0532"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: stp:Strop_0444
FT                   YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96461"
FT                   /db_xref="GOA:A8M0E0"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E0"
FT                   /protein_id="ABV96461.1"
FT                   /translation="MGADHTRPTPSAPPRVRRILVVTVVPLFLATLVAAAILWPRDTRG
FT                   ADPGNEPPRFHGTVTKVVVEPCPPTPETPEGGLGTDGGPCGNVTVQVEQGPDAGRQVNT
FT                   PVPTGPGAPTIAVGDEIILVELIDPTDPTTSMYSIAEHQRGKPLLWLVALFAAAIVAFG
FT                   RWRGLAALAGLAASFAVLLTFVLPGISAGRSPLLVAVVGAALIMFVVLYLTHGTTAQTS
FT                   VAVLGTLGSLVLTGLLGTLATTATRLTGYGSEEAITLSMFQTNVDLHGLLLAGIIIGSL
FT                   GVLDDVTVTQAATVTELAQANPGLSRRQLYRSATRVGRAHIASTVNTIVLAYAGASLPV
FT                   LLLLTADSRPVSQILTSEFLAQEIVRSAVATLGLIAAVPLTTGLAAVVTTAGRNTDGVS
FT                   GDGTAPAPRPRPAAATRTEALEALSTFPVGPTARAADRRPDRDRNTDGIW"
FT   gene            complement(605121..605423)
FT                   /locus_tag="Sare_0533"
FT   CDS_pept        complement(605121..605423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0533"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   stp:Strop_0445 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96462"
FT                   /db_xref="GOA:A8M0E1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E1"
FT                   /protein_id="ABV96462.1"
FT                   /translation="MTTPAPTPVRGYTATKDQLLTRLRRVEGQVRGIEKMVEEDRYCID
FT                   VLTQISAIQAALDKVALGLLDGHARHCMREGAAEGRADEMATEMMAAVGRLMKRG"
FT   gene            605531..605740
FT                   /locus_tag="Sare_0534"
FT   CDS_pept        605531..605740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0534"
FT                   /product="copper ion binding protein"
FT                   /note="TIGRFAM: copper ion binding protein; PFAM: Heavy
FT                   metal transport/detoxification protein; KEGG:
FT                   stp:Strop_0446 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96463"
FT                   /db_xref="GOA:A8M0E2"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E2"
FT                   /protein_id="ABV96463.1"
FT                   /translation="MITVTYQVQGMTCGHCVNSVSTEVGALPGVENVQVDLDAGRVTVT
FT                   SQRPLDITSVRNAVDEAGYDLVSA"
FT   gene            605763..606086
FT                   /locus_tag="Sare_0535"
FT   CDS_pept        605763..606086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96464"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E3"
FT                   /protein_id="ABV96464.1"
FT                   /translation="MNTATKLTGFLFGLVAVFGAAYGVGQLTDPVTSGAEIRHEAPGHE
FT                   NGHDESGREGPEGDEVRSPVGPATTPTAPCADPPTPTGTAPAPSGGAGPGALGRGHDRQ
FT                   EAR"
FT   gene            606083..608377
FT                   /locus_tag="Sare_0536"
FT   CDS_pept        606083..608377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0536"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: stp:Strop_0448 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96465"
FT                   /db_xref="GOA:A8M0E4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E4"
FT                   /protein_id="ABV96465.1"
FT                   /translation="MTTTSTSQSTAANRIELAIGGMTCSSCAARIEKKLNRMPGVTATV
FT                   NYATEKASVAYPDGVTLDDLITTVEKTGYTAAEPAPPVPAGAAPAAQPVDELRGLRTRL
FT                   WVSVALTVPVILLAMVPPWQFTYWQWLSLTLAAPVVVWAGQPFHRAAWTNFRHGAATMD
FT                   TLVSLGTLAAFGWSVWALFFGTAGVAGMTHPFSFDIARTDGAGNIYLEAAAGVTTFVLA
FT                   GRYFEARAKRAAGAALRSLLELGAKDVAVLRGSTETRIPIDQLRVGDRFVVRPGEKVAT
FT                   DGVVTEGTSAVDASMLTGESVPVEVEVGDTVVGATVNAGGRLVVRATRVGGDTQLAQMA
FT                   RLVEDAQSGKAAVQRLADRISGVFVPIVIALAAGTLGWWLGSGAGPTAAFTAAVAVLII
FT                   ACPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRKADTVVLDKTGTITSGQMTLV
FT                   DVVAANGADRAEVLRLAGALEVASEHPIAQAVAAGAAKAGPLPAVTDFANLEGLGVSGV
FT                   VDGRAVLVGRPRLLRERDLVVPEEIEAAGTAAQAAGRTAVLVAWDGRARGLLTVADVVR
FT                   PSSAVAVRQLRELGLNPVLLTGDNETVARTVADEVGIDQVIAEVLPADKVAVVQRLQRE
FT                   GRGVAMIGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGELTAAVDAIRLSRRT
FT                   LSIIRGNLFWAFAYNVAALPLAAAGLLNPMIAGAAMAFSSVFVVANSLRLRGFRPVAQV
FT                   AVEPRSPGYPR"
FT   gene            608623..608778
FT                   /locus_tag="Sare_0537"
FT   CDS_pept        608623..608778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96466"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E5"
FT                   /protein_id="ABV96466.1"
FT                   /translation="MRNGGEPVFRSVVIARRAAALAALAVLVLTGHGERHDASGPAAPP
FT                   PVTAIR"
FT   gene            complement(608853..609896)
FT                   /locus_tag="Sare_0538"
FT   CDS_pept        complement(608853..609896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0538"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: stp:Strop_0449 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96467"
FT                   /db_xref="GOA:A8M0E6"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E6"
FT                   /protein_id="ABV96467.1"
FT                   /translation="MPDVLTSLPWPTGPSIAVFGVAGVLTVLGSVRLVALGDTLADRTG
FT                   WGEAFFGAVFIGLATSLSGIVMTAVTAAADQPQLGYSNAVGGIATQTTAVAVADAFHRR
FT                   ANLEHASASLSNVLFGVLLIVLLSLALLGKYAPDITVVGLHPASLAMVAAYLGGLHLVR
FT                   RSGASPLWRAVATAETLPDITHEHGSLDRTSFSRLWVRFAAVGLLVSAGGWAIARAAES
FT                   LVLVTGLSAGFVGAILMGAVNALPETVTAVAAVRRGAPTLAIAAVLGGNSLDALNLVVG
FT                   DVAFRGGSIYHAAGDAQLFVTTSALFMTAILLGGLLVRQAYGWGRLGFEGVLLLTSYAV
FT                   MTIVLAT"
FT   gene            610248..610958
FT                   /locus_tag="Sare_0539"
FT   CDS_pept        610248..610958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96468"
FT                   /db_xref="GOA:A8M0E7"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E7"
FT                   /protein_id="ABV96468.1"
FT                   /translation="MKADQSPVLPGDGATDYARYMRLDALFDLQRPSAEMIHRDELLFQ
FT                   VVHQSTELWLKLAATELTEAVARVEAGDPAAAEALLGRATLAVRLVTDHLEMFRYLSPV
FT                   DFQAMQPALGNGSGAESPGWRRIQSASRRLWQAFDDEVSARGTTVAALLPAIPGDSLHR
FT                   LAEAMVEWDERVALWRARHYQVALRVGGHAPAGTPNSAANMLGKILGHRFFPDLWQARL
FT                   CAVAADSSAVHPED"
FT   gene            611016..612245
FT                   /locus_tag="Sare_0540"
FT   CDS_pept        611016..612245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96469"
FT                   /db_xref="GOA:A8M0E8"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E8"
FT                   /protein_id="ABV96469.1"
FT                   /translation="MCFVRELNCWLSGTTDPADFPYLAVLREFHEVGKHFVEKETLSLL
FT                   DESRGRVTGHPAAGHDDPARLLRDFLDVALDKWDGRYDYRSYLALRLIGLSGEAEEPTF
FT                   GGDDAARRLLRDRLVVCLVADVLNFELAAAAHATTLLPRQRPGLTVVAKRCRLGVRAAL
FT                   PALARLGLTGLVQEGEPTSAAATLHAVAVDLDSVGALPLRLSMLPVHVTHDEYLFLRVL
FT                   QAYECVFAGVADELRAVIAAIGVDDARAAADRLEYARNLILNAGPLFSLLATMQPKSFQ
FT                   TFRQYTEGASAIQSRSYKLVESLCRGPDQDRLDSAAYAAVPELRALVRAGQPTIDDAYR
FT                   SAVRDGRLVGADRDLITRRMELFAETLLQWRRTHHRIAVRMLGPRPGTGYTEGTPYLAA
FT                   VRALPVFFTA"
FT   gene            612413..613210
FT                   /locus_tag="Sare_0541"
FT   CDS_pept        612413..613210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0541"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: stp:Strop_0450 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96470"
FT                   /db_xref="GOA:A8M0E9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0E9"
FT                   /protein_id="ABV96470.1"
FT                   /translation="MIMSLFHGTVGFYRQFRPDIPAEVADVLDAAAPAGSPRRLLDIGT
FT                   GTGLVVEALRGRFDDILAIDPDPEMLSAAESALRPRLPADAQLRLHEARAEEFTPPPEW
FT                   QADLVTICRTFHWLDQDMVLTRLHAQVSPEGAVAILADKSFWVASNDWELAVRAVIEDF
FT                   LGEQRRAGEGAFQEQRRPDLQVLRDSPFNQVEEHTVPVSRTWTANSILGYLHSTSFAEP
FT                   ELFGDRLSEFDSAVRTALASYSDTDTFIEENEFLIHIGRRGQA"
FT   gene            complement(613314..614015)
FT                   /locus_tag="Sare_0542"
FT   CDS_pept        complement(613314..614015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0542"
FT                   /product="spermidine synthase-like protein"
FT                   /note="KEGG: stp:Strop_0451 spermidine synthase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0F0"
FT                   /protein_id="ABV96471.1"
FT                   /translation="MSDIRQLPVTLDRVTTSRGELVLRETNGHYEVISNGVFLMDTSDG
FT                   RSERLLVDAAVHRCTTPAPRLLVGGLGVGFSLVRAIEYTHLAAIDVVEIEAAVIGWHTS
FT                   HLHHLTSRAMADPRVRIIEADILAWMADTGDQYDAICLDTDNGPNWLVFEANAELYGHR
FT                   GLDLVVRRLRPGGVLAIWSASRDDSFEQRLRGRFGDLVTLETPTDTGAPDVVYVVWAAT
FT                   AARGEQPESLA"
FT   gene            614364..615866
FT                   /locus_tag="Sare_0543"
FT   CDS_pept        614364..615866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0543"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   stp:Strop_0463 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96472"
FT                   /db_xref="GOA:A8M0F1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0F1"
FT                   /protein_id="ABV96472.1"
FT                   /translation="MTSEKQAKASHRGIPSSNEFREFIASGWATTDREPAPRAEVADHA
FT                   ARRRALLSQRFPGERLVIPSGGLKVRSNDTDYTFRPHTAFAHLSGLGAHADPDSVLVLD
FT                   PKPGGGHHAILYFRPLAPRDSQEFYADSRHGEFWVGPRPTIADRESELGITSRHVDSLA
FT                   DDLAKDDAAARMRVVRAADPQLTELVDGVRREAGATGSASELQEADAEFARHLSAMRLV
FT                   KDEWEVAEMRRAVAATHKGFDAMIASLPEAVRKGRGERWVEGVFGLYSRHEGNGVGYES
FT                   ICASGDHANTIHWTKNTGEVREGDLILIDCGIEIDSLFTADITRTLPVTGRFTDVQRRI
FT                   YDAVYEAQQAGLAAVKPGNRFSDIHAAANAVIARILHEWGLLPEGVTLEQTLDRENGGW
FT                   HRRWMVHGTSHHLGMDVHDCQLMLREDYLDTELRPGMVLTVEPGLYFKSDDLLVPEEFR
FT                   GIGVRIEDDVLVTEDGCENLSAAMPRTSHEVEEWIARVWANA"
FT   gene            complement(615984..616523)
FT                   /locus_tag="Sare_0544"
FT   CDS_pept        complement(615984..616523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbb:BCG_3912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96473"
FT                   /db_xref="UniProtKB/TrEMBL:A8M0F2"
FT                   /protein_id="ABV96473.1"
FT                   /translation="MTREGSSTTARGANPAPAAVGRRSGPDAPRQSTVAGRLNELFATV
FT                   TWVDERGRRREYSTPQVARAISDDPSHDTTVSRVYLATLRSGTNTNPTVAVLKAIARFF
FT                   DQRRAVEAPPITASYFLDEEDESQEFRRQLADRQVRMIAMRAGNMTPAVRRQVLQMLDI
FT                   LEQPVSEEPTAEQPGG"
FT   gene            complement(617045..618154)
FT                   /locus_tag="Sare_0545"
FT   CDS_pept        complement(617045..618154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0545"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   stp:Strop_2703 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96474"
FT                   /db_xref="GOA:A8M104"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8M104"
FT                   /protein_id="ABV96474.1"
FT                   /translation="MTSLFTRLSRRVVPGHVRHVHPVLHRDAQGLVAKVYDQMERDFGM
FT                   IAPPVALHAPAPTVLSASWVLLREILLVDGRVDRATKEAVAAAVSLGNRCPYCVDVHST
FT                   TFLGLVGGDEAQAVAADRIDTIADPRLRELVRWGRLSGGAERPAPPFTPAEAPELIGTA
FT                   VAFHHFNRMVNIFLQESPLPPVRGRVRGAVRRGAAGIMGRLAGGGTGPGGSLDLLPPAV
FT                   SPPGLEWAAGQPHIAEAARRALAAVEDSAARSVPEQVRQLVTDRLATGPPPGPGPVNRP
FT                   WLAEVTAGLPDEHRPAARLALLTAFASYQVTDAVVAECRARGQDDTELITLTGWAALSA
FT                   ARQVGTRLYSDLSTCGVAARCADRPGGAE"
FT   gene            complement(618165..619772)
FT                   /locus_tag="Sare_0546"
FT   CDS_pept        complement(618165..619772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0546"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; KEGG: stp:Strop_2704
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96475"
FT                   /db_xref="GOA:A8M105"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8M105"
FT                   /protein_id="ABV96475.1"
FT                   /translation="MSAIESTDVVVIGSGFGGAIAAYHLAAGGARVVVLERGPWLTAQD
FT                   FDHDFLLGTSYTRIFDFVVGDGMSILSGNCVGGGSVVYFATMPRAPGFVFERRGSIGRR
FT                   MWPAAISRQTLDPWYDRVSESLPITQQSWDQVPYAGGLWAAACAHAGRTANPAPSAVDV
FT                   SLCTNCNWMMAGCKFDAKRSLLLNYLPGALAHGAQIRPMHEVQRLSRNADGGYRVHYRI
FT                   VDDEDYRVLHDSGTIDARIVVLAAGTGATPVILRRSEPDLGPMPHAVGRYFSGNGERLN
FT                   TAVFDEDRVRDVLKLSRPDGSAYGAYQIGRGPTVASWDRLDGSLPEYERFSLEQLYFPP
FT                   GLGTILAQVPDADAPTWFGVQKKEMLSRWPSWLTVFTMSEDDNEGVFGPPPATGNATRL
FT                   SQQMLGDGPLRYRPTANTQRGWDLSDAEVKDILERDGLARVRPWTNDLIGAYTVHPLSS
FT                   CRIGDDPQTSALNDGHELRNHPGIFVTDGSAVPGALTVNPALTISALAERAVPGIVRAA
FT                   AERGVPVRYGAPVPAGVS"
FT   gene            complement(619769..620338)
FT                   /locus_tag="Sare_0547"
FT   CDS_pept        complement(619769..620338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_2705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96476"
FT                   /db_xref="UniProtKB/TrEMBL:A8M106"
FT                   /protein_id="ABV96476.1"
FT                   /translation="MTNDASDEDDVRNSTLEAFADTIIPGEKRWPGDRAVAGASTGGGA
FT                   VSAGALALLEQPGTGMSPALDSLAVLLNEHAREYAEARGDTLDDDAPPFVALSFANRTE
FT                   LVQQLTAPDHPEKSMWVGLALFSNMAYDSAAHLNLADAFAQGHPGLLAIGYARPDATGV
FT                   YQFPQFSYGRALAPIHPLTTATGSPA"
FT   gene            620593..621684
FT                   /locus_tag="Sare_0548"
FT   CDS_pept        620593..621684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0548"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   stp:Strop_2703 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96477"
FT                   /db_xref="GOA:A8M107"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8M107"
FT                   /protein_id="ABV96477.1"
FT                   /translation="MVAAVAQRQVRYVTPVPAGAAEGPVARVYDQVVEEMGLVIPPVLV
FT                   HSPAPAALAAFWALFRESLIASGDVDRAAKETVAAAIGVATTCPYCVDMHSVAMYELAT
FT                   EEDAEAVVADRSADLADGRLRALVRWAATAHLDARTALPAQLTTAGRAELLAVLVSMHY
FT                   LTRVVNVFLPGFLLPSGLTPRARRRFKRGVAQLMRSLLHRYNAPGRALGRRTSRSAGVP
FT                   PTWAAAVPPLAAAYTGAAEAFEEAGARSLSPAVRRLLWDRLAGWDGSDPGLDTRWCERL
FT                   VAGLPEPERAAGRLVLLTAIASYRVDAEVVAGFRRHHPDDVTLVEAVAWAAFTTARVIA
FT                   GRQDAAGAQRTAGDAFGNRPVPR"
FT   gene            621740..622732
FT                   /locus_tag="Sare_0549"
FT   CDS_pept        621740..622732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0549"
FT                   /product="protein of unknown function DUF1702"
FT                   /note="PFAM: protein of unknown function DUF1702; KEGG:
FT                   stp:Strop_2701 protein of unknown function DUF1702"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96478"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:A8M108"
FT                   /protein_id="ABV96478.1"
FT                   /translation="MPTTLGTLRRMAMAPSLAQVSFAGRGFPVRPSAATRHLEAIPQAV
FT                   VCGFEWGIEGRDLWEVQRRLDLVDAEHRGFAYEGATMAFTVRDAIPGGHRHWARDLLSG
FT                   PAVPHTFLTYIGIGFAMARLPRPLWRSVLPNLTGTPYYPVMSWLAVDGYGFDKAYFDTT
FT                   RWVTQQERPRPYPWLGRPDYFPRAFDQGVGRALWFIHGGRPSNVAPAVECFDATRRADL
FT                   WSGVGLAATFAGGWDDDGPQALAAEAGPYRAHLAQGSVFAAKARAYSGTVPSCTETAVQ
FT                   VLAGMTVTDADTLADEVAVGGVAAGSEPDYEVWRERIRQRCAQELGLRG"
FT   gene            622795..623781
FT                   /locus_tag="Sare_0550"
FT   CDS_pept        622795..623781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0550"
FT                   /product="protein of unknown function DUF1702"
FT                   /note="PFAM: protein of unknown function DUF1702; KEGG:
FT                   stp:Strop_2700 protein of unknown function DUF1702"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96479"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:A8M109"
FT                   /protein_id="ABV96479.1"
FT                   /translation="MGIVGRLRRRMLTPDVSETRLAVRGFHVKSAAAQERLETVGETFV
FT                   AGYAAAAEASRPPDAEETLESLPENYRGFGYEGAAMAFALRDGLPVGRRDHVATFLAGR
FT                   AADHVYMAYVGVGWAMARLPRFRWPALHLADPLLCHLALDGYGFHQAYFKTRTYVYDQF
FT                   QESRFPWPPGGPTDAVNEVIDQGIGRACWFVGGGDPDLVARILDRFPQHRRADLYSGAG
FT                   LAATYAGGADVAELRHFRELCGPYQPNVAQGAAFAAQARLRAGLLGEHNEIATEVFCEA
FT                   PPAAAAKVTDEARAALPEPGGLHAFATWRQQISAAYVPSRASRVNEA"
FT   gene            623870..629677
FT                   /locus_tag="Sare_0551"
FT   CDS_pept        623870..629677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0551"
FT                   /product="Erythronolide synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; Beta-ketoacyl synthase ; Acyl transferase;
FT                   KEGG: stp:Strop_2697 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96480"
FT                   /db_xref="GOA:A8M110"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A8M110"
FT                   /protein_id="ABV96480.1"
FT                   /translation="MTRIAVIGMACRYPDAASPTELWENALAGRRAFRRLPDERMRLED
FT                   YWDPDPRTPDRFYARQAAVIEGYEFDRIAYKVAGSTYRSTDLTHWLALDVAAAALADAG
FT                   FPMGEGLPRQATGVIVGNTLTGEFSRANQLRLRWPYVRRVVAAALKEQDWDDARLGAFL
FT                   EQLESTFKSPFPEVDEDTLAGALANTIAGRICNHLDLRGGGYTVDGACSSSLLSVATAC
FT                   KALVDGELNVAVAGGVDLSIDPFEIIGFAKTGALASSEMRVYDQRSNGFLPGEGCGMAV
FT                   LMRESEARAAGHRIYATIAGWGISSDGRGGITRPEATGYRLALRRAYERAGFGIETVGL
FT                   FEGHGTGTKVGDTTELTALAEERAAADPHASPAAISAIKAMIGHTKAAAGIAGLIKAAM
FT                   ATHHEVLPPTLGCVEPHDVFGAQSAPLRMLRKAEPWPSDSPVRAGVTAMGFGGINTHLV
FT                   LENDRPRRRARFDSRTHALASSMQDVELLLVDALSPQELRDRLQRLTDFVPSLAYAELA
FT                   DLAATLHGDLRELPWRAAVVVSSPDDAVHRLNQLCAALDSGEAELISPDGRTMLGHASG
FT                   PGKIGFLFPGQGSGRGTNGGALRRRFAEAEQVYAQATLPSSGDMVATEVAQPRIVTGSL
FT                   AGLHVLSALGIEASVGLGHSLGEISALYWAGAFDSATLLRVAGVRGRTMAAHSSSGTMA
FT                   GISASPEVAERIIGDRPVVIAGYNGPTQTVVAGPVEEVDAVVRDAAEAGVSASRLNVSH
FT                   AFHSPLVEPAADAFGELLTVERFNSLDRRVISTVTGEGLPDQTDLKSLLRRQITDPVLF
FT                   SQAIALAAKEVDLFVEVGPGRVLSGLATAATDVPAIALDTDNESLAGLLSAVSAAYVIG
FT                   GQPVDSALFHGRLTRPLPVGTTFSFFANPCEAAPTLPVPATTAATRPAEPTNDPIGAPT
FT                   AGESTVDTMRRLAAERAELPLELVNPDSRLLDDLHLSSITVGQVVNHAAQALGVPVAQA
FT                   PTNFAVATVQELADALDSLVGTGESDAAPIAAQVTGAAEWIRAWRVDLDDVPLSPRAGT
FT                   ETGGAWQVFAAPDSTFAEPLRRALERAGVGGGVLLCLPSSCTTDELERALTAARAALAG
FT                   GDRFVLVQSGRGAAGLAKTLHLEDPRVRTTVVHLPEQTPTAVDTVVAEVAATTAFSETY
FT                   HDPDGTRRVPTLRAMPVRATREQAALDQTDVLLVTGGGKGITAECALAMAQDSGARLVL
FT                   LGRSDPATDRALADNLDRIAESGIRVRYLRADVTDAEQLAGALNSLPPEWGPVTAVLHG
FT                   AGRNEPTSLNSLTMADLDATFAPKVDGLRNVLAAVDPAQLRLVVSLGSIIGRAGLRGEA
FT                   HYAIANEWLADATAEVGRQYPGCRALCLEWSVWSGVGMGERLSVVESLARDGITPITPD
FT                   QGVALLRRLLADPDTPPVVVISGRTEGIHTVRHDAPPLPLLRFVERPLVRYHGVELVSE
FT                   VELSSGTDRYLEDHLLDGNLLFPAVFGMEAMAQVAAAVTGESGVPVIEDAEFLRPIIVP
FT                   PAGSTTVRVAVVVTDDRTVDAVIQSAETGFGAEHFRARLRYGGTDAPDGPPDQVAEGLP
FT                   VVPLDPVQDLYGHTLFQGQRFQRLHRYHRSAARNVDAEVVVPQRTDWFAPYLSAELLLG
FT                   DPGVRDALMHGNQVCVPEGTLLPAGIERVWPGGGRIEAEEVLRYAAVERSRDGDTYVYD
FT                   IALRTTTGRTVERWSGLRLRAVRKRDGRGPWVAPLLGSYLERTLGDLGASEVAVALEPD
FT                   EPASGTPGDHVATRRGRTALAAGRALGRPVEVRYRPDGRPEVAGERGISAAHGAGMTLC
FT                   VAGTGPLGCDVEPVAERSPADWKGLLGRYQDVADLIATRDRETAHTAGTRIWAATESLR
FT                   KAGYSTGAPLVLLPDDRGPWVTFTSGDVRIATLLTTVRDVPDPVVLAALFAPTRRKVGS
FT                   HG"
FT   gene            629670..630110
FT                   /locus_tag="Sare_0552"
FT   CDS_pept        629670..630110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_2696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96481"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8M111"
FT                   /protein_id="ABV96481.1"
FT                   /translation="MGDYFEYLHTVGFEETNLVGNVYYVNYLRWQGRCRELFLKQQAPE
FT                   VLADLQTDLKLFTLQVDCEFFAEITAFDELSVRMRLLELGQTQIRFGFDYVRLDPGGET
FT                   FVARGNQRVACMRGPNTRTVPARVPEALVRALEPYTASARTQ"
FT   gene            630129..630650
FT                   /locus_tag="Sare_0553"
FT   CDS_pept        630129..630650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0553"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: stp:Strop_2695 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96482"
FT                   /db_xref="GOA:A8M112"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8M112"
FT                   /protein_id="ABV96482.1"
FT                   /translation="MEVHPIQTAEFDSRQLRSTLGAFATGVTVVTVGGDAPHGMTANSF
FT                   TGVSLDPPLVSVCVQRDAVMHAVLLEQGSFAVSVLAADQVRAARWFADRRRPLGRAQFD
FT                   AVDVRPGERTGAPLLVGAVAQFECRLWRTYDGGDHSIFLGVPLTVARGVTDDVLVFHDG
FT                   AFRRLERGRR"
FT   gene            630647..632005
FT                   /locus_tag="Sare_0554"
FT   CDS_pept        630647..632005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0554"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: stp:Strop_2694
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96483"
FT                   /db_xref="GOA:A8M113"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8M113"
FT                   /protein_id="ABV96483.1"
FT                   /translation="MTLDTITPRVPLGPPRTAALRMLLVMKRDRLGMLSSAAARYGDAS
FT                   RLPVGHKALWFFNHPRYAKHVLADNSANYHKGIGLVHARRALGDGLLTSEGDLWRKQRK
FT                   VIQPAFQSRRIAQQAGMIAEEAFALVERLRARAGAGPVELTAELTGLTLGVLGRSLLDA
FT                   DLAGFDSIGDSFATVQDQAMFELETLNAVPMWIPLPRQIRFRRARRKLQAVVDTLVDGR
FT                   AGNLADRVDVLSRLILSARGEADPRVGRERLRDELVTLLLAGHETTASTLGWTLSLIDR
FT                   HPGVWERLHAEAVEVLGDRLPEYDDLRRLRYTVMVVEEAMRLFPPVWLLPRRALAPDTI
FT                   GEYRVPANADVVISPYTLHRHPEFWPNPERFDPERFAPGQAADRPRYAYLPFGAGPRFC
FT                   VGNNLGMMEAVFVIALLCRHLRLTGVPGYRLVPEPMLSLRIRGGLPLVVRPVS"
FT   gene            632352..634385
FT                   /locus_tag="Sare_0555"
FT   CDS_pept        632352..634385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0555"
FT                   /product="ASPIC/UnbV domain protein"
FT                   /note="PFAM: ASPIC/UnbV domain protein; FG-GAP repeat
FT                   protein; KEGG: stp:Strop_2699 ASPIC/UnbV domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96484"
FT                   /db_xref="GOA:A8M114"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="UniProtKB/TrEMBL:A8M114"
FT                   /protein_id="ABV96484.1"
FT                   /translation="MPSGVAPWYVVRKGDPLPPQRFGRLRRIIPSVFVLMLVGVLFAVA
FT                   RIPAVSATDRKLVAERFQFTELPIALPEGLPQRTIREVNPAYEEIRSWISSVGAAVAVN
FT                   DVAGTGRAADLCLVDTRSDSVIVTPVPGTGDRYAPFVLDPAPLPSGPGVAPMGCVPGDF
FT                   NGDGRMDLLTYYWGRTPVVFLHRAGVETFGRQSFHPAELVPQAPAADGTYHGPLWNTNA
FT                   VAVADFDGDGHPDIGVFNYFPDSPVLDPTAAKNVTMNHSMSRATNAGGAHVLRWTGATA
FT                   GDRPTISYQEQRGAIPPEAASGWTLGSASADLDGDVLPELYLANDFGHDHLFHNVSEPG
FT                   RIAFTEVTGRRGAFTPKSMVLGDDSFKGMSAEFGDLVGNGRFDLFISNITTEWGLEESN
FT                   FAWVNNAATPAEAKAKLERGTAPYDNKASSLGIAWTGWGWDAKMADFDNSGRQSVVQTD
FT                   GFVKGDINRWAWLQELAASNDLLLANPDMWPKAGPGDDIAGDQTLAFWARQDDGTFLDV
FT                   SEDLGLAVPIPTRGVAVSDADGNGAQDFAVARQWGAPAYYRNAKSGSDDFLGLRLFRPA
FT                   TGTGSEVASSKVVGTPAYGAQVRLTTADGKTQIAQLDGGSGHSGKRSFEVFFGLGPSAG
FT                   KSVTAELTWRDLDGAVHRQALSLAPGWHDLMLTTEAAEVSRR"
FT   gene            634382..635419
FT                   /locus_tag="Sare_0556"
FT   CDS_pept        634382..635419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96485"
FT                   /db_xref="GOA:A8M115"
FT                   /db_xref="UniProtKB/TrEMBL:A8M115"
FT                   /protein_id="ABV96485.1"
FT                   /translation="MTDTVADVNTSAVGAPVTGAGRERSAPSPARAPNTPPRIDKRDPR
FT                   YLALRNFAISISVFNILGYTVLGFEHPWTWPLFALAVGYVAEIVIELVSAWAQRRPAAF
FT                   TGNGAWGMYTFLLPTHITALAVNMLLYANDLFWPIAFGVVVAIGAKTVFRAPIKGRSRH
FT                   FLNPSNFGITVTLLAFSWVNVAPPYQFTENVPDMIALGVPLIILTAGTVLNAKLTGRVL
FT                   LIVGWVGGFVIQALVRHLIWDVALWGALGMMTGVAFVLFTNYMITDPGTTPPSGRAQFI
FT                   FGSSVAAVYGVLMVANVVYTLFFAVTIVCFARGAYWWARWALQRRRERQRPVELMRTLA
FT                   QPAAG"
FT   gene            complement(635576..636250)
FT                   /locus_tag="Sare_0557"
FT   CDS_pept        complement(635576..636250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0557"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: stp:Strop_2692
FT                   regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96486"
FT                   /db_xref="GOA:A8M116"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8M116"
FT                   /protein_id="ABV96486.1"
FT                   /translation="MRISDLSRKSGVPVATIKFYLREKLLPPGTLTGRNQAIYGDVHLR
FT                   RLLLIRSFTNIAQLDLSSVGELLSAIADDGLPLPGLYEAADRAVFGVDPSATGSAEVNH
FT                   AKIEVNEFLDKLGWRISADTPAAGRLAQVLVALRALGCECGIEFFEPCAQAAERFAAQE
FT                   LDLVPEDLDRTERAPAVVRSVMLGVATAALHRMAREHLVNERFANSAVTHGSEVPQPAP
FT                   VG"
FT   gene            636583..637032
FT                   /locus_tag="Sare_0558"
FT   CDS_pept        636583..637032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0558"
FT                   /product="sterol-binding domain protein"
FT                   /note="KEGG: stp:Strop_0137 sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96487"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A8M117"
FT                   /protein_id="ABV96487.1"
FT                   /translation="MSSPWADPVTMDPREFARHVRAMSTDELETLMRGPRRRHVLDELL
FT                   RRMPSALRQDRAKSIDAVVHWQIGDRPDGGTDRYQMVIVKGECELSSACDRAPALTLTL
FT                   SGADFVRLVTGNVHAVMLVMKGRLATKGDLRLTAKFPNLFDIPKP"
FT   gene            637060..637854
FT                   /locus_tag="Sare_0559"
FT   CDS_pept        637060..637854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0559"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="PFAM: Wyosine base formation domain protein; KEGG:
FT                   stp:Strop_2706 wyosine base formation"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96488"
FT                   /db_xref="GOA:A8M118"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8M118"
FT                   /protein_id="ABV96488.1"
FT                   /translation="MIEQRNPVSDLIADGAALDQLVAGLSPEQWRIPTPAPDWSIAHQI
FT                   AHLAATFRLAGLAASNPEGFAALGARLSPDFNANVTAALNEYVGDPPEVLLDRWRAERA
FT                   GAEKALGALPPHQQVPWLVRPLPAGVLACAGMMETFAHGQDIADALGVDRTHTDRIGQL
FT                   VAFAVRTWDFGYQARKLPTPDVAFRFEITAPSGAVWEFGPADSPERISGPAVDFCLLVT
FT                   RRRHPDDLAVRALGPLATEWLGLAQAYRGPAGEGRRPGQFRP"
FT   gene            complement(638120..638965)
FT                   /locus_tag="Sare_0560"
FT   CDS_pept        complement(638120..638965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0560"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: stp:Strop_2693 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96489"
FT                   /db_xref="GOA:A8M119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8M119"
FT                   /protein_id="ABV96489.1"
FT                   /translation="MEQSVELAVKRAIMMMQENLGEQLTVEDMARAAMFSKFHFSRIFL
FT                   RATGVSPGRFLSALRLQRAKHLLRSTKLNVADISLRVGYNSLGTFSSRFTRSVGLSPTA
FT                   YRRLAGFATHIPIDRSGRLGQPSAARVSGEIRLGPAVEPGLIFVGMFPDRIPEGRPVSC
FT                   AVLTEPGCFHFESVPTGSWYLLAQSVTEKSQQMMWDHDAPDQRISVATHGPLTVRSDTV
FT                   VEAELTLQPAGTLDPPVLLALLDVRPEAPTERGHTEPRPLLQTIGRRQFPWTRACRPAA
FT                   "
FT   gene            639751..640045
FT                   /pseudo
FT                   /locus_tag="Sare_0561"
FT                   /product="hypothetical protein"
FT   gene            640158..640346
FT                   /locus_tag="Sare_0562"
FT   CDS_pept        640158..640346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96490"
FT                   /db_xref="UniProtKB/TrEMBL:A8M120"
FT                   /protein_id="ABV96490.1"
FT                   /translation="MTVHMAHTTLRVNRTRGNPTTPSRWCRSAHGPRSRTDDRLGRIGT
FT                   STERRLRWVEVIGFYGT"
FT   gene            complement(640334..641407)
FT                   /locus_tag="Sare_0563"
FT   CDS_pept        complement(640334..641407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0563"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bbr:BB1606 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96491"
FT                   /db_xref="GOA:A8M121"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8M121"
FT                   /protein_id="ABV96491.1"
FT                   /translation="MREITLSTALWVKATVGGLKLPHRLVMAPMTRNRSTPDGIPTQLN
FT                   ATYYAQRAALGLLISEGTQPCADGQGYPLTPGIYTPEQVDGWRRVADSVHRAGGHLFIQ
FT                   LMHAGRISHPANTPFGRQPVAPSAVPPAHLIFTTAGPQPMPVPHAMSEEEIHATVDHFR
FT                   HAAAAAMAAGADGVEIHAGNGYLLHQFLSDNVNQRTDAYGGTIAGHIRFAVEVAHAVVG
FT                   EIGAERTGVRISPGNTFNDIIEGDPGPVYAALVRALAALELAYLHLVSRGEDGLAMALR
FT                   RAWPGTVILNRPGAEIEARAADVETGLADLVSVGTLALANPDLVARLRAGVELNEPDPA
FT                   TFYGGDHRGYTDYPYVP"
FT   gene            complement(641511..642440)
FT                   /locus_tag="Sare_0564"
FT   CDS_pept        complement(641511..642440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0564"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rsq:Rsph17025_0611
FT                   1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96492"
FT                   /db_xref="GOA:A8M122"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8M122"
FT                   /protein_id="ABV96492.1"
FT                   /translation="MGRPVLVGTVTLDVLHEGPIGAGRPPAVLRWGGVMTNAACAAGMR
FT                   GADPALVTVTYTGELAPAVPAHLAANQVRWTPLPARSPLPLFHAELVDGSVRHKVFIGD
FT                   EALSALTPTALEANRATLADASVLVAGTDAEEQTLAWLANHAAARDLPFWLLSADPTEV
FT                   GKLRPYGRGADLVALNLPELSGWAGRTLTDRTDIVEAARDLAAPGGRCLVTLGAEGALL
FT                   IPPGNAEALFQPAPPIENSSLAVGAGDVMFGCLLAARLDGAGWAAALRQASEFTTAFLL
FT                   GVASTHFPFHVLGTREVAQPAAAGSRTA"
FT   gene            complement(642433..643005)
FT                   /locus_tag="Sare_0565"
FT   CDS_pept        complement(642433..643005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0565"
FT                   /product="Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /note="PFAM: MGS domain protein; KEGG: rrs:RoseRS_0206
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96493"
FT                   /db_xref="GOA:A8M123"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8M123"
FT                   /protein_id="ABV96493.1"
FT                   /translation="MLAVLAVSDKRNIEELATGLLGLGWDVVATEGTRRLLRDHGVTVG
FT                   AVSDLAGVPTLLGGRVKTLTVSLMGGILARDEPADRAEVERHGLTRVHLVCCNYYRLPD
FT                   PQPAQPFERFRELIDVGGPAMLRAAAKNCAHVVPLSDPDDYAGVLKALADGGVDRRQRL
FT                   DLARKAFAVSAAYDTSVAALLAGAVNG"
FT   gene            complement(643026..644294)
FT                   /locus_tag="Sare_0566"
FT   CDS_pept        complement(643026..644294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0566"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   sbm:Shew185_3187 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96494"
FT                   /db_xref="GOA:A8M124"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A8M124"
FT                   /protein_id="ABV96494.1"
FT                   /translation="MISAVVGLNWGDEGKGRMVDWLSASADIVGRYHGGGNAGHTIHVA
FT                   EGRFTLHHLPSSVFRPGVRHVLGPGIVADIDGILDEIALVTKHGVVSDNILLSEAAGIC
FT                   FPFHRALDAAEEDRLGHDQYGSTKMGISPAYGDRVMKKTLLVRELFETRHLATRLTPVL
FT                   GWANARLEKVYGRPAVRVADAERWILGVRDQIEPFVTDTTAMLAAAEADGATILAEGQL
FT                   GALRDVYFGIYPFSTSSSCLAAHAPVGLGVPWARVRHTVGVSKAFSSCVGAGPLVTEYQ
FT                   PDLAASLRERWGEYGATTGRPRRLGHFDAVATRYGVTMQGTDEVAITNLDQLSGVGDLR
FT                   ICVAYRHEGRTTREFDPSPATLADTTPCYETLTGWDDDISGIRDFAALPEPAQAYVLAI
FT                   ESLLDVPVTYVSVGAQRDALITR"
FT   gene            complement(644291..645328)
FT                   /locus_tag="Sare_0567"
FT   CDS_pept        complement(644291..645328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0567"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: mka:MK0297 predicted
FT                   dehydrogenase related to phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96495"
FT                   /db_xref="GOA:A8M125"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M125"
FT                   /protein_id="ABV96495.1"
FT                   /translation="MRLNVLLIGAMYHQEAEALLNTHFAVTRIEADELPARPAALREAH
FT                   GLAVRYPAQITADVLDAAPQLLAVLSSGRGVDNIDIPAASRAGVVVANNPGLGGKPVSE
FT                   HALGLLIMITRDLTAVARDAMTGAWEKRLTTRRVELTGGTLGIVGCGNVGGWMARRASA
FT                   GFQMRVLAYDPYVSAEQMAQVGATKVDNLDKLLAEADFVSCHPELNDETDGMFNDDTFG
FT                   QMKSGAYFVNTSRGAVVRTDALVRALRSGRLSAAALDVYDQEPPPADSPLLRLDNLVLS
FT                   AHVADFTVQTKHALAMSAARQLVTALNGELPPHPLNPEVWDRVAARRSVVIGTTGHLAQ
FT                   REGAQ"
FT   gene            complement(645353..645952)
FT                   /locus_tag="Sare_0568"
FT   CDS_pept        complement(645353..645952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0568"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: rxy:Rxyl_2365 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96496"
FT                   /db_xref="GOA:A8M126"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8M126"
FT                   /protein_id="ABV96496.1"
FT                   /translation="MGGSVQEFESHRRWLLAMAYRWVRSTAEAEDIVSEAWIRWHRVSD
FT                   IRDHSAVLATIVSRLCSDHLKSARVRREKCDGAVLPEPSTAAAPPTPDGVVERNEEVML
FT                   VAGRLLERLNPAERGVLVLRHGFEYSYRDVSQVLGIREASCRQLYSRGRARLVASARRF
FT                   ATEPAKQAELASRLAAASRAGDLAALERLLAADVKI"
FT   gene            complement(646014..647321)
FT                   /locus_tag="Sare_0569"
FT   CDS_pept        complement(646014..647321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0569"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: rpd:RPD_2366
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96497"
FT                   /db_xref="GOA:A8M127"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8M127"
FT                   /protein_id="ABV96497.1"
FT                   /translation="MTISAHELSDAIVPNSTRSEQLYQRARKVMPGGNSRTAVFTTPYP
FT                   VYVRSGQGARVVDVDGNERLDFLNNSTALIHGHAHPRIVEVMAQAAARGMSFGMPTEVE
FT                   VTFAEALCGRNETFEHVRFTSTGTEAVMMAVQAARAYTLRPKIAKIAGAYHGAYDTVAI
FT                   NNDGSGSLITHATQGIPDGVSHNTVVIPFNDPEGALAVLRRHADELACVLIDPVPWRIG
FT                   LVPASGDYLTALRSFCDETGTVLISDEVGSFRIGWHGAMSRLGSAADITVLGKVIAGGM
FT                   PIGAVAGRRTVMAVFDPSSGSPALPHSGSYNANPVSMSAGLGSLELLTQEETQRINDLG
FT                   ESVRRHMAHILAARTEGWTVNGVGSLFRVLGPAVTDASGQRMNLVNLLSRALLRRGVHI
FT                   GDSGLGCVSTAMGPDEVDSYARAFEGAVADVVAAQR"
FT   gene            complement(647341..649320)
FT                   /locus_tag="Sare_0570"
FT   CDS_pept        complement(647341..649320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0570"
FT                   /product="Methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; tRNA
FT                   synthetase class I (M); KEGG: pen:PSEEN0982
FT                   methionine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96498"
FT                   /db_xref="GOA:A8M128"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/TrEMBL:A8M128"
FT                   /protein_id="ABV96498.1"
FT                   /translation="MLVAGIPRSVSEMEAPTFVRSSAPPWADVTRPPFNVTRVTLRPGE
FT                   TTAAHNHHDNEVWIVLAGRGLVRSDGAAERVVAGDTVYLTPLATHTLHNEAMEQPLTFL
FT                   SVWWEDMDSLAEAHSARATASTTDDRPVLLLPSFPTPNGELHLGHLAGPYLGADIARRA
FT                   LAATGTPVHLLLGTVGHQSQVAAAATAAQVSFHTLAEQNTDAIMAGLAAAGAEWDVFVR
FT                   PTSPEYPALARRVFERLRDDGVVLTRTTPTHHCPHCDRFLFEAFLAGACPHCGSYDTAG
FT                   IECESCALPFADTDLIDVTCATCGSPAERRPLTRYFLPLEPLRDRLTAYLRTVRMGSRL
FT                   AGYVDRVLANRLPDMLVSIVADDGIEVPGTDGQRLYSAFELAARYLTAVDRLARDQGES
FT                   GWESYLTGRRPRTVLFFGFDNAYLRTIVFPAVLGAFTDLAQLPDTLVSNEFYELDGAKF
FT                   STGRRHAIWARDAFDDKSRDRLRLYLAATRPEYRRRSFSTAEYDLFVQHELVEGLDGWL
FT                   GGINARLDRHFAGAAPEAGSWIPEAEEFYGRIRALHAEAGSALGLGRFSPATAVAAVLS
FT                   FVAAGRRFGEVAEDILAAPTLTGPARTCMALELMAVRTVAEVLRPLVPGAADRLAGQLG
FT                   GVGTATNPEWVRPGTPARVSALFS"
FT   gene            complement(649360..650664)
FT                   /locus_tag="Sare_0571"
FT   CDS_pept        complement(649360..650664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0571"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: lpf:lpl1946 lysine N6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96499"
FT                   /db_xref="GOA:A8M129"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8M129"
FT                   /protein_id="ABV96499.1"
FT                   /translation="MNAPSETLDLVGVGIGPANLSLAALLHGNDRVTKTFVERRKAFEW
FT                   HAGIMVPDAQMQVHFLKDLVTPVDPTNPFTFLAFAVEARRLYRLLITGRSRVPRKEFEQ
FT                   YCRWAADRVEDLRFGVAVEHVEWDGSAFVVYTDDGSIRARNIVTGTGLVPRMPECAKGH
FT                   DPEQVFHTSQMLDIPRDLSRRRVAVIGGGQSGAEIVHYLLGSEARRPTRIVWGSRRPNL
FT                   FPLDNSPFVEEHFLPNYSRHFHAQPADRRDLLNEQQRMSSDGVSVELLRAVYRRLYDLE
FT                   LLEGVERPCEVMVDHQLLGIERDRGGLLTTWRAGSGESVHKQVDVIICATGYRRGLPAV
FT                   LEGMRHRLPQPDEFGVRADFSLDWDGPPDNRIYVQNAARRHFGVADPNLSLLAWRSAVI
FT                   ANSLLGHRRYDTDVVSGAVAWSFAEERRPAGAAGA"
FT   gene            complement(650661..651827)
FT                   /locus_tag="Sare_0572"
FT   CDS_pept        complement(650661..651827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0572"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   rha:RHA1_ro08656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96500"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M130"
FT                   /protein_id="ABV96500.1"
FT                   /translation="MKAAQFGCGKMGAGAAYALATDPATTRLTLVDRDRARAEETARLI
FT                   APYATCRIVVSSDPDTAISGQDILTMALPWAATRHLIEEAARGGRPVASITRPPVEQLD
FT                   TLHTVARAGDSSLLLPIGLEPGLTELLAASLAERLDHTTAVEIFCGGIPREPREPIGHV
FT                   TFFGGENAHHLPIAQRDAYAAATGQIIRLPRFSGLEQRSFRGVGNLQAFHDGMVPWLCE
FT                   HPALDRADCTQKTVRWPGFGEAVTELARLGLLAEEPVDLDGTSVVPRRLTERVLAPQLV
FT                   AGARDNDLVVLDVAVQGTIAGRPAHLRTELRDAHDPATGLSAMARTTGFTLAAAGVLLA
FT                   EDAIGGTGWLVPHLTIRGDVRKRLFRSLARHGISITSTSDQPPREETR"
FT   gene            complement(651850..653112)
FT                   /locus_tag="Sare_0573"
FT   CDS_pept        complement(651850..653112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0573"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201; KEGG:
FT                   rha:RHA1_ro08658 possible dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96501"
FT                   /db_xref="GOA:A8M131"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR041472"
FT                   /db_xref="UniProtKB/TrEMBL:A8M131"
FT                   /protein_id="ABV96501.1"
FT                   /translation="MEKRQVLFVNLRRIEREGLESLLAARRLGYEVVLLGRSLPPFAAP
FT                   LVTAFYQVDTYDRATALAAARDVAGRYDIAGVPSFTEVDVQLVAAIAAELGLPGMTTDA
FT                   ALKARNKYHMKQGLQDMRDVLPTYHRVRNLTELRTAVRDIGLPAVIKPTGASGSKGIFE
FT                   LRDDEDLEAAVEQLEKIARPQFDAVFQQFGAEFIVEEYLEGEELSVEGLIAGGEPHVVM
FT                   VTDKLTSAPYHLELQHVMPSALPSDVLAEVQATTVQIVSALGFDNCAFHLEAKWGPRGM
FT                   KFIEVAARPAGDYIVSHLVPLSCGIDYFANVVRIAVGAPLELEPDRDLQAGLRFVLADR
FT                   SGRFEGLGGIEDVCADPGYPYLFLEHPVGTEVTLPPASFGLQRVAAVCARHVNRAGLDA
FT                   LLSDVDRLVSARVTVAETALA"
FT   gene            653419..654639
FT                   /locus_tag="Sare_0574"
FT   CDS_pept        653419..654639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0574"
FT                   /product="Phthalate 4,5-dioxygenase"
FT                   /EC_number="1.14.12.7"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   reu:Reut_B4795 phthalate 4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96502"
FT                   /db_xref="GOA:A8M132"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8M132"
FT                   /protein_id="ABV96502.1"
FT                   /translation="MTTSKMNDQLTRVGPGTPMGRLLREYWMPVMRSGRLTEPGGAPMA
FT                   VELLGEKFVVFRADDGTLGCFAEACPHRGASLTLARNEDCALRCIYHGWKFSVTGQVLE
FT                   TPSEPAELTRFASRVKLRHHPVIESGGVIWVWIGGTGRSAPAPPAFTFTKLPPEQVFGL
FT                   VAVVECNWLQGLEADIDSAHVSLLHETEARAGALRDLLDDRTPRDEIDEQPYGLRFGSV
FT                   RTLSSGAELVRVKPFAMPWYTVVPELPSGDRLWHAWVPINDHRTIMWYLWYNEERPVDP
FT                   AVFADQFGLNLDTMNPDNIREGFTRENNWGQDRRQMRENQSFSGIRGLVLQDIAVQESM
FT                   GPIVDRTGENPGRSDTAIVATRRYLLDAIKRHERGETPPGLGPEADYDRVRSAEITLAP
FT                   GVDWRSA"
FT   gene            654636..656267
FT                   /locus_tag="Sare_0575"
FT   CDS_pept        654636..656267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0575"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bxe:Bxe_C0508 putative dehydrogenase flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96503"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8M133"
FT                   /protein_id="ABV96503.1"
FT                   /translation="MSNPGELTEEADVVVVGSGGAGLLAACVAADTGASVTVVESTDRL
FT                   GGTTAVSGGMIWAPGNPFMADLDQTDSRVDALRYLDQVTEGAVRRPTIELFLNTITVTV
FT                   DYLLTRTPLRLAAIDRPDYHSEWPGARVAGRTLDVVPFPTADRPGLLDRIRAGAHFAPL
FT                   MTYDERHRWRWPGTRDEDLLARRERDGAVAVGTGLVAALVAACDDRGVRFCTRTRATSL
FT                   AVRDGRVRGVRVDRPTGPALLHARRGVVLACGGFEWNDQLKQAFLREPETVAVSPPGNR
FT                   GDGLVMAMRLGAAVDSMAQGWWVPVVSDPDEGYDGAPLYRHLVGERCLPGSIIVDWRGR
FT                   RFVNEAVNYNDLTRALHAFDPTTHRPAHAPAWLVFDEAFRRRYPVGATQPHRPAPAWFL
FT                   RGESLADLAKVADIDPGGLEETVNAFNVHARRGVDPDFGRGSSAHDRYYGDDRQPGNPC
FT                   LAPLENPPFYAVELRSGMLGTKGGLRTAPSGEVLRHDGTAITGLYACGNVAGGPMGPGY
FT                   PGSGGTLAPALAGGYRCGRSLGEAAR"
FT   gene            656264..657361
FT                   /locus_tag="Sare_0576"
FT   CDS_pept        656264..657361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0576"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sen:SACE_2961 fructosyl-amino acid oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96504"
FT                   /db_xref="GOA:A8M134"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8M134"
FT                   /protein_id="ABV96504.1"
FT                   /translation="MNVVVVGAGAIGTCAAYRLACRGMAVTLVDAQDPQRSLSAHSFAW
FT                   VNAVDDGSAPYFALSREALAAHRRLAGEVRGPCWFWPTGNLVWADSPATSRNLIAAAES
FT                   YRSKGYRAESCTASQARTLEPDLNLGGQADPIVFYPEDAHLHPDLFLTEVQGAARRQGV
FT                   RLLLGDAAVGIENHTVRLASGVRLHGDVVVCCAGRGTGDLLAEARHAVPLVEPDDPEIT
FT                   TRGLLVRTSPVPSGVTVRRVLHAPGLSIRPHHGRRLVLHSHDVDHTLPADVPTAAVGVL
FT                   ARLADVVPAAEGVTVESAFVGVRPMPLDGRSVVGWLPGSDRLYVVVTHSGLTLAPVLAE
FT                   IVAREVSGERHELAEAFRPERFAAA"
FT   gene            complement(657374..658552)
FT                   /locus_tag="Sare_0577"
FT   CDS_pept        complement(657374..658552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0577"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mag:amb1486 adenine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96505"
FT                   /db_xref="GOA:A8M135"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8M135"
FT                   /protein_id="ABV96505.1"
FT                   /translation="MATLAVTRVGTLFSGVLEAPQIDDADTLICRDGMIAAIGTAAELT
FT                   AEIAGADQVLDVDGATVAPGLIDSHGHPTLGDYTPRQKAVDFLDSYVHGGVTRMISAGE
FT                   VHVPGRPRDREGVKALAVTARAVFENIRPGGMRVHAGNVLLEPTLTEEDFRHLVRCGVW
FT                   LAKFGFGAYADPLDAVDQIRIAKSCGLLVMCHAGGVSAAGSAALRAAEIIKLGPHVCGH
FT                   ANGGPTAMPDTDVDRLLYDTEMALQVVQAGNLRSALRLVRRAEAAAVLHRVVVGSDTPS
FT                   GFGVMPLAVLKTVVELSALAPLEPAVSWALATGNVAQVWGLPAGRVRVGAAGDLVVLDA
FT                   PLGGIASDAAEAMRNGDMPGITAIVTDATVRALTSRNTPKARRVATLATGGH"
FT   gene            658682..659650
FT                   /locus_tag="Sare_0578"
FT   CDS_pept        658682..659650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0578"
FT                   /product="SAICAR synthetase"
FT                   /note="PFAM: SAICAR synthetase; KEGG: hal:VNG1939G
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96506"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A8M136"
FT                   /protein_id="ABV96506.1"
FT                   /translation="MKQWSTKDLHVLEPATGGRAGDAVLTFTDRYSVFDHGVMPDLIPG
FT                   KGRATCAMAVLSFGLFERAGITTHFVEQVAEDAIRIRLLGLDLTGSRRTGPAQLIPLQI
FT                   VYRRQLRPESSVHRRVATGAVDPASIPPMEPETGRLDPVMVEFTSKFEETDRFLDPAAA
FT                   TRVGHISPADLTGLTEQARRVCAAVDEHCVRVGLTLVDGKTEYGFDEHGDLMLVDHAGT
FT                   PDENRFYFEDTPVCKELLRALYPELRERVQGWVRDGLPRSRWPRPQPLGPDLVAAVAEV
FT                   YAAVAQVWVTGASAARARLSAAVKTYLAGCPSVEPQREHRR"
FT   gene            659647..660660
FT                   /locus_tag="Sare_0579"
FT   CDS_pept        659647..660660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0579"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase family"
FT                   /note="TIGRFAM: beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase family; KEGG: mba:Mbar_A0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96507"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A8M137"
FT                   /protein_id="ABV96507.1"
FT                   /translation="MIGRTVQVRGSARLSFTLINLDAASLRRNGIAAMAVQRPGLTVRM
FT                   RASRGATSRVLGVEPETAADLLAALATLEKLWDGPPVTVTVPRPLPQHSGFGSKTAGLL
FT                   AVGRAYGALCGHDPALPQLSEILGRGRTSGASTGLAEFGGFLVDGGHRNPPDFAASPAT
FT                   YLRPSRFAQPVPVPKPIVKLPFPPWPVLVLMTNGRHLGGAEELAWFQRVTPIPQEQAQR
FT                   TAQLVFMGLAPAVAEHDYEGFCDAVNEITFTSHFKREQIAFQGRAVEDVLTAGRDSTAI
FT                   DAIALSVTGPACFAFTRTPEAARGWAQSLMRRGAIRDFWFTEADNCGLTVGHVPHR"
FT   gene            660667..662097
FT                   /locus_tag="Sare_0580"
FT   CDS_pept        660667..662097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0580"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="KEGG: sen:SACE_7153 adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96508"
FT                   /db_xref="GOA:A8M138"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A8M138"
FT                   /protein_id="ABV96508.1"
FT                   /translation="MSDKHDIPNVLAERYASPEMVELWAAQHKVVLERRLWLAVLQTQA
FT                   DLGVDVPPGVVDRYRAVAEQVDLAAITERERVTRHDVKARIEEFNRIAGHEHIHKGMTS
FT                   RDLTENVEQLQIRDSLRLVRRRCVAVLARLARLATEHSGTVMAARTHNVPAQPTTLGKR
FT                   FAGVSEEMLLALGRLDELLEAYPARGIKGPVGTGQDMLDLFGGDHERLARLNDRVAVHL
FT                   GFTRVTTSVGQVYPRSLDWAVLSLLVQIAAGPSSLAVSLRLMAGHDLVTEGFAEGQVGS
FT                   SAMPHKMNMRSCERINGLMLVLRGFAAMAGELAGSQWNEGDVSCSVTRRVALPNAFLAL
FT                   DGMLETLLVVLDEFRAFPAVIDAELERYLPFLATTRMLMAAVRSGQGREAAHGIIKEHA
FT                   VRCGDRLRAQGGDNGLLESLGADERFPLRRPALEALLADRLVFTGAAGEQVTKIVQRIE
FT                   AEVAAHPDAAAYRPGPLL"
FT   gene            662185..662742
FT                   /locus_tag="Sare_0581"
FT   CDS_pept        662185..662742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0581"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mxa:MXAN_1246
FT                   hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96509"
FT                   /db_xref="GOA:A8M139"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8M139"
FT                   /protein_id="ABV96509.1"
FT                   /translation="MHNTTTAPIAALLAGYRPRTSTEASDVERLLGLLTSGDPWSRDLP
FT                   LHVTASALVVHPPTRRIMLRWHARMQAWLQIGGHGDPGEHDPIDVVLREGREETHLDDL
FT                   VCWPDTSIRQVAVLPVPASPDEPAHEHADLRFVLATETPARARPEKPTATLRWLSLPEA
FT                   HAITTEPNLHELLARVAELFDQ"
FT   gene            662769..663479
FT                   /locus_tag="Sare_0582"
FT   CDS_pept        662769..663479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0582"
FT                   /product="SAICAR synthetase"
FT                   /note="PFAM: SAICAR synthetase; KEGG: mth:MTH170
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96510"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A8M140"
FT                   /protein_id="ABV96510.1"
FT                   /translation="MSSPTLPTGRPDITGRSKKVWFVEPGRCVVEMIPSLRSFTHDRDE
FT                   LMDGTAELRLDFFEYVSGVLAKAGVPTVFRERLGPITYLADYRPAVPFEVIVKNRATGS
FT                   TTRKYPGLFEEGRVFAPPVVKFDYRTDPEDQPIGEDYLRRTGVDVEAYRRLALACNTVL
FT                   HTLVSPLELWDFCLVIAPDEERGLVINSEISPDCMRLRRADGEPYDKDLFRRGASREQI
FT                   IERWTELMGLVRHG"
FT   gene            663472..664161
FT                   /locus_tag="Sare_0583"
FT   CDS_pept        663472..664161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0583"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dra:DR_1467 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96511"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8M141"
FT                   /protein_id="ABV96511.1"
FT                   /translation="MADRLALVTGANRGTGRAVRNRLIADGFTVRCLNRTSCADHVDPV
FT                   LVDLRDGDTVQRGALAALDGADRLDVLVLNAVTRGFGRLAELSPAAWDEAVAVNLTSVF
FT                   RLTQAVLPMLRTAGGHIVIMGSHAGVRPFEEGLVYCATKAALRSVAEVLLMEERQHGVR
FT                   TTLVNPGAIRNFPDDFATTKMSVDSVASVVSWAVATPPDTVLGEIELRPALLDPPPVTG
FT                   LDRLQYV"
FT   gene            664181..664555
FT                   /locus_tag="Sare_0584"
FT   CDS_pept        664181..664555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96512"
FT                   /db_xref="UniProtKB/TrEMBL:A8M142"
FT                   /protein_id="ABV96512.1"
FT                   /translation="MTVRAPNAIWQEDTAVLHVVLSGDDGRRPTRTVSLSLLCWVNLDS
FT                   AGEVCGVDVHDLPPELTDAISNYTGDDIIGRTLVNDGWLWIPLSGNSTQRRHTGVADID
FT                   LVLDEEGLAALAVRFERKPH"
FT   gene            664552..665733
FT                   /locus_tag="Sare_0585"
FT   CDS_pept        664552..665733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0585"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV6684 transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96513"
FT                   /db_xref="GOA:A8M143"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8M143"
FT                   /protein_id="ABV96513.1"
FT                   /translation="MSYLDLLRSPSVARLLLAAIVGRLPTSMVALALTLTLREHGVEFR
FT                   FIGVALAVLTVSHAVGGPALSRLVDRRGQTTVLTGAAVVSSAAVVAAALQPSNRTVVLV
FT                   GMAFAGFATPPLEPCLRALWPGLVGQENLQRAYSLDSVGQEVIFVTGPMLVAVTVAVWS
FT                   PAAALMLTAVLCLLGTMVFASSVPSRQWRGVPGSAGLLGPLRSPLLVVLLLGVAGTVVP
FT                   IGALSIVLVSYAEQNAVWGGASVLLVVSASGALIGALTMGRIQWKTAATTRIVVFSACL
FT                   GAAYLLVATLAPAWAMAAIVFVAGFFLPPLLVIAFSLIDELAPPGTIVEAFAWLVTLFA
FT                   VGSGAGSAIAGAVQDVAGTREAAATTAGLAFVGTVLLVLFRRAHTARVPTLVS"
FT   gene            665733..666551
FT                   /locus_tag="Sare_0586"
FT   CDS_pept        665733..666551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0586"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase type 3; KEGG:
FT                   fal:FRAAL6592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96514"
FT                   /db_xref="GOA:A8M144"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8M144"
FT                   /protein_id="ABV96514.1"
FT                   /translation="MSRLLGLDLDGTLLDPDGTVTARVAEALQRAVDAGFAIAILTARP
FT                   ARDVPASVRDRIPTAACWAYSNGTLVQATGDARPRRLAGLAPHTVRWLLHELTAVAPDW
FT                   TFAADLADATVARVPFPTRETRPWNNVRHVAELTLTEPASKILVRTGAPVGPAEVARVQ
FT                   EVIRDRGEATASGGWYVEINPTGAGKAPALRWVATALGVPMRQVTAVGDGLNDLPMLAA
FT                   AGRSAAPANATEAVRGAVDHLLPGNHEDAVAVLVDLLLAGDGARPAAVAD"
FT   gene            666565..668436
FT                   /locus_tag="Sare_0587"
FT   CDS_pept        666565..668436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0587"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: sco:SCO6488 acyl-peptide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96515"
FT                   /db_xref="GOA:A8M145"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8M145"
FT                   /protein_id="ABV96515.1"
FT                   /translation="MPIQAPYGSWPSGWQAADASRGHSVVDWVGFAGSEVWWVAADAGD
FT                   GRNHLVRPGADGRPEDVLPGDWDVRTAFMEYGGRPWVFLGTGGAVFVHWSDQRVYRWTP
FT                   EAAVRPLSPRSDRYRYCDFAVRGDEVWCVRETTGGEVRRDLVALPLDGSARIRVLAATH
FT                   DFLSGPRISPDGGRVAWLGWNHPDMPWTRTAVMVANVDPDGSLVGLRRLATGADESVTQ
FT                   IEWTSDGAALLVVSDRSGWWNVHEVSGDGRWRARCPRAEEFGEALWRIGASTCAALTGG
FT                   GLAAAHGTGVRRLGLCDADGGLVDVDDGFTDWRSVVSDGRRVAAVAAGPRRSRSVVLVE
FT                   QGCTRVLWSSPGALASYASVPMLRTYQGVHAHVYEPHHPGYAGPPGEPPPYIVQAHGGP
FT                   TSRGVPVADAVTTYFTSRGIGVVDVQYGGSTGYGRAYRDRLRHRWGEVDARDCATVARG
FT                   LVAEGRADPSRIALRGASAGGWTALRSLIDDPDLYQAAVVYFPVLDARSWAKSTHDFES
FT                   RYAEWLIGPWPQERGRYESRSPAAAVERIRTPLLLMQGARDAICVPEQADQFARYLASI
FT                   SVPIRYLRFHAEAHGFRQADTVARCLNAELDLYAKALRFPLPVEARA"
FT   gene            668503..669156
FT                   /locus_tag="Sare_0588"
FT   CDS_pept        668503..669156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0588"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="PFAM: ATP phosphoribosyltransferase catalytic
FT                   region; KEGG: fal:FRAAL6590 ATP phosphoribosyltransferase
FT                   (ATP-PRTase) (ATP-PRT)"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96516"
FT                   /db_xref="GOA:A8M146"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:A8M146"
FT                   /protein_id="ABV96516.1"
FT                   /translation="MTRTLRIAMPNKGSLAPGSRQLLTAAGFDLCGVGPRLFYTDQDND
FT                   AEILSLRARDIPEMIAQGYVDAGITGRDLVADSGHELSEMLTLGFGRSTVRVAAPHGHV
FT                   DNVRALHGKRVATTLPSLTARHLAGLGVRATVVAMTGAVEGAVHLGVAEAVVDVVESGR
FT                   TMAAHDLRVIGAPLVISEAVLVALPAATGAPELRRLAERLGKVLPTRGTVGAFG"
FT   gene            669198..669893
FT                   /locus_tag="Sare_0589"
FT   CDS_pept        669198..669893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0589"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: stp:Strop_2976 haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96517"
FT                   /db_xref="GOA:A8M147"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8M147"
FT                   /protein_id="ABV96517.1"
FT                   /translation="MRRSDGQTLIFDADDTLWENNVLFENVIESFIEWLAHPTLDRAQV
FT                   RTILDDIEAANAVTHGYGSAMFLRSLHDCFERLRERPGSPQERQEIEELARALLDRKVE
FT                   LIPGVTETLAELQSRHRLLLFTKGHPEEQRHKFELSGLERLFAGVHIVEEKKTADYLRL
FT                   IADNELDPGVTWMIGNSPKSDIIPARQAGMNAVFIPNDNTWVLEHEILDPADEKVLTLA
FT                   CFPDLLGHF"
FT   gene            669922..670803
FT                   /locus_tag="Sare_0590"
FT   CDS_pept        669922..670803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0590"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: fal:FRAAL1505 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96518"
FT                   /db_xref="GOA:A8M148"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A8M148"
FT                   /protein_id="ABV96518.1"
FT                   /translation="MTDAPIGIFDSGVGGLTVARALTDQLPGEDLVYLGDTAHVPYGPK
FT                   PIADVRRHALACLDQLMDAGAKLLVIACNSAAAACLHDARERYSVPVVEVIRPAVRRAV
FT                   AATRNGRVGVIGTSATITSGAYEDAFAAAPHITVTGVACPEFVEFVERGITSGSALHSI
FT                   AQRYLTPLRASGIDTLVLGCTHYPLLAGLLNLVMGNGVTLVSSADEAAKKVYRLLTEGV
FT                   VPRRADDESRPARHRFIATGDPAPFERLTSRFLGPTAARVETLSATSRHDNGSGDACQP
FT                   LESPAPPRQRLP"
FT   gene            complement(670744..671259)
FT                   /locus_tag="Sare_0591"
FT   CDS_pept        complement(670744..671259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0591"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ret:RHE_PF00197 probable nitrilotriacetate
FT                   monooxygenase component B protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96519"
FT                   /db_xref="GOA:A8M149"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8M149"
FT                   /protein_id="ABV96519.1"
FT                   /translation="MPEQAHPAVFTRPIDVAGFREAMSTMVAPVTVVTARDALGEPFGF
FT                   TASAVASLSLEPPLLLVCADRRAGSHDPLVAAAHFCVNVMGANGKNLALRFGSHRSDKF
FT                   DNVETEESFGGTPSLPAALSRIFCTVHGLRDGGDHTIVLGRVTAFQRRSGEPLAWWGRG
FT                   FQRLARVP"
FT   gene            complement(671294..672655)
FT                   /locus_tag="Sare_0592"
FT   CDS_pept        complement(671294..672655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0592"
FT                   /product="xenobiotic compound monooxygenase, DszA family, A
FT                   subunit"
FT                   /note="KEGG: mjl:Mjls_2559 xenobiotic compound
FT                   monooxygenase, DszA family, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96520"
FT                   /db_xref="GOA:A8M150"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8M150"
FT                   /protein_id="ABV96520.1"
FT                   /translation="MSVQRTLHLGLMFWATGTHAAGWRHPDAQADAAYDIELLQEVSRA
FT                   VERAKFDFVFLGDRLAIDPALQYSNPAQISRLEPFTTAAAIAAATTHIGIVVTANPTYS
FT                   DPYGIARLLASLDQLSGGRAAWNLVTGADSAAALNFGREAYWDTEKRYDWAEETLQVVR
FT                   ALWDSAPDLDGTGGRPIHHRGAYFSVDGPLDVCRPPQGQVVLLNAGTSDRSRALGAREA
FT                   DMVFAGPQPTLAARREFYADIQTRAARYGRVDHVTVLPGLTPIVAPTTEEAVARYDQLN
FT                   SLLMLAPEEEVGELVRAGGIGEGYRHNRTSASRLFGVDLRRYDLAAEVPAETLAAVSEE
FT                   GRRRLAEITRLTRRTANGPNRITYGDLVHATPTQLAHTVVGNPYEVADVIQEWFEERLA
FT                   DGFNIYPSQVPGSVTDFVELVVPELQRRGIFRKDYPGTTLRDHLGLPVSPRRSV"
FT   gene            complement(672662..673678)
FT                   /locus_tag="Sare_0593"
FT   CDS_pept        complement(672662..673678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0593"
FT                   /product="putative monooxygenase"
FT                   /note="KEGG: bbt:BBta_2529 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96521"
FT                   /db_xref="GOA:A8M151"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8M151"
FT                   /protein_id="ABV96521.1"
FT                   /translation="MSGGVDLTIGYELPDTGLMGSPGALVAAARAAETAGVDYLVFPDR
FT                   PATATRRAGPPAAVIAAPWIAAQTSRIGLVVTGSTAYHEPYHLARMVASLDHVSAGRAG
FT                   WQVVTGPDHLADANHRREGVDPAARREDRAAEYVPVVRDLWDSWEDGAFVRDKATGQFL
FT                   DEDCIHVLDHVGPTLHVRGPLNLARPPQGHPVVFASVTDRPVAPTADVLIVGDRAPERG
FT                   ADADQPHVLAVVPFVGRTGEHAAELHARAGAPRGDHERAVVVGDPDEVTEHLSRCAVAG
FT                   FTVRFPDPSQVAVFTDEVLPRLRPAPSGRSDVLRDRLGLPPAANRFTAEAATGAERS"
FT   gene            674403..674475
FT                   /locus_tag="Sare_R0011"
FT                   /note="tRNA_Arg1"
FT   tRNA            674403..674475
FT                   /locus_tag="Sare_R0011"
FT                   /product="tRNA-Arg"
FT   gene            complement(674801..676543)
FT                   /locus_tag="Sare_0594"
FT   CDS_pept        complement(674801..676543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96522"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:A8M152"
FT                   /protein_id="ABV96522.1"
FT                   /translation="MLRQLSASDPRFKTIDLHDGLNVLVADTTSTSRDTDSRNSAGKSS
FT                   MIELLHFLLGGGGDKNSLPAHRQLRDTTFGLRLDWPGIPDGLRVQRSASRTTAISLRPM
FT                   PPGAAPDQLDLGAGEIQLPEWQRLIERDLFRLPTEHPGVSGRALLSFLMRRISSHAFNG
FT                   PTRTHSRHSDAEGTTNLAYLLGLDWQLADRYRTLKARETTSKQLRNAANDPILGRIVGK
FT                   ASELRGQIAVAEHRVNEVERQVAGFRVVPEYENLRRRADEMDQRIRALRNQDVLDRRNL
FT                   ADLEKAVEEAVDPDIAYLESTYAELGVVLSDQVRRSFADVEAFHNSVVRNRRRYLGEEA
FT                   ALIRTRLTEREAERERLGTELATVLRALNEGGALDALTTLQQVLAQEQAMLAALRHRYE
FT                   AAQALEASRRSIATDRIALQQATEADIDERRRIVDEAVVLFAEFAQTLYGEGREAYLRF
FT                   SPGDSSLRIDPHIASDNSGGIGNMVIFCFDLTVAVLGHRGRRAPNFLVHDSHLFDGVDE
FT                   RQVARALTLAAEVARREQMQYIVTLNSDELDKAVRRGFDPTGRVLEQRLTDAYESGGLF
FT                   GFRF"
FT   gene            complement(676518..676787)
FT                   /locus_tag="Sare_0595"
FT   CDS_pept        complement(676518..676787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96523"
FT                   /db_xref="UniProtKB/TrEMBL:A8M153"
FT                   /protein_id="ABV96523.1"
FT                   /translation="MIVPTKGITPQRSLLAVGAQILQNLDRPMTVSQAWATLRHWRHTH
FT                   GHHAPVPFWWFVLALDALFALGVVDLEDELLVARRVDAAATQRL"
FT   gene            complement(676784..677707)
FT                   /locus_tag="Sare_0596"
FT   CDS_pept        complement(676784..677707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96524"
FT                   /db_xref="UniProtKB/TrEMBL:A8M154"
FT                   /protein_id="ABV96524.1"
FT                   /translation="MYVKFVYRELMVSLHGDAFEDFFHRLMSARYADFVQVRTHGNLGD
FT                   LGADGLRLHNGRLYACYAPEVFDAVKVGGKFGGDLAKALRKRPGEFKAFVFVYNDARGL
FT                   HPEVTRLLAQARRDHPAIEFEPMGPPHLLRKLFDLLRHEIEDLLRAPIQVENLVYGVGL
FT                   EDLAPLLQHLVENRRRANGRAAPHEVSALKIDYNALSDDDQEMLRLGMRHTHLVEQYYQ
FT                   GVTDVTERDEVAADFNAYYRQMAEQHQNPDEVVTELQKYVAGNQRGRAGMEIALWVVLA
FT                   YFFETCDIFQEPPPGWQPSAAHAVPS"
FT   gene            678182..679609
FT                   /locus_tag="Sare_0597"
FT   CDS_pept        678182..679609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV5887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96525"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8M155"
FT                   /protein_id="ABV96525.1"
FT                   /translation="MAPKSGASDGPNTLLSDARRRLLSPSGSGRRMSRQEVAEAVNNYL
FT                   WDNYGTRTSMDANHVGKLERGEHRWPKPTTREAFRAVLKASRDAELGFYITRGQRHTDP
FT                   VVHQMRPGERLTPDDDHAGESLTGGEITDTGDMNRRELLRLLSLTGALLAAPVPGSQLD
FT                   WARIESSGDGNRRLDPATLDEYEGLNALLWAAFGAAESKAAVSPLVNRQLTTLTVNLRR
FT                   SHTTPVHRRLCGVTADLLQLAGEVAFDANAYSEAAHCYTLAATAAREAAAYDLWACAMI
FT                   RHAFISVYERDFRHAAPMLAVAADLAQNGDSALSTRHWARTVQAQALAGLGDLGGCRRA
FT                   LDQAEEVNHLPGQVHNGGWLRFDGSRLAEERGACYVELRRPDLAEPVLSGALSQTLSTR
FT                   RRGTVLTDLALVGVQRSDVHQIVLYGSAALDTARQSGSGVVGSKLNQLHHRLQPFLADT
FT                   HVRHLNRQISALTRAGN"
FT   gene            679611..680006
FT                   /locus_tag="Sare_0598"
FT   CDS_pept        679611..680006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV5888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96526"
FT                   /db_xref="UniProtKB/TrEMBL:A8M156"
FT                   /protein_id="ABV96526.1"
FT                   /translation="MTRGRTSVQVEEPGRVFREAWIAGVRKHYPGAPKPGYVTPWEDTP
FT                   EWERESAAAVYEQVRQFIEVADGATTKLTREQKGRFVALCWIVQIFKHFASPKASYVAD
FT                   WSDMPEWHQETNSDIFEHIEQALVSTR"
FT   gene            complement(680120..680329)
FT                   /locus_tag="Sare_0599"
FT   CDS_pept        complement(680120..680329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0599"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   stp:Strop_4235 protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96527"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A8M157"
FT                   /protein_id="ABV96527.1"
FT                   /translation="MTMHPEKFTNWRKSSRSGGGDNCIEVAVALDGTVGMRDSKDRTGP
FT                   VLGFTRGEWTAFTDAIRDGEFDAY"
FT   gene            complement(680326..681201)
FT                   /locus_tag="Sare_0600"
FT   CDS_pept        complement(680326..681201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0600"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   stp:Strop_1133 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96528"
FT                   /db_xref="GOA:A8M158"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8M158"
FT                   /protein_id="ABV96528.1"
FT                   /translation="MISPYVRRRRLATELVRLREEHGYSAERLCKEAKIAKQKLSRLEN
FT                   ARVRPDQDEIMRVLDHFRVDEKRWEEIMAIARESQENGWWEKFRVEMGPRQALYADLEA
FT                   GAEHIAEYHITLLPGLLQIPAYTEVRAVADRAAYPTRFTVERALEARAARQRVLDRPGG
FT                   PTYEVIIDELAIRRHAAPPEIVRAQLDHLINVGHDKQKTTIRVLRLTARIAGNAVPRSS
FT                   YFSYRYPDPSDPVVVAVDTITSDLVLTDPDEVANYASLYERLRSAALSPADSLDFLASV
FT                   AEELPDYTRR"
FT   gene            681511..681852
FT                   /locus_tag="Sare_0601"
FT   CDS_pept        681511..681852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96529"
FT                   /db_xref="InterPro:IPR027575"
FT                   /db_xref="UniProtKB/TrEMBL:A8M159"
FT                   /protein_id="ABV96529.1"
FT                   /translation="MDATSADRHPAYLRPLPAVTAKEGVAAGRPNVASSHGRRSTKADR
FT                   SASQRAGSCGGYLPTIIPVPLEASMNSLLAVSNDPFELDVQIVTEGPVAAALLADTDDG
FT                   CDTVKGSDC"
FT   gene            681963..684992
FT                   /locus_tag="Sare_0602"
FT   CDS_pept        681963..684992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0602"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   sco:SCO6930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96530"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8M160"
FT                   /protein_id="ABV96530.1"
FT                   /translation="MFRSVDAATIRIAAHSWPDSPAPWPGRSGASGIAYWLQATWRKVG
FT                   LAEAVWAASPEFAARVEAVLASGSAAPDRGWRMALALARYLVRAQRRATPFGLFSGVAT
FT                   LRFDTVAAVVPAGQPAIRVRPDASWLASLIARLEADPDVHRRLPVQANNLALVNGSRIV
FT                   GARRPHASARTESTSVRSTAAVRLAMSLTPTPLPWAELVDAVAAAFPGFPRASADAMVA
FT                   GLVDHGVLISALRPPSTCTDPIRHVLDTLDAMFDGAPGGQRALRAELRSLHDRLGGTSA
FT                   GSTTYLCGLADDMRRVAPATQPLAVDLQLADQVALPEQLAAEIAASVEVLRRLTPDPAG
FT                   RPEWCAYRARFVDRYGMTAVVPLARLVDPLVGLGFPAHFATVADAPVALLSDRDERLLA
FT                   MAQQVVIDGAREVVLDDAAVEWLAGTGRVTGSVSPHVDVSAEVRAVSLEALTQGRFTVA
FT                   LTGMGRSAMATSGRFLDRLPYADRELMCREFARLPVAVAGAMPAQLSFPPRKLHSQNVL
FT                   NSRQVLPWLVSLAEHRHVAENVIGLDDLGVTAGCDRLVLVSMSRRRVVEPTVGHAAAVH
FT                   TMPLLGRFLLELPRATDARLKPFDWGAASCLPFRPALRYGRVLLAAARWRVDPAALPGA
FT                   EAGDDEWLTAWEALRTRLRLPAWVQVGNGDQRLRLHLDQSMDRALLRAHLDASAGPVTV
FT                   VDAASPEDFGWLSGRAHEIVVPVASTVAPAAAPAAVTARGAWPPPAPPEPIIPGASGLL
FT                   SASVAVEPSTMELVLMRGLPALFADWPEPPLWWFVRLRRSTPHLRLRLHTDDYGDAAVR
FT                   VGRWVAGLRQQRLAGDWSLDTYHPESGRYGCGTALAAAEELFAADSTAALAQLVAQPES
FT                   GIDRQALTALSMVDLAASMLGSRTDGCEWLVARPEQTGQAPIQRAVLRQAVTLDPGKLP
FT                   EPIQQAWQERSRAATRYAAELSAVAGPLTPASVLASLMHLHVVRALGPDEDAEQLTYRL
FT                   ARHVALAAVRRRVRAVGASR"
FT   gene            684989..686251
FT                   /locus_tag="Sare_0603"
FT   CDS_pept        684989..686251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0603"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   fra:Francci3_1126 lanthionine synthetase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96531"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:A8M161"
FT                   /protein_id="ABV96531.1"
FT                   /translation="MTGKALRTPLLRAAEAMAACITDTLTEPPPPGFAADDYGPRSTRW
FT                   YAQSLSRGAAGVALLHGVRAQTGHGGWGPVHEWLRRATVDPLNNGSGAGLWFGAPAVTH
FT                   ALTMAMPHSRPAALDALDHALDDLVERRLVAATARLAARTRPSLSEFDLVRGLTGLGAH
FT                   LLRRAPDGHLLRRVLAYLVRLTEPVQTDDAAGRLAPGWWSADPADREGSEQGGHANVGM
FT                   AHGIAGPLALLALAMRQDIRVPGHAEAIRRICAWLDCWQQASPAGPWWPEKVTLAELYA
FT                   GRPSMGGPARPSWCYGTPGVARAQQLAGIALDDAARQEAAEEALTFCMADPRQLSRIVD
FT                   PSLCHGWAGLAATAWSAAADARTTSLQEQLPQIVRLLIQHATDTTPTRSGLITGPAGIA
FT                   LTLHTVATGTDVRWATSLLIN"
FT   gene            686266..687135
FT                   /locus_tag="Sare_0604"
FT   CDS_pept        686266..687135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0604"
FT                   /product="putative O-methyltransferase"
FT                   /note="KEGG: fra:Francci3_4466 putative
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96532"
FT                   /db_xref="GOA:A8M162"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8M162"
FT                   /protein_id="ABV96532.1"
FT                   /translation="MDFESEPDTEPPGVSPVSRRRQLNLIFPDWQTAEDYAATRLAPEL
FT                   TAAEDHRAIVAFWFIRKSETWRLRLLPGDRLAQVYALLAAITDDDRIRGVTEPIYRPEA
FT                   YAFGGDQAMTIAHTLFHADSRHILGHLATAGGTHRRELGVLLATRLMRAAGLEFSEQGD
FT                   VWRLLASRRHQANAPAPSPRLIAAVQRLITAADDTARSPLAITPQWPQAHEQAGTDLGL
FT                   LDRRGALTRDLREVLTHHLLFLFNRLGISAADTWLLATAAVTVTFHHPFDTHPAINPPP
FT                   RSEVGSTQ"
FT   gene            687132..688349
FT                   /locus_tag="Sare_0605"
FT   CDS_pept        687132..688349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0605"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fra:Francci3_4467
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96533"
FT                   /db_xref="GOA:A8M163"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8M163"
FT                   /protein_id="ABV96533.1"
FT                   /translation="MNTSPTAPGTSSAATLREQLASTLEQRGHIRSAAVAHAFRTVPRE
FT                   QFLPGVDLETVYTRRQIVTKRDPSGAALSSASSPSLVADMLEQLAPQPGHRVLEIGAAT
FT                   GINAALLAELTSPDGTVVTIELDQDLADGARVSLDRAGYDTVKVICGDGALGDPKHGPY
FT                   DRIIVTAGAWDIAAAWWEQLADHGRIVVPLRVHESGLTRCFAFDRTSPTTMVSTTTPLV
FT                   CGFVPMRGSTEHIDHHVRLDADVVLKLDATDQPDRAALAKALSHPRLERWTGIQASDAD
FT                   PIGHLDLWLLVHANKPFGRLGVGDTARTSGLVTPAYRWAGAAIYHGGTVAYLAFQDAGN
FT                   GHHELGAIAHGPDANTLATELTNLLDQWDEANRPNQLTVTAHRAGTRPADHGDISRADT
FT                   ILTISF"
FT   gene            688473..689597
FT                   /locus_tag="Sare_0606"
FT   CDS_pept        688473..689597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96534"
FT                   /db_xref="UniProtKB/TrEMBL:A8M164"
FT                   /protein_id="ABV96534.1"
FT                   /translation="MTPSRAATIAARFPLVARKRPPAKPLDARVNRLVRLAETAHRESD
FT                   PDKASMVFNGAALVASDCGDPNLARAWCRRHASLYLSRAPLNGYTARFALEPVVNLARL
FT                   SIRDGDGDGAYRLLTHLYTAIVGGTPAFLDGLEIHPRQLPADPEELSPIISWLRGTLLS
FT                   DGTRALTLAGRWDDAVTHVRRYDGIGPTLVDGRQVAIVAHLLRDEGPSAAALLAATEIE
FT                   APWEQTVHGLLKIWQELAVGTVAVDHADLIERVSAVPRTPGLAVFRVRLGLTALDLSVG
FT                   LPIDVVDNLTKQLVADAIHDEDAKAARDLINHPAVEVEHQEALRPLLKASGLDQGSLPA
FT                   RAIDPFSVALDLAGAVIARQRDRGRGAGLHARTQ"
FT   gene            689769..690077
FT                   /locus_tag="Sare_0607"
FT   CDS_pept        689769..690077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96535"
FT                   /db_xref="UniProtKB/TrEMBL:A8M165"
FT                   /protein_id="ABV96535.1"
FT                   /translation="MSTTYLASVALEEVERAQAELERHLTVRPSGECVTCGEVEPCSGR
FT                   QEAGTTIIKYGLLPRRRPGASGVRRAASTTVGAAPTSWFASATDGDGHELPGTESEA"
FT   gene            690411..690845
FT                   /locus_tag="Sare_0608"
FT   CDS_pept        690411..690845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96536"
FT                   /db_xref="UniProtKB/TrEMBL:A8M166"
FT                   /protein_id="ABV96536.1"
FT                   /translation="MQAQRAPRIRAWGLQLVTLNGTSADAVGTVGEGEQATGTEAVRRG
FT                   RRTADGDGGVVLVGADGLAGRGADGVTDRPGRRMGARTGRAGAPHHKAISSTARGGRPG
FT                   HALQQKMILFKWAKILCNLSLITLALHAAPVPPEVGTSGV"
FT   gene            690995..691366
FT                   /locus_tag="Sare_0609"
FT   CDS_pept        690995..691366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96537"
FT                   /db_xref="UniProtKB/TrEMBL:A8M167"
FT                   /protein_id="ABV96537.1"
FT                   /translation="MPKPSSTTPGDRPQPATDGLLLPPIHVPCTPDPEVPDGHGPSAPQ
FT                   ADDGRHRGVPTSPDRESPACGDGQSAEGTIACGDAPEVRFDVTVLDGEAGRRLAVLQAE
FT                   VVLDVLTWLHDQQHHAEPA"
FT   gene            691534..691689
FT                   /locus_tag="Sare_0610"
FT   CDS_pept        691534..691689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96538"
FT                   /db_xref="UniProtKB/TrEMBL:A8M168"
FT                   /protein_id="ABV96538.1"
FT                   /translation="MYATVTRDDTGRIVVYGPRDTPAIAPNDGAVIVPICSPGVADGTT
FT                   GALAEA"
FT   gene            691686..692153
FT                   /locus_tag="Sare_0611"
FT   CDS_pept        691686..692153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96539"
FT                   /db_xref="UniProtKB/TrEMBL:A8M169"
FT                   /protein_id="ABV96539.1"
FT                   /translation="MNIHPTTVLPRVAFYGRTVEASDLATAAFVVGGQYQQCVSVLPDG
FT                   AITAVFLDLGTRPDYRRAPATLILDNEREISRDGGLDALLTEANRPERRFDFVISTDVH
FT                   RLSRCTVTSTALLRTLAVAGIEFLHAPEIRDGVTDCQSCPGDYAASTTSRC"
FT   gene            692182..694152
FT                   /locus_tag="Sare_0612"
FT   CDS_pept        692182..694152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0612"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   stp:Strop_2909 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96540"
FT                   /db_xref="GOA:A8M170"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8M170"
FT                   /protein_id="ABV96540.1"
FT                   /translation="MTSTLPDWLRPPATTAPKRTIRVAFLGRTSTEEQQDPTLSIPRQL
FT                   TNSERALLPSMVIVAWFWDVESSRKELSQRGRGTAWQKFDIAVQRDGGLADMLDEATSP
FT                   DRRFDVVICESIDRIARWTHQGTKIEHDLELAGVPLLAADEPVMQSNSRKRAAQILLRR
FT                   TKQGVAEWYMIEMLEKSWDGFEEHTTQGWNVGKPPYGYLAEKHKHPVPAKRAEGKHKTK
FT                   LKIDPDRGPVVEQIYAWRIDEKLSYRAIAERLNTDPDRYPPPQPVDPTRAVGRWTGSAV
FT                   REILVNPKYTGHMVWNRRSTKDKLHPGKVNPREQWVVSTQPTHPGIVPIETFLAAQNVS
FT                   RSRERSRADAHHGTPNRHRQTKRVYALRSYVWCTPCQRRMFGRTVTGYTYYSCQPRERA
FT                   IPEGHPSMISVTEEVLLDFADRFFNTYVLGPDRVRLAERSLDITAQQAADEQRQQIAVL
FT                   RRTLDDITTRRRRLLRVIEENDDPDGSVFAEISERRAQLDRDREIKTAELAHLEETTPN
FT                   DPGNADILADLPEMEIKLSLLPTDRLRRLLDAFAVQIYHDVRTNQVAFRATVSQHAAPH
FT                   LARLTRATADGPRPATHRHTSANDAAPADNDGGGSDHLQFCDMPRRGHLEDQPKRHLAC
FT                   GYASPSIGRGVHPHATRSRRL"
FT   gene            694268..694549
FT                   /locus_tag="Sare_0613"
FT   CDS_pept        694268..694549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96541"
FT                   /db_xref="UniProtKB/TrEMBL:A8M171"
FT                   /protein_id="ABV96541.1"
FT                   /translation="MMIGQPTPPSRTEVEARFTAILDGDQSRDEVDRWATRAMQTLEYA
FT                   EVDETTWWALGMLAGIDLRDGPGGPYLYDDEQVLGCLTEFRERCGVIS"
FT   gene            complement(694542..695282)
FT                   /pseudo
FT                   /locus_tag="Sare_0614"
FT                   /product="hypothetical protein"
FT   gene            695594..695962
FT                   /locus_tag="Sare_0615"
FT   CDS_pept        695594..695962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96542"
FT                   /db_xref="GOA:A8M172"
FT                   /db_xref="UniProtKB/TrEMBL:A8M172"
FT                   /protein_id="ABV96542.1"
FT                   /translation="MTAVTTYEVAATVVDMLFASGTVALVGCAAWVVIHSRRASTVRLF
FT                   GRTLHYPRLWAAGAACIGFYVLLGLGDLTEVTPNTWRTPGRRIGAVLLLTGLALMVTYG
FT                   ILENRARRRIGRNQHVGP"
FT   gene            696292..696681
FT                   /locus_tag="Sare_0616"
FT   CDS_pept        696292..696681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96543"
FT                   /db_xref="UniProtKB/TrEMBL:A8M173"
FT                   /protein_id="ABV96543.1"
FT                   /translation="MSEHAFVFPAVPRLEVVRLLDELAVAGHGSWSTNTRLIVWLTDEA
FT                   SGLYQGWEPEDIANLEQTVGRRPEWAVQINYRLSHRADLAALAVALLRDGGVAVDDFCS
FT                   RVWKAAEIETDTVFSGGRFGEDHVR"
FT   gene            697277..698257
FT                   /locus_tag="Sare_0617"
FT   CDS_pept        697277..698257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0617"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: stp:Strop_0500
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96544"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8M174"
FT                   /protein_id="ABV96544.1"
FT                   /translation="MQYVRLGRTGLKVSRICLGMMSYGDRSKSDGWVLTEDAAEPLVRR
FT                   AVDAGVTFFDTADMYSLGTSEEVTGRLLGKIFPRRDDYVLATKVFFPMGSGPNDGGLSR
FT                   KHIHTAIDESLRRLGTDHVDLYQIHRWDDQTPIEETMEALHEVVRAGKARYIGASSMAA
FT                   WQFAKAQHTADMSGWTRFVSMQNHYNLLYREEEREMIPLCRDQGVGVIPWSPLARGLVA
FT                   RAGATEAAATARVSSGDADRREALYGRGDERILRRVAQVANECALPPAQIGLAWLLSKS
FT                   GVTAPTVGATKERHIDDAVAAVDVSLTEEQIEYLEEPYQPQTIRM"
FT   gene            complement(698635..698955)
FT                   /pseudo
FT                   /locus_tag="Sare_0618"
FT                   /product="hypothetical protein"
FT   gene            complement(699088..699456)
FT                   /locus_tag="Sare_0619"
FT   CDS_pept        complement(699088..699456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0619"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96545"
FT                   /db_xref="GOA:A8M175"
FT                   /db_xref="UniProtKB/TrEMBL:A8M175"
FT                   /protein_id="ABV96545.1"
FT                   /translation="MTSTGSSRLSLWSTDSLLSIGSHGSVLSIGSVGSIASIASIGSAG
FT                   SILSVGSALSTGSALSWRSRWSLLADQSFGATLASRSSTRPLTGPPAALAAVALGAYVG
FT                   YLLARSRQPDSNRSLSTK"
FT   gene            complement(700580..701674)
FT                   /pseudo
FT                   /locus_tag="Sare_0620"
FT                   /product="hypothetical protein"
FT   gene            702358..703098
FT                   /locus_tag="Sare_0621"
FT   CDS_pept        702358..703098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0621"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV529 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96546"
FT                   /db_xref="GOA:A8M176"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8M176"
FT                   /protein_id="ABV96546.1"
FT                   /translation="MTEVVLDEVAQKFRGGFHLGPVSLNLTVGVTCLLGANGSGKTTLL
FT                   RMLSGIDSPAKGTIQIGKEGKPGEAKSIGFLPQDFTAPKNATCQDFLHYVAWSRRVSAK
FT                   SRETLIQSALSRTGLSDQAEERIGNISGGMLRRLGIAQALVHEPSFLILDEPTVGLDPG
FT                   QRLRIRDQVRKLATDVAVLYSTHLVEDVRSLADQIIILRSGKVAFKGTLAEVEQSAEEG
FT                   APIDQPGAPTRLERGISMFMDEVE"
FT   gene            703095..704336
FT                   /locus_tag="Sare_0622"
FT   CDS_pept        703095..704336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0622"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96547"
FT                   /db_xref="GOA:A8M177"
FT                   /db_xref="UniProtKB/TrEMBL:A8M177"
FT                   /protein_id="ABV96547.1"
FT                   /translation="MSIITYLIRTHVAPKAALALLAIEVFNLFNRGMPWRGELVWTVDW
FT                   VGTALVLIGPVLAGAAAIDAGRLSRAGSEYLMPGGGLVSRAYVITWLAATVPAIAVHLV
FT                   TVTVILLVSNSASQISPWPSAVAVLAQVCGIAFYAALGAFCGRLAGSIAGPPIAVLAGV
FT                   VLFWQFGTSPGQFSFLMFGRATSSVLGLQYNTNYFLVQTLCLAVLILALMTLPVRVIAG
FT                   VRRPPHTVTAVSIVAIVAALVLFPSTKAERFVPVTVAPTSCTGENPRVCVYPDHERFLD
FT                   DAHRAAAQLRAAGAALGVEDLLPTELRERTPGAGPAPDARGRFQIPVESFSFHSPGLTM
FT                   NDLATQMILPFHCPLLYGDRPPSMEFAEDLNRASYTLLKAGGATGDPMMPPESDMSKDE
FT                   LRETIESFRNCRFR"
FT   gene            704333..704965
FT                   /locus_tag="Sare_0623"
FT   CDS_pept        704333..704965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96548"
FT                   /db_xref="GOA:A8M178"
FT                   /db_xref="UniProtKB/TrEMBL:A8M178"
FT                   /protein_id="ABV96548.1"
FT                   /translation="MRFAIVHSCQTIRAWLAVHHFTISFAMIALSGIICLVFNDATLTG
FT                   LVVDFLNPIPVPIVAPMLAGVAVGLGVGSRIDSQILAGRSLVVPRMAWSTALIFAACTF
FT                   MAAGSAPGDVGGASIIRNGLIFGALGIGSTVYFGPTGSWIGPSVAGLFLILFGGARPEG
FT                   LPVWAFALQEDVTTVQLAIAVGMYFVVTLLYAAVGSTRRVRITSTWT"
FT   gene            complement(705159..706373)
FT                   /pseudo
FT                   /locus_tag="Sare_0624"
FT                   /product="hypothetical protein"
FT   gene            706716..707303
FT                   /locus_tag="Sare_0625"
FT   CDS_pept        706716..707303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0293 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96549"
FT                   /db_xref="UniProtKB/TrEMBL:A8M179"
FT                   /protein_id="ABV96549.1"
FT                   /translation="MAFRELEAMQAAYDLLSPLEASAQQRVIAWLSAALADTNGAPMVV
FT                   DELTLGKPVADVHADITSKDSAPTVLDEHAAAGPEVETAAPTVSVAPVAAAEPEVTELE
FT                   PAPQRPKRGRPAKATGRRAARSVSATKPAVAAPGRRGERPSGEQYLADLAAAGSFKALA
FT                   EKYGKSVGTIGNWANQLREKGFDIPVGRQKRA"
FT   gene            707391..707773
FT                   /pseudo
FT                   /locus_tag="Sare_0626"
FT                   /product="hypothetical protein"
FT   gene            708144..708860
FT                   /locus_tag="Sare_0627"
FT   CDS_pept        708144..708860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0627"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96550"
FT                   /db_xref="UniProtKB/TrEMBL:A8M180"
FT                   /protein_id="ABV96550.1"
FT                   /translation="MSSYTITTTVKIEVSGTTAHVSEPMVRAGENVTPAGGEISGVGLE
FT                   LLVKLPAVGGAQVTSQSSLTAATEVDGSVRQNMPVHGVEAHADKVESPVAATSPDAESI
FT                   TTAGFVDAVAIESAGVAADGVEGTDDSVTTDGVAVDVVVPLQASRVKQSAVGARARRGR
FT                   SAAGAKATPTVRKASPKRATSVDAGRAYRRAPEDLESIFQQAGSASAVADYYDVPRHTA
FT                   QGWIRTLRRRQAKATK"
FT   gene            709012..709818
FT                   /locus_tag="Sare_0628"
FT   CDS_pept        709012..709818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0628"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   stp:Strop_0646 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96551"
FT                   /db_xref="GOA:A8M181"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8M181"
FT                   /protein_id="ABV96551.1"
FT                   /translation="MVGTVAVAAGGVVAQALPVVTASGAVRRRWWPHLAGVGAASRIAL
FT                   TFDDGPNRASTSLFLRALERAGVQATFFVLGTLLDRDPGLGREMVAAGHELAVHGWEHR
FT                   NLLWRSRAATYADIARARDTIAAVTGTSPSWYRPPYGVLTTSALLACRRLGLAPRLWTA
FT                   WGRDWEATRSPASIWETIVKDLGGGGTVLLHDSDYASTPGTWRGALAVLPRLVDWARDR
FT                   ELTIGTLGTHEGTGAVEDRAWRTPVPGTSWAWRRTGWVTASGEATA"
FT   gene            709847..710995
FT                   /locus_tag="Sare_0629"
FT   CDS_pept        709847..710995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0629"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase-like protein"
FT                   /note="KEGG: stp:Strop_0647 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96552"
FT                   /db_xref="GOA:A8M182"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A8M182"
FT                   /protein_id="ABV96552.1"
FT                   /translation="MPDGIRPVPLGAAVGAGRDDPGGDPGRMRILVVSADIGAGHDAAA
FT                   AELAARLGGDEVVVEQLNFFTALPRPLHLLVREGYRTMLQRFPWSYDALFRFTDRSSLT
FT                   LRAFRAALRAAAPRMLSRIPADTRLVVTTHPFANQLLGPMRGAGQLTVPVLSYVTDFVI
FT                   HPVWISPGVDTYCVIHEATQQQAMARGARDVRVVDPLISAEFASLSTACRRTARARFGL
FT                   PAQDRLALIVAGSWGVGDVTRTARDVLATGCVTPVVACGRNDDLRHRLRTFPGHIMGWV
FT                   DDMPTLMRAVDVVVENAGGLTCQQSLACGLPTVTYRPISGHGRANARVLADAGLTTYVT
FT                   TAAQLQPVLSALTLAEGGLTTPAVTATDMAALISDVVRTDHR"
FT   gene            711341..711838
FT                   /locus_tag="Sare_0630"
FT   CDS_pept        711341..711838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0630"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /note="PFAM: LuxS protein; KEGG: stp:Strop_0654
FT                   quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96553"
FT                   /db_xref="GOA:A8M183"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:A8M183"
FT                   /protein_id="ABV96553.1"
FT                   /translation="MTSRDLDHRYVVPPYLRVVTEQTVPGTDQRVALWDFRVAQPNASH
FT                   VPGPVMHSLEHFLGTYVRTHHPTIMNVAPMGCMTGLYVWTVGEWNFDDLADVITAGLRS
FT                   IRDADEVPLANIVQCGWAEHHSLEGVKEFAERLLADRDQWRDPGPDAHEVSAADLRELS
FT                   AG"
FT   gene            712170..713198
FT                   /locus_tag="Sare_0631"
FT   CDS_pept        712170..713198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96554"
FT                   /db_xref="UniProtKB/TrEMBL:A8M184"
FT                   /protein_id="ABV96554.1"
FT                   /translation="MLGRRYIACCLVSAAAGMGALAPAAPASAEVQQGLGSALVHDPFG
FT                   ASSAYRGEIRAPREFSGIAWLATEESDEVVQEVFLVCHDTRDNDAERDLPRLSIVRTPV
FT                   DPRGIIVEELDVEFPGRTVPNDLESIARLPGRNAALLVESNADGTDPDPMIYLARWDED
FT                   LNVEIVSSVPWPETPEPLVNVEATAVVTVRGWDYFVYAERAEGRDTTNINMTRLVVGAD
FT                   GAIRFGRRWTSVPFTAPVPPGARPASGMDIDTMGNVYVSSAYDPGDLGPFDSAVYRAAT
FT                   VRAGGGIGARLRPVEPPQQLARSSGLKVEGVGLVAGSFPIFIGDDDEDYGGLLRQLRVV
FT                   GE"
FT   gene            complement(713278..713733)
FT                   /locus_tag="Sare_0632"
FT   CDS_pept        complement(713278..713733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sare_0632"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   stp:Strop_0657 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sare_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABV96555"
FT                   /db_xref="GOA:A8M185"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8M185"
FT