(data stored in ACNUC7421 zone)

EMBL: CP000853

ID   CP000853; SV 1; circular; genomic DNA; STD; PRO; 3123558 BP.
XX
AC   CP000853; AAQV01000000-AAQV01000076;
XX
PR   Project:PRJNA16083;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Alkaliphilus oremlandii OhILAs, complete genome.
XX
KW   .
XX
OS   Alkaliphilus oremlandii OhILAs
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Alkaliphilus.
XX
RN   [1]
RP   1-3123558
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Stolz J.F., Dawson A., Fisher E.,
RA   Crable B., Perera E., Lisak J., Ranganathan M., Basu P., Richardson P.;
RT   "Complete genome of Alkaliphilus oremlandii OhILAs";
RL   Unpublished.
XX
RN   [2]
RP   1-3123558
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Stolz J.F., Dawson A., Fisher E.,
RA   Crable B., Perera E., Lisak J., Ranganathan M., Basu P., Richardson P.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 99b0a0a98dddd0f5a57a82fe1ac29b04.
DR   BioSample; SAMN00623039.
DR   EnsemblGenomes-Gn; Clos_R0001.
DR   EnsemblGenomes-Gn; Clos_R0002.
DR   EnsemblGenomes-Gn; Clos_R0003.
DR   EnsemblGenomes-Gn; Clos_R0004.
DR   EnsemblGenomes-Gn; Clos_R0005.
DR   EnsemblGenomes-Gn; Clos_R0007.
DR   EnsemblGenomes-Gn; Clos_R0008.
DR   EnsemblGenomes-Gn; Clos_R0009.
DR   EnsemblGenomes-Gn; Clos_R0010.
DR   EnsemblGenomes-Gn; Clos_R0011.
DR   EnsemblGenomes-Gn; Clos_R0012.
DR   EnsemblGenomes-Gn; Clos_R0013.
DR   EnsemblGenomes-Gn; Clos_R0014.
DR   EnsemblGenomes-Gn; Clos_R0015.
DR   EnsemblGenomes-Gn; Clos_R0016.
DR   EnsemblGenomes-Gn; Clos_R0017.
DR   EnsemblGenomes-Gn; Clos_R0018.
DR   EnsemblGenomes-Gn; Clos_R0019.
DR   EnsemblGenomes-Gn; Clos_R0020.
DR   EnsemblGenomes-Gn; Clos_R0021.
DR   EnsemblGenomes-Gn; Clos_R0022.
DR   EnsemblGenomes-Gn; Clos_R0023.
DR   EnsemblGenomes-Gn; Clos_R0024.
DR   EnsemblGenomes-Gn; Clos_R0025.
DR   EnsemblGenomes-Gn; Clos_R0026.
DR   EnsemblGenomes-Gn; Clos_R0027.
DR   EnsemblGenomes-Gn; Clos_R0028.
DR   EnsemblGenomes-Gn; Clos_R0029.
DR   EnsemblGenomes-Gn; Clos_R0030.
DR   EnsemblGenomes-Gn; Clos_R0031.
DR   EnsemblGenomes-Gn; Clos_R0033.
DR   EnsemblGenomes-Gn; Clos_R0034.
DR   EnsemblGenomes-Gn; Clos_R0035.
DR   EnsemblGenomes-Gn; Clos_R0036.
DR   EnsemblGenomes-Gn; Clos_R0037.
DR   EnsemblGenomes-Gn; Clos_R0038.
DR   EnsemblGenomes-Gn; Clos_R0039.
DR   EnsemblGenomes-Gn; Clos_R0040.
DR   EnsemblGenomes-Gn; Clos_R0041.
DR   EnsemblGenomes-Gn; Clos_R0042.
DR   EnsemblGenomes-Gn; Clos_R0043.
DR   EnsemblGenomes-Gn; Clos_R0044.
DR   EnsemblGenomes-Gn; Clos_R0045.
DR   EnsemblGenomes-Gn; Clos_R0046.
DR   EnsemblGenomes-Gn; Clos_R0047.
DR   EnsemblGenomes-Gn; Clos_R0048.
DR   EnsemblGenomes-Gn; Clos_R0049.
DR   EnsemblGenomes-Gn; Clos_R0050.
DR   EnsemblGenomes-Gn; Clos_R0051.
DR   EnsemblGenomes-Gn; Clos_R0052.
DR   EnsemblGenomes-Gn; Clos_R0053.
DR   EnsemblGenomes-Gn; Clos_R0054.
DR   EnsemblGenomes-Gn; Clos_R0055.
DR   EnsemblGenomes-Gn; Clos_R0056.
DR   EnsemblGenomes-Gn; Clos_R0057.
DR   EnsemblGenomes-Gn; Clos_R0058.
DR   EnsemblGenomes-Gn; Clos_R0059.
DR   EnsemblGenomes-Gn; Clos_R0060.
DR   EnsemblGenomes-Gn; Clos_R0061.
DR   EnsemblGenomes-Gn; Clos_R0062.
DR   EnsemblGenomes-Gn; Clos_R0063.
DR   EnsemblGenomes-Gn; Clos_R0064.
DR   EnsemblGenomes-Gn; Clos_R0065.
DR   EnsemblGenomes-Gn; Clos_R0066.
DR   EnsemblGenomes-Gn; Clos_R0067.
DR   EnsemblGenomes-Gn; Clos_R0068.
DR   EnsemblGenomes-Gn; Clos_R0069.
DR   EnsemblGenomes-Gn; Clos_R0070.
DR   EnsemblGenomes-Gn; Clos_R0071.
DR   EnsemblGenomes-Gn; Clos_R0072.
DR   EnsemblGenomes-Gn; Clos_R0073.
DR   EnsemblGenomes-Gn; Clos_R0074.
DR   EnsemblGenomes-Gn; Clos_R0075.
DR   EnsemblGenomes-Gn; Clos_R0076.
DR   EnsemblGenomes-Gn; Clos_R0077.
DR   EnsemblGenomes-Gn; Clos_R0078.
DR   EnsemblGenomes-Gn; Clos_R0079.
DR   EnsemblGenomes-Gn; Clos_R0080.
DR   EnsemblGenomes-Gn; Clos_R0081.
DR   EnsemblGenomes-Gn; Clos_R0082.
DR   EnsemblGenomes-Gn; Clos_R0083.
DR   EnsemblGenomes-Gn; Clos_R0084.
DR   EnsemblGenomes-Gn; Clos_R0085.
DR   EnsemblGenomes-Gn; Clos_R0086.
DR   EnsemblGenomes-Gn; Clos_R0087.
DR   EnsemblGenomes-Gn; Clos_R0088.
DR   EnsemblGenomes-Gn; Clos_R0089.
DR   EnsemblGenomes-Gn; Clos_R0090.
DR   EnsemblGenomes-Gn; Clos_R0091.
DR   EnsemblGenomes-Gn; Clos_R0092.
DR   EnsemblGenomes-Gn; Clos_R0093.
DR   EnsemblGenomes-Gn; Clos_R0094.
DR   EnsemblGenomes-Gn; Clos_R0095.
DR   EnsemblGenomes-Gn; Clos_R0096.
DR   EnsemblGenomes-Gn; Clos_R0097.
DR   EnsemblGenomes-Gn; Clos_R0098.
DR   EnsemblGenomes-Gn; Clos_R0099.
DR   EnsemblGenomes-Gn; Clos_R0100.
DR   EnsemblGenomes-Gn; Clos_R0101.
DR   EnsemblGenomes-Gn; Clos_R0102.
DR   EnsemblGenomes-Gn; Clos_R0103.
DR   EnsemblGenomes-Gn; Clos_R0104.
DR   EnsemblGenomes-Gn; Clos_R0105.
DR   EnsemblGenomes-Gn; Clos_R0106.
DR   EnsemblGenomes-Gn; Clos_R0107.
DR   EnsemblGenomes-Gn; Clos_R0108.
DR   EnsemblGenomes-Gn; Clos_R0109.
DR   EnsemblGenomes-Gn; Clos_R0110.
DR   EnsemblGenomes-Gn; Clos_R0111.
DR   EnsemblGenomes-Gn; Clos_R0112.
DR   EnsemblGenomes-Gn; Clos_R0113.
DR   EnsemblGenomes-Gn; Clos_R0114.
DR   EnsemblGenomes-Gn; Clos_R0115.
DR   EnsemblGenomes-Gn; EBG00001230280.
DR   EnsemblGenomes-Gn; EBG00001230281.
DR   EnsemblGenomes-Gn; EBG00001230282.
DR   EnsemblGenomes-Gn; EBG00001230283.
DR   EnsemblGenomes-Gn; EBG00001230284.
DR   EnsemblGenomes-Gn; EBG00001230285.
DR   EnsemblGenomes-Gn; EBG00001230286.
DR   EnsemblGenomes-Gn; EBG00001230287.
DR   EnsemblGenomes-Gn; EBG00001230288.
DR   EnsemblGenomes-Gn; EBG00001230289.
DR   EnsemblGenomes-Gn; EBG00001230290.
DR   EnsemblGenomes-Gn; EBG00001230291.
DR   EnsemblGenomes-Gn; EBG00001230292.
DR   EnsemblGenomes-Gn; EBG00001230293.
DR   EnsemblGenomes-Gn; EBG00001230294.
DR   EnsemblGenomes-Gn; EBG00001230295.
DR   EnsemblGenomes-Gn; EBG00001230296.
DR   EnsemblGenomes-Gn; EBG00001230297.
DR   EnsemblGenomes-Gn; EBG00001230298.
DR   EnsemblGenomes-Gn; EBG00001230299.
DR   EnsemblGenomes-Gn; EBG00001230300.
DR   EnsemblGenomes-Gn; EBG00001230301.
DR   EnsemblGenomes-Gn; EBG00001230302.
DR   EnsemblGenomes-Gn; EBG00001230303.
DR   EnsemblGenomes-Gn; EBG00001230304.
DR   EnsemblGenomes-Gn; EBG00001230305.
DR   EnsemblGenomes-Gn; EBG00001230306.
DR   EnsemblGenomes-Gn; EBG00001230307.
DR   EnsemblGenomes-Gn; EBG00001230308.
DR   EnsemblGenomes-Gn; EBG00001230309.
DR   EnsemblGenomes-Gn; EBG00001230310.
DR   EnsemblGenomes-Gn; EBG00001230311.
DR   EnsemblGenomes-Gn; EBG00001230312.
DR   EnsemblGenomes-Gn; EBG00001230313.
DR   EnsemblGenomes-Gn; EBG00001230314.
DR   EnsemblGenomes-Gn; EBG00001230315.
DR   EnsemblGenomes-Gn; EBG00001230316.
DR   EnsemblGenomes-Gn; EBG00001230317.
DR   EnsemblGenomes-Gn; EBG00001230318.
DR   EnsemblGenomes-Gn; EBG00001230319.
DR   EnsemblGenomes-Gn; EBG00001230320.
DR   EnsemblGenomes-Gn; EBG00001230321.
DR   EnsemblGenomes-Gn; EBG00001230322.
DR   EnsemblGenomes-Gn; EBG00001230323.
DR   EnsemblGenomes-Gn; EBG00001230324.
DR   EnsemblGenomes-Gn; EBG00001230325.
DR   EnsemblGenomes-Gn; EBG00001230326.
DR   EnsemblGenomes-Gn; EBG00001230327.
DR   EnsemblGenomes-Gn; EBG00001230328.
DR   EnsemblGenomes-Gn; EBG00001230329.
DR   EnsemblGenomes-Gn; EBG00001230330.
DR   EnsemblGenomes-Gn; EBG00001230331.
DR   EnsemblGenomes-Gn; EBG00001230332.
DR   EnsemblGenomes-Gn; EBG00001230333.
DR   EnsemblGenomes-Gn; EBG00001230334.
DR   EnsemblGenomes-Gn; EBG00001230335.
DR   EnsemblGenomes-Gn; EBG00001230336.
DR   EnsemblGenomes-Gn; EBG00001230337.
DR   EnsemblGenomes-Gn; EBG00001230338.
DR   EnsemblGenomes-Gn; EBG00001230339.
DR   EnsemblGenomes-Gn; EBG00001230340.
DR   EnsemblGenomes-Gn; EBG00001230341.
DR   EnsemblGenomes-Gn; EBG00001230342.
DR   EnsemblGenomes-Gn; EBG00001230343.
DR   EnsemblGenomes-Gn; EBG00001230344.
DR   EnsemblGenomes-Gn; EBG00001230345.
DR   EnsemblGenomes-Gn; EBG00001230346.
DR   EnsemblGenomes-Gn; EBG00001230347.
DR   EnsemblGenomes-Gn; EBG00001230348.
DR   EnsemblGenomes-Gn; EBG00001230349.
DR   EnsemblGenomes-Gn; EBG00001230350.
DR   EnsemblGenomes-Gn; EBG00001230351.
DR   EnsemblGenomes-Gn; EBG00001230352.
DR   EnsemblGenomes-Gn; EBG00001230353.
DR   EnsemblGenomes-Gn; EBG00001230354.
DR   EnsemblGenomes-Gn; EBG00001230355.
DR   EnsemblGenomes-Gn; EBG00001230356.
DR   EnsemblGenomes-Gn; EBG00001230357.
DR   EnsemblGenomes-Gn; EBG00001230358.
DR   EnsemblGenomes-Gn; EBG00001230359.
DR   EnsemblGenomes-Gn; EBG00001230360.
DR   EnsemblGenomes-Gn; EBG00001230361.
DR   EnsemblGenomes-Gn; EBG00001230362.
DR   EnsemblGenomes-Gn; EBG00001230363.
DR   EnsemblGenomes-Gn; EBG00001230364.
DR   EnsemblGenomes-Gn; EBG00001230365.
DR   EnsemblGenomes-Gn; EBG00001230366.
DR   EnsemblGenomes-Gn; EBG00001230367.
DR   EnsemblGenomes-Gn; EBG00001230368.
DR   EnsemblGenomes-Gn; EBG00001230369.
DR   EnsemblGenomes-Gn; EBG00001230370.
DR   EnsemblGenomes-Gn; EBG00001230371.
DR   EnsemblGenomes-Gn; EBG00001230372.
DR   EnsemblGenomes-Gn; EBG00001230373.
DR   EnsemblGenomes-Gn; EBG00001230374.
DR   EnsemblGenomes-Gn; EBG00001230375.
DR   EnsemblGenomes-Gn; EBG00001230376.
DR   EnsemblGenomes-Gn; EBG00001230377.
DR   EnsemblGenomes-Gn; EBG00001230378.
DR   EnsemblGenomes-Gn; EBG00001230379.
DR   EnsemblGenomes-Gn; EBG00001230380.
DR   EnsemblGenomes-Gn; EBG00001230381.
DR   EnsemblGenomes-Gn; EBG00001230382.
DR   EnsemblGenomes-Gn; EBG00001230383.
DR   EnsemblGenomes-Gn; EBG00001230384.
DR   EnsemblGenomes-Gn; EBG00001230385.
DR   EnsemblGenomes-Gn; EBG00001230386.
DR   EnsemblGenomes-Gn; EBG00001230387.
DR   EnsemblGenomes-Gn; EBG00001230388.
DR   EnsemblGenomes-Gn; EBG00001230389.
DR   EnsemblGenomes-Gn; EBG00001230390.
DR   EnsemblGenomes-Gn; EBG00001230391.
DR   EnsemblGenomes-Gn; EBG00001230392.
DR   EnsemblGenomes-Gn; EBG00001230393.
DR   EnsemblGenomes-Gn; EBG00001230394.
DR   EnsemblGenomes-Gn; EBG00001230395.
DR   EnsemblGenomes-Gn; EBG00001230396.
DR   EnsemblGenomes-Gn; EBG00001230397.
DR   EnsemblGenomes-Gn; EBG00001230398.
DR   EnsemblGenomes-Gn; EBG00001230399.
DR   EnsemblGenomes-Gn; EBG00001230400.
DR   EnsemblGenomes-Gn; EBG00001230401.
DR   EnsemblGenomes-Gn; EBG00001230402.
DR   EnsemblGenomes-Gn; EBG00001230403.
DR   EnsemblGenomes-Gn; EBG00001230404.
DR   EnsemblGenomes-Gn; EBG00001230405.
DR   EnsemblGenomes-Gn; EBG00001230406.
DR   EnsemblGenomes-Gn; EBG00001230407.
DR   EnsemblGenomes-Gn; EBG00001230408.
DR   EnsemblGenomes-Gn; EBG00001230409.
DR   EnsemblGenomes-Gn; EBG00001230410.
DR   EnsemblGenomes-Gn; EBG00001230411.
DR   EnsemblGenomes-Gn; EBG00001230412.
DR   EnsemblGenomes-Gn; EBG00001230413.
DR   EnsemblGenomes-Gn; EBG00001230414.
DR   EnsemblGenomes-Tr; Clos_R0001-1.
DR   EnsemblGenomes-Tr; Clos_R0002-1.
DR   EnsemblGenomes-Tr; Clos_R0003-1.
DR   EnsemblGenomes-Tr; Clos_R0004-1.
DR   EnsemblGenomes-Tr; Clos_R0005-1.
DR   EnsemblGenomes-Tr; Clos_R0007-1.
DR   EnsemblGenomes-Tr; Clos_R0008-1.
DR   EnsemblGenomes-Tr; Clos_R0009-1.
DR   EnsemblGenomes-Tr; Clos_R0010-1.
DR   EnsemblGenomes-Tr; Clos_R0011-1.
DR   EnsemblGenomes-Tr; Clos_R0012-1.
DR   EnsemblGenomes-Tr; Clos_R0013-1.
DR   EnsemblGenomes-Tr; Clos_R0014-1.
DR   EnsemblGenomes-Tr; Clos_R0015-1.
DR   EnsemblGenomes-Tr; Clos_R0016-1.
DR   EnsemblGenomes-Tr; Clos_R0017-1.
DR   EnsemblGenomes-Tr; Clos_R0018-1.
DR   EnsemblGenomes-Tr; Clos_R0019-1.
DR   EnsemblGenomes-Tr; Clos_R0020-1.
DR   EnsemblGenomes-Tr; Clos_R0021-1.
DR   EnsemblGenomes-Tr; Clos_R0022-1.
DR   EnsemblGenomes-Tr; Clos_R0023-1.
DR   EnsemblGenomes-Tr; Clos_R0024-1.
DR   EnsemblGenomes-Tr; Clos_R0025-1.
DR   EnsemblGenomes-Tr; Clos_R0026-1.
DR   EnsemblGenomes-Tr; Clos_R0027-1.
DR   EnsemblGenomes-Tr; Clos_R0028-1.
DR   EnsemblGenomes-Tr; Clos_R0029-1.
DR   EnsemblGenomes-Tr; Clos_R0030-1.
DR   EnsemblGenomes-Tr; Clos_R0031-1.
DR   EnsemblGenomes-Tr; Clos_R0033-1.
DR   EnsemblGenomes-Tr; Clos_R0034-1.
DR   EnsemblGenomes-Tr; Clos_R0035-1.
DR   EnsemblGenomes-Tr; Clos_R0036-1.
DR   EnsemblGenomes-Tr; Clos_R0037-1.
DR   EnsemblGenomes-Tr; Clos_R0038-1.
DR   EnsemblGenomes-Tr; Clos_R0039-1.
DR   EnsemblGenomes-Tr; Clos_R0040-1.
DR   EnsemblGenomes-Tr; Clos_R0041-1.
DR   EnsemblGenomes-Tr; Clos_R0042-1.
DR   EnsemblGenomes-Tr; Clos_R0043-1.
DR   EnsemblGenomes-Tr; Clos_R0044-1.
DR   EnsemblGenomes-Tr; Clos_R0045-1.
DR   EnsemblGenomes-Tr; Clos_R0046-1.
DR   EnsemblGenomes-Tr; Clos_R0047-1.
DR   EnsemblGenomes-Tr; Clos_R0048-1.
DR   EnsemblGenomes-Tr; Clos_R0049-1.
DR   EnsemblGenomes-Tr; Clos_R0050-1.
DR   EnsemblGenomes-Tr; Clos_R0051-1.
DR   EnsemblGenomes-Tr; Clos_R0052-1.
DR   EnsemblGenomes-Tr; Clos_R0053-1.
DR   EnsemblGenomes-Tr; Clos_R0054-1.
DR   EnsemblGenomes-Tr; Clos_R0055-1.
DR   EnsemblGenomes-Tr; Clos_R0056-1.
DR   EnsemblGenomes-Tr; Clos_R0057-1.
DR   EnsemblGenomes-Tr; Clos_R0058-1.
DR   EnsemblGenomes-Tr; Clos_R0059-1.
DR   EnsemblGenomes-Tr; Clos_R0060-1.
DR   EnsemblGenomes-Tr; Clos_R0061-1.
DR   EnsemblGenomes-Tr; Clos_R0062-1.
DR   EnsemblGenomes-Tr; Clos_R0063-1.
DR   EnsemblGenomes-Tr; Clos_R0064-1.
DR   EnsemblGenomes-Tr; Clos_R0065-1.
DR   EnsemblGenomes-Tr; Clos_R0066-1.
DR   EnsemblGenomes-Tr; Clos_R0067-1.
DR   EnsemblGenomes-Tr; Clos_R0068-1.
DR   EnsemblGenomes-Tr; Clos_R0069-1.
DR   EnsemblGenomes-Tr; Clos_R0070-1.
DR   EnsemblGenomes-Tr; Clos_R0071-1.
DR   EnsemblGenomes-Tr; Clos_R0072-1.
DR   EnsemblGenomes-Tr; Clos_R0073-1.
DR   EnsemblGenomes-Tr; Clos_R0074-1.
DR   EnsemblGenomes-Tr; Clos_R0075-1.
DR   EnsemblGenomes-Tr; Clos_R0076-1.
DR   EnsemblGenomes-Tr; Clos_R0077-1.
DR   EnsemblGenomes-Tr; Clos_R0078-1.
DR   EnsemblGenomes-Tr; Clos_R0079-1.
DR   EnsemblGenomes-Tr; Clos_R0080-1.
DR   EnsemblGenomes-Tr; Clos_R0081-1.
DR   EnsemblGenomes-Tr; Clos_R0082-1.
DR   EnsemblGenomes-Tr; Clos_R0083-1.
DR   EnsemblGenomes-Tr; Clos_R0084-1.
DR   EnsemblGenomes-Tr; Clos_R0085-1.
DR   EnsemblGenomes-Tr; Clos_R0086-1.
DR   EnsemblGenomes-Tr; Clos_R0087-1.
DR   EnsemblGenomes-Tr; Clos_R0088-1.
DR   EnsemblGenomes-Tr; Clos_R0089-1.
DR   EnsemblGenomes-Tr; Clos_R0090-1.
DR   EnsemblGenomes-Tr; Clos_R0091-1.
DR   EnsemblGenomes-Tr; Clos_R0092-1.
DR   EnsemblGenomes-Tr; Clos_R0093-1.
DR   EnsemblGenomes-Tr; Clos_R0094-1.
DR   EnsemblGenomes-Tr; Clos_R0095-1.
DR   EnsemblGenomes-Tr; Clos_R0096-1.
DR   EnsemblGenomes-Tr; Clos_R0097-1.
DR   EnsemblGenomes-Tr; Clos_R0098-1.
DR   EnsemblGenomes-Tr; Clos_R0099-1.
DR   EnsemblGenomes-Tr; Clos_R0100-1.
DR   EnsemblGenomes-Tr; Clos_R0101-1.
DR   EnsemblGenomes-Tr; Clos_R0102-1.
DR   EnsemblGenomes-Tr; Clos_R0103-1.
DR   EnsemblGenomes-Tr; Clos_R0104-1.
DR   EnsemblGenomes-Tr; Clos_R0105-1.
DR   EnsemblGenomes-Tr; Clos_R0106-1.
DR   EnsemblGenomes-Tr; Clos_R0107-1.
DR   EnsemblGenomes-Tr; Clos_R0108-1.
DR   EnsemblGenomes-Tr; Clos_R0109-1.
DR   EnsemblGenomes-Tr; Clos_R0110-1.
DR   EnsemblGenomes-Tr; Clos_R0111-1.
DR   EnsemblGenomes-Tr; Clos_R0112-1.
DR   EnsemblGenomes-Tr; Clos_R0113-1.
DR   EnsemblGenomes-Tr; Clos_R0114-1.
DR   EnsemblGenomes-Tr; Clos_R0115-1.
DR   EnsemblGenomes-Tr; EBT00001798943.
DR   EnsemblGenomes-Tr; EBT00001798944.
DR   EnsemblGenomes-Tr; EBT00001798945.
DR   EnsemblGenomes-Tr; EBT00001798946.
DR   EnsemblGenomes-Tr; EBT00001798947.
DR   EnsemblGenomes-Tr; EBT00001798948.
DR   EnsemblGenomes-Tr; EBT00001798949.
DR   EnsemblGenomes-Tr; EBT00001798950.
DR   EnsemblGenomes-Tr; EBT00001798951.
DR   EnsemblGenomes-Tr; EBT00001798952.
DR   EnsemblGenomes-Tr; EBT00001798953.
DR   EnsemblGenomes-Tr; EBT00001798954.
DR   EnsemblGenomes-Tr; EBT00001798955.
DR   EnsemblGenomes-Tr; EBT00001798956.
DR   EnsemblGenomes-Tr; EBT00001798957.
DR   EnsemblGenomes-Tr; EBT00001798958.
DR   EnsemblGenomes-Tr; EBT00001798959.
DR   EnsemblGenomes-Tr; EBT00001798960.
DR   EnsemblGenomes-Tr; EBT00001798961.
DR   EnsemblGenomes-Tr; EBT00001798962.
DR   EnsemblGenomes-Tr; EBT00001798963.
DR   EnsemblGenomes-Tr; EBT00001798964.
DR   EnsemblGenomes-Tr; EBT00001798965.
DR   EnsemblGenomes-Tr; EBT00001798966.
DR   EnsemblGenomes-Tr; EBT00001798967.
DR   EnsemblGenomes-Tr; EBT00001798968.
DR   EnsemblGenomes-Tr; EBT00001798969.
DR   EnsemblGenomes-Tr; EBT00001798970.
DR   EnsemblGenomes-Tr; EBT00001798971.
DR   EnsemblGenomes-Tr; EBT00001798972.
DR   EnsemblGenomes-Tr; EBT00001798973.
DR   EnsemblGenomes-Tr; EBT00001798974.
DR   EnsemblGenomes-Tr; EBT00001798975.
DR   EnsemblGenomes-Tr; EBT00001798976.
DR   EnsemblGenomes-Tr; EBT00001798977.
DR   EnsemblGenomes-Tr; EBT00001798978.
DR   EnsemblGenomes-Tr; EBT00001798979.
DR   EnsemblGenomes-Tr; EBT00001798980.
DR   EnsemblGenomes-Tr; EBT00001798981.
DR   EnsemblGenomes-Tr; EBT00001798982.
DR   EnsemblGenomes-Tr; EBT00001798983.
DR   EnsemblGenomes-Tr; EBT00001798984.
DR   EnsemblGenomes-Tr; EBT00001798985.
DR   EnsemblGenomes-Tr; EBT00001798986.
DR   EnsemblGenomes-Tr; EBT00001798987.
DR   EnsemblGenomes-Tr; EBT00001798988.
DR   EnsemblGenomes-Tr; EBT00001798989.
DR   EnsemblGenomes-Tr; EBT00001798990.
DR   EnsemblGenomes-Tr; EBT00001798991.
DR   EnsemblGenomes-Tr; EBT00001798992.
DR   EnsemblGenomes-Tr; EBT00001798993.
DR   EnsemblGenomes-Tr; EBT00001798994.
DR   EnsemblGenomes-Tr; EBT00001798995.
DR   EnsemblGenomes-Tr; EBT00001798996.
DR   EnsemblGenomes-Tr; EBT00001798997.
DR   EnsemblGenomes-Tr; EBT00001798998.
DR   EnsemblGenomes-Tr; EBT00001798999.
DR   EnsemblGenomes-Tr; EBT00001799000.
DR   EnsemblGenomes-Tr; EBT00001799001.
DR   EnsemblGenomes-Tr; EBT00001799002.
DR   EnsemblGenomes-Tr; EBT00001799003.
DR   EnsemblGenomes-Tr; EBT00001799004.
DR   EnsemblGenomes-Tr; EBT00001799005.
DR   EnsemblGenomes-Tr; EBT00001799006.
DR   EnsemblGenomes-Tr; EBT00001799007.
DR   EnsemblGenomes-Tr; EBT00001799008.
DR   EnsemblGenomes-Tr; EBT00001799009.
DR   EnsemblGenomes-Tr; EBT00001799010.
DR   EnsemblGenomes-Tr; EBT00001799011.
DR   EnsemblGenomes-Tr; EBT00001799012.
DR   EnsemblGenomes-Tr; EBT00001799013.
DR   EnsemblGenomes-Tr; EBT00001799014.
DR   EnsemblGenomes-Tr; EBT00001799015.
DR   EnsemblGenomes-Tr; EBT00001799016.
DR   EnsemblGenomes-Tr; EBT00001799017.
DR   EnsemblGenomes-Tr; EBT00001799018.
DR   EnsemblGenomes-Tr; EBT00001799019.
DR   EnsemblGenomes-Tr; EBT00001799020.
DR   EnsemblGenomes-Tr; EBT00001799021.
DR   EnsemblGenomes-Tr; EBT00001799022.
DR   EnsemblGenomes-Tr; EBT00001799023.
DR   EnsemblGenomes-Tr; EBT00001799024.
DR   EnsemblGenomes-Tr; EBT00001799025.
DR   EnsemblGenomes-Tr; EBT00001799026.
DR   EnsemblGenomes-Tr; EBT00001799027.
DR   EnsemblGenomes-Tr; EBT00001799028.
DR   EnsemblGenomes-Tr; EBT00001799029.
DR   EnsemblGenomes-Tr; EBT00001799030.
DR   EnsemblGenomes-Tr; EBT00001799031.
DR   EnsemblGenomes-Tr; EBT00001799032.
DR   EnsemblGenomes-Tr; EBT00001799033.
DR   EnsemblGenomes-Tr; EBT00001799034.
DR   EnsemblGenomes-Tr; EBT00001799035.
DR   EnsemblGenomes-Tr; EBT00001799036.
DR   EnsemblGenomes-Tr; EBT00001799037.
DR   EnsemblGenomes-Tr; EBT00001799038.
DR   EnsemblGenomes-Tr; EBT00001799039.
DR   EnsemblGenomes-Tr; EBT00001799040.
DR   EnsemblGenomes-Tr; EBT00001799041.
DR   EnsemblGenomes-Tr; EBT00001799042.
DR   EnsemblGenomes-Tr; EBT00001799043.
DR   EnsemblGenomes-Tr; EBT00001799044.
DR   EnsemblGenomes-Tr; EBT00001799045.
DR   EnsemblGenomes-Tr; EBT00001799046.
DR   EnsemblGenomes-Tr; EBT00001799047.
DR   EnsemblGenomes-Tr; EBT00001799048.
DR   EnsemblGenomes-Tr; EBT00001799049.
DR   EnsemblGenomes-Tr; EBT00001799050.
DR   EnsemblGenomes-Tr; EBT00001799051.
DR   EnsemblGenomes-Tr; EBT00001799052.
DR   EnsemblGenomes-Tr; EBT00001799053.
DR   EnsemblGenomes-Tr; EBT00001799054.
DR   EnsemblGenomes-Tr; EBT00001799055.
DR   EnsemblGenomes-Tr; EBT00001799056.
DR   EnsemblGenomes-Tr; EBT00001799057.
DR   EnsemblGenomes-Tr; EBT00001799058.
DR   EnsemblGenomes-Tr; EBT00001799059.
DR   EnsemblGenomes-Tr; EBT00001799060.
DR   EnsemblGenomes-Tr; EBT00001799061.
DR   EnsemblGenomes-Tr; EBT00001799062.
DR   EnsemblGenomes-Tr; EBT00001799063.
DR   EnsemblGenomes-Tr; EBT00001799064.
DR   EnsemblGenomes-Tr; EBT00001799065.
DR   EnsemblGenomes-Tr; EBT00001799066.
DR   EnsemblGenomes-Tr; EBT00001799067.
DR   EnsemblGenomes-Tr; EBT00001799068.
DR   EnsemblGenomes-Tr; EBT00001799069.
DR   EnsemblGenomes-Tr; EBT00001799070.
DR   EnsemblGenomes-Tr; EBT00001799071.
DR   EnsemblGenomes-Tr; EBT00001799072.
DR   EnsemblGenomes-Tr; EBT00001799073.
DR   EnsemblGenomes-Tr; EBT00001799074.
DR   EnsemblGenomes-Tr; EBT00001799075.
DR   EnsemblGenomes-Tr; EBT00001799076.
DR   EnsemblGenomes-Tr; EBT00001799077.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000853.
DR   SILVA-SSU; CP000853.
DR   StrainInfo; 692617; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000263
CC   Source DNA and bacteria available from John Stolz (jstolz@duq.edu)
CC   Contacts: John Stolz (jstolz@duq.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3123558
FT                   /organism="Alkaliphilus oremlandii OhILAs"
FT                   /strain="OhILAs"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:350688"
FT   gene            49..1404
FT                   /locus_tag="Clos_0001"
FT   CDS_pept        49..1404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: amt:Amet_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17571"
FT                   /db_xref="GOA:A8MEA0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEA0"
FT                   /protein_id="ABW17571.1"
FT                   /translation="MQDNLPQIWEKTLNLIKPELTEVSFTTWIKSIEVISLEGNTMILG
FT                   VPNVFTKDILTARYATLISNALKQTTSKNFEIRFIVPSEEKISKTEESQKKLEGSVNIS
FT                   VASDQFVSNNLNPKYTFDTFVIGNSNRFAHAASLAVAESPAKAYNPLFLYGGVGLGKTH
FT                   LMHAIGHFILQNNPKAKVVYVSSETFTNELINSIRHDRNVEFRNRFRTIDVLLVDDIQF
FT                   IAGKESTQEEFFHTFNALHESNKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPD
FT                   LETRIAILYKKAQMENIDVPNEVLTHIAKKIQSNIRELEGALIRIVAYSSLTNSEITVE
FT                   LASEALKELFSSKARQLNIDLIKEVVANKYNMKIEDFNSKKRTRSISYPRQIAMYLSRE
FT                   LTDLSLPKIGEEFGGRDHTTVMHAHEKISKDILADDNIKEKIERIAKEIKGD"
FT   gene            1642..2748
FT                   /locus_tag="Clos_0002"
FT   CDS_pept        1642..2748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: amt:Amet_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17572"
FT                   /db_xref="GOA:A8MEA1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA1"
FT                   /protein_id="ABW17572.1"
FT                   /translation="MKFFCNQKALMHSISIVQKAVSSKSTLPIIKGIYLEAYEDHLRLV
FT                   GTDMEIGIDHVMEANIIEEGSIVVDARLFSEIIRRLPDYEVEVSLQENNQLLIKCAATE
FT                   FNILSYNASEFPELPEIEEDQIHEISQDLFKNMIRQTVFATAQDETRPILTGVLMEIED
FT                   DILSMVALDGYRVALRKGKLNAHLNNRVVIPGKTLNEVNRIMTGEEDENIKISLTNNHA
FT                   LFTVGNTKLISRLLEGEFMNYNQIIPKEFKSRVKVNTRSLLDSIERASLLGKEGRNNLV
FT                   KFSITDYKMVINSNSELGNVHEEILIELEGDDLQIAFNSKYFIDALKVIDDESVYLEFT
FT                   TNLSPGIIKPITNDNTIYLVLPVRLSSY"
FT   gene            2846..3061
FT                   /locus_tag="Clos_0003"
FT   CDS_pept        2846..3061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   amt:Amet_0003 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17573"
FT                   /db_xref="GOA:A8MEA2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA2"
FT                   /protein_id="ABW17573.1"
FT                   /translation="MRKKVEVKIEGEYIKLDQLLKLAEVVGSGGHAKLVILNGEVKVNE
FT                   QTIVQRGKKIRVGDKVLFQDIEIEVK"
FT   gene            3236..4333
FT                   /locus_tag="Clos_0004"
FT   CDS_pept        3236..4333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: amt:Amet_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17574"
FT                   /db_xref="GOA:A8MEA3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEA3"
FT                   /protein_id="ABW17574.1"
FT                   /translation="MIVEELKLINYRNYEQMNLKFHPRLNVFIGDNAQGKTNLIESIYL
FT                   CSAGKSFRTNHDQELINMNKKQAYIHVKVKKVHSDVHIEVRLNSERKKDLKVNQIPLVK
FT                   MGELLGNLNVVLFSPEDLKLVKEGPSERRRFMDREISQISTKFYYTLSQYNKILQHRNK
FT                   LLKYNKGKEIDIEVWDEQLAAAGAWLIVYRRNFIKKISILAKLMHRKITESIENLEVIY
FT                   EPNVKVKENDEVDVIKEKILQNLKENFNVDKQRGLTTCGPHRDDMILKINGLDVKTYGS
FT                   QGQQRTAVLSLKLAELELVKGEVGEYPILLLDDVMSELDSKRQHYLIHNLKSVQTFITT
FT                   TMMETLKDLKPEDRAVFYVNKGQID"
FT   gene            4422..4757
FT                   /locus_tag="Clos_0005"
FT   CDS_pept        4422..4757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0005 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17575"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA4"
FT                   /protein_id="ABW17575.1"
FT                   /translation="MFLHLGGDIMVNTRDVIAILDVESVLDSRHSRNFISKQEKEGSII
FT                   RITDEETRSFVITEKSEGRRKKKNSVRQIKVYYSPISASTLQKRADLLIRSFSHTSSTN
FT                   KEQNINI"
FT   gene            4884..6794
FT                   /locus_tag="Clos_0006"
FT   CDS_pept        4884..6794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: amt:Amet_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17576"
FT                   /db_xref="GOA:A8MEA5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA5"
FT                   /protein_id="ABW17576.1"
FT                   /translation="MDKIKTQEYSAEQIQVLEGLDPVRKRPGMYIGTTGPRGLHHLVYE
FT                   VVDNSIDEALGGYCDTILVTIKEDDSIEVIDNGRGIPVDVHPQTGKSTLETVLTVLHAG
FT                   GKFGGGGYKVSGGLHGVGVSVVNALSEYLEATIKLDGKVYWQRFERGNPVEDIKIIGET
FT                   KEKGTTILFKPDAEIFEETVFQYETLEYRLRELAFLNKGIKIVLIDKREGKEQEKVFYY
FT                   DGGIMEYVKYLNKNKSVLHEKIIHFEKEKETSVVEVAMQYTDTYTENIFSYANNINTHE
FT                   GGTHLSGFRASLTRIVNDYAKKAGFLKEKDANFLGEDIREGLTAVISVKLTEPQFEGQT
FT                   KTKLGNSEMRGIVENSVSEALEAFLEENPSDAKIIVEKSLRAQRAREAAKKARELTRRK
FT                   GALESMALPGKLADCSEKDPALSEIYIVEGNSAGGSAKQGRDRSIQAILPLRGKILNVE
FT                   KARLDKMLNSDEIRNMITAFGTSIGEEFDIEKLRYHKIVIMTDADVDGAHIRTLLLTFL
FT                   FRFMKPLIERGYIYIAQPPLYKLKKGKVEEYAYSEEEMQVKLSEMGGNVDIQRYKGLGE
FT                   MNPEQLWETTMNPETRTFLQVTIEDAAAADNIFTTLMGDKVEPRREFIEQNSKYVTNLD
FT                   I"
FT   gene            6807..9266
FT                   /locus_tag="Clos_0007"
FT   CDS_pept        6807..9266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: amt:Amet_0007 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17577"
FT                   /db_xref="GOA:A8MEA6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA6"
FT                   /protein_id="ABW17577.1"
FT                   /translation="MLEKRGNIVPINIEKEMKNSYIDYSMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMIELGITPDKPHKKSARIVGDVLGKYHPHGDTAVYDAMVRLAQDFSMRYMLVD
FT                   GHGNFGSVDGDGAAAMRYTEARLSKMAMEMIRDINKDTVDYRPNFDESLKEPSVLPSKF
FT                   PNLLVNGSNGIAVGMATNIPPHNLGEVIDGVVTLIDNSEAQVEDLMEHIKGPDFPTAAT
FT                   IMGTEGIKEAYTTGRGRIKVRAKASIEEVNKGRQQIIITEIPYQVNKARLIEKIAELVR
FT                   DKKVEGISDLRDESDREGMRIVIELKRDANANVVLNKLYKHTQLEDTFGVIMLAIVNGE
FT                   PKVLNLKEVLTHYLDHQKDIITRRTQFDLNKAEERAHILEGLKIAIDNLDEVIKLIRGS
FT                   ENTQIAKTGLMETFTLSEKQAQAILDMRLQKLTGLEIEKVEEEYEDLIKLINHFKEILA
FT                   NERLMLNIIKDELIEIKEKYGDERRTEITRAIGEINIEDMITEEEVVITLTHFGYIKRL
FT                   PADTYKSQKRGGKGIAALTTREEDFVENLITSSSHDYLLFFTNFGRVYKLNVYEIPEAR
FT                   RQAKGTAIVNLIPLSPNETVAATIPVGRQFDSKYLVLATKNGIIKKTQLSQFESTRKSG
FT                   LIAISIREDDELIKVKLTDEDSEIILITAQGMSIRFKEQDVRDMGRSAMGVKGINLSPK
FT                   DHVVSMEIVEENKDLLVISEKGFGKRTDTSEYRLQTRGGKGIKTYNVTGKTGPLVGAKI
FT                   VTDEDEVLLINNYGTVIRLNVSNISKLGRNTKGVTLMRMEEDQSIITIALMASTENEEV
FT                   EEGLTEE"
FT   gene            9496..9813
FT                   /locus_tag="Clos_0008"
FT   CDS_pept        9496..9813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0008"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   amt:Amet_0008 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17578"
FT                   /db_xref="GOA:A8MEA7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA7"
FT                   /protein_id="ABW17578.1"
FT                   /translation="MSLQIKKDFNNEDNQWLVGLEGEVDIYTAGELKEFFMKIIEEKKE
FT                   NIKIDAEKLEYIDSTGLGILIGVLKRLKKEDKNIIIANIKPNVKKLLNITGLDKIFIIE
FT                   G"
FT   gene            9821..10249
FT                   /locus_tag="Clos_0009"
FT   CDS_pept        9821..10249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0009"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: amt:Amet_0009 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17579"
FT                   /db_xref="GOA:A8MEA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA8"
FT                   /protein_id="ABW17579.1"
FT                   /translation="MNMMQMDEFKLTVPSKPEYVGVIRLTLAAIASRVGFDIEKIEDMK
FT                   VAVAEACTNAIIHGCHCEHGKNFNIDFVSTEEKLTILVYDDGEGCYLDNIEEPDLTKPK
FT                   EGGLGIFIIKSLMDDVEIKSEKGKGMMIKMIKYLGDEA"
FT   gene            10249..11061
FT                   /locus_tag="Clos_0010"
FT   CDS_pept        10249..11061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0010"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-B/F/G type; PFAM: sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: amt:Amet_0010 phage transcriptional
FT                   regulator, RinA family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17580"
FT                   /db_xref="GOA:A8MEA9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEA9"
FT                   /protein_id="ABW17580.1"
FT                   /translation="MANIANSTEADDYMIMNKSKKEKNLTEKELFKEYALTRDIEIRNE
FT                   LINRHLYIAEILSKKFLNKGIEYEDIYQVASLGLIYAIERYDVTKGFEFSSFATPTIIG
FT                   EIKKYFRDKGWSIRVPRRIQELSKKVNVSKNTLQQTLQRTPTVKDIAEYLNCTEEEVIE
FT                   AMEASQVYTPKSLDLIYDNDGDDKDIQLLDLIGELDKRFDDIENKDFFQKAIDKLNEVE
FT                   KKVLKDRFFNNKTQMKVSEELNVSQMTVSRMEKRIIEKFKKELDRSME"
FT   gene            11368..12872
FT                   /locus_tag="Clos_R0001"
FT   rRNA            11368..12872
FT                   /locus_tag="Clos_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            13101..16036
FT                   /locus_tag="Clos_R0002"
FT   rRNA            13101..16036
FT                   /locus_tag="Clos_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            16086..16202
FT                   /locus_tag="Clos_R0003"
FT   rRNA            16086..16202
FT                   /locus_tag="Clos_R0003"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 98.20"
FT   gene            16349..16867
FT                   /locus_tag="Clos_0011"
FT   CDS_pept        16349..16867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0011"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix type 11
FT                   domain protein; KEGG: amt:Amet_0020 3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17581"
FT                   /db_xref="GOA:A8MEB0"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB0"
FT                   /protein_id="ABW17581.1"
FT                   /translation="MNSIERRKYILDNLIKHKAPIKGTELAQLFNVTRQIIVQDIALLR
FT                   AQGADIISTPQGYIIPFKKDNRIIKRIACKHEGYSPIREELQIMLDHGATIVDVIVEHP
FT                   LYGEITSQLNITNKIDLDGFIENITKKKAEPLASLTDGIHIHTIEIANEKIFEDLKKAL
FT                   DEKGYLIKD"
FT   gene            16911..17957
FT                   /locus_tag="Clos_0012"
FT   CDS_pept        16911..17957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0012"
FT                   /product="phosphotransferase system, EIIC"
FT                   /note="KEGG: amt:Amet_0021 phosphotransferase system, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17582"
FT                   /db_xref="GOA:A8MEB1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB1"
FT                   /protein_id="ABW17582.1"
FT                   /translation="MKINNNKVTIREYFTKALNGMALGLFSSLIIGLILKQIGELTNIS
FT                   MLVYFGQVAQFLMGPAIGAGVAYSVGAPPLAVFASIATGAIGANTISLTEQGVFAIIVG
FT                   EPVGAFIAALMGAEVVKWIAGKTKVDIVLVPAATIVMGGVAGTFIAPSIASIMKILGNV
FT                   INTVTELHPIPMGILLSVLMGMILTLPISSAALSISLGLNGLAAGAAVVGCCTQMVGFA
FT                   VASYKENGIGGLIAQGLGTSMLQVPNIIRNPFVWIPPTLASAFLGPLSTTIIRMENNSI
FT                   GAGMGTSGLVGQFGAFTTMVAQNGESVISVMAKIAILHFILPAILTFFIAQFMRSKGWI
FT                   KDGDMKLD"
FT   gene            complement(18122..18316)
FT                   /locus_tag="Clos_0013"
FT   CDS_pept        complement(18122..18316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17583"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB2"
FT                   /protein_id="ABW17583.1"
FT                   /translation="MNDINLMGQIADLKEVDYRNTLAIATLLELLIDKGIITRQEFAKK
FT                   SYYLDNISLEQLKKLRTGP"
FT   gene            18900..20177
FT                   /locus_tag="Clos_0014"
FT   CDS_pept        18900..20177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0014"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: amt:Amet_0024 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); seryl-tRNA synthetase class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17584"
FT                   /db_xref="GOA:A8MEB3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEB3"
FT                   /protein_id="ABW17584.1"
FT                   /translation="MLDIKRIRNNLDEIKAAMARRGEKDFDLDAVVALDEKRRELLQQV
FT                   ELMKNEQNTVSKEVPKLKKEGKDATEVMARMKELSGKIKELDGQVKEVEDQLEYTLLRI
FT                   PNVPHPDVPQGETDDDNIEVRKWSEPTHFDFEPKAHWDIATDLGIIDFEAASKITGARF
FT                   ALYKGVGARLERALINFMLDLHIEEHGYTEVLPPFMVNRSSMTGTGQLPKFEEDAFKLP
FT                   QKDYFLVPTAEVPVTNMHRDEIIEGANLPLSYVAYTPCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYAELEKLTNNAEKVLQLLEIPYRIVRICTGDLGFTAAFKYDIEVW
FT                   MPSYNRYVEISSCSNFEDFQARRANIRYRPEEKGKVEFLHTLNGSGLAVGRTVAAILEN
FT                   CQDDEGNVKIPEALIPYMRGIKVITK"
FT   gene            20282..20449
FT                   /locus_tag="Clos_0015"
FT   CDS_pept        20282..20449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17585"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB4"
FT                   /protein_id="ABW17585.1"
FT                   /translation="MERKKIIRSTVKDKFDYEEDIYDKLSNLEKGRKETPYFKRIKKTE
FT                   FDYEKDPYEP"
FT   gene            20517..20593
FT                   /locus_tag="Clos_R0004"
FT                   /note="tRNA-Arg1"
FT   tRNA            20517..20593
FT                   /locus_tag="Clos_R0004"
FT                   /product="tRNA-Arg"
FT   gene            20878..22308
FT                   /locus_tag="Clos_0016"
FT   CDS_pept        20878..22308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0016"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; KEGG: ctc:CTC01477 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17586"
FT                   /db_xref="GOA:A8MEB5"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB5"
FT                   /protein_id="ABW17586.1"
FT                   /translation="MKSSIRQVTMILIVSMAMLFFVSCKNSSQQLISNEKLIAVGQLTK
FT                   EDFLSDFDYMMQTMEDTFPYFGVAERKLGVDIRARGRETRSIIEKYPYSLQGFASELGI
FT                   SFEDMPELDEHVFWSIIRHEFFSHFIGLAHAYPLNSGLYNTFQRPYSSSYSTSNNHHAF
FT                   TNPISQKFYREQEVLFNTLDEEGALFQFIFRSSPLLQIKDSTVKGEIIEKDRIAYLNVP
FT                   SFLNFNVNTDTDTLRRFYRDINECDHLIIDIRDNDGGSPDIWRMFIMKPLWQNRDHMPD
FT                   MPLYAFYRDSKLGKSLGEESLKIEAQGSRNIPESDNLLTISEIIEENHFSHMNEQDVQD
FT                   LAYGVRFNTSISNIQWHHIQQMRFPYIPDTSFDGKVWLLTNGNNYSGGALFARHAKEMG
FT                   FATLVGEQTGGAYTTSAGMFFALPNTGIILRWDIDYLTDSEGRALNEFPTTPHHLNRPG
FT                   MDALETVLQLIEEEVIDK"
FT   sig_peptide     20878..20964
FT                   /locus_tag="Clos_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.321 at
FT                   residue 29"
FT   gene            22464..22763
FT                   /locus_tag="Clos_0017"
FT   CDS_pept        22464..22763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0017"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: amt:Amet_4264
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17587"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB6"
FT                   /protein_id="ABW17587.1"
FT                   /translation="MQFIVKAYDGKDEGAYERRLEARDAHLAGAKAMYDNKTLLFAAAM
FT                   LDEEDKMIGSTMIVEFPSKEAIEKEWFAEEPYIRNKVWEKIEIVPCKVPPFCIK"
FT   gene            22876..23340
FT                   /locus_tag="Clos_0018"
FT   CDS_pept        22876..23340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0018"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   amt:Amet_0026 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17588"
FT                   /db_xref="GOA:A8MEB7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB7"
FT                   /protein_id="ABW17588.1"
FT                   /translation="MVLEENFMLEAIEEAKKAFNKKEVPIGAVVVKDNEIIGRGHNLRE
FT                   TTKNSISHAEIMAIQEACKFLGGWRLTDCTLYVTIEPCPMCAGAILQSRIQKVVIGAMD
FT                   PKAGACGSLVNLLNDSRFNHQTEIEQGVLEEECSLLMKEFFKALREKRFG"
FT   gene            23350..23438
FT                   /locus_tag="Clos_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            23350..23438
FT                   /locus_tag="Clos_R0005"
FT                   /product="tRNA-Ser"
FT   gene            23573..23673
FT                   /gene="ffs"
FT                   /locus_tag="Clos_R0006"
FT   misc_RNA        23573..23673
FT                   /gene="ffs"
FT                   /locus_tag="Clos_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            23941..24945
FT                   /locus_tag="Clos_0019"
FT   CDS_pept        23941..24945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0019"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="TIGRFAM: lipoyltransferase and lipoate-protein
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   cbo:CBO1635 lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17589"
FT                   /db_xref="GOA:A8MEB8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB8"
FT                   /protein_id="ABW17589.1"
FT                   /translation="MKYIENHSTDPHYNLAFEEYVFKNLPLEEGGYVLLWRNGPSIIIG
FT                   KNQNSIEEINMEFVKENNIHVVRRVTGGGAVYHDLQNVNFSFITKAEELGEIDFKTYTI
FT                   PVLRALESLGIPCELSGRNDITIDGKKFSGIAQSVVKGRVLNHGTLLFNSELEVLSKAL
FT                   NVKRDKIESKGVKSVASRVTNIKPYLKEDVDVLEFRDLILDNIFKFLNLPIEKYELTEE
FT                   DKNAIQKMVDERYGTWDWNFGKSPKFNYKGYQRFAGGGVEVRLQVEKGLIEECKIYGDF
FT                   FGKGDIAVLEEKLKGIKYNEEAVEEALKDIAVGDYLGRITKEEFFLCLFNLID"
FT   gene            complement(25004..26275)
FT                   /locus_tag="Clos_0020"
FT   CDS_pept        complement(25004..26275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17590"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEB9"
FT                   /protein_id="ABW17590.1"
FT                   /translation="MSEERLMILRLLEQGKISEVEAEQLLDALGDIEYDQAKQEASSSF
FT                   NYSQVNLSKDEDDEHNHYYKEKQHYNPNKNKDFEEIFDSLGKKFEGLGEHLEGKMDVFG
FT                   EQFGKKMMDLGSIFANKSISFAEKIIDVVEKAVDSDTFINVDLFSPVMVYEEVLEKKLE
FT                   DNSHLSLQFESYNGNISIHKWNEPTIKVTAHISAKEGKYDSANPIFTLNEDNNSIYFYP
FT                   RPLEGAGVKLKVEVPEGLYNLIKAQTTNGSISAENLNCNRLLLQTKNGSIKINNIHTQE
FT                   NTSCTTTNGKIVVEKCKAENLLAATKNGRISIENSTIKRIEGLTSNSKITVIDIAYNLL
FT                   QSLSLKTTNSKIEVIGTVPENTGFSLEANTTQGNINIGIPVAYSENIKTYSNHRVHGKT
FT                   SNFDKCETIANIKAYTTNSNIYLF"
FT   gene            complement(26419..26781)
FT                   /locus_tag="Clos_0021"
FT   CDS_pept        complement(26419..26781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17591"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC0"
FT                   /protein_id="ABW17591.1"
FT                   /translation="MKKEILGQCPVCNHSLEVTKLHCSHCSTTIEGSFQPCKFCQLSPE
FT                   YKNFIEVFIKNRGNIKEIEKELGISYPTVRGKLESVITALGYSAKPISTVNKKDILEKL
FT                   SKGEITAEEAVDLLKE"
FT   gene            27112..27720
FT                   /locus_tag="Clos_0022"
FT   CDS_pept        27112..27720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0022"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: amt:Amet_0027 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17592"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC1"
FT                   /protein_id="ABW17592.1"
FT                   /translation="MNKEVDARGMNCPLPVIHTKKALESIDDGRITTIVDNEVAKENVA
FT                   KLAKSMNLKVDIKQDLGNYYIDIFKDSGMEIIGIETLDIQKTSNNSKDLVILISTDKFG
FT                   EGSEELGKLLMKSYVYALTEVMPQPTALIFLNSGVKLTIKDSEVIDHIRTLESRGVEVL
FT                   SCGTCLDYYKIKDQLAVGGISNMYTIVEKLNNAGNTIKL"
FT   gene            27736..28005
FT                   /locus_tag="Clos_0023"
FT   CDS_pept        27736..28005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0028 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17593"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC2"
FT                   /protein_id="ABW17593.1"
FT                   /translation="MINQEELYIIVFESTHHAIAGEKIFKESNYKFDVIPTPREITHSC
FT                   GLSIRFHKDKLNDVKMKMAEGNILIKGIYEIQKIDKDKIIHQVG"
FT   gene            28022..28210
FT                   /locus_tag="Clos_0024"
FT   CDS_pept        28022..28210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0024"
FT                   /product="protein of unknown function DUF951"
FT                   /note="PFAM: protein of unknown function DUF951; KEGG:
FT                   amt:Amet_0030 protein of unknown function DUF951"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17594"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC3"
FT                   /protein_id="ABW17594.1"
FT                   /translation="MPVKLEIGDIVELKKQHPCGSKNFEILRTGADFRIKCLGCEKQIW
FT                   LERPELERRIKKINPAG"
FT   gene            28424..29599
FT                   /locus_tag="Clos_0025"
FT   CDS_pept        28424..29599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0025"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   amt:Amet_0031 putative transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17595"
FT                   /db_xref="GOA:A8MEC4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC4"
FT                   /protein_id="ABW17595.1"
FT                   /translation="MKFAKRMDYLKASEIRELLKLAEKPEIISFAGGLPAPELFPTEEL
FT                   AKVSEVVLKEHGMQALQYGPTDGFTPLREKIAKRMEVFGFKTNAENILITSGSQQGLDF
FT                   SARVFLNEGDIVICESPSYLGAINAFKACMPEFVEVATDAEGMVMEDLEEILKTRDNVK
FT                   MIYVIPDFQNPSGKTWSVERRKRLIELANEYDLPVIEDNPYGELRFEGEIPPSLKAFDT
FT                   EGRVIFLGTFSKTFSPGMRLGWVIADAPILQKYNFIKQGADLQSSTIAQREMNTYMEMY
FT                   DFDAHIEKIKKVYKNRRDVMIEAIKEHFPSNVTYTYPEGGLFTWVVLPEHLSARDIMPK
FT                   ALENNVAFVPGGSFYPNGGNENTFRLNYSNMSEDKIKEGIARLGKVLKEMM"
FT   gene            29851..31608
FT                   /locus_tag="Clos_0026"
FT   CDS_pept        29851..31608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0026"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: amt:Amet_0663 sigma54 specific transcriptional
FT                   regulator, Fis family; TIGRFAM: PAS sensor protein; PFAM:
FT                   CBS domain containing protein; sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17596"
FT                   /db_xref="GOA:A8MEC5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC5"
FT                   /protein_id="ABW17596.1"
FT                   /translation="MFLEVLNNMNVSDVMDIDIVTITKDATLGQAMQIMLKYNKGDVIV
FT                   LNNTNELFGILTMTDISIIGGTFFCKNNLDDSVELYCNQNIVTIGPDEDAIWAKDLMKR
FT                   KGIGRLPVIRENKIIGIVRIKDILDKVYFKIDKTMEAFGHILNNIHEAVCVVDKYGKVI
FT                   FWSKNSEVLYGIKSEDIINKNIREYFPQAILLNVLENRKSVNSIHHIPREGSHVFLSAE
FT                   PLYIDNEFVGSVSTDRDITEIINLSMELEKTKERLHFLQSEMKKITNTRYSFDKVLGKS
FT                   ESIVNIVNNAKKVARTNSSVLITGESGTGKEVFARALHEESGRKGDFVAINCSAIPESL
FT                   FESEMFGYDGGAFTGALKNGKIGKIELANKGTLFLDEIGDMPFYMQAKMLRVLQERQIV
FT                   RIGSDKVIEVDVRIISATHRDLRKLVNEGKFREDLFYRLNVVNISLPSLRKRKEDIPML
FT                   ITKFIKEFCEENKINYPNMTPEVLKILVNYDWKGNIRELKNAVDHLLIFSQDGEITTNS
FT                   LPEHIFNSHRINHLDEEDFDLQKTIEKIEYETIKKAMSKAGNNKSKAATILNIPRSTLY
FT                   YKMNYYRMG"
FT   gene            31947..33113
FT                   /locus_tag="Clos_0027"
FT   CDS_pept        31947..33113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0027"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: amt:Amet_0664 respiratory-chain NADH
FT                   dehydrogenase domain, 51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17597"
FT                   /db_xref="GOA:A8MEC6"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR031001"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC6"
FT                   /protein_id="ABW17597.1"
FT                   /translation="MLIKISLKQHVGVESKAIVKENEKVKKGQLLAVPDGLGSNIHSSV
FT                   HGIIEKVTSEYVSIKAYSDQSEDYMMIKATDNYLEAIKEAGVVGAGGAGFPTHIKLDVD
FT                   LTGGYVIVNAAECEPVLNHNMLAIEKQPDLILRGLKYVMEITKAAKGYIAIKPKNKNAI
FT                   IALGKVCKSESNIEIKFLPDMYPAGDERVIVRELLNVELKPGKLPIEVNTVVLNIETIK
FT                   NICLAIEKRKPVITKDITVGGRVKAPKVFLESPIGYPVSYFIDQCGGYENPHGEIVIGG
FT                   PFTGKKGGEETTIIKTTGGILVAMPFPVEKRKVGIIACECGAQEERLKEIAAGMEAEVV
FT                   AEVQCKRMTAFNGRYRCDLPGVCPGQAEKVLFLKKQGAEVIITGTCED"
FT   gene            33239..35122
FT                   /locus_tag="Clos_0028"
FT   CDS_pept        33239..35122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0028"
FT                   /product="Glycine/sarcosine/betaine reductase complex
FT                   protein B alpha and beta subunits"
FT                   /note="PFAM: Glycine/sarcosine/betaine reductase complex
FT                   protein B alpha and beta subunits; KEGG: amt:Amet_0665
FT                   D-proline reductase (dithiol)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17598"
FT                   /db_xref="GOA:A8MEC7"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR031002"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC7"
FT                   /protein_id="ABW17598.1"
FT                   /translation="MSISLETAKDHGNDPAVSCCRFEAGIVIGPSNLEDPNIFPDLVDS
FT                   KLLQIPEDCLKISEVIGAKLIKTIDALVPITADYVEGIHKPVAVEEKSNATKQEEKKVE
FT                   SIVPQEVSSKAKNTAMIKIHIGEGKDIDLEIPILLSGANTISGLDDAEQMVARTEEVKE
FT                   ARSNIMDQPFVSKEIRRLTKKHFSITSVEFGKETKIDGTTLYIREDICKDALKADKLVV
FT                   DIKLDIITPDRYKEYSETIMDVQPIATKEEGKLGNGITRVLDGVIIMVTGTDENGVQIG
FT                   EFGSSEGVLETNIMWGRPGAPDKGDIFIKTQVVIKDGTNMERPGPLAAHKASDFITQEI
FT                   REALKRLDESLVTNVEELVQYRRPGKKKIAIVKEIMGQGAMHDNLILPVEPVGVLGGKP
FT                   NVDLGNIPVVLSPLEVLDGSIHALTCIGPASKENSRHYWREPLVIEAMNDEEIDLASVI
FT                   FVGSPQINAEKFYVSERLGMIIESMDLDGVIITTEGFGNNHIDFASHHEQVGQRGVPVV
FT                   GMTFAANQGALVVGNEYMTHMIDLNKSKLGIENEILSNNTLCKEDAIRAIAMLKAAMAN
FT                   EHVKEAERKWNANVKINNIEILEKTYESKIGLVDNEQILPKSKKRLEIYEK"
FT   gene            35154..35438
FT                   /locus_tag="Clos_0029"
FT   CDS_pept        35154..35438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17599"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC8"
FT                   /protein_id="ABW17599.1"
FT                   /translation="MENLRFGDKQIYMEGIIIEIQDGAVSIDLKGRLGFMKIPRRMLIS
FT                   NHNIKVGQEVGFMMSYPESLSEEINEKYLDLINHNKKMREERSNESFNS"
FT   gene            35419..36144
FT                   /locus_tag="Clos_0030"
FT   CDS_pept        35419..36144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:35869..35871,aa:Sec)
FT                   /locus_tag="Clos_0030"
FT                   /product="D-proline reductase (dithiol)"
FT                   /EC_number="1.21.4.1"
FT                   /note="KEGG: cbo:CBO2477 subunit of proline reductase;
FT                   Contains selenocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17600"
FT                   /db_xref="GOA:A8MEC9"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="InterPro:IPR022787"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEC9"
FT                   /protein_id="ABW17600.1"
FT                   /translation="MSLSIVKGLQSEIFVPITPPPVWTPVKKELKDMTIALATAAGVHL
FT                   KSDKRFNLAGDFSFREVPVESLSTDLMVSHGGYDNGDVNKDINCMFPIDRLKELAEEGF
FT                   IKAAAPVHFGFMGGGGDQQKFQEETGPEIARRLKSEGVDAVLLTAGUGTCHRSAVIVQR
FT                   AIEESGIPTIIIAALPPVVRQNGTPRAVAPLVPMGANAGAPNDKAMQTAIVRDSLIQLV
FT                   EITSAGKIVQLPYEYTAKV"
FT   gene            36201..36962
FT                   /locus_tag="Clos_0031"
FT   CDS_pept        36201..36962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0031"
FT                   /product="D-proline reductase (dithiol)"
FT                   /EC_number="1.21.4.1"
FT                   /note="KEGG: cdf:CD3240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17601"
FT                   /db_xref="GOA:A8MED0"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR031000"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED0"
FT                   /protein_id="ABW17601.1"
FT                   /translation="MEKEINLRRLVIKSFHIDNVLLGDENSVDKGNLTISRRSLDLILQ
FT                   KEEAIESININVISPKDHNLWVNSIMDIIPISTKVLGKLGEGITHTFTGVYVMLTGVSK
FT                   DGFQLAEFGSSEGILKDVIFLGRAGTPSKNDFIINFDVTFKRGYALDRNLPRVAHRSCD
FT                   RFIQPIRELLKIMDGRTATEFNEYYDKIRPEKKKVVIIKQIAGQGAMYDNQLFPKEPSG
FT                   FDGGRSIIDMGNMPIIVTPNEYRDGALRAMT"
FT   gene            36977..37447
FT                   /locus_tag="Clos_0032"
FT   CDS_pept        36977..37447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0032"
FT                   /product="D-proline reductase (dithiol)"
FT                   /EC_number="1.21.4.1"
FT                   /note="KEGG: amt:Amet_0670 D-proline reductase (dithiol)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17602"
FT                   /db_xref="GOA:A8MED1"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED1"
FT                   /protein_id="ABW17602.1"
FT                   /translation="MGIGPSTKETTLHHFRDPLLNVVSGDEDIDLLGVIFVGTPQDNRD
FT                   KHFVGQRTAAMIEMMRADGVIISVDGWGNSHVDYANTIEEIGKRRISVVGISFIGKQAS
FT                   FVVKNKYMDTIVDFNKSAKGIETEVVGENNVTLLDAKKALALLKLKMKREDK"
FT   gene            37448..38455
FT                   /locus_tag="Clos_0033"
FT   CDS_pept        37448..38455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0033"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: amt:Amet_0671 proline
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17603"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED2"
FT                   /protein_id="ABW17603.1"
FT                   /translation="MNFTKSIHTIDSHTMGEPTRIVVGGIPNIPGDTMAEKKAFLEKEM
FT                   DAVRTTIMHEPRGHNDMFGSIILAPTHKEADFGIIFMDGGGYLNMCGHGSIGAITVAIE
FT                   TGMVEKKEPFTEVAMDTPAGLIRGKARIENGRVKEVSIVNVPAFLYKKDVVINVPDIGD
FT                   VILDISFGGSFFAIVNAKQLMVTIDPKNTQRLIEIGLKIREIINHTIDIKHPNLEHIKT
FT                   VDLVEIFDDAVHQNAHYRNVVIFGQGQVDRSPCGTGTSAKLATLYAKGQIKMDEPFIYE
FT                   SILGTTFKGRILGTTKVGDYEAIIPEITGSAFITGFNQFVISPDDPVKNGFVLK"
FT   gene            38545..39432
FT                   /locus_tag="Clos_0034"
FT   CDS_pept        38545..39432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0034"
FT                   /product="membrane protein"
FT                   /note="KEGG: cbo:CBO3180 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17604"
FT                   /db_xref="GOA:A8MED3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED3"
FT                   /protein_id="ABW17604.1"
FT                   /translation="MLKLVLGVLTVLVAWFTIIFLKDFNNNKNNLESNSWVKVGIIGFI
FT                   TNFFDTLGIGSFAPTTALLKAFKQTKDKVIPGTLNVACTIPVVTEAFIFMTVIEVEPVT
FT                   LIGMLSAAAIGAWVGAGIVSKLPEKKIQITMGIALFVTAFLMFASKMGWMPGGGEAIGL
FT                   EGGKLVFAIAANFVLGALMTAGIGLYAPCMALVYFLGMSPSVAFPIMMGSCAFLMPVAS
FT                   VKFVKEGAYDRKASLGITLGGIVGVFIAAYIVKSLPLNVLGWVIILVILYTSTTMLLSA
FT                   FKPRKESDVVQNLR"
FT   gene            39789..40073
FT                   /locus_tag="Clos_0035"
FT   CDS_pept        39789..40073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0035"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: amt:Amet_0032
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17605"
FT                   /db_xref="GOA:A8MED4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MED4"
FT                   /protein_id="ABW17605.1"
FT                   /translation="MNKYELVYILKSNVEEEKRNQLLDKFRGIIEADGTIENVDEWGNR
FT                   RLAYEINKINEGYYTLVNFSAAADVPKELDRNLKIADEVIRHMIIRLEK"
FT   gene            40093..40506
FT                   /locus_tag="Clos_0036"
FT   CDS_pept        40093..40506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0036"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: amt:Amet_0033 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17606"
FT                   /db_xref="GOA:A8MED5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED5"
FT                   /protein_id="ABW17606.1"
FT                   /translation="MNRVILIGRLARDPELRFTASGKAVATFSIAVNRPFSKEKEADFF
FT                   NIVVWGKSAENCANYLSKGRLVGLEGRLQSRSYETQTGEKRYITEVIADQVEFLEWGNK
FT                   EGQTPTRRNDDFGSVDIDISEFQAMDDDEDIPF"
FT   gene            40522..40758
FT                   /locus_tag="Clos_0037"
FT   CDS_pept        40522..40758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0037"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: amt:Amet_0034
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17607"
FT                   /db_xref="GOA:A8MED6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MED6"
FT                   /protein_id="ABW17607.1"
FT                   /translation="MMENNKRKRKARKKICVFCADKSKNIDYKDVHKLKKYITERGKIL
FT                   PRRISGNCAIHQRELTQAIKRSRHIALLPYTMD"
FT   gene            complement(40868..42715)
FT                   /locus_tag="Clos_0038"
FT   CDS_pept        complement(40868..42715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0038"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tde:TDE0028 ABC transporter, ATP-binding protein,
FT                   HlyB family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17608"
FT                   /db_xref="GOA:A8MED7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED7"
FT                   /protein_id="ABW17608.1"
FT                   /translation="MKSNQFKIVIDDTREILKWISHISKWFFPLILAKNIIQATLPYIH
FT                   ILFGYLILDGIIAKDSSSDIMKNLYWMIGLNLGLGLLHSFLTRLLNVKTEYIHHATKAE
FT                   IARKAQTLDYEELEKKESLDLLRRAEEGINSNGGIPSFCNTIGSLITHAITIVYSILLL
FT                   SGLFIAAPKENATVLERVFNSPLPTLLFFILFASALFLNFKISEQLNKRSYAFFEENVD
FT                   TNRILNYFGGVSNNYNFGKDIRIYGMADMIQEEMNQKNDAIITMMRSLGITYGRYSALI
FT                   EIVNQFVIFSVYIFVGIKAILGLVSIGSILKYVGALIRFIGAVSSITIFYTQLDLQRQY
FT                   LNNYSLFLNLENKKYQGTLPIEKRDDNEYELEFRNVSFRYPNSPDTVLDRISFKLKVGN
FT                   KMAIVGRNGAGKTTFIKLLCRLYDPTEGEILLNGINIKKYDYKEYLQIFSVVFQDFKLF
FT                   SFDIGQNVAASIDVNEEKVWKALEQSGISERVKKMDRGIYTNIYQNEENGIEISGGEAQ
FT                   KIAISRALYRDAPIVILDEPTSALDPMAEYEIYARFDHMVSQKTSIYISHRMSSCRFCD
FT                   HILVFDKGRIAQVGNHTTLMKDEKGLYHTLWTKQAKYYN"
FT   gene            complement(42696..44522)
FT                   /locus_tag="Clos_0039"
FT   CDS_pept        complement(42696..44522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0039"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tde:TDE1061 ABC transporter, ATP-binding/permease
FT                   protein, HlyB family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17609"
FT                   /db_xref="GOA:A8MED8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED8"
FT                   /protein_id="ABW17609.1"
FT                   /translation="MTYSLFSNIRYLYQKLFNFDKKFRFYIPLHFLCEFSLPLLSSVIP
FT                   ALAVKLITESADIQSYILIIGITVALYAFILSAKQYLYQRINFENTLLRLKDFIIANGV
FT                   KLMTTDYVNVEPQEKQLVIQKALNALTSNWVGVEFMMKNTPVFFLNISGLLTYGLLITA
FT                   LDYKIILVLALMTLLNIVLTNYARAYEEKHKKEYVNYDRQIRYLYENSTSLINGKDIRM
FT                   YQMEDWFYALFQQLIKKRVAWHKQVEFRYFIPALSDNLLLFIRDFMAYGILIRSVLGGQ
FT                   IDAAQFTFYIGILAGFSTFLTEAVNAYSNLRRANLGVNDYRLMDEIKEVFNHGDGCDLP
FT                   QPSDYPLSIEFENVSFRYPGATKDTISNFNLKIEPGSKIALVGVNGAGKTTLVKLLSGL
FT                   YYPTQGEIRIHGKSLTDYNIEEYYKLIAAIFQDVQVLAFTIAKNVAVCRDELIDYDRVR
FT                   QCLALAGLKEDVDLLKYKEHTYLTQNLDKEGVMLSGGQMQKLMLARALYKDAPILILDE
FT                   PTAALDPIAESEIYEKYNDLTAGKTSLFISHRLSSTKFCDRILFLEEGRIVEDGTHDEL
FT                   LAKGGKYAEMFEIQSHYYKENSEVGFYEKQSI"
FT   gene            complement(44755..45642)
FT                   /locus_tag="Clos_0040"
FT   CDS_pept        complement(44755..45642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0040"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: lca:LSEI_2600 predicted signal transduction
FT                   protein with a C-terminal HATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17610"
FT                   /db_xref="GOA:A8MED9"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A8MED9"
FT                   /protein_id="ABW17610.1"
FT                   /translation="MIEPLNRTLIICVYHFILCLFFLLSHVKKHTVSFIFQGIFYLVMV
FT                   LIAYCSVLYLQNRIWISFLLSTLVFVIAEYHHYFIKKIYDQLEIEHQDKLVSHHIDEVQ
FT                   SIYLTMREWRHDYHNHMQTLKAHMAMAQYDLANQYLDELEKDLNDIRIFIKSGNINLDA
FT                   ILNSKLSLAKSKNITVNCKAQLPSKLTISDIDLCVLIGNLLDNALEACEQMPPDTEPFL
FT                   RIYIGIFKQQLYISVTNSTKDLVRKLDHEYITNKRGNHGHGLKRIYNTVKKYEGFINSQ
FT                   NEPGVFVTEIMLPL"
FT   gene            complement(45639..46355)
FT                   /locus_tag="Clos_0041"
FT   CDS_pept        complement(45639..46355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0041"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: tde:TDE0033 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17611"
FT                   /db_xref="GOA:A8MEE0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE0"
FT                   /protein_id="ABW17611.1"
FT                   /translation="MRIGLCDDNQVQLNYIQTLIFSWMNLKNIQCHISTYISAEEFIFE
FT                   HPDTYPFDLLILDIQMGNMNGMELAKNIRATDANIMIIFLTGLEEYVYEGYEVGALRYL
FT                   LKPINEQQLMVLLDESLHKVKRNIHKWYIFTYNGNTMKLNHNDIVYIEARGHYVDLVTT
FT                   GNHYEIKRNISQLFKDLGESDFFCCHRSYIVNLNHVEKINKSDCVLSTGVSIPVSRGNY
FT                   SGLNKAFIHYYRRKSL"
FT   gene            46667..47527
FT                   /locus_tag="Clos_0042"
FT   CDS_pept        46667..47527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0042"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: amt:Amet_1075
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17612"
FT                   /db_xref="GOA:A8MEE1"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEE1"
FT                   /protein_id="ABW17612.1"
FT                   /translation="MSYVITDETKLTGIIGRPIKQSFSPKIHNGAFQYLNLNYIYIPFE
FT                   VVQQDLSKTVEAMKVLKFRGFNVTMPHKREVMNYLDEVSENAKIIGAVNTVVNQNGKLV
FT                   GHNTDGKGYVQSLEDEGIYVKEKTFVIAGAGGAARSVAVQLALDGAKKITILNRTIDKA
FT                   HDIAQLIGMSIPNVHIEINCLENKTLAKAVEEADVLINTTSLGMYSMEEESIIGEEKVL
FT                   PSNLVVSDLIYNPAKTKLLQQAESRGCKTINGLGMLIGQAAIAFELWTEVAMPIDYIKK
FT                   TLFTR"
FT   gene            47677..48093
FT                   /locus_tag="Clos_0043"
FT   CDS_pept        47677..48093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0036 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17613"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE2"
FT                   /protein_id="ABW17613.1"
FT                   /translation="MAYVVIGDRFVDSEDILKTILKGTEFKKVKDLTKGSKREDTLVFQ
FT                   IIQDVNQLKKELDTEESGIAIDDEELVEELMSLADEIAYNIEEFLPEEVVCYVYSYHYD
FT                   EGLEEIRTIVVAASEEIGGLRLRDVAERILRSVD"
FT   gene            48196..48789
FT                   /locus_tag="Clos_0044"
FT   CDS_pept        48196..48789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0044"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   amt:Amet_0037 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17614"
FT                   /db_xref="GOA:A8MEE3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE3"
FT                   /protein_id="ABW17614.1"
FT                   /translation="MATPVLNIELRDFKGKNQMLKTRRSGNVPGVVYSRGEKTKKVLFN
FT                   EREMEKILSRYGQSMKIALNLGGERFFAIIKEIQKGSIHNEILHIDFQTLDENEKVKIQ
FT                   MPIQIIHREEVESSVRLMQMNMNEVEIQTYPRYLPDKVELDATKLNEKDVLTIADLDIA
FT                   ENEHIEILEDREKVIASFAYISNKAEVAATEAEA"
FT   gene            48996..49571
FT                   /locus_tag="Clos_0045"
FT   CDS_pept        48996..49571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0045"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   amt:Amet_0038 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17615"
FT                   /db_xref="GOA:A8MEE4"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE4"
FT                   /protein_id="ABW17615.1"
FT                   /translation="MKYAFRSEVRKNVGKNSSHRLREKGYVPAVIYGSNINTIPIELDH
FT                   NEVQECIRNNNGGGLVTLNIDENDYTVFIKEIQKDPVTGNIIHLDFQQVDQNEKIHVLV
FT                   PIILKGKSNIKRSGSILQQQLRDLEVECSANNIPKALEVDISHFKPGDTLKVGDVEFGE
FT                   EISIVHDAESIIASVAFAQQNIESETEV"
FT   gene            49919..51423
FT                   /locus_tag="Clos_R0007"
FT   rRNA            49919..51423
FT                   /locus_tag="Clos_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            51652..54587
FT                   /locus_tag="Clos_R0008"
FT   rRNA            51652..54587
FT                   /locus_tag="Clos_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            54637..54753
FT                   /locus_tag="Clos_R0009"
FT   rRNA            54637..54753
FT                   /locus_tag="Clos_R0009"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 98.20"
FT   gene            complement(55320..55952)
FT                   /locus_tag="Clos_0046"
FT   CDS_pept        complement(55320..55952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17616"
FT                   /db_xref="GOA:A8MEE5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE5"
FT                   /protein_id="ABW17616.1"
FT                   /translation="MDQLKLKNINILENEFISRKDGIKVRKASPRDLHSIYSIACSVGN
FT                   NKKEATQGFLIDDYASNPKHYQAQLLEKIFELDHFYVAENYNKIVGFLIAYTKEQWLKY
FT                   NEGWTEEVYWKPDFDINKTDDFILIDKTAILSHLTGKGIGSELYKKLIPDIKAKGIHDI
FT                   FAETIISPTPNFASLSFRIKQNYTLAGMRYEDYLNQVLTTLIYHKSI"
FT   gene            56775..57257
FT                   /locus_tag="Clos_0047"
FT   CDS_pept        56775..57257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0047"
FT                   /product="protein of unknown function DUF988"
FT                   /note="PFAM: protein of unknown function DUF988; KEGG:
FT                   amt:Amet_0013 protein of unknown function DUF988"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17617"
FT                   /db_xref="GOA:A8MEE6"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE6"
FT                   /protein_id="ABW17617.1"
FT                   /translation="MKMNKSKFLTQAAMIAAIYVVLVEVFKPISYGIMQIRIAEILTVL
FT                   PYFTPAAIPGLTVGVIISNVIGPYGFLDIVVGSLATLIAAYLTHKIGRKLWAPLPPIIV
FT                   NAIFVGLMLYYIFLGSPDEMPLTAIMGWVALGQVIVCYGLGYPFMAILDKYKNNIF"
FT   gene            57367..59235
FT                   /locus_tag="Clos_0048"
FT   CDS_pept        57367..59235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0048"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="KEGG: cdf:CD2383 putative sigma-54 interacting
FT                   regulatory protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   Propionate catabolism activator domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17618"
FT                   /db_xref="GOA:A8MEE7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE7"
FT                   /protein_id="ABW17618.1"
FT                   /translation="MDKKIGVIASDEELKSRIIELFRDDVQRGKIMIDVLDSDTIDEQG
FT                   RILEGKGARAIIARSGGYKHTVGKVNIPVIHLNVTTPDIIQAIVTAKKYNKDIVLVISD
FT                   LDYFDYDSWKDLMNANIILERFHSKDEIYERVLKYKDIKKEVVIVGGGIPCSLARKWGM
FT                   DNVFINASKESIYEVMGHAKEVIDNLYEQKYNNTVLKTILDEVHDAVIVMNYEGKVRLY
FT                   NERAMELLKKDREEIIGGNLSEVLPELNFIKDAFERKIDISNKIMTIKNITITVNTSIL
FT                   VMDGKTEGILCTFQDISNLQSLEKKIRHELNKKGLIAKYTFDDVVGFSHIMEEVVGKAK
FT                   KIGQSDNTVIIYGESGTGKEIFAQSIHNISKRSKEPFVAINCAAISENLLESELFGYEE
FT                   GSFTGARKGGKPGLFEIAHGGTIFLDEINSISYSLQGKLLRVLQEKETMRIGSDYVIPL
FT                   NIRIIAATNEELKTMVEEGRFRKDLFYRLNILELHIPPLRERKEDILPLFKYFMGDIAK
FT                   DLSYEVPSAIEEKLLAYRWPGNARELRNIAERYIIFKEIDIDSKEIHKNPSNIENDSIC
FT                   INLREINRYVEEKVIEMLVNQGMTKTEIANILGISRTALWKKIKSE"
FT   gene            59560..61341
FT                   /locus_tag="Clos_0049"
FT   CDS_pept        59560..61341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0049"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; thiamine pyrophosphate protein domain
FT                   protein TPP-binding; KEGG: cdf:CD2381 indolepyruvate
FT                   oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17619"
FT                   /db_xref="GOA:A8MEE8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE8"
FT                   /protein_id="ABW17619.1"
FT                   /translation="MKKLLTGNEAIARGAYEAGVRYASAYPGTPSTEILENIALYKGDI
FT                   LAEWATNEKVALEAAIGASIAGARSIASMKHVGVNVASDALFTFAYTGVNGGMVLVTAD
FT                   EPGQHSSQNEQDNRNYAKFAKIPMLEPSNSQESKDMIKTAFEVSENFDTPVLVRVTTRI
FT                   CHSKGIVECSEREDVAIKEYVKDITKYITVPAFAQKMRVKIEGRTQRLLEFSNTTDLNY
FT                   IEWNDTKVGVITSGAAYSFAKEVFGDSVSYLKLGFTYPLPTEKIKEFGSKVEKIYVIEE
FT                   NDPYIEEQVRILGFDCLGNNFFPPYGEMTPDVIRKAVYGETKETLEYDRVKVVPRPPTL
FT                   CAGCPHRGFFHQIGKRKNVMIAGDIGCYTLGFADPYNAMDFNMCMGAASSTGHGAQQVF
FT                   NMTENPKRVVSVMGDSTFFHTGINALMDVSYNGSNTVTVILDNRITGMTGHQDNPGTGY
FT                   TLQGKEAKELDIKTLVLACGIEHVVQIDPNDLTAMKNALDWALSLEEPSVIITRWPCVL
FT                   KRLTTQDKTEFKGVFQDRYSVNHEVCIGCKACVRTGCPAISFDTEHKKSSINIEQCVGC
FT                   SVCYQVCPVKAIGKVEA"
FT   gene            61343..61933
FT                   /locus_tag="Clos_0050"
FT   CDS_pept        61343..61933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0050"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: cdf:CD2380 putative indolepyruvate oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17620"
FT                   /db_xref="GOA:A8MEE9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEE9"
FT                   /protein_id="ABW17620.1"
FT                   /translation="MVKSILLVGVGGQGTILASKLLTTGLMEAGYDVKMSEIHGMSQRG
FT                   GSVSSQVRYGDKVESPVIELGGADILVSFEKMEAMRWLEYLKPTGKVIVNNYEIGPVSI
FT                   LSGKIPYPKGIVEEISSKVDTMIIDAAEEAKELGNSKVMNIILLGATVKSMGLEDIDWE
FT                   KLIRENVKEAFVDINIEAFALGMRLANGIESTL"
FT   gene            62147..62860
FT                   /locus_tag="Clos_0051"
FT   CDS_pept        62147..62860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0051"
FT                   /product="uncharacterized membrane protein"
FT                   /note="KEGG: cac:CAC0198 uncharacterized membrane protein,
FT                   ortholog YyaS Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17621"
FT                   /db_xref="GOA:A8MEF0"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF0"
FT                   /protein_id="ABW17621.1"
FT                   /translation="MKKVRIYNFFIFLLGLFSLTLGIALVVKSNLGISVAMSFPYVLSL
FT                   GLTKLTLGQWSYIVQGLSLVVLFFIVKKLTVKHLMSFVVAFLFGVTLDMFNKLLVPFQV
FT                   FTIMERIMVFVLGSIVISIGVAAFVKSNYPIMPFDTFVKEVSIEKNIKYAKFKTGFDLV
FT                   CLTTSIISSFLFFRKIQGVHIGTFISAMVLGSSIGFCIDRMNRYIEGVDFLPPDKTKKV
FT                   LELKLLNIEKSERAC"
FT   sig_peptide     62147..62236
FT                   /locus_tag="Clos_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.428 at
FT                   residue 30"
FT   gene            63174..64678
FT                   /locus_tag="Clos_R0010"
FT   rRNA            63174..64678
FT                   /locus_tag="Clos_R0010"
FT                   /product="16S ribosomal RNA"
FT   gene            64740..64815
FT                   /locus_tag="Clos_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            64740..64815
FT                   /locus_tag="Clos_R0011"
FT                   /product="tRNA-Ala"
FT   gene            64992..67927
FT                   /locus_tag="Clos_R0012"
FT   rRNA            64992..67927
FT                   /locus_tag="Clos_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            67977..68093
FT                   /locus_tag="Clos_R0013"
FT   rRNA            67977..68093
FT                   /locus_tag="Clos_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 96.92"
FT   gene            68170..68286
FT                   /locus_tag="Clos_R0014"
FT   rRNA            68170..68286
FT                   /locus_tag="Clos_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 96.35"
FT   gene            68306..68416
FT                   /locus_tag="Clos_R0015"
FT   rRNA            68306..68416
FT                   /locus_tag="Clos_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            68709..70196
FT                   /locus_tag="Clos_0052"
FT   CDS_pept        68709..70196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0052"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   amt:Amet_0043 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17622"
FT                   /db_xref="GOA:A8MEF1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF1"
FT                   /protein_id="ABW17622.1"
FT                   /translation="MFWERKRKIEDLSKKIIRMSQGDLTFQLDDKGDKDFGGIANSINQ
FT                   LIYGFRNFIGNVSTTNEKTLNFAIELENNARYISDASADVASAVIDIASEATTQNQAVF
FT                   QAKEYTEKMEKDALNILEQSVKTKMISKEMVSVVKDSTEVFDQVANLLNLSSNWSIDLS
FT                   NKMNSLKNEAEKIQQITSVVTNISENTNLLALNASIEAARAGDSGRGFAVVAGEVKKLA
FT                   EQSSESAEEIESIINSIVTKVNDITDEIEEQVGQSKENIKTVNQSKVLLDQILDSTEST
FT                   YEAVESIHSLAQEEVELIKIFNDIIEKIAFATEKSTAFAQEAAASGQEQTASVQVMFES
FT                   IQKLTSMTNEVQNIVNGFVKEFVMDEKIKALVNRGLKALEEISQLREIDAMDPSNCEKI
FT                   LRNEMKKQEVFELLAIMNKSGDSKAIILKGLDSSQDLQGNYSHRPYFQEAIKGDHFISK
FT                   PYISLSTYTYCVTIAVPIIAHQREIIGIVMGDLSLEN"
FT   gene            70382..70693
FT                   /locus_tag="Clos_0053"
FT   CDS_pept        70382..70693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0053"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   amt:Amet_0044 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17623"
FT                   /db_xref="GOA:A8MEF2"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF2"
FT                   /protein_id="ABW17623.1"
FT                   /translation="MTNCCSMDKEEKKPTESSIKTQKSVLDRLNRIEGQIRGIKNMIEN
FT                   NTYCDDVINQIEASRSALHSVQIILLESHIKNCVVEQLQQGERDVIEEVLKTIKKLTK"
FT   gene            70950..73409
FT                   /locus_tag="Clos_0054"
FT   CDS_pept        70950..73409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0054"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper ion binding protein;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: dsy:DSY4510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17624"
FT                   /db_xref="GOA:A8MEF3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF3"
FT                   /protein_id="ABW17624.1"
FT                   /translation="MKAIRTVSVKGMTCAACSAAVERNLSKAEGISKATVNLATEKLTV
FT                   EYDTEKISMEDMVTRIDKLGYKLIDEEDFREIVIPIKGMTCASCSAAVERALKKQEGVV
FT                   ATSVNLATEKATVKYNNDVIKISQIKNAIEKAGYEPLDIEVEASNDKDKEAKENEIKGL
FT                   WKRFVVALIFTAPLFYISMGHMLGAPLPEVINPHHNPLNFAIVQLFLTIPVMLAGHKFY
FT                   TVGFKTLFKGSPNMDSLIAIGTSAAFLYGIYAIKEIAGGNQDMAMELYFETAGVIITLI
FT                   MLGKYFEAVSKGKTSEAIKQLMGLQPKAATVIVDGKEVKIPIQEVEVGHKIVVKPGEKI
FT                   PVDGIVIEGYTSVDESMLTGESIPVEKNKGDRVTGGSINKNGSIAFEATKVGKDTALAQ
FT                   IIKLVEDAQGSKAPIAKMADIISGYFVPIVIAIAVIAGVIWYFTGSSINFSLTIFISVL
FT                   VIACPCALGLATPTAIMVGTGKGAEYGVLIKGGEALETAHQIKTVVFDKTGTITEGKPK
FT                   VTDIITNEQITEEELLTLAASAEKGSEHPLGEAIVKAGEERNLILKKVDRFTAIPGHGI
FT                   EVTIEGKNMLLGNKKLMADRKISITLQNESDQLATEGKTPMYITIDGDLAGIIAVADVV
FT                   KGSSKAAIDALHRMGIEVAMITGDNRRTAEAIAKQVGIDIVLAEVLPEDKSNEVKKLQA
FT                   SGKKVAMVGDGVNDAPALAQADIGMAIGSGTDVAMESADIVLMRSDLMDVVTAIQLSKK
FT                   TIKNIKENLFWAFAYNTAGIPIAAGVLYALGGPLLNPMIGAGAMALSSVSVVSNALRLR
FT                   GFKPSHR"
FT   gene            73505..73720
FT                   /locus_tag="Clos_0055"
FT   CDS_pept        73505..73720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0055"
FT                   /product="copper ion binding protein"
FT                   /note="TIGRFAM: copper ion binding protein; PFAM: Heavy
FT                   metal transport/detoxification protein; KEGG: amt:Amet_0045
FT                   heavy metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17625"
FT                   /db_xref="GOA:A8MEF4"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF4"
FT                   /protein_id="ABW17625.1"
FT                   /translation="MKKKIMIEGMSCGHCSGRVEKALKEQSAVKAVTVDLASKNAVVEL
FT                   SEDLSDDVIKEIIDDAGYDVVGIENL"
FT   gene            73869..76433
FT                   /locus_tag="Clos_0056"
FT   CDS_pept        73869..76433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0056"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; glycoside hydrolase family 39; KEGG:
FT                   cbe:Cbei_3047 xylan 1,4-beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17626"
FT                   /db_xref="GOA:A8MEF5"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF5"
FT                   /protein_id="ABW17626.1"
FT                   /translation="MDDGFELMNWQEDFPIRGSIYSIEGFKVHWHSAVEILLVLQGNVS
FT                   LGVGDHKYLLKENDLILINYNEIYSITRGKEDNLLLSLQIDPVTLSQYDPNFSRLVFDC
FT                   KSFMYCKDNQEKFDVVRYYMAKVVWEYSKKKPGYQLRIASNIHLLAAHLVNNLTNENLN
FT                   QLKSEIKDKDLARLKRILSYINENIDKKISLKTIAKNEHISYFYLSRFIKDNLGVTFQE
FT                   YINTLRLDKAVNLLLSSNKTITEVSYESGFANIKLFNKLFKETFGASPLQYKKIHKESS
FT                   EQKGYSDSLHHGQVSRVCLGVERKTAFKKLLSYLKPMDLQPQLSDKYKTNRINISVDVS
FT                   TIEEPLNHYWKKLTTFSSASEGLRSQWQNQLKELQREGGFEYIRVHDVFSDRMMVCNFT
FT                   EADTMVYNWSSVDELFDLFKSVNIKPFIGLGFVPSKLNKMDQPIFLWQDNRSPSQPMEL
FT                   WTELTREFIKHCINRYGLREVETWYFEVWKEPELPYGFWDGRNEEDFEFYRQTALTIKS
FT                   IAPTLKVGGPGATYHMNQQSYWLEIFLTYCKDYSIPLDFVSLHIYPEDYIANEKECENI
FT                   SKMLQESKSKDAMKKWMDLKKIYLDKNYTFNAVDSAKKTILDVLNFNIETHITEWSVST
FT                   SYGNFIQDTSFLSTFIVKNTLDCVNKVDAIGYGAFTDLREEAKGGISSFHGGLGLMNKE
FT                   GLKKPSYFAYHLLDKLGDGIIEKGEEYIITKKDENIQILAYNYAYFDEIFLKGDPSLLT
FT                   SKERYLVFEEKSPNEINFNLSGLNGKYKITRYQLDRENGSVFDEWSKLGMVENMTKEEL
FT                   EYLQGRAGPKITVEYVEILGDYKGRILTSAHGIELITIDRQI"
FT   gene            complement(76529..77548)
FT                   /locus_tag="Clos_0057"
FT   CDS_pept        complement(76529..77548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0057"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG:
FT                   amt:Amet_0046 aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17627"
FT                   /db_xref="GOA:A8MEF6"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF6"
FT                   /protein_id="ABW17627.1"
FT                   /translation="MKKLFYMLILVGILAAASAIFVPPYLSVSSNQDVVEVTVPKGASL
FT                   NHVSNELYEKGVIKNKAWFKYKAKDAGVDRKIKPGTYTIPSNITLENIFALLEKGIPDE
FT                   QMVLTIPEGFTLYQIAQRVSDLGFGTTEDFIDATQRYFEKEGYDFPTKDLFFSLEGYLY
FT                   PETYYFTERQSVDDIVRTLAEPIKNIFTEEYKSRAKELDLSIHQVLTIASLIEREAVND
FT                   EERPMISGVIHNRLEKNMLLQIDASVIYYTGKGREHKSDIYKSELEKMVPFNTYRVPGL
FT                   PPGPIASPSKASIDAALYPEEHDFLFYVLNETEDKHIFSKTLAEHEVHAQKYRNRNKK"
FT   sig_peptide     complement(77465..77548)
FT                   /locus_tag="Clos_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.475 at
FT                   residue 28"
FT   gene            77817..78884
FT                   /locus_tag="Clos_0058"
FT   CDS_pept        77817..78884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0058"
FT                   /product="acyltransferase 3"
FT                   /note="KEGG: amt:Amet_0311 acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17628"
FT                   /db_xref="GOA:A8MEF7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF7"
FT                   /protein_id="ABW17628.1"
FT                   /translation="MVKRERIDETTIMRGISCLAVIMVHITANPVSMLNAGSPSSILFT
FT                   LLNRGSKFTTPTFLFLSGLTLFYSYEARDFSYGKFLKRRFESTLIPYFIWSTVYFMYFY
FT                   FKGIYILSPKFIAENFLLGKTSYHLYFVVTITQFYILFGGFLYIYRKYNSHLILGSTLI
FT                   INVLFLKYGAPSMVYADRFFINYIFFFSLGCYVARNLSKVKGFIVKYKYGIVGGYMGMV
FT                   LYDSYLFYQYYILQQPVSVFWVSVSWLVFSTVSIFALMYVGDTILNKGEKMQRIFKTIS
FT                   KSSYYVYLMHPLFLNISDTWLIEKGIYSITKRSLLNMFIVYTISLCLSIGYTNLKAYLK
FT                   NTKNKTNQKAPIKQA"
FT   gene            80271..81719
FT                   /locus_tag="Clos_0059"
FT   CDS_pept        80271..81719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0059"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   amt:Amet_0081 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17629"
FT                   /db_xref="GOA:A8MEF8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF8"
FT                   /protein_id="ABW17629.1"
FT                   /translation="MKAMQDLPVINRLLDLNNENIVSFHVPGHKNGRLYERFQYKNFID
FT                   VLHQLDTTEILGTDNLHHPEDVIKESQERASKVFGSEETFFLVNGSTSGIYSMIMAATS
FT                   PGDKILIDRNCHQSVINAMILGDLVPIYIYPRIEEGQGISIGMPEEEIERQLIAHKEIK
FT                   AVILTYPTYYGIAWDLKKIGEIVHKYDKILLIDEAHGAHFGLSVHLPPTALSCGADCVV
FT                   QSTHKTLPSFTQSSMLHIQGNRVQREKLKSMLKIHQSSSPSYLLLSSLDFAVMLYKEQG
FT                   EALMEELLRNIEGFKADIGTCSRIKVMGEEVVGENKAFALDPTRLWIAVEGVKGYDLDA
FT                   ILRKRFRIQMELSNEYGVLAVTTMGNNKADFDQLQRALQIISSEYMDRCIEEIDVQRYR
FT                   APKQVLTPRAAFYGKKKRILLKESIGEISGEYIIPYPPGIPLVIPGEEINEEVLNVLDQ
FT                   MIKGKKEILGLRDGAYQWIDVILR"
FT   gene            81740..82372
FT                   /locus_tag="Clos_0060"
FT   CDS_pept        81740..82372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0060"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: amt:Amet_0082 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17630"
FT                   /db_xref="GOA:A8MEF9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEF9"
FT                   /protein_id="ABW17630.1"
FT                   /translation="MHKGLFITIEGPDGSGKSTQIHFIKRFLEEKGYKVVLTREPGGTV
FT                   IGEKIRELVLDKNHKEMANVTEALLYAASRAQHVAQRIIPAIEEGSIVLCDRFVDSSIV
FT                   YQGKGRGLGVENIRDINDFATMGLKPDLTILLDIDPEIGIERAKSAKEADRLEQEKIDF
FT                   HRIVYDGYKELVQMYPERIKVVDANQSIEEVSKGIEYILNKILLREE"
FT   gene            82377..82706
FT                   /locus_tag="Clos_0061"
FT   CDS_pept        82377..82706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0061"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   amt:Amet_0083 protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17631"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG0"
FT                   /protein_id="ABW17631.1"
FT                   /translation="MKLIIAIVNDEDVHHLIEDLTKSKFMVTKLATTGGFLKSGNTTLL
FT                   IGVDDEKVDQVIGIIKDNCETRKQTITSTTPISGAAGVFIPYPVEVRVGGATIFVVDIE
FT                   KHVKL"
FT   gene            82725..83714
FT                   /locus_tag="Clos_0062"
FT   CDS_pept        82725..83714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0062"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: amt:Amet_0084 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17632"
FT                   /db_xref="GOA:A8MEG1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG1"
FT                   /protein_id="ABW17632.1"
FT                   /translation="MTLESIVGQEKAIKNLEKAVLENQVAHAYLFEGAEGLGKKALALK
FT                   LAAALVCFDHSKRPCGKCNSCLKINSGNHPGIKIIEEAGTIKVDEVRELIKDIQLKPYE
FT                   GSHKVYIICDADKMNIQGQNALLKTLEEPPAYATLILLTTKKSSLLPTIISRCQSIKLS
FT                   PVSSDRIKSYLIQEKDMDPDRAQMLAALSEGIIGKALDLLSNEDFYKRREDTIDLCNAL
FT                   MGAKVLNILEYTMFFEEQKIYVEQILDLMVSWYRDVFVYKETGNIELITNVDKKQELDL
FT                   KAGRIDFRKLRDIIFIIENAKNNLKSNVQFHLNIEVMLLNIQEVLSKW"
FT   gene            83708..84592
FT                   /locus_tag="Clos_0063"
FT   CDS_pept        83708..84592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0063"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: amt:Amet_0085 PSP1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17633"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG2"
FT                   /protein_id="ABW17633.1"
FT                   /translation="MVTVVGVRFKKAGKIYYFDPSDIELTKNAFVIVETARGIEFGQVV
FT                   VGPKNVVEEDIISPLKSVIRIATDEDITRHNENKLKEKEALEVCIEKIRKHELDMNLVD
FT                   VEYTFDNNKVIFYFTADGRVDFRDLVKDLAAVFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   PLCCATWLGDFEPVSIKMAKDQSLSLNPAKISGICGRLFCCLKYEYDVYAEILQKLPGV
FT                   GAIVLTPDGEGTVTEVNVLSELVKVRINNTKDAAEIKTYFLHDITRIKDVEIEEVVDIP
FT                   EELVHELKKLDGK"
FT   gene            84900..86153
FT                   /locus_tag="Clos_0064"
FT   CDS_pept        84900..86153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0064"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   amt:Amet_0679 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17634"
FT                   /db_xref="GOA:A8MEG3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG3"
FT                   /protein_id="ABW17634.1"
FT                   /translation="MAEHVLDKAKQCLQCKNPRCEQGCPINTPIKEMIRLLLEGDIHEA
FT                   GKMVFENNPLSIVCSLVCPHERQCEGNCIKGIKSNPVKIGDIEHYISDYNLELLDLKPA
FT                   EKQSGNIGIIGSGPAGITIALILALRGYSVTIFESREKIGGMLRYGIPEFRLSRNILDR
FT                   IQRWLTDLGVVIRPNTLIGSKLTIDELLRDGFDALFIGTGVWQPKKLDIRGESLGHVHF
FT                   AIDYLRNPDVYNLGKKVCVIGAGNVAMDVARTAVRKGAKEVTIMYRKGIEEMTATKHEI
FT                   EYTKIDGVRFELYKAPLEITAEGVIYTETEKIEDEKGVRFATIKGSEKLFQCDSVMIAI
FT                   SQGPRANIISTTTGIEVNSQGLAIVDENGMTTREGVFAAGDVVTGAKTVVNAVKYSKHI
FT                   ADAIGNYVDKRYHENKEN"
FT   misc_binding    86373..86475
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   55.42"
FT   misc_binding    86476..86562
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   49.28"
FT   gene            86842..87948
FT                   /locus_tag="Clos_0065"
FT   CDS_pept        86842..87948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0065"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: tte:TTE0296
FT                   aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17635"
FT                   /db_xref="GOA:A8MEG4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEG4"
FT                   /protein_id="ABW17635.1"
FT                   /translation="MTELKRTPLFDAHNRYGGKLVDFAGWEMSVQFEGLTAEHEAVRNA
FT                   AGIFDVSHMGEIEVRGKDAEAFVQYLVTNDVAALEDNQIVYTFMCYPDGGIVDDLLVYK
FT                   FNKEYYYLVVNASNSDKDFAWMNENKGAYDVEIINISDSVSQVAVQGPKAEEIVQELTD
FT                   TDLSEIPFFYFKNDVVINGANCLISRTGYTGEDGFEIYVDNDKVDALWDKIIEVGKDRG
FT                   LKPAGLGARDTLRFEATLPLYGHEIDKDISPLEAGLGFFVKLNKENFIGKDALVRQKEE
FT                   GLKRKVVGFEMKENGIPRQGYEVKVGDKVIGVVTTGYNSPTLKKNIGYALIDAEYAALG
FT                   TPIDIQVRKKTLKAEVVSKKFYTRSTKK"
FT   gene            87991..88374
FT                   /locus_tag="Clos_0066"
FT   CDS_pept        87991..88374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0066"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: amt:Amet_1355 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17636"
FT                   /db_xref="GOA:A8MEG5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEG5"
FT                   /protein_id="ABW17636.1"
FT                   /translation="MKTVAGLLYSKDHEWVKVEGNEAYIGITDFAQHALGEIVFVELPE
FT                   VDDEIAQGDAFSVVESVKAASDAYSPVSGKVLEVNEELDGAPELLNEDAFANWIIKVEL
FT                   TNPSELEGLLSDKEYAEFCEKEA"
FT   gene            88376..89716
FT                   /locus_tag="Clos_0067"
FT   CDS_pept        88376..89716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0067"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   tte:TTE0294 Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17637"
FT                   /db_xref="GOA:A8MEG6"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG6"
FT                   /protein_id="ABW17637.1"
FT                   /translation="MHRYIPNTDADTKRMLEVIGVNNLEDLFNDIPKELQLGRELDLEG
FT                   PYSEMEILRHMKELSGKNTNIDELTCFLGAGAYDHYIPSIIKHLAGRSEFFTAYTPYQP
FT                   EISQGTLQAIFEYQTMICNLTGMDVTNASMYDGATACGEAAVMAADNTRRKSIVVSSTV
FT                   HPEVRKVLKNYVELRDIELVEVNMAEGVTDIDHLKSLVSKETAAVIIQSPNFFGIIEDL
FT                   TEAEKIIHENKGLLISYVDPISLGILKSPSELGVDIVVGEGQSLGSSLNFGGPYLGFLA
FT                   TTSKLIRKMPGRIIGQSNDIDGKRAFVLTLQAREQHIRRYKATSNICSNQGLVALMASM
FT                   YLTILGKKGIKEVAMQSTQKAHYAFNELTKSGKFKPLFNKPFFKEFALTSDLDPTQVNK
FT                   ELLKNGILGGYELRKEYAEMENGLLLCVTEKRTKEEIDKLAKVMEVI"
FT   gene            89716..91176
FT                   /locus_tag="Clos_0068"
FT   CDS_pept        89716..91176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0068"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   amt:Amet_1357 glycine dehydrogenase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17638"
FT                   /db_xref="GOA:A8MEG7"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEG7"
FT                   /protein_id="ABW17638.1"
FT                   /translation="MKSDYNKLIFEISKEGRKAYSLPKCDVEEVNLESLIPKEFLSDKE
FT                   LDLPEVSEVDVIRHYTQLSNKNYGVDTGFYPLGSCTMKYNPKLNEDMAVLPGFANIHPY
FT                   QPEETVQGALELMYKLDKMLAEVAGMERMTLQPAAGAHGELVGLMVIKAYHKKRGDLKR
FT                   TKIIIPDSAHGTNPASAAVAGFDVVEIKSNPDGSVNIDSLKSALSDEIAGLMLTNPSTL
FT                   GLFETNIKQIADLVHDAGGLLYYDGANMNAIMGVTRPGDMGFDVIHYNIHKTFSTPHGG
FT                   GGPGSGPVGVRKDLVEFLPSPVIEKKGEEYVLDYDRPYSIGKIKSFYGHFGILVRAYTY
FT                   ILSYGPALREVSEKAVLNANYMMHKLKEKYYLPIEQVCKHEFVLGGLNEDILGVSTLDI
FT                   AKRLLDYGYHPPTIYFPLIVNEAMMIEPTETESVETLDQFIDALNKIADEAKETPELLK
FT                   NAPHHTHVRRIDEAKAARNLIVKWEREQ"
FT   gene            91313..93415
FT                   /locus_tag="Clos_0069"
FT   CDS_pept        91313..93415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0069"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; AAA ATPase; KEGG: cdf:CD2732 putative
FT                   sigma-54-interacting regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17639"
FT                   /db_xref="GOA:A8MEG8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG8"
FT                   /protein_id="ABW17639.1"
FT                   /translation="MKKKLAILCYSNGTLEIYYEQIQSLFQDNLIIEKYCLENGPIQKE
FT                   IVADLILLPSFDAFEKVRHLIKKVDKVLFADRTISKGGLDKMMDIEEGTEAFFLDESME
FT                   MSKQMVSTLYEIGVDHMNLTPICPTTEGNFKEKMIIVLGKSSNIPLNTTNILNIGNSLL
FT                   DINTIIEIGVRLDYLHILNRQNIGKSYKEIATANYGLSRILGMTNMSEGQLDILLQVID
FT                   DGLIGIDAKGSIFLYNENAGEIVGYTREDVVHRDGILLFPQIPFKDVLENLRSVREILI
FT                   KINGVDLIVSVDPIVHSERLYGAVAIIRRFSDAESQQHRLRAKVIGKGHKAKYNFGDIV
FT                   GESENIKKTIEIAKRMARSNSSILITGESGTGKELFAQAIHNNSKRRNFQFVAINCGAL
FT                   PESLLESELFGYEEGAFTGARKGGKSGLFELAHNGTLFLDEIGEMPPSLQMRLLRVLQE
FT                   REVMRLGGDSIINVDIRIIAATNKNLKEMMATGGFREDLYYRLNVLPLKIPPLRSRKKD
FT                   IETLVDRFRAEFRGSFVLSQMAKDVLLSYNWKGNVRELKNYIEYLVSLEIKEVDVKDLP
FT                   FEIFEEVEGNILLEEDAEAIVSSEERNIYNDLKEDAGKDLPKYIFILEELEKAFLSNKR
FT                   LGRRSLLTIAKQKKMFLGEQEIRNMLLYLESKGMVEVYKGRGGTLITDRGKNILNYYAK
FT                   SKGFNG"
FT   gene            93603..95381
FT                   /locus_tag="Clos_0070"
FT   CDS_pept        93603..95381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0070"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: cdf:CD2381 indolepyruvate oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17640"
FT                   /db_xref="GOA:A8MEG9"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEG9"
FT                   /protein_id="ABW17640.1"
FT                   /translation="MKQLLTGNEAVARGAYEAGITYAAAYPGTPSTEILENIAPYKKEI
FT                   IAEWAPNEKVALESAIGASVVGARALAAMKHVGVNVAADPLFSYAYTGVNGGLVLVSAD
FT                   DPGCHSSQNEQDNRLYAKFAKVAMVEPSDSQECKDMVKAAVEISERFDTIVILRMTTRI
FT                   CHGKGVVEFGEREEVGLKPYVKNPQKYATVPANARALRFVVEDRLAALEKFSNETDLNF
FT                   FEWNDKKIGIISSSVSYQYAKDVFGDTVSYLKLGFTHPLPMDKIKEFAKEVETLYVIEE
FT                   LEPYIEDQIKAAGIHCIGKDKITGIGELNPDIIAKSLLGEEREMVDYDRSIAVNRPPTL
FT                   CAGCPHRGFFYELSKKKDIIVNGDIGCYGLGVAPPLSTVDTIICMGASVSMAHGAQKVL
FT                   NRHDVNKRMVAVIGDSTFFHTGINSLMDTMYNRGNTINVILDNRITGMTGHQENPGTGY
FT                   TLQGMPTKEIDITALCKAIGVEHVRTINPLDLKEGKEALEWAMALDEPCVIITRWPCVL
FT                   KSLSPEDKKEFGDYKGLCEVNHEKCIGCKMCIKTGCPALRFDKETKKVTIDKTQCVGCT
FT                   VCLQVCPVKAISKVGE"
FT   gene            95383..95961
FT                   /locus_tag="Clos_0071"
FT   CDS_pept        95383..95961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0071"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: cdf:CD2380 putative indolepyruvate oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17641"
FT                   /db_xref="GOA:A8MEH0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEH0"
FT                   /protein_id="ABW17641.1"
FT                   /translation="MSEVKSLLLVGVGGQGTILASKILSAGLLDAGYDVKMSEVHGMAQ
FT                   RGGSVTTQVRYGKKVHAPIIGKGQADILVSFEAMEALRWLEFLNPKGRAVVNDFKIPSA
FT                   PILMGNVDYPEGVIETIKEKVNTSILDAGQIAERIGNPKTMNIVLLGALVKAMGLTDID
FT                   WEKAIRENVKEQFVEINIKAFEEGMKAVA"
FT   gene            95997..97061
FT                   /locus_tag="Clos_0072"
FT   CDS_pept        95997..97061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0072"
FT                   /product="Butyrate kinase"
FT                   /note="TIGRFAM: Butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: cdf:CD2379 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17642"
FT                   /db_xref="GOA:A8MEH1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEH1"
FT                   /protein_id="ABW17642.1"
FT                   /translation="MSFKILAINPGSTSTKIAIYEDTKEISKKNIEHPSDEIAKYNKIT
FT                   DQYEMRYKQILSFLEENNFDIKSLSAVVGRGGPLPPVRSGAYKVNDAMVDRLKNRPIIE
FT                   HASNLGSIIAKEIADSIGVNAYIYDSISVDELDDIARISGLAEIERQSLTHCLNMRAAA
FT                   IKTAGNIGKAYKDCNFVVAHLGGGISLSAHRQGKMVDMVSDVEGPFSPERAGVLPTDKL
FT                   VSMCYTTEQSVVNKKLRGKGGLVSYLNTNSALEVQDRIDNGDEYAKLVYEAMAYQIAKA
FT                   IGQLSVVLEGNIDRIILTGGIAYSKMLMDWIVKRVSFIAPIEILPGENELESLALGTLR
FT                   VLKGEEEAYEYDLD"
FT   gene            97091..98206
FT                   /locus_tag="Clos_0073"
FT   CDS_pept        97091..98206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0073"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: chy:CHY_1929
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17643"
FT                   /db_xref="GOA:A8MEH2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MEH2"
FT                   /protein_id="ABW17643.1"
FT                   /translation="MTTNLFRKELEVLKPYVPGKPIEEVQKEYGIDQIEKLASNENPLG
FT                   PSPKAVEAIMREVQHINIYPDAYAMKLKEEIAKRTNLTHENIITGNGGEQIIQLIAQTF
FT                   INPGDEAIMADTTFGLYETSVLNMKGVPVILPLKDYKHDLDGFVEKINENTKIIYICNP
FT                   NNPVGNILSKEEMEGFVARVPENVVIVLDEAYYDYAKVNPEYPESLDVLAKRPNTVILR
FT                   TFSKVGGIAGVRVGYALTSKEIASQMSKVKDVFNVNILAQAAALGVLEDTEHIEKTVKL
FT                   NYESLGMMEKYCEENDLEYIKSNANFMFMNIGTHSKPVFEELMKQGIIIRPGFLWKWDN
FT                   WIRVSTGTLEQTEKFIDKLDGILNKGTCCCG"
FT   gene            98781..99974
FT                   /locus_tag="Clos_0074"
FT   CDS_pept        98781..99974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0074"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; KEGG: mta:Moth_1931
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17644"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MEH3"
FT                   /protein_id="ABW17644.1"
FT                   /translation="MNQDREKINGLIEYVKGIKDNLNGAELYLKYKSDIENVKPQEAFE
FT                   VFYALLEEGMEPKEVLVFLDKIINVFYKSLSHHQWERPANDNFLVDLILENEALFERAE
FT                   EIKIDLKEENLEIKKEKLIPKVKALEAIKHHYLKKENILFPYLEKTMEKFHGLKIMWAL
FT                   HDEVRNRIQETVSILQSKESDEKEVNGVIGKLFFGILGVAKKENLILFPAASEVLSPQD
FT                   WYDMHKQSLEYEFSFIEKAKEEIEMYRTDSEGRTEVFEGEYKLKTETGELSLEQVAMIF
FT                   NALPVDMTFVDENNKVRYFTRPKDRIFPRSPAIIGRDVNNCHPPDSVHIVQKIIEGFRT
FT                   GQKDSAKFWIELKGKMILIQYFALRDAKGIYRGTLEVSQDITEIRGLEGQRRLLDWD"
FT   gene            100086..100802
FT                   /locus_tag="Clos_0075"
FT   CDS_pept        100086..100802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0075"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cth:Cthe_1959 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17645"
FT                   /db_xref="GOA:A8MFK6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFK6"
FT                   /protein_id="ABW17645.1"
FT                   /translation="MSKFYTEISKYYDYIFPTGKAQLQLIKKIVGEAPKNILDVACGSG
FT                   GYAKSLNDSGHQVTAIDLDQEMVQALKARDTGIDARVLNMLDIEVLNKTFDLIFCIGNS
FT                   VVHLNNNEEIYEFLKSCKNSLKENGHLLIQIVNYDRVLAQDVKQLPTIKNEDVPLVFER
FT                   YYDYWPEQHKINFRTILRVNENVLENSVLLHPIKSTEFVGLLEELGFQDIQLYGSFNQE
FT                   AYDPMVSFPLIMVAKK"
FT   gene            100814..101692
FT                   /locus_tag="Clos_0076"
FT   CDS_pept        100814..101692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_1860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17646"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFK7"
FT                   /protein_id="ABW17646.1"
FT                   /translation="MEIYIFYYVDEDIHDFSSKRLKGGLKLKKLIILVLSITMVLAGCS
FT                   GHKDASQRFKKDNFKSVVIGNGKMLKLVMDDEDTKALVDLFNTMVLKEMDKNLKEEPFI
FT                   KVHFFGNDAEDTISIVFLGEKVFSQKEWYAVDLEFTKKLYNFYEGRALLEVEDDTLLEI
FT                   QEKRADRANLDWKEALEGTWIVDDTTALTFDEEFLYQGDYKLKYVIHEAEGNRLLISAY
FT                   GIHGLFTKNQKLFDMDIIFSEDLCNVQTQKIVPQFGTRDLVFQNNMIYQDEEGNILGDL
FT                   SSVFFSENLLN"
FT   gene            complement(101842..102444)
FT                   /locus_tag="Clos_0077"
FT   CDS_pept        complement(101842..102444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0077"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   mba:Mbar_A3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17647"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFK8"
FT                   /protein_id="ABW17647.1"
FT                   /translation="MLEEIILNAQMEDRYLRDGNFEDELLIGVDISKIEFESVQFTKCT
FT                   FENCDFTKASFYATRFINCNFSNCIFTESYWKNSEILSCKGDGGNFSRSSIKESTLLNS
FT                   SFCYAIYSETLWEKCTIHHCNFKNAFFSEVKLKKSDLKEVDFSNVDFFKTPLKGIDLSA
FT                   CEIGGIMVSDTYKELQGVKISPLQAVDVVHLLGVKII"
FT   gene            103112..104008
FT                   /locus_tag="Clos_0078"
FT   CDS_pept        103112..104008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0078"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: cbo:CBO1621 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17648"
FT                   /db_xref="GOA:A8MFK9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFK9"
FT                   /protein_id="ABW17648.1"
FT                   /translation="MQIKELFKRKNLVFSFEVFPPKVTSPIGSIYDTLEGLQDLKPDYI
FT                   SVTYGAGGNGNDNRTGEIAAIIKNKYGIEALAHLTCIGSTLEQTKGVLQELRDKGVHNV
FT                   LALRGDIPEGFEGKGELKNSQDLIRLIREDQGNRFGIAAACYPEGHVEGKNVDQDIEIL
FT                   KLKEEAGADHAITQLFFDNNYFYEFLNKVEEKGIQLPIQAGIMPVTNKKQIERIVALSG
FT                   ANLPVKFKKIMEKYEHNKEALRDAGIAYALDQIVDLISTGARGIHLYTMNNPYIARSVT
FT                   ESIHSILKSVNKEKEVV"
FT   gene            104052..104723
FT                   /locus_tag="Clos_0079"
FT   CDS_pept        104052..104723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0079"
FT                   /product="Vitamin B12 dependent methionine synthase
FT                   activation region"
FT                   /note="PFAM: Vitamin B12 dependent methionine synthase
FT                   activation region; KEGG: cbe:Cbei_1401 vitamin B12
FT                   dependent methionine synthase, activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17649"
FT                   /db_xref="GOA:A8MFL0"
FT                   /db_xref="InterPro:IPR017342"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL0"
FT                   /protein_id="ABW17649.1"
FT                   /translation="MNQSPQNKSEVLRYLGYSGQEIDHITNRIIDESMEEMQNLIEERF
FT                   VYKFFNILRKKDHLLLKNTEFELRGNSIRKHLREAKDCILMAITLGNGVDARIRYYEKV
FT                   SMAKALILDACATVAVEEICDKVCDNLEHIVAAEEKTLTCRFSPGYGDLPLSIQKNFLA
FT                   VLDAEKSIGLNASSHHILTPRKSVTAIVGIVPRNKSVEKVDSICQGCNKYTTCTFKHLK
FT                   F"
FT   gene            104803..107181
FT                   /locus_tag="Clos_0080"
FT   CDS_pept        104803..107181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0080"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: dihydropteroate synthase DHPS; homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   KEGG: cbo:CBO1623 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17650"
FT                   /db_xref="GOA:A8MFL1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017215"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL1"
FT                   /protein_id="ABW17650.1"
FT                   /translation="MKIVNRLKDGTLIFDGAMGTMLQNRGLKLGELPEMLNFSAPEIVI
FT                   EIHKSYVDAGADVVTTNTFGANELKLAGSPYTVEEVIHKAVVNARTACEGTDTYVALDI
FT                   GPIGELLAPMGTLSFQEAYEIFKRQVVQGVKSGADLILIETMTDLYEAKAAVLAAKENA
FT                   NVPVFCTMSFEANGRTFTGCTPEAMVLVLEGLGVNALGVNCSLGPKELGPIVDHILKIA
FT                   TVPVMVQANAGLPTVVEGRTVFNVLPEDFARHGCNFVEKGVKIVGGCCGTTDRYIEGLK
FT                   EVLKDRQPGKIEAATLTGVCTPTKVVEIQGVRVIGERINPTGKKLLKEALRSGNLDYIL
FT                   REAIAQVDAGAHILDVNVGLPEINEEEIMEKIVQEIQSILDVPLQIDSTNPKAIEKGLR
FT                   IYNGKAIVNSVNGEDKVLERILPIVKKYGAAVVGLTLDERGIPKTAEARFEIAEKIVDR
FT                   ALSYGIKREDVYIDCLTLTAAAQQEEVQETLKTIQLVKKHLNVKTVLGVSNVSFGLPNR
FT                   DLLNRTFLAASIFAGLDLPIINPLDQGMMETIVASQVLWNQDKSAEAYLKYHQNQPKTE
FT                   VGSKPKMAQSQEDLFNMIIKGIRDEAKIATENLLQEKAPLDIVNQYIVPALDFVGERYE
FT                   KGDLFLPQLIQSAETVKSAFEVIKKKLKENAHSDISNGKILLATVKGDIHDIGKNIVKV
FT                   LLENYNYEIIDLGRDVPKEKIVEEVVKNKIKLVGLSALMTTTVKNMEETIEALKKMDPE
FT                   CIVMVGGAVLNPEYAEMIKADYYAKDAKDAVAIAKNILG"
FT   gene            complement(107279..108595)
FT                   /locus_tag="Clos_0081"
FT   CDS_pept        complement(107279..108595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0081"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bld:BLi03495 YvqG"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17651"
FT                   /db_xref="GOA:A8MFL2"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL2"
FT                   /protein_id="ABW17651.1"
FT                   /translation="MNREEYLKQLKAALKSLPEDELQDILYDYEEHFDIGLSKGKSEKE
FT                   ISAELGDPKEIAKNHTIAPGADPVENIQQQDFYEELNFSKDKKAKAVSKKIPYAFIGVG
FT                   LIVLGISSLPLKINPFYRPKTLINSNTSKDELVKINGKGIEVQDGNNYVKIGWNGIKVS
FT                   DGEDGVSIGWDGVRVHGKNGSTSTVIHSAKSLTSSIIDEEKLEDIKNVSSISVGSSFVD
FT                   IKVIPQEREDLRVHYHGSIVSNAVPVLSINKKSTDLQILLEAPNQTSRTILNSDLVVEI
FT                   FVPIAFKGDYNIQSSSGEIEVSNLKGKHIHITSSSGDLSLSNIVSETLNIKTSSGDIDM
FT                   SNPIGKLRMSSSSGDLSLGIAETSEDMALSTSSGDISLKCSEQLSYNILGSTSSGSFTT
FT                   NIPMVVAENANRKFHGKIGAGSKEIKISTSSGNVRFDKK"
FT   gene            complement(108588..108908)
FT                   /locus_tag="Clos_0082"
FT   CDS_pept        complement(108588..108908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0082"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cac:CAC0571 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17652"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL3"
FT                   /protein_id="ABW17652.1"
FT                   /translation="MNIQFKKGVLELCVLSLLTKRDYYGYELVEHISKFVSISEGTIYP
FT                   LLRRFRTEGYVTTYLQESQEGPPRKYYRITPKGSEAFDELEREWESFIEGVNYIIRGVL
FT                   NE"
FT   gene            complement(109064..109999)
FT                   /locus_tag="Clos_0083"
FT   CDS_pept        complement(109064..109999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0083"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: amt:Amet_0462
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17653"
FT                   /db_xref="GOA:A8MFL4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL4"
FT                   /protein_id="ABW17653.1"
FT                   /translation="MTKKAFAEDFKTTDGKSIYLRKWSPQTPPENPLIIQLVHGMAEHI
FT                   HRYDEFAKELVKEGFIVYGHDHRGHGRTAKIREDLGYFSDEHGWNRILQDLNEINKKIR
FT                   IEYPHSKIILFGHSMGSFLSRRYVQLFPHAVDGLVISGTGYRNGILGKVGMIVAKGSGL
FT                   IFGKKKANPLLNKIAFGSFNNRFKPNETSCDWLTRDKEAVKAYIADPLCGFIFTSEAFY
FT                   ELMKGIEELHEKENLEKTPRDLPLYIFSGTQDPVGNFGKGVLKVCEIYKNMGIKNITYK
FT                   LYPEGRHEMLNEINRKEVYEDVIHWIRSLY"
FT   gene            110205..111383
FT                   /locus_tag="Clos_0084"
FT   CDS_pept        110205..111383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0084"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: cbe:Cbei_0411 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17654"
FT                   /db_xref="GOA:A8MFL5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL5"
FT                   /protein_id="ABW17654.1"
FT                   /translation="MREIVIASGVRTAIGSFGGVLSKVSAVDMGAAVIKEALSRAKLDP
FT                   NLVDEVYMGCVLQAGLGQGVARQAAIKAGIPQEVPATTINMLCGSGLKTVSMAAQTIIA
FT                   GDNDIVVVGGTESMSQSPYLVPHARWGARMGNSNMVDSMINDGLTDAFNNYHMGITAEN
FT                   LAAKYSLTREEQDEFAAASQNKAEKAMVEGKFKDEIVPVEIPQRKGDPIIVDTDEYPKA
FT                   GMTVESLGKLKPVFKKDGTVTAGNASGINDGAAALILMTKEKAEALGIEPLATLVSYSS
FT                   AGVDPAIMGIGPVPATEMALKKAKLRIEDMDLIEANEAFAAQALSVGKELGWDKEKVNV
FT                   NGGAIALGHPIGASGARILVTLLYEMKRRSAQYGLATLCIGGGMGTAVIVKR"
FT   gene            111488..112957
FT                   /locus_tag="Clos_0085"
FT   CDS_pept        111488..112957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0085"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: amt:Amet_4533 sigma54 specific transcriptional
FT                   regulator, Fis family; TIGRFAM: PAS sensor protein; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17655"
FT                   /db_xref="GOA:A8MFL6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL6"
FT                   /protein_id="ABW17655.1"
FT                   /translation="MHIKKEEYLSLNALNVTKDNFEEHLDQVQFLLGLYKNIFNDIYNW
FT                   IVVVDKEGFIVMMNKKYCDFIGIKQEDAIGRHVTEVIENTRMHIVLKTQQKEIGDIHEI
FT                   KGNQMIADRIPIYKDGELMGAVGTVIFKDLVEFDVYVKNILKMEKQLEFYKKELKKALG
FT                   SVYTFDNIIGESNAIKRAKEISKKVALSKSNVLILGESGTGKELFAHAIHNASPRGEYP
FT                   LIKVNCGAIPSELLESELFGYEEGAFTGAKKGGKLGKFELANKSTIFLDEIGDLPLNMQ
FT                   VKILRVLQEREIERVGSVKSQKIDVRIIAATNRDLKEMVKKKLFREDLYYRLNVISIGV
FT                   PPLRERIEDIPLLARHLMKKLASEMERHVTEISPNALEALKNYHWPGNIRELANLIERA
FT                   LNMVEKEAVITLDHFPYYIRKQAKPDIGVSLDTLEMQLDGTLKEIFDEIEKKAIQKTLL
FT                   KYDGNKLKTARKLGISRTNLYEKIKKYDLDM"
FT   gene            113253..114806
FT                   /locus_tag="Clos_0086"
FT   CDS_pept        113253..114806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0086"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: amt:Amet_4532
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17656"
FT                   /db_xref="GOA:A8MFL7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL7"
FT                   /protein_id="ABW17656.1"
FT                   /translation="MAIRFMNAEDAVKLIQSDSVVATGGFVGNAVPEELEIALEKRFLE
FT                   SAEPKNLTLVYAAGQGDGKDRGLNHLGHEGLLKRVIGGHWGLVPKVQKLAFENKIEAYN
FT                   FPQGSISHLFRDIAANKPGTITKVGLKTFVDPRVEGGKLNEKTKEDLVELIEVLGEEYL
FT                   IYKAFPIDFALIRGTYADEHGNITMEKEAGTLEVLSIAQACKNSGGKVIVQVEKVVKAG
FT                   SLDPKLVKVPGIYVDTVVEVKDIKNHMQTFAEAFNPSYTGDIKVPVNSVQPLELDERKI
FT                   IARRAAMELVPSAIVNLGIGMPEGVAVVANEEGIGDEMVLTVEPGPIGGIPAGGQSFGA
FT                   AINPEAIIDQPYQFDFYDGGGLDVAFLGLAQCDQIGNINVSKFGPKIAGAGGFINITQN
FT                   AKKVIFCGTFTASGLKIEVAEGALKIAQEGKVKKFISEVEQITFSGEYATDAKQTVLYI
FT                   TERAVFALGAEGIILTEIAPGVDLQKDILDQMEFEPIISSELKVMDSKIFKPEKMGLTI
FT                   "
FT   gene            114821..116137
FT                   /locus_tag="Clos_0087"
FT   CDS_pept        114821..116137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0087"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   KEGG: amt:Amet_4531 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17657"
FT                   /db_xref="GOA:A8MFL8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL8"
FT                   /protein_id="ABW17657.1"
FT                   /translation="MLGIIIGLALLMLLAYRGMSIIWVAPICALVVAFSGGLELLPAYT
FT                   GSYMEGFVGFTKSWFPVFMLGAIFGKVMDESGAAQSVATWISKVIGTKFAIVAVVAACA
FT                   ALTYGGISLFVVVFAVYPIAIALFREANITRKLIPGTIALGAFTFTMTAVPGTPQTQNL
FT                   IPMKYFGTTPMAAPIMGIVGALIMCGGGIAWLTYRERKFAAAGEFFTEPAKNNVKVVDE
FT                   ESAATSKGLAKDLPNPALSALPLISVILLLNLFELNIIVSLAAGILLAIVLNFKRLPSL
FT                   ISTINGGAAGSVMAIINTSAAVGFGSVVKAVPGFAALTSMLLGIKGNPLISEAVAVNLL
FT                   AGATGSASGGMGIALEALGTKYAELAATSGIPLAAFHRIASLASGGLDTLPHNGAVLTL
FT                   LAATSMTHKDSYLDIFMVACVIPIASVIAAIILASIGLV"
FT   gene            116245..117087
FT                   /locus_tag="Clos_0088"
FT   CDS_pept        116245..117087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0088"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   amt:Amet_4523 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17658"
FT                   /db_xref="GOA:A8MFL9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFL9"
FT                   /protein_id="ABW17658.1"
FT                   /translation="MKKIGIIGSGTMGSGIAQVLAEYGYEIILRDINEEFINRGIGLIT
FT                   KNLNKKVEKGKITDLDKNETLNRIKGTINITDLKEVDLVIEAAVENMEMKKQIFSELDK
FT                   VCRKETILATNTSSLSITEIANATNRPDRVIGMHFFNPVPVMKLVEVIKGIATSEECKS
FT                   AIVKIINRIEKTPVEVEEAPGFVVNRILIPMVNEAIGIFSDGVSTKEEIDDAMKLGANH
FT                   PIGPLALADLIGNDVCLFIMEILHKEFGDDKYRPHPLLRKMVRGGLLGRKTGKGFYTY"
FT   sig_peptide     116245..116310
FT                   /locus_tag="Clos_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.709 at
FT                   residue 22"
FT   gene            117132..117872
FT                   /locus_tag="Clos_0089"
FT   CDS_pept        117132..117872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0089"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: amt:Amet_4631 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17659"
FT                   /db_xref="GOA:A8MFM0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM0"
FT                   /protein_id="ABW17659.1"
FT                   /translation="MKFKDKVVLVTGAAQGIGKATAVKFAEEGAKVVAIDVKLEAMDEV
FT                   SSEINEIGAELLTYEVNVVNREQIQAMVSDVVAKWGKIDVLVNNAGITADSQLVKMEEE
FT                   AFDKVIAVNLKGVYNCTQIVVPVMVENGGGVILNASSVVGLYGNFGQTNYAATKFGVIG
FT                   MTKTWAKELGKKGIRVNTVAPGFIGTPMVAKMPDKVIDMMKGKSPLNRLGTPEDIANAY
FT                   AFLASEDAGFITGATLSVDGGVVL"
FT   gene            118268..118684
FT                   /locus_tag="Clos_0090"
FT   CDS_pept        118268..118684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0090"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   cbe:Cbei_3349 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17660"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM1"
FT                   /protein_id="ABW17660.1"
FT                   /translation="MVGKKISEIKVGDQASFQKTITETDVYLYAGITGDLNPAHINEIS
FT                   AQGSLFKGRIAHGMLTAGLISAVLGMQLPGPGTIYMGQELKFLAPVRFNDTILATVEVI
FT                   EMNVEKNRIKLSTTCTNQEGVVVLSGVATVMPPK"
FT   gene            118721..119860
FT                   /locus_tag="Clos_0091"
FT   CDS_pept        118721..119860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0091"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: amt:Amet_3091
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17661"
FT                   /db_xref="GOA:A8MFM2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM2"
FT                   /protein_id="ABW17661.1"
FT                   /translation="MNFTLSKEHLMLKNLYQEFAQKEVKPLAEEVDEKEMFPVETVKKL
FT                   ARYGFMGIPFPKEWGGSGGDSIAYAMAVEELSKVCATTGVIVSAHTSLGAAPIYEFGTK
FT                   EQKEKYLPSLASGEKLGAFGLTEPNAGTDASAQQTIAVLDGDHYILNGSKIFITNAGYA
FT                   DIYIIMAMTDKSQGTRGISAFIVEADTPGFSIGKKESKLGIKGSSTCELVFENCRIPKE
FT                   NLLGKEGKGFGIAMKTLDGGRIGIAAQALGIAQGALDETVSYVKERKQFGKSISYFQNT
FT                   QFQLADMATKIEAARLLVYKAAFLKQEGLPYSNEAAMAKLFASETAMEVTVKAVQLHGG
FT                   YGYTREYPVERMMRDAKITEIYEGTSEVQRMVISAQLLK"
FT   gene            119874..120656
FT                   /locus_tag="Clos_0092"
FT   CDS_pept        119874..120656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0092"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: amt:Amet_3090 electron transfer
FT                   flavoprotein, alpha/beta-subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17662"
FT                   /db_xref="GOA:A8MFM3"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM3"
FT                   /protein_id="ABW17662.1"
FT                   /translation="MKIIVCIKQVPDTTEVKLDPKTGTLIRDGVPSIINPDDKSGLEAA
FT                   LRIKDEIGAHITVLTMGPPQAEAAIREAFAMGADRGILLTDRAFSGADTWATSSTLAAA
FT                   IKELEYDLVIAGRQAIDGDTAQVGPQIAEHLNLPQVSYVEDLKLDGDRIILKRVFEDRY
FT                   HTVRVTTPCLITTIKELNEARYMSVGGIYDAYNSKEVEVWNLNNIHVDMENIGLKGSPT
FT                   KVKKSFTKGAKTAGKVFVVDAKEAAEIIVDKLKEKYMI"
FT   gene            120671..121672
FT                   /locus_tag="Clos_0093"
FT   CDS_pept        120671..121672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0093"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: amt:Amet_3089 electron transfer
FT                   flavoprotein, alpha/beta-subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17663"
FT                   /db_xref="GOA:A8MFM4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM4"
FT                   /protein_id="ABW17663.1"
FT                   /translation="MSSLGHKGIWVFAEQRDGEIQNVSLELLGKGRELADELKTELTAV
FT                   LLGEGIKDLSKELLYYGADKVIVADHPMLNIYITEPYTKVMCDAIKGHNPEIILIGATA
FT                   IGRDLAPRISARIHTGLTADCTSLEIEEETKNLLMTRPAFGGNIMATIICPEHRPQMST
FT                   VRPGVMVKRTRDEGRRGDIIELSPELNESHMNVEVLEVVKESKKKVKIEEANVLVSGGR
FT                   GIGKKENFEVLEKLAKELGGVVSGSRAVVDAGWIERDYQVGQTGKTVRPDLYIACGISG
FT                   AIQHVTGMEESELIIAINKNADAPIFELADVGIVGDVNKVIPALIDALKNSR"
FT   gene            complement(121751..122512)
FT                   /locus_tag="Clos_0094"
FT   CDS_pept        complement(121751..122512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_2831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17664"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM5"
FT                   /protein_id="ABW17664.1"
FT                   /translation="MKKFVGISLSIALIGAFVVGCSPKAPTGSVNEKTLSQKKELPIKV
FT                   EDKVISSDNGVLNSSIKLPVFSNDKNQSILDEINARLEKNATDINKELATIAENDSKEA
FT                   KKSNFEFRPYELLVDYTIHTVNEKVLSLTTLNYQYTGGAHGMSIKVPYNFDLTTGKEIT
FT                   LKDLFKEGTAYKNIINEEIQKQIKSEPEKFFPDEVELFSGIKDDQNFFIENDQLFIYFG
FT                   QYDIAPYSSGIIEFEIPSSILKDVISTSFIK"
FT   sig_peptide     complement(122450..122512)
FT                   /locus_tag="Clos_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.958 at
FT                   residue 21"
FT   gene            122783..123481
FT                   /locus_tag="Clos_0095"
FT   CDS_pept        122783..123481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0095"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: dsy:DSY1106 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17665"
FT                   /db_xref="GOA:A8MFM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM6"
FT                   /protein_id="ABW17665.1"
FT                   /translation="MEERIKVLVVEDETSIRKFLAINLNRDGFEVIEAASGEEALDIIT
FT                   RTQPKVVVLDLMLPGIDGFEVCQNIRKSIPNIVIIMLTAKSQDMDKIMGLELGADDYMV
FT                   KPFNPLELIARIRANLRKIDNAKGQLNKIISLREFELDLDAQKFYKRGIEIELTPIEFS
FT                   MMKMFMEGNNKAFSRDEILNIVWGKNYFGDMKTVDVHVRRIREKIEDDPSNPRIIETVW
FT                   GVGYRLKGAK"
FT   gene            123483..124874
FT                   /locus_tag="Clos_0096"
FT   CDS_pept        123483..124874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0096"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cbo:CBO0353 two-component
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17666"
FT                   /db_xref="GOA:A8MFM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM7"
FT                   /protein_id="ABW17666.1"
FT                   /translation="MNSIKRRITINFIFIVVITVVILEIFLINIVKENYYRNLEQSLSN
FT                   QIRISADLYSRYFSDATLNENILNNVDTFWKQTNAQVEILDKNGKVLMDSIGVIPSNPI
FT                   RTDDVIGAINGEMGTWIGKVEYDNNKVMAISHPLRSGENIVGVLRFITSLREVNRDINE
FT                   IAFLFIGFGALVILISSFVGIFLTKTITGPLKNVTESAEKMALGDYSIRSVKTYDDEIG
FT                   KLSDTLNYMASEIVKKEELKNDFISSVSHELRTPLTSIKGWAITLKHSPDDKEILADGL
FT                   NIIETESDRLANMVEELLDFSKFVSGKISLEKKEVNINEIIDHIKKQLTPRAMRDNIKF
FT                   EVIAEEPMPIFCSDGNRLKQVFINVLDNAFKFTPAGGSVSLVASYRDGNFIFNIKDTGH
FT                   GISAEDLPRVKEKFYKGRTSLSQNGIGLSICDEIISLMKGTFEIKSQLNKGTEIIITLP
FT                   LGECE"
FT   gene            124875..126443
FT                   /locus_tag="Clos_0097"
FT   CDS_pept        124875..126443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17667"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM8"
FT                   /protein_id="ABW17667.1"
FT                   /translation="MKKVKLLWVVLSMILLISACSHSSVDSSDDMIVPPKNQLMPLEGV
FT                   WEIEDILTTESPVKNENREDWLGKQVQFSRDHMYLRGISLEKPQYQMKTVNAESYLLFN
FT                   SKSLPSDFSFPNKEIEVITVIDNERFFCDILILDSEEIILKIQGYSLLLNKLSDHTGDY
FT                   VLGDITKENDGNGEQIKDDKVETTDTGVLIGLRSKNTDSDAEDQYDYRTLWISSIHNES
FT                   GPVLQMDHLFFPRRSGFWKITVNQEQRGNILEESILSSNVLMNESQIEANLRNKKLNFE
FT                   GSIEASGYGSNSMESYKAANLITGQIHRRIDYVGNDYISIETTEKGMNFETSKLQLLPI
FT                   DGLPNANSVKISDILGEMGVISIKSAWEKALNSLKIENADILYREELLENFGMERKLGN
FT                   WRLKGRINYTKNNVFNTADYNINILPPSKVVFYDTLFVPWKNIKDRVPRALDAYTSPNK
FT                   DIAIVQTKRELLIYDIHGNELDQYPKIRIDLKEEETVIMAEWATGKYVENWEGIFLKTG
FT                   GSVLE"
FT   sig_peptide     124875..124946
FT                   /locus_tag="Clos_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.743 at
FT                   residue 24"
FT   gene            complement(126494..126823)
FT                   /locus_tag="Clos_0098"
FT   CDS_pept        complement(126494..126823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_1370 collagen triple helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17668"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFM9"
FT                   /protein_id="ABW17668.1"
FT                   /translation="MRCDCSNNRSRSNCYILPRNCQERNYVEFRCHRRNNRPQPCPPFP
FT                   CLCPVCCHGFILIPGPQGPQGPQGPQGPQGAQGPQGPQGAQGPAGPQGPQGPQGPQGPE
FT                   GPSGS"
FT   gene            127238..128383
FT                   /locus_tag="Clos_0099"
FT   CDS_pept        127238..128383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0099"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG:
FT                   bat:BAS1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17669"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN0"
FT                   /protein_id="ABW17669.1"
FT                   /translation="MDYKNDNIYYNWNRDCKCGHCGHCRQCIICPCGITGPTGPTGATG
FT                   ATGPTGATGATGSTGPTGATGATGPTGATGATGPTGPSGGPAGPTGPTGPTGPTGPTGP
FT                   TGPTGPTGSTGATGVTGATGPTGATGVTGPTGPTGPTGATGVTGPTGPTGESGPTGATG
FT                   VTGPTGPTGESGPTGATGVTGPTGPTGESGPTGATGVTGPTGPTGPTGATGPTGATGAT
FT                   GATGPTGPTGSTGATGATGPTGPGGNTIYLATDQSIANNQYLGLGNASADFTRNTVVIA
FT                   QDSTIVGLAFSIRTEILDANDTISAEIVRSTTCGDVLIDTGIIATVTGPSSEGARNCCA
FT                   FVSADYNVTRCDLLSIRITRTGEQGALMEGATATILVNTSA"
FT   gene            128668..129990
FT                   /locus_tag="Clos_0100"
FT   CDS_pept        128668..129990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0100"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG: cdf:CD3349
FT                   putative exosporium glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17670"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR021210"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN1"
FT                   /protein_id="ABW17670.1"
FT                   /translation="MDYKNDHRYSRWNGSGNCNCGHCRQCIICLGGITGATGPTGPTGA
FT                   TGPTGPTGTTGATGSTGPTGSTGATGSTGPTGPTGPSGGPAGPTGPTGPTGITGPAGAT
FT                   GPTGATGVNGVTGATGPTGATGANGVTGATGPTGPTGATGANGVTGATGPTGPTGATGA
FT                   NGVTGATGPTGPTGATGANGVTGATGPTGATGADGVTGATGPTGATGADGVTGATGPTG
FT                   ATGADGVTGATGPTGATGANGVTGATGPTGPTGSTGATGPTGATGAAGDGAIIPFASGV
FT                   TPAVLTTVLGSVLNTGSIVGFGSNITGVSGLGGAINITLIGDLAFNVPRDGILDSLSAT
FT                   FNVTVGLSLIGSTVTVSATVYSAPAGSNSFTPVPGATVNLVPAYTGLISVGDIATGSIS
FT                   GINFPVTTGMRLMLVFSSAITGGLDIASTLTGQASGGIGIS"
FT   gene            complement(130105..131661)
FT                   /locus_tag="Clos_0101"
FT   CDS_pept        complement(130105..131661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0101"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC00588 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17671"
FT                   /db_xref="GOA:A8MFN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN2"
FT                   /protein_id="ABW17671.1"
FT                   /translation="MSILTVKNLTHGFGDRAIFNNVSFRLLKGEHIGLIGANGEGKSTF
FT                   MNIITGKLEPDDGQVEWSKRVRVGYLDQHTVLERGMSIRDVLKGAFQYLFDLETEMNTI
FT                   CEKMGDASEDELEKLLEDMGTIQDTLTNNDFYIIDSKVEEIARGLGLEDIGLDKDVQDL
FT                   SGGQRTKILLAKLLLEKPDILLLDEPTNYLDEQHIEWLKRYLQEYENAFILISHDIPFL
FT                   NSVINLIYHMENQELNRYVGDYDNFINIYETKKLQLEAAHRKQQQEIADLKDFVARNKA
FT                   RVSTRNMAMSRQKKLDKMDIIELPDEKPKPEFNFKEAKTSGRLIFETRDLVIGYDEPLS
FT                   KPLNLRMERGQKIALVGANGLGKTTLLRSILGEIKALSGEVELGDTLYTGYFQQEIKEA
FT                   NYNTCIEEVWHDFPSLSQYEVRAALAKCGLTTKHIESKIVVLSGGEHAKVRLCKLINKE
FT                   TNVLVLDEPTNHLDVDAKEELKRALKAYKGSILLICHEPEFYQDVVTDVWNLEAWTTKI
FT                   V"
FT   gene            131995..132576
FT                   /locus_tag="Clos_0102"
FT   CDS_pept        131995..132576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17672"
FT                   /db_xref="GOA:A8MFN3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN3"
FT                   /protein_id="ABW17672.1"
FT                   /translation="METDSSDSDDSDSDRNKNIRSDAKLLDYRKEILINITDERGRIGY
FT                   IKGVLLNTEHILKELKSEEVLKVLEFNDKEDEEEIKSFYIQVLSKGNCKDNGFYITELF
FT                   IEKEYRGNGIGRKIFDELPKFLYDQVDRDISCIYLMPGPLEKVDGEVKYIMNSKDEQMV
FT                   ALKQRLIKFYESVGFKRIGNTDFYNKNQVI"
FT   gene            132793..132939
FT                   /pseudo
FT                   /locus_tag="Clos_0103"
FT   gene            132953..133138
FT                   /locus_tag="Clos_0104"
FT   CDS_pept        132953..133138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_1134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17673"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN4"
FT                   /protein_id="ABW17673.1"
FT                   /translation="MYEYKYVQATLGGFFKEANHREIINEHAKQGWRLVQVLPMYYNSH
FT                   GKPMEYEIIFERKIDE"
FT   gene            133157..133330
FT                   /pseudo
FT                   /locus_tag="Clos_0105"
FT   gene            134093..134617
FT                   /locus_tag="Clos_0106"
FT   CDS_pept        134093..134617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0106"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ssa:SSA_1986 acetyltransferase, GNAT family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17674"
FT                   /db_xref="GOA:A8MFN5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN5"
FT                   /protein_id="ABW17674.1"
FT                   /translation="MYSIDRITEDSKKKEISNLILRQLPEWFGIEQSLIEYVDGVYDTD
FT                   FYVSYCNETPVGFISVKYNNRFTAEIYVVGILKEHHHRGMGKKLIHICEEELRRKGIVY
FT                   FMVKTLGESHPDQNYKDTRNFYTKVGFYPLQEINEIWGNENPCLIMVKYIGYKEVVLSK
FT                   NLTTQTQTFKR"
FT   gene            135053..135859
FT                   /locus_tag="Clos_0107"
FT   CDS_pept        135053..135859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0107"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cpr:CPR_0075 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17675"
FT                   /db_xref="GOA:A8MFN6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN6"
FT                   /protein_id="ABW17675.1"
FT                   /translation="MTEEVRKYYDDFAENEWNRLNNSYSRVEYASTLYLIEKYFPRTGN
FT                   IIDIGSGPGRYSLELLKRGYHVSLLDLSKNELEIAKKKIEESNLKAEHYYCKSALELDF
FT                   LEDEFFDGVLVMGPLYHLHGAQEREKVLKDTYRILKKGGVALISYINTWGALKASVSEF
FT                   PESFEDEAHFERYIKGDLRFSSEESFTATFFTTPPLALKEVEESGFTIVSYAGAESFLS
FT                   GLNIQLQNLHKYMPHVYKNYLEAAPKYCELPQYRDATEHLHIIVQK"
FT   gene            135971..136771
FT                   /locus_tag="Clos_0108"
FT   CDS_pept        135971..136771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0108"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cdf:CD1963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17676"
FT                   /db_xref="GOA:A8MFN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN7"
FT                   /protein_id="ABW17676.1"
FT                   /translation="MKTVVDFYEKYDEESRITTNNARKIEFLMTTGVLDNHIEKTHRIL
FT                   EIGAGTGAYSFYYGEKGNFVIATDITPKHIEIIGQKMKERGNDINLQAEVANATDLSQF
FT                   SSESFDVVLCLGPMYHLTNSSDRKTCLSEALRVLKKGGLLAIAYINKHFVLNSVMIRNK
FT                   EFLTRNFIDKILDTGVTREGEKECFWTDAFFTTPDEMASYMNCFEVEIIDHLGVDGLSP
FT                   YFKDAVDGMNSEEYESWLYYNMRSCREKSILGISNHGLLLCKKK"
FT   gene            136997..137758
FT                   /locus_tag="Clos_0109"
FT   CDS_pept        136997..137758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0109"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: fnu:FN0736
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17677"
FT                   /db_xref="GOA:A8MFN8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN8"
FT                   /protein_id="ABW17677.1"
FT                   /translation="MDYIKLIEAWKLEEKNGFEGWNFSHIAHRMMEEPLPWDYDKIIRH
FT                   NLNADDRLLDMGTGGGEYLLTLNHPYKNTFVTESYEPNFKLCQSQLTPLGIDVRQVFDD
FT                   HSLPYEDNLFDLIINRHESFDIKEVYRILKPDGLFITQQVGGLNNKELSKFLIKDFKEA
FT                   VSSEYTLDHCIKSIQNQGFIILESKEYFPTVKFFDIGALIYFAKIVVWEFPGFSVEKCF
FT                   EELCQLQSIMNNRGYVETKEHRFMIVSKKLK"
FT   gene            137869..138432
FT                   /locus_tag="Clos_0110"
FT   CDS_pept        137869..138432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0110"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csc:Csac_0988 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17678"
FT                   /db_xref="GOA:A8MFN9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFN9"
FT                   /protein_id="ABW17678.1"
FT                   /translation="MIEGKKIMIRQLELGDEEYLYKWWNTGEMMEHATHVFGVLQSKQT
FT                   IQDSIKRETENTNLFPENKRFLICKKDSFEPIGEMNYVGWNARNQKCEFGIKICEVGEQ
FT                   GKGYGKDALYHFIDFLFRFLNLNKIELTSMKDNIRAHNLYKSLGFKEIGIIREACFDSR
FT                   IGQFSDVVYMDLLKREWIQIKGRI"
FT   gene            138904..139443
FT                   /locus_tag="Clos_0111"
FT   CDS_pept        138904..139443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0111"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbo:CBO0859 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17679"
FT                   /db_xref="GOA:A8MFP0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP0"
FT                   /protein_id="ABW17679.1"
FT                   /translation="MEEISYRELKEIELDEALFVKFNRYQDVKKCWRKENGEWLLKDIA
FT                   FTEQWSLDEYRELTKYLQNTIKTGGTVFGAFNKDVLVGFASLENEFFGSNKEYLQLSSI
FT                   HTSYEYRGCGIGKKLFSLICRQAKELGAQKLYISAHSAQETQEFYKAMGCTEAVEYNEK
FT                   LVAAEPCDCQLEYVLA"
FT   gene            139518..139865
FT                   /locus_tag="Clos_0112"
FT   CDS_pept        139518..139865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17680"
FT                   /db_xref="GOA:A8MFP1"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP1"
FT                   /protein_id="ABW17680.1"
FT                   /translation="MDKNLIRFLMFLAYCVPYGYLAMKGDATFGTMIFYGLMIASFGIL
FT                   CRTAIRTNNAIVLIIGNVLSFISSYLFTFKNLSEEWGWYFKPFTPMSLLLLITTVFFTI
FT                   QVLIIFRFSKK"
FT   gene            140125..140862
FT                   /locus_tag="Clos_0113"
FT   CDS_pept        140125..140862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0113"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG: tte:TTE2723
FT                   peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17681"
FT                   /db_xref="GOA:A8MFP2"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP2"
FT                   /protein_id="ABW17681.1"
FT                   /translation="MGTIFAIGGGEIRKLETLHIDNMIVESAHKENPKTLFIPTASNES
FT                   QEYIDSFNYIYGEKLGCSTDVLLLLEGKTSAEECKKKIMDADIIYVGGGNTRKMLQVWE
FT                   DYGVDQLLKEAYKSGKVLSGMSAGSICWFKSGHSDSQSFDKEDNWRYIRIEAMNLINAM
FT                   HCPHYDEDARKEDFSRKVLEYDEIGIAVENNCAIEFKDNYYKIHKSNLKAKAYKLYQLN
FT                   GKVIKVELNNTAEYRPIEEILHK"
FT   gene            141101..141568
FT                   /locus_tag="Clos_0114"
FT   CDS_pept        141101..141568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0114"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vvy:VV1879 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17682"
FT                   /db_xref="GOA:A8MFP3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP3"
FT                   /protein_id="ABW17682.1"
FT                   /translation="MYYRTINIKNYQDRDMIIKFRKDTHEVGWEMSTRFDSISYIQRME
FT                   ERIHKFPDGQLIIEDSGKPIGQVGFDIQEYNGKEIGYVNIFYLIPEYRGRGIGKEIIQY
FT                   VEDFFTKSNVSEYHLRVSSRNEKAINLYTKIGMIKINEEDGSLRMKKTLSK"
FT   gene            141676..142506
FT                   /locus_tag="Clos_0115"
FT   CDS_pept        141676..142506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0115"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: cpf:CPF_2402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17683"
FT                   /db_xref="GOA:A8MFP4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP4"
FT                   /protein_id="ABW17683.1"
FT                   /translation="MDRKDQYQVDMHIHTTASDGTWTMEKLLEFILKSNIKLFSITDHD
FT                   TIENSIKMFHRVPDNINYVIGTEISCTYDMEEYHITAYDFDYRNSKLNGLIEFNQIRRK
FT                   EFNRKIIEFVKEIDKITDITDYFLYKYDRNRGGWESLNYLLDKNIVGNLKEYFEIVKLS
FT                   NKKIRFKSPQEVIDIIKDAGGHPFLAHPSAYKNGGKLPAEVLKEWKAYGISGIECFSPY
FT                   LRNIEDGNYYVKFCNENNLMISAGSDCHGEFNNRALGIPKVGVDEIRLDFMKNI"
FT   gene            142874..143401
FT                   /locus_tag="Clos_0116"
FT   CDS_pept        142874..143401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0116"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   amt:Amet_2241 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17684"
FT                   /db_xref="GOA:A8MFP5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP5"
FT                   /protein_id="ABW17684.1"
FT                   /translation="MNRLKLVLPAPEYKEEIMEYKKEFIENGDSMDGTAGLRNAETFED
FT                   WYDAFLHNLKEETVKEGLVPSTTYMAMSTKDNRLIGMIDIRHRLNDYLLNFGGHIGYSV
FT                   RKSERRQGYATEMLALGLIECAKMNIRKVLITCDKDNIASAKTIRNNGAKLENEVQEGD
FT                   RVTQRYWVTLDK"
FT   gene            143494..143772
FT                   /pseudo
FT                   /locus_tag="Clos_0117"
FT   gene            143865..144395
FT                   /locus_tag="Clos_0118"
FT   CDS_pept        143865..144395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0118"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fnu:FN0657 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17685"
FT                   /db_xref="GOA:A8MFP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP6"
FT                   /protein_id="ABW17685.1"
FT                   /translation="MDKCILIKPNLCYESDIQDFRKEMLDVNSSMDGAGPLKRMDSIKE
FT                   WLEFNRRCENKETVPKNWVTCEQYIYVREADNKIVGMIQFRHYFNEFLEKYGGHIGYSV
FT                   RPDERRKGYATMMLAECLGICKAYGLKKVLITCIKGNEGSKRTVLANGGVYEGTIYCEP
FT                   DDVYLERYWIALD"
FT   gene            144576..145385
FT                   /locus_tag="Clos_0119"
FT   CDS_pept        144576..145385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17686"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP7"
FT                   /protein_id="ABW17686.1"
FT                   /translation="MEDLYKNIEMFFEKLPISRNNMALKKAFIEEIDAEYEELKKENTE
FT                   EESIRILKNEHQFIYEVNKMDGTPGLYLYSKGLTISDVGLVFDPSENEERFERAYQLLK
FT                   ELCDIDLCYQREKEDFKFDPSERLIIFALDRDRNYFGFIGDSGNLGESNIPIAYIRKEG
FT                   IYGKVANNLKELLELALFYPYWYEFIQLRSSDKEYSLEMLERQWIQETPDFYEKQKELA
FT                   NALGINKNDHSLDILIENLRQKPSFIVSDLADDFHQFKYILGAFEEE"
FT   gene            145638..146162
FT                   /locus_tag="Clos_0120"
FT   CDS_pept        145638..146162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0120"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17687"
FT                   /db_xref="GOA:A8MFP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP8"
FT                   /protein_id="ABW17687.1"
FT                   /translation="MKTIHEQSNLIILRNTTEDDLDFVVQTERDLENAKYVLQWTKEQH
FT                   RGAMEDEDMLHLVIEDSQTHNLVGYAIIAGLKNYDRNIELKRIAISEKNKGYGREAIKQ
FT                   IRKISFEDLNGHRLWLDAICKNHKAHRLYESEGFVQEGVLRECMFINGQYESIVVMSIL
FT                   EEEYRSNFKNR"
FT   gene            146380..147075
FT                   /locus_tag="Clos_0121"
FT   CDS_pept        146380..147075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0121"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ctc:CTC00163
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17688"
FT                   /db_xref="GOA:A8MFP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFP9"
FT                   /protein_id="ABW17688.1"
FT                   /translation="MEESVNILIVEDDMDINNLLSKMLSKRGYHVRQAYSGTEALMCLE
FT                   HYEFQLVLLDLMLPGMVGEEIICQIRKLKNMPIIVISAKLAQDTKIEVLNLGADDFIVK
FT                   PFDVNEVLARVEAQLRRYMVFSNPRDKQNILTYKDLVLNRDTVEVTMKGLPISVTAKEF
FT                   AILELLMEHPKKVFTKANLFEQVWNDEFLGDDNTVNVHISNLRSKLAKADPATEYIHTV
FT                   WGIGFKMNE"
FT   gene            147165..148088
FT                   /locus_tag="Clos_0122"
FT   CDS_pept        147165..148088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0122"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC00162 ABC-type multidrug transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17689"
FT                   /db_xref="GOA:A8MFQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ0"
FT                   /protein_id="ABW17689.1"
FT                   /translation="MIETVLRTKDITKKYKNNFAVNNVSMEVKQGDIYGLVGKNGAGKT
FT                   TLLRMVSGLSVATSGGLELFGEASSDGLNKSRMRTGCIIETPSFFPYLSASKNLEYYRI
FT                   QKGIVEEEVIERTLKMVGLEGTGNKKFKNFSLGMKQRLGLAFAIMGNPELLILDEPING
FT                   LDPSGIVEFRELLLKLNRENNITIIVSSHILSELSQLATTYGFIHNGQLVEQISAKELE
FT                   EKCRHYLAIKVDDIGKATVTIENKLGTNKYEVLNDNQIRLYDYIDRPEVVNKTLVINDV
FT                   MVSSIHQTGMNLENYFIELIGGSHNA"
FT   gene            148081..148833
FT                   /locus_tag="Clos_0123"
FT   CDS_pept        148081..148833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0123"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /note="KEGG: ctc:CTC00160 putative ABC-2 type transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17690"
FT                   /db_xref="GOA:A8MFQ1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ1"
FT                   /protein_id="ABW17690.1"
FT                   /translation="MLNYIKAELYRNFNRVYYWAFITITSAVALLCNILIKSTGNVTSM
FT                   SLSEIMYIGIQAINLPIFLVLMMVEIVTSEENKNLTIRNAVSFGIPRNKMIASKVVTTT
FT                   ILSSIAALIILTVFLGSGAILLGFGADFSLEIVKDFSLRLLVAVPLWIGAISVGTFLGI
FT                   VFKSSTVSSFIYFGVFTMARKIINVLEVIVSDKFKYLHKILITTNLFNLRNDVLSNEII
FT                   ISAILVGVGFTALFTILSMVYFNKIEVK"
FT   gene            148866..149789
FT                   /locus_tag="Clos_0124"
FT   CDS_pept        148866..149789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0124"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ctc:CTC00159
FT                   sensory transduction protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17691"
FT                   /db_xref="GOA:A8MFQ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ2"
FT                   /protein_id="ABW17691.1"
FT                   /translation="MMLIILLGIFITLYIFLQKEIRGMVKQLKRINKSNTNAKVTLSSA
FT                   NKDIVGLAREINATLEEKQKSEIEHKKIDLELRQAIANMSHDLRTPLTSIIGYIQLMDD
FT                   PNLSDDEKTEYKDIVKRRAESLQTLISSFYDLSRLEAREYNFELGPVYLDKILYDLIAS
FT                   FYRDFLNKNIEPAIDILEKAAPVIADENAVKRIFFNLIQNALKYGNQRMAISLKQNEAY
FT                   TITTFTNDTSNLKEEDAARIFERFFTADSTRSNKSTGLGLAITKELVEQMGHTIDAEIS
FT                   GDKLSIIIKWRRTSISTRLDSRNCLK"
FT   gene            150210..151253
FT                   /locus_tag="Clos_0125"
FT   CDS_pept        150210..151253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: efa:EF2082 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17692"
FT                   /db_xref="GOA:A8MFQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ3"
FT                   /protein_id="ABW17692.1"
FT                   /translation="MIEIVNVSKIFDDSKNKVHAVQDVSLKVEKGQIYGIIGYSGAGKS
FT                   TLIRCINLLERPTTGKVLFKGEDITLLSEKELREKRKKIGMIFQNFNLFNSRDVYHNIA
FT                   YPLKGANLSKEEERKKVKALLELVGLSDKEHAYPSQLSGGQKQRVAIARALANDPEVLL
FT                   CDEATSALDPKTTKSILELLKELREKLGLTIILITHEMAVIKDICDRVSVMENGKVVEE
FT                   GDIVKIFSRPENQTTKGFLETATNTSKIYELLQLKDNIFNIRDEDVLTKVNYLGEATKD
FT                   ALISEVSRKFSINASILYGNLEVLGKTPVGELIVLFSGNREDIFKGIDYFREKGLIVEV
FT                   MDHGRNS"
FT   gene            151237..151917
FT                   /locus_tag="Clos_0126"
FT   CDS_pept        151237..151917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0126"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: amt:Amet_3893
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17693"
FT                   /db_xref="GOA:A8MFQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ4"
FT                   /protein_id="ABW17693.1"
FT                   /translation="MVEILSKYIPNVLNSTDEILVAIYQTLIMVSISGILSLIFGVLLG
FT                   VTLVVTRKNGILENTVINNILDKVINVFRSIPFIILIAAIMPLTRWMVGTAIGIKGAIV
FT                   PLVIGTVPFFSRQIESALLEINKGIVEAAQAMGSGPMDIIFRVYLKEGLPGIIRGVTIT
FT                   FISLIGSSAIAGAVGGGGIGDLAIRYGYQRFQADITYISVILLLILVSIIQGVGNLIIK
FT                   KVTH"
FT   gene            152104..153345
FT                   /locus_tag="Clos_0127"
FT   CDS_pept        152104..153345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0127"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   amt:Amet_3646 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17694"
FT                   /db_xref="GOA:A8MFQ5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MFQ5"
FT                   /protein_id="ABW17694.1"
FT                   /translation="MSYLIEQCKRLKEASYALGMISTKDKDEALRLIIDSIKRNKDDIL
FT                   AENDKDVLAAKEKGTKDSLIDRLKLTEDRIQGILEGIETIIGLKDPIWRSNDVWTLENG
FT                   LTISKMTVPLGVIGIIYESRPNVTVDAFSLALKSGNCILLRGSSSAIHSNKMIVSAIKE
FT                   GLRRSKVSEDIIELIEDTDRNVVKEMLTLNEYIDVIIPRGGADLIRFVVDHATVPTIET
FT                   GIGNCHIYVDESANLENAIQIITNAKIQRPGVCNACETTLIHEDIAPKFLPMLAAALKD
FT                   KVELKGCPRTREIIQAAEATDMDWAEEYLDYILAVKVVSNVDEAIGHIQAYGTKHSEAI
FT                   ITENYTNANYFLRRVDAAAVYVNASTRFTDGGAFGFGGEMGISTQKTHARGPMGLNELV
FT                   TMKYTVVGNGQIRQ"
FT   gene            153359..154150
FT                   /locus_tag="Clos_0128"
FT   CDS_pept        153359..154150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0128"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: amt:Amet_3645 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17695"
FT                   /db_xref="GOA:A8MFQ6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MFQ6"
FT                   /protein_id="ABW17695.1"
FT                   /translation="MLQDVMKKSKKIVIKIGSNTLSNVDGTINHDFIEALCQQVAFLVG
FT                   EGKQVVIVTSGARIAGISRTNKWSRKEDMNYKQALCAIGQVELMSAYNSHFSHHGIYIG
FT                   QLLLTREDFFDKTRNLNIRNTLFTLVDEGIVPIINENDTVSVEQIKIGDNDTLAAYTAT
FT                   LWNADLLILLSDIDGIYNKNPKEYEDAELLEQVQNIDDMLKEIEVGETNSFGTGGIETK
FT                   IEAARIVNRYNIPMILGNGKNKEILMKLYQNEAKATIFFRE"
FT   gene            154161..154982
FT                   /locus_tag="Clos_0129"
FT   CDS_pept        154161..154982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0129"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: amt:Amet_2533 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17696"
FT                   /db_xref="GOA:A8MFQ7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ7"
FT                   /protein_id="ABW17696.1"
FT                   /translation="MEKRIGFIGAGNMSSTIIRGLVKSFEGMNQSIYISNRTIKKAEKL
FT                   CNQVHINLCRTNVELAENSDIIFLGVKPHMYDGVLREISSYVTKDQIIVSLAAGITTED
FT                   MGEYFKEPMKIIRIMPNVPVSVGEGMIALSSNGNVTGEEVDFVVQLLSSVGKVDQIDES
FT                   LIDAVTTISGCSPAFIAMFVEALADGSVRKGMPRDKAYLYAAQTLIGTGKMILEKGLHP
FT                   GELKDMVSSPGGVTIEGVYELEKRGFRNMLIEVVEACERKTKSMKSKKVEE"
FT   gene            155211..155720
FT                   /locus_tag="Clos_0130"
FT   CDS_pept        155211..155720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0130"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24
FT                   S26A and S26B; KEGG: amt:Amet_3647 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17697"
FT                   /db_xref="GOA:A8MFQ8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ8"
FT                   /protein_id="ABW17697.1"
FT                   /translation="MEKEIMEWLKSIVVALIIGVIITTFAQPTIVRGPSMEPTLQNNNL
FT                   LLVNRLLYKLKEPNHGDIIVFRLEAEKRNLIKRVIGVAGDTVEISSGIVYVNGSELEEV
FT                   YLDDIDISSKDQQVVVPRNSVFVLGDNRNDSKDSRNTEVGTVNKELILGKAYLRLFPFN
FT                   KLGKIR"
FT   gene            155789..156052
FT                   /locus_tag="Clos_0131"
FT   CDS_pept        155789..156052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17698"
FT                   /db_xref="GOA:A8MFQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFQ9"
FT                   /protein_id="ABW17698.1"
FT                   /translation="MAGMIYYNKAMKVIDRVLVTFTLIFVVVWVYTKASVSPYILLMLG
FT                   LQRLLYAYNANKMELKRGVGISLGLGVLMVVTSCAMLVAAMR"
FT   gene            156096..157115
FT                   /locus_tag="Clos_0132"
FT   CDS_pept        156096..157115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0744 copper amine oxidase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17699"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR0"
FT                   /protein_id="ABW17699.1"
FT                   /translation="MAYVYTRGNTLGNLQNKGLIVDYGKYIYFYLNGGLYRMNKENNEK
FT                   ILIYKGETKYLNVTGDFIYCVEDRTLYRIAISGEEHYIAPYYEDVEEISIVDHWIYCHD
FT                   SWSEYIFRINMNNSHKDEFFYIDTVPFSMAMDNENIYFSSDRNGNLEVVPVGAPFDGDE
FT                   GKIIGEDIGKGAFYIHVEEQWIYYLESEQHPLEYDSFKTIKYHIYKIRKDGTNKTKIVE
FT                   DYVNHINVQDGWIYFSNRSEQGALYKMKIDGTNKIKLSDDVCENIHLVEDWVYYYVEDK
FT                   SVYRLFQEKLRYFQSQNLSFEEVNQRMNEYENGIFLQKEPKKLYRIRKDGTFNEEVKI"
FT   gene            157376..158254
FT                   /locus_tag="Clos_0133"
FT   CDS_pept        157376..158254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0133"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: cbo:CBO1067
FT                   cofactor modifying protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17700"
FT                   /db_xref="GOA:A8MFR1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR1"
FT                   /protein_id="ABW17700.1"
FT                   /translation="MKKFKKFYIEITNRCNLACSFCPETKRAAEFMKIESFHKILEEIK
FT                   PFADYIYFHVKGEPLLHPAIDQFLDLSHEKGFQVNITTNGTLIKKQKDKILGKPALRQV
FT                   NFSLHSFDGNEGGGSKAEYIKDIIDFTKEAVAITETIVSLRLWNLDQDNETNVQRARNR
FT                   QILEIIEKEFNLSYRIEEKVTPGNGIKIGQRIYLNQDPEFKWPDLKEEEDEGKGFCYGL
FT                   RNQIAILVDGTVVPCCLDGEGIINLGNINQTKFSDIVENERANHIVQGFSRREAVEELC
FT                   RKCGYRKKFGV"
FT   gene            158312..158860
FT                   /locus_tag="Clos_0134"
FT   CDS_pept        158312..158860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0134"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: swo:Swol_1215
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17701"
FT                   /db_xref="GOA:A8MFR2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR2"
FT                   /protein_id="ABW17701.1"
FT                   /translation="MNQFALTKEEAVLMVIDIQERLVPVMEKKEQVIGNTNILISISNE
FT                   LNIPILVTEQYPKGLGRTVEALKNNMGDSPIYEKTSFTACTEALVSDLEKLGRKKIIIT
FT                   GMETHVCVFQTVRDLIQRGYHVFVVQDGVCSRTEENYKNGLDLMDRMGAMVTNTETVFF
FT                   DLMKAAGTPEFKKLSKLIK"
FT   gene            158948..159727
FT                   /locus_tag="Clos_0135"
FT   CDS_pept        158948..159727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0135"
FT                   /product="protein of unknown function DUF975"
FT                   /note="PFAM: protein of unknown function DUF975; KEGG:
FT                   cth:Cthe_3044 protein of unknown function DUF975"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17702"
FT                   /db_xref="GOA:A8MFR3"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR3"
FT                   /protein_id="ABW17702.1"
FT                   /translation="MWIRAELKSRAKEVLKKSYWKAFLVSMIIVAASGDMDSFKIKKQW
FT                   NITEPRNVLLEQKSDYIGSSFLEGVTDTAPWVWGLLIGIIASFLMLWLFKIIIGYAFEV
FT                   SGKRYFLKSAQDHFDLNNLTYAFNRSRIVDIVKTMAYRGLLVFLWSLLFLIPGIVKSYA
FT                   YQMVPYILADNPNIGYQRAVELSKNMTEGEKWNIFVLDLSFIGWNILGSLLFGIGRLFV
FT                   NPYVDSTQAELYLVLRENALERGLCTREELMMDEFTK"
FT   gene            159755..160198
FT                   /locus_tag="Clos_0136"
FT   CDS_pept        159755..160198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0136"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   amt:Amet_2950 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17703"
FT                   /db_xref="GOA:A8MFR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR4"
FT                   /protein_id="ABW17703.1"
FT                   /translation="MIRELTKDDKDIFISMVKEFYTSDAVLYSIPEENIVNTFNEAIKD
FT                   SPYVKIYIMEEEKGIAGYGQISLSYSNEAGGLVVWLEEIYIREDFRGLGLGGKFLDFVK
FT                   NEFSADAKRFRLEISESNMDAKRLYIRNGYETLDYLQMVCDIK"
FT   gene            160405..162681
FT                   /locus_tag="Clos_0137"
FT   CDS_pept        160405..162681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0137"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; SMART: AAA ATPase; KEGG:
FT                   amt:Amet_2822 ATPase AAA-2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17704"
FT                   /db_xref="GOA:A8MFR5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR5"
FT                   /protein_id="ABW17704.1"
FT                   /translation="MKKCSICNKNIAVVFATKMEDGKSEMKGICMECAKKMGLPIMNQI
FT                   MEQTGMTEEEIEGLSQQMNDVFEEMDLEEMEDDNFLGKLFKGSLGSFKMKEDEDIEVEE
FT                   TAEDKEEIFEEKAKKKKKGKKRKNLDTYGTNLTDRARNKEIDRVIGRNKEIDRVVQILN
FT                   RRSKNNPILIGEPGVGKTAIAEGLAGRIVEKQVPAKLFNAEVYLLDLTAIVAGTQFRGQ
FT                   FEGRMKAIIEEAQECGNIILVIDEVHNIMGAGEVHGGVMNAANILKPALARGEIQVIGA
FT                   TTLDEYRKHIEKDSALERRFQPVLVEEPSVEDTIEILKGIKGYYEDYHKVKISDEVIEA
FT                   AAKMSERYITDRYLPDKAIDIIDEAGSRVNLRNEGLVEIEGLKVELKAIEEKKAEAAKK
FT                   NDYEKAAQYKVDECRILDRIEELEAEVNKSALTVEDVAFVIESWTNIPVGKITEEEASR
FT                   LLSLEEQLHRRVVGQKDAVRSLSRTIRRNRSGFRKKRKPASFIFVGPTGVGKTELVRAL
FT                   AEELFGSEEAMIRVDMSEYMEKHTVSKLIGAPPGYVGYDQGGQLTDKVRRKPYSVILLD
FT                   EIEKAHPDVFNMLLQILEDGRLTDSQGRTVHFENTVVIMTSNAGTQIKSGSMGFGNRGY
FT                   EALENRAKDALKETFRPEFLNRVDETIVFTQLSKEELREIIELMLKDVIEDVKEKGMTI
FT                   TISDAVKDFILEKGYDEKYGARPLRRVIQRSIEDEIAEEYIKNTFVPGDHIQVDLKEDR
FT                   VVLSK"
FT   gene            162771..163502
FT                   /locus_tag="Clos_0138"
FT   CDS_pept        162771..163502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0138"
FT                   /product="putative metal dependent hydrolase"
FT                   /note="KEGG: ctc:CTC00445 putative metal dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17705"
FT                   /db_xref="GOA:A8MFR6"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR6"
FT                   /protein_id="ABW17705.1"
FT                   /translation="MENLNCSVVHLGHSTILVETPKYKMIFDYFNDGSVDSKEGPNNGV
FT                   LNEGEFRTEKDIFVFASHGHGDHYHPVIFKWRETNPNIHYILSSDIETTEEKGVHHMSP
FT                   YEDLKIGDVRIKTYGSTDKGVSFLVNVEGVQIFHAGDLNWWHWKSFTQEQLQAEEVDFK
FT                   REVDKLMGQNIDIAFVPVDPRLEEFYHLAGVYFAETIKPKFLIPIHFRDQFSIGKDFGR
FT                   ILAQSTVNVPKFKHIGQKFIF"
FT   gene            163818..165038
FT                   /locus_tag="Clos_0139"
FT   CDS_pept        163818..165038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0139"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: cth:Cthe_1485
FT                   beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17706"
FT                   /db_xref="GOA:A8MFR7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR7"
FT                   /protein_id="ABW17706.1"
FT                   /translation="MNHTKVTDDVYKLSVNIDNILFEGLWEMPNGVSLNSYIIKGEKTA
FT                   IIDGVCGWDGVPESLLALLDQLEIDPKSIEYLIINHMEPDHSGWIEDFKKIHSDFKVVC
FT                   SQKGAALLDAFYAHNNNVIVVKDKDTLDLGNGHILEFVDVPNVHWPDTIATFDRKTGVL
FT                   FSCDSYGSFGTVKESGYDDLLTEEEIEFYEKEAVRYYSNILGAFSLPAKKATEKCEALP
FT                   IKIIAPGHGIVWRKNPNKILEDYKRYVAYQKGVAKKEITVLWGSMYGMTEKAVNYVVEE
FT                   LKKYDIKVNVHKVPEDSCGTVLASVWNSTGVILAMPTYEYKMFPPMAAVLDEIGRKKAV
FT                   GRKAFRLGSYGWSGGAQRELDEIIEKHKMNWEFLEPVEFKGAPKEEDLSLIGLRIKELV
FT                   GKIESVF"
FT   gene            165293..166621
FT                   /locus_tag="Clos_0140"
FT   CDS_pept        165293..166621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0140"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   amt:Amet_1556 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17707"
FT                   /db_xref="GOA:A8MFR8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR8"
FT                   /protein_id="ABW17707.1"
FT                   /translation="MKFFKKRKVMIGVVVAALIIGVVSVNARLKSSATSGMAVNVADVV
FT                   KKEIKSTLNLKAPLQGTENVEVVSRLHYEILSIDVKEGDKVEKDQVLAVLDVSRLEEEI
FT                   EKLKDNVELLQIQNTEGKSSKETSAALAEQRLNEELENNQRNYETALEMYHTAKSRYDS
FT                   TKVLYDSGAASKWELVDKENALNDAKRKVDTFNVVNGKVQATEAQLAEMNNAKISSNNA
FT                   SGVKSIEIAKKELERKKKELEDCKIKSSITGTITRVNAKVGRFADEIDDRKPMFVIENV
FT                   DTLKMVANVSEYDIGKLEIGQKVKISADILNGAEVDGVVSRISPTGEQKQGSNERVIPV
FT                   QIDVVGDTKGLIAGINASAKVETAIAEDALVIPLEALIDGGDNTYSVFVVKEDKTIQKI
FT                   NVSLGVEDVLEVQIISDEIKEGDQVILNPQTFMTDGMSVIVNE"
FT   sig_peptide     165293..165376
FT                   /locus_tag="Clos_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 28"
FT   gene            166614..167306
FT                   /locus_tag="Clos_0141"
FT   CDS_pept        166614..167306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0141"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: amt:Amet_1555 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17708"
FT                   /db_xref="GOA:A8MFR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFR9"
FT                   /protein_id="ABW17708.1"
FT                   /translation="MSSIIKIENISKVYDTGAVQVHALREVSLSIEEGDFVAIMGQSGS
FT                   GKSTLMNILGCLDKPTSGIYELDGINISKTDNRDLSSIRNKKIGFVFQSFNLIPRTSAL
FT                   KNVELPMIYAKMGKKERQKRAKELLERVGLGDRLDHMPNEISGGQKQRIAIARALANKP
FT                   SIILADEPTGNLDTASSEEIMNLFTELNNEGVTVIVVTHEDNIAEYTKRTIRFRDGQII
FT                   EDRRRETK"
FT   gene            167306..168517
FT                   /locus_tag="Clos_0142"
FT   CDS_pept        167306..168517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0142"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   amt:Amet_1554 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17709"
FT                   /db_xref="GOA:A8MFS0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS0"
FT                   /protein_id="ABW17709.1"
FT                   /translation="MLIFENISLALSSIRVNKMRSFLTMLGMIIGISSVISIVSLGDTM
FT                   RNVIATEFENIGTTLAYSYIMSESDYYTSNETYSYEDIENIKEVFGDNVQYISAGARTS
FT                   GKIKNGRVMKDARLMGLAENPEVYKPLDIIHGKMFSNNDIKNARPYILIEDKTAEEIFG
FT                   TKNAVGKVLRIQVNENLLEFTVTGIYRNNDSALKKLLGGSETMAVTYVPETAITEKNGM
FT                   FWSIEISSSKDISVEEFKTKFISYVSRAKGIKPENIRYYTAEEEMKSIDGLMSTLSLVV
FT                   GAIAAISLVVGGIGIMNIMLVSVTERTREIGIRKSLGARMEDILLQFLVESAIISAAGG
FT                   IIGTTLGASIVAIGSMAFGISAIVKPQVVIIAVVFSAMVGIFFGLYPARKAAMADPIEA
FT                   LRYE"
FT   sig_peptide     167306..167434
FT                   /locus_tag="Clos_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.486 at
FT                   residue 43"
FT   gene            168749..170329
FT                   /locus_tag="Clos_0143"
FT   CDS_pept        168749..170329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0143"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: dsy:DSY4404
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17710"
FT                   /db_xref="GOA:A8MFS1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS1"
FT                   /protein_id="ABW17710.1"
FT                   /translation="MLKDSKMSRRLIAPIVCLVMLLSFTAGSAMNSKSSLGMNFAEAGT
FT                   LSNIQVEGKTPKYIFMFIGDGMAAVQVNSAQIYKGNNNHNQIALQEVNFQDFEAVGYQT
FT                   THDATSFAPDSASTATSLSSGFKTWSGTIGLRPVGGISANKVENVDINKVPKTIAERLK
FT                   DEKGMKIGIISTVTINHATPAAYYAHIPSRNDYYDIAMQMADSNFDYFGGGTISQPTGK
FT                   NKDQRDAYEVLEEKGYKIARTKEEILGLNSSSGKVYAVTPVTQDGGAMPYAIDSKEGDL
FT                   ALADFVKKGIDVLDNEKGFFMMAESGKIDWAGHANDAKANIGDVLAFADAVQVAIDFAK
FT                   EHPEETLIIVTGDHETGGMTIGQATTGYDTAVNILENQKISYIEFDKIIDGMKDKKPNL
FT                   TFEEVLPVITENFGLKDEYVDGEGDQPYMALELSNSEVKRLKTAFSETMAKERTKNEET
FT                   ALLYGGYNPLSVTLTHILNNKAGIGWTSYAHTGVPVPVYATGVQAKLFNGAYDNTEVYH
FT                   KLVAATKLQ"
FT   sig_peptide     168749..168835
FT                   /locus_tag="Clos_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.494 at
FT                   residue 29"
FT   gene            170419..171555
FT                   /locus_tag="Clos_0144"
FT   CDS_pept        170419..171555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0144"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: dsy:DSY4405
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17711"
FT                   /db_xref="GOA:A8MFS2"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS2"
FT                   /protein_id="ABW17711.1"
FT                   /translation="MNRKEIVFIIVFLFIIAILAMLPTGFQKQEYRHTEGVRAKVISVN
FT                   NMGIHNSGIFKLGDQSAVIEIETGSRKGEQVQGNNMLTGRLSEDKIFQEGDTAWVLIGF
FT                   DEKNNINFANMIDHYRMDKQALLIGTFAVIIIIFSGFTGVRTLLSFAFALLSIWKILIP
FT                   VMLKGYNPLIVALIVGNLLTIGTLLLVAGFSKKAYAAIISAMTCSLATCFLAMSFGQLF
FT                   NIHGAVMEGAESLLYAGFMNLNLTSIFQAGIYLASSGAILDLAIDISSALEEIVHNNPN
FT                   VTRQELMKSGLNIGKSVVGSQTTTLLLAYMGSYITIMMVYMAQGTPLMNILNSKPISAE
FT                   ILHTFVGCIGLVLVSPLTALISSLMMNTDSVKKAEDLY"
FT   gene            complement(171683..172210)
FT                   /locus_tag="Clos_0145"
FT   CDS_pept        complement(171683..172210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0145"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: dsy:DSY4761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17712"
FT                   /db_xref="GOA:A8MFS3"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS3"
FT                   /protein_id="ABW17712.1"
FT                   /translation="MYYKTTYPSPVGILTLACGGDHLVGVWNEGQKYHGDTILKDMIEN
FT                   NNLPIFDSTKKWLDRYFAGQRPDISELPLAPLGSAFRQQVWRILCDIPYGKVITYGDIA
FT                   KQMAVKMNKKSMSSQAIGGAVGHNPISIIIPCHRVVGSKGSLTGYAAGVHIKVKLLELE
FT                   GADMLPLFVPKV"
FT   gene            complement(172222..173679)
FT                   /locus_tag="Clos_0146"
FT   CDS_pept        complement(172222..173679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0146"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; HhH-GPD family protein; Ada metal-binding domain
FT                   protein; AlkA domain protein; KEGG: hch:HCH_04648 adenosine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17713"
FT                   /db_xref="GOA:A8MFS4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS4"
FT                   /protein_id="ABW17713.1"
FT                   /translation="MIDNDNGLYAAFKAKDARFDGRFFVGISSTGIYCRPVCRAKQPKI
FT                   ENCTFYSTAAEAEQAGYRPCLLCRPELAPGTSITDATVNLVYRAARMLEKNCGSGQSIA
FT                   EIAGRLGCTDRHLRRVFTAAYHVSPVQYLQTCRLLLAKNLLTDTDLSVLEVAMVAGFGS
FT                   LRRFNDLFKKQYKLSPTALRKHNSEEKHQDNITLVLSYRPPYHWEDMLRFLAGRAITGI
FT                   EVVKNNEYMRTVHLENSEGKPVYGWIRVGHQSKRNALSVTVSQALLSVLPQVLARIRHL
FT                   FDLYCDPDAVYETLQVMNDIRPNLCTLGTRVPGCFNAFEMVVRAVLGQQITVKAASTLA
FT                   ARIVQTYGTPIQTGFEGLTHVFPSPEDILALNGPIENHLGPLGVIAARAKTIYELAQAF
FT                   VQGEIDFDLPAQPEEEMKRLMAIRGIGSWTAQYIAMRAMEWPDAFLETDAGVKKALPPY
FT                   TAKELLEIAEAWRPWRSYATVNLWNTL"
FT   gene            173999..175237
FT                   /locus_tag="Clos_0147"
FT   CDS_pept        173999..175237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0147"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   tde:TDE0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17714"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS5"
FT                   /protein_id="ABW17714.1"
FT                   /translation="MNKYFDIKDKIYDITEKYPETIDIFVANDFSQFADKNMRKSLGKS
FT                   ISLDMACTSKKVNVELFEQKLVDAIEQNRASKDGSLVMAEKPQHADIRIDGVLPCPVKI
FT                   PMLEGFEAWLKENEGRFNFTIDYELKSANLGLDFIKERIESGDESNLSDLFMSAGFDLF
FT                   FDKNLMGQFKEKGVFEDITGIDQLNKDFDNEYIDLKDPLKQYTIVGVVPAIFMVNTEEL
FT                   KGREMPKSWEDLLKPEFESSISIPMRDLDMFNALLLNIYKKFGEEGVAKLGRSLLKSMH
FT                   PAEMVKAHTKKSEFNMPAITVMPYFFTRMVQENSPMKPVWPEDGAIISPIFLLSKKDSK
FT                   ERIKPFVDFFFSKEIGEILSFNGKMPSTHPAVDNGLSEEQKFMWVGWDFINSNDIGGLI
FT                   KKCEQLFNGVYEL"
FT   gene            175250..175951
FT                   /locus_tag="Clos_0148"
FT   CDS_pept        175250..175951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0148"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   tde:TDE0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17715"
FT                   /db_xref="GOA:A8MFS6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS6"
FT                   /protein_id="ABW17715.1"
FT                   /translation="MNLVVFSGPPSSGKTSVILKTIEALKQRDISVGVVKFDCLYTDDD
FT                   VLYKKAGVPVKKGLSGALCPDHFFASNIEEVVQWGVDLKLDLLVTESAGLCNRCSPYIK
FT                   EIKGVCVIDNLSGINTPKKIGPMLKTADIVIITKGDIVSQAEREVFSSKVSSVNPRAIT
FT                   MHVNGLTGQGAYELSTLLLDKEKEIQSVQGMALRFPMPAAMCSYCLGETRIGEAYQMGN
FT                   VRKMDLGDYDE"
FT   gene            175944..176936
FT                   /locus_tag="Clos_0149"
FT   CDS_pept        175944..176936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0149"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tde:TDE0475 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17716"
FT                   /db_xref="GOA:A8MFS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS7"
FT                   /protein_id="ABW17716.1"
FT                   /translation="MNKLTIKQLINKYPFVTTYFEDNKLDIKGYEDVTFSQYLDHFSEE
FT                   EIENWAIDKERLQADLGAFIKQMKEFLGIQDEVGIESLTIKAGHNKFKEPESFQEFTIR
FT                   KSEIVSIVGPTGSGKSRLLADIEWAAQNDTPTGRSIFINGNVPDKKWRYSSNNKLVAQL
FT                   SQNMNFVMDLTVKEFLDLHAKSRMVEDIEATIDRIIVAANKLAGEKFDLDTPVTSLSGG
FT                   QSRALMIADTAILSSSPIVLIDEIENAGIDRKKALELLISEDKIVLMATHDPILALMAD
FT                   KRIVIKNGGIHKIIETSKEEKILLTELEEMDTKLQNMRTLLRQGEELNQ"
FT   gene            complement(177882..178343)
FT                   /locus_tag="Clos_0150"
FT   CDS_pept        complement(177882..178343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17717"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS8"
FT                   /protein_id="ABW17717.1"
FT                   /translation="MKKIKNSILFITLSSALLFSIFFPKNIFDVIGKDIHTVPITHLTI
FT                   HHKDFISHGGHTLESSNISDVERLVTFFKNYKVVRVPIYNYKDYDHKEIYSITFTTDTN
FT                   SLIRISTSDDGHVFLTNKYGSYGLYKFANKKLDIPYLNQFYNSLLILNI"
FT   gene            179268..179558
FT                   /locus_tag="Clos_0151"
FT   CDS_pept        179268..179558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0151"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   amt:Amet_4732 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17718"
FT                   /db_xref="GOA:A8MFS9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFS9"
FT                   /protein_id="ABW17718.1"
FT                   /translation="MSVEKRPRRTYTDEFKNQVVQLYKNGKRKCNITREYDIASSLLDK
FT                   WIKQADTSGSFKEKDNLTLEQKELIELRKRNKQLEMENDILKQAALIMGRK"
FT   gene            179561..180394
FT                   /locus_tag="Clos_0152"
FT   CDS_pept        179561..180394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0152"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bcz:pE33L466_0288 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17719"
FT                   /db_xref="GOA:A8MFT0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT0"
FT                   /protein_id="ABW17719.1"
FT                   /translation="MIRNNAHKYSVSAMCKVLEISRSSYYYESKPKQYESKLTSKIKKI
FT                   FQESRSNYGTRKIKAVLRDNGYQVSRRRIGRIMKQEGLVSKYTVAQFRPYADKCNESQI
FT                   ENLVKREFDDRSQYNVVVSDLTYVRVGNQWNYICVLVDLFNREIIGYSAGKNKDANLVS
FT                   KAFARVNTNLKNIQVFHTDRGNEFKNKLLDETLKIFDIKRSLSKKGCPYDNAVAEATFK
FT                   IIKTEFVKYKVFETLEELQYELADYVNWFNNHRLHSSLGYLTPATFRMNTLKKVV"
FT   gene            180640..181856
FT                   /pseudo
FT                   /locus_tag="Clos_0153"
FT   gene            complement(182201..182716)
FT                   /locus_tag="Clos_0154"
FT   CDS_pept        complement(182201..182716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17720"
FT                   /db_xref="GOA:A8MFT1"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT1"
FT                   /protein_id="ABW17720.1"
FT                   /translation="MLKNKPLIVSLILIIFLISYLIISSNIKDLTKNNQILKSRLEELE
FT                   IENQTIKEHYETEYFLRDTLDIKARSIYKSLIEKDLTMLEREVSNNTKVLPDTIIFTTE
FT                   NGEVSYDLYTRKDTPILRQRYYILSEDNRTFTTGYEIHSEYYDSIPVIIMIFSYENEDW
FT                   KLSSILTE"
FT   gene            complement(182864..183445)
FT                   /locus_tag="Clos_0155"
FT   CDS_pept        complement(182864..183445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0155"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   bha:BH0966 N-acetylmuramoyl-L-alanine amidase (sporulation
FT                   mother cell wall hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17721"
FT                   /db_xref="GOA:A8MFT2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT2"
FT                   /protein_id="ABW17721.1"
FT                   /translation="MSYSLYKVFIDPGHGGTDVGAKNGTFYEKDFALDIAKHTRDRLAS
FT                   YGVKTKMSRETDISGKLYVDERSDASNAFGADIFVSIHNNAGGGTGVETWKHDNASTYV
FT                   NQLAQSVNSKLVSNLGVANRNVRTAPSQRGENIYVLDPKNTNAWAILPEVLFMDTTADL
FT                   EKLKSSTFRRNAGYAIADGIISFINTLPPR"
FT   gene            complement(183592..183831)
FT                   /locus_tag="Clos_0156"
FT   CDS_pept        complement(183592..183831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0156"
FT                   /product="phage related protein"
FT                   /note="KEGG: cbo:CBO0746 phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17722"
FT                   /db_xref="GOA:A8MFT3"
FT                   /db_xref="InterPro:IPR024405"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT3"
FT                   /protein_id="ABW17722.1"
FT                   /translation="MANEVLKLASTQGIWATLSVVLIFYILKTQEKRDLKQDEREQKYQ
FT                   EIIATLTDKLNVIESVRKDVEEVKSYIITKQKES"
FT   gene            184379..184906
FT                   /locus_tag="Clos_0157"
FT   CDS_pept        184379..184906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0157"
FT                   /product="putative RNA polymerase, sigma 28 subunit,
FT                   FliA/WhiG family"
FT                   /note="KEGG: btk:BT9727_0859 possible RNA polymerase
FT                   sigma-B factor (sigma-37) (general stress protein84)
FT                   (GSP84)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17723"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT4"
FT                   /protein_id="ABW17723.1"
FT                   /translation="MNQLAKGFLNNQTFSNNLVKDLSLDNLQDEFNGYAFKVYLNGYIK
FT                   KTIVFGAMQIKKKSSQISKKEELSLNIIDPNFNEERINLITDTVDDFVENIGESLIKED
FT                   CCDYSELLYDRELILAINTLTDRQKEILHRCVIIGESDTVVAKKLGITKQGVNKAKKSA
FT                   LNKIRKKLSYSA"
FT   gene            184934..185185
FT                   /locus_tag="Clos_0158"
FT   CDS_pept        184934..185185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17724"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT5"
FT                   /protein_id="ABW17724.1"
FT                   /translation="MKNRELREVFNSAKNGDQIAMEKMLKMFRPLIYKNSFIDGKFDED
FT                   CFQDISIKFISCIKTFELSPIAMEDIHKSFEEIFHEKE"
FT   gene            185487..186395
FT                   /locus_tag="Clos_0159"
FT   CDS_pept        185487..186395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17725"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT6"
FT                   /protein_id="ABW17725.1"
FT                   /translation="MRNIKITIILVIIILSNGCSLSMSNMEKLNSIDSPIEIYVENDYG
FT                   SSWSHVGLYSTFLDDHSSKLYILKEDKIFFVVEDYNYWEPILSPDGEHFLAIDFQRLNQ
FT                   NEKYIFYLFNTKTREKEFFTEVDFYQEFDNQPSLSSIIWNEEGIYALSKTFGEDNKLIS
FT                   SNLIMLDRSSDIEVIWENPPFSSIEDIVNNWVLYYTGEDYIAHNILTKESIVYEIFQKT
FT                   INGLHDYRNLKFLQAPMKLVGSKIYNYNEYYTFIYSHEEGNITRISDGQFIGFSTSGFA
FT                   YKKYTGNENKHIIYIKPFDFK"
FT   sig_peptide     185487..185555
FT                   /locus_tag="Clos_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.451 at
FT                   residue 23"
FT   gene            complement(186443..186988)
FT                   /locus_tag="Clos_0160"
FT   CDS_pept        complement(186443..186988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0160"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   SMART: Animal peptidoglycan recognition protein PGRP; KEGG:
FT                   dme:Dmel_CG14745 PGRP-SC2"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17726"
FT                   /db_xref="GOA:A8MFT7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT7"
FT                   /protein_id="ABW17726.1"
FT                   /translation="MIYQSEPSMVSRSGWGARSATNNLVNLGSKQYIVIHHAGDANDNI
FT                   VKVYPDEKAAMKRYQEIHMDSNGWADIGYHYCVGIKGTILQGRNDTKEGVHTPGYNYCS
FT                   IAVMIHGNYDIRSLTSTQKSKLVSLLAWLCYTNNISPSKIYGHGDLASSSCPGSSVKSQ
FT                   LSSIRGLVMNKLYPQPEN"
FT   gene            complement(187114..188658)
FT                   /locus_tag="Clos_0161"
FT   CDS_pept        complement(187114..188658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17727"
FT                   /db_xref="GOA:A8MFT8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT8"
FT                   /protein_id="ABW17727.1"
FT                   /translation="MLSITFISLFIAMILYFSFPSILLKMGEKFSHDGDYFKAKTYYDK
FT                   INENFPKASVTESALEKAGYVSAIHNKIMISSSGFGPIYNSNHYIFPETRAYYEEILQR
FT                   FPRGLSAQRVRYNLLIPDVQGEVLHGNVEEAIEMIKSFYANIHNETPRYMNAYTINGAI
FT                   QAFEVKGYDEEAKDLLRWIIDYEDDWEKNIFQDYLSRLENSKDAYGSVTGKVSLRGKSF
FT                   KNIPVFLQYQDTPDGTLYGFTQEAFWAITDNNGNFEFPNIPEGRYTVGLIGDLDQIGDT
FT                   VLQGNPFEHTDFTIEKGQTYDFNISFVDRMKIISPVDGEEIKEDFIQFQWEPLEGAAYY
FT                   TIALGISFEGASGTRIYGKYNTNEALVSKEDILYLHNFHTFDEEGPIPEPFFGFMNPKG
FT                   QLFWGVHAYDENDRLLSSSIGYIRDESTEFSIGEIELTEGDKKLLKRDYAGAIESYEQS
FT                   LAENKEDIHSLLMLARLYNFEQKLSNYTYGNKEKAKEYYRRLHKITGNEIFLENSN"
FT   gene            complement(188697..189047)
FT                   /locus_tag="Clos_0162"
FT   CDS_pept        complement(188697..189047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17728"
FT                   /db_xref="GOA:A8MFT9"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFT9"
FT                   /protein_id="ABW17728.1"
FT                   /translation="MKKEKLGKFIDAENKLTDIQIKNLFHENVQTIKLTEASKNKLHRI
FT                   PLSTEKQSFIQRFLEKEILIPLPSFALGTSAIILLVGIYVTNLVLITDMPKPKYEIINL
FT                   QYNSYISQERGR"
FT   gene            complement(189048..189593)
FT                   /locus_tag="Clos_0163"
FT   CDS_pept        complement(189048..189593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0163"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: amt:Amet_2149 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17729"
FT                   /db_xref="GOA:A8MFU0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU0"
FT                   /protein_id="ABW17729.1"
FT                   /translation="MEKQDDDLIRDLKLKDLNAYHKLIEYYGEKLLRLAYIIIGDYQLA
FT                   EDALQESYINIYRHINHFNEKSSLLTWVTRITINNAKQALKKKNKRAWNPLYHSINESS
FT                   NSPPLTYDIIQKEEYEKVNKTLMSLPIKYREALYLHYYEELKIKEIANILDIGESGVKS
FT                   RLQRGRTMLEEMLRKELD"
FT   gene            complement(189776..190159)
FT                   /locus_tag="Clos_0164"
FT   CDS_pept        complement(189776..190159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_3195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17730"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU1"
FT                   /protein_id="ABW17730.1"
FT                   /translation="MSYLHYYETMGYPSCSPIAGYSTESLESMYPNIYHMIHPKVRHMC
FT                   MMMDTPNNPEMYPCPSKEAIERMADHIHMQVVSEMGGEYDNWAPMSQQYPEYGEGFGGS
FT                   SFLRDIISIILIRELLFRRGHRF"
FT   gene            190843..191646
FT                   /locus_tag="Clos_0165"
FT   CDS_pept        190843..191646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0165"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cdf:CD0800 3-hydroxybutyryl-CoA dehydratase (crotonase)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17731"
FT                   /db_xref="GOA:A8MFU2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU2"
FT                   /protein_id="ABW17731.1"
FT                   /translation="MKTVALKDLNPENIKVDIEGSVAIITMNRPKALNALNNQTLDELS
FT                   SIIDSIGKDDEILGVIITGEGKGFVAGADIVQMQPYKAEEGRNYAEYAQGIFNKIEALG
FT                   KPVIAAVNGYALGGGCELSMSCDLRIASERAVFGQPEVNLGVIPCFGGTQRLPRLIGSG
FT                   RAKELIFTGRMVKADEAAAIGLVNKVVPAEELLNEAKNMMDIIISKAPMAIKYSKIAIN
FT                   KGIDLDLSNALELEKDLAALTFASEDKDEGMTAFLEKRTPKFMNK"
FT   gene            191742..193046
FT                   /locus_tag="Clos_0166"
FT   CDS_pept        191742..193046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0166"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   KEGG: cdf:CD0801 probable permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17732"
FT                   /db_xref="GOA:A8MFU3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU3"
FT                   /protein_id="ABW17732.1"
FT                   /translation="MLSLVGIIIALGLLMILVMKGVNIFIIAIACSVVVALTGGINLYD
FT                   ALKSNYMEGFVGFLKNNFLIFLTGTLMGKMYEVTNGAKAIAKMIVRIFGAKMALISIPL
FT                   ACGIISYGGVSAFVASFAVFPIAIEVFKEADLPRRFIPAALTFGCSTFAMVAPGAPQIH
FT                   NAIPAQVLGTDLMAGAVIGFTSCAIILLLGAFLLYRMVNKAKANGEHFVAKSMDNFQED
FT                   TELPNGIMALIPLIITIILINFKVDGNPLLPLEAGVFVGSILVFIILNKYQDNKRILDN
FT                   VGEVCKTSIFSISNTCAVVGFGAVVQASLAFPVAVNAMVNIPGPEFVGIAVGTTVIAGI
FT                   TGSASGGLGIAAPLLGPVYLARNVAAGAIHRTMSISSAALDSLPHNGYIVTVTNGLCNE
FT                   THKDAYGPIFWLTVVTPAVGTIVAVVLFSMFPMLP"
FT   gene            193118..194677
FT                   /locus_tag="Clos_0167"
FT   CDS_pept        193118..194677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0167"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: amt:Amet_4532
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17733"
FT                   /db_xref="GOA:A8MFU4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU4"
FT                   /protein_id="ABW17733.1"
FT                   /translation="MSKVITREQAAEMVNDNMTIGIGGFVGFGVPEDLLVALQNRYIQT
FT                   KSPKDLTVVHCAAVGDAAERGANRLGEEGLVKKLICGHIGLEPRLNKLTVENKLASYML
FT                   PQGVISHILRAIAGGKPGVLTHVGLKTFADPRLEGCKANQAAIDSGEEVVSLVKIENKE
FT                   YLLYKSFPMDICFIKGSIGDESGNISLCKEAVFSDQLEMAAAVHNSGGIVIAQVDQIVA
FT                   KGTLKAHDVQVHGFMVDYIVEGSKENSFQSFICDYYRPELSGEIKVPLGAIEPMKLDQR
FT                   KICGRRGALELEPNTLINLGIGIPEAVGAVAGEEGLADKITLSIESGALGGVPTGGLGI
FT                   GGTVNPESIYKQPDIFDIYDGGGIDMSFLGAAEIDPMGNVNVSKFAGRVVGPGGFINIS
FT                   QNAKKVYFTGTFKAGKMEMEIKDGKLNILKDGKAIKFKKELEQVTFSAEYANETGQQVY
FT                   YITERAVFKLTEEGIMLIEIAPGVDLEKDILENMEFKPLIAEDLKLMDERIFKDEKMGL
FT                   TF"
FT   gene            194763..195899
FT                   /locus_tag="Clos_0168"
FT   CDS_pept        194763..195899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0168"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: cdf:CD0803
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17734"
FT                   /db_xref="GOA:A8MFU5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU5"
FT                   /protein_id="ABW17734.1"
FT                   /translation="MDFKFTDSQLMLQKVAREFAEKEVGPIAAEVDKTGRFPRETFDKM
FT                   VKIGFTGIGTPVEYGGSGGNDIDKVIVVSEIAKKCAATAAILSIHSIFSHVVHKFATEE
FT                   QKQKYLPQVTSGGCLAAFALTEPNAGSDAGAAKTTAILDGDEYVLNGTKCFISNGGQAQ
FT                   HLLIFALTDPSKGLKGLSCILVEKGTPGFTIGKIEDKMGINGSETVELIFDNCRVPKEN
FT                   LIGKEGKGFMIAMNALDSARIGVGAQALGIAESALEESVKYMKERVQFGKPLTALQGLT
FT                   WYISDMATKTEAAKWLVYHAAHLKATGENHTKEAAMAKLNAAETARHVTNLALQIHGGY
FT                   GYMKDYPLERMYRDAKITEIYEGTSEIHKLVISRAVLR"
FT   gene            195910..196704
FT                   /locus_tag="Clos_0169"
FT   CDS_pept        195910..196704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0169"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: cdf:CD0804 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17735"
FT                   /db_xref="GOA:A8MFU6"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU6"
FT                   /protein_id="ABW17735.1"
FT                   /translation="MNIIVCLKQVPDTNEVRINQETGTLIRDGVPSIINPDDKNALEAA
FT                   LAIKDEKGAKVTVLSMGPPQAKDALKEALAMGADEAILVSDRAFGGSDTWATATILAAA
FT                   IEKVGNYDIILCGRQAIDGDTAQVGPEIAEFLGVPQITYAKEIKVGEDKLIVTRYTETG
FT                   DYIIESKLPVLLTAIKELNVPRYPSVRGIFKAYGTDVDEIKVWGSNDLEVDPTQIGLKG
FT                   SPTNVYKSFVPTKSKTAEIIEGISGKEKATILISKLIDLKLI"
FT   gene            196720..197760
FT                   /locus_tag="Clos_0170"
FT   CDS_pept        196720..197760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0170"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: thiamine pyrophosphate protein central region;
FT                   Electron transfer flavoprotein alpha/beta-subunit ;
FT                   Electron transfer flavoprotein alpha subunit; KEGG:
FT                   cdf:CD0805 electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17736"
FT                   /db_xref="GOA:A8MFU7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU7"
FT                   /protein_id="ABW17736.1"
FT                   /translation="MKRAKVNQNINLNDYNDIWVIGEQREGKIHPVTIELIGEAKKLAG
FT                   EINKKVVVVVAGYEINEEVNKLLYYGVDKVIYLSNPLLKNFSTDGYSISISNLILERKP
FT                   EIVLVGATSIGRDLGPRIAAKVGTGLVADCTMLSIDPEDKKLLQTRPAFGGNLMATIIC
FT                   PINRPQMATVRPGVMKKATHIDRPTGVVEVVAPAITEADIVAKVVKIMKSSKKTVDLTD
FT                   AKIIVSGGRGVKGPEGFELIKALAEKLGGEVGASRACIDSGWIDSMHQIGQTGTTVRPE
FT                   VYFACGISGAIQHLAGMSDSKYIVAINSDPAAPIFNVCDLGIVGDLKEVIPAMIEEIEK
FT                   NKTFEI"
FT   gene            197954..199363
FT                   /locus_tag="Clos_0171"
FT   CDS_pept        197954..199363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0171"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: cdf:CD0806 putative sigma-54-dependent
FT                   transcriptional regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; PAS fold domain protein;
FT                   SMART: PAS domain containing protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17737"
FT                   /db_xref="GOA:A8MFU8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU8"
FT                   /protein_id="ABW17737.1"
FT                   /translation="MDNNLDRYKYIFDEILTMTDDGFIVVDREGVVTDINDQYCDFLGT
FT                   SKENVIGRNIKETISNSKMIDIMKNACREEGAIHKFVDGETKEVDNKFLLVSRSCVFDE
FT                   KQEVIASVAQVKFRLQTLDCAQKLMKEYSALEFYREEYNKISTNQYTFDGMIGISKRFL
FT                   GIKKMGMRAAKNSFPVLLTGETGTGKEVFARAIHNGSDRSSKPMVSINCGAIPSELLES
FT                   ELFGYEEGSFTGAKKGGKIGKFIQADGGTIFLDEIGDMPPDMQVKLLRVLQEKEVDKIG
FT                   GTEPVSVDIRVIAATRQNLVKMVREGKFREDLYYRLNVINIEMIPLRERREDILIFANY
FT                   FLNKINIEYKTNTTLSKEVKRCFQGYSWPGNIRELDNVIRSSYASCDEFIIQLTDLPAK
FT                   MVSSHNVNSFSGSGEKMLKNMVDSYESSIIKEVLKKCNWNCQLTANELGIHRSLLYKKM
FT                   DKFGIKVKKTI"
FT   gene            199594..200520
FT                   /locus_tag="Clos_0172"
FT   CDS_pept        199594..200520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbo:CBO0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17738"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFU9"
FT                   /protein_id="ABW17738.1"
FT                   /translation="MLSSKAFIRQSLEIHLFFARIMKEHAFFLQLGFTPRDANYFQQAN
FT                   NLRMEFDQLLWEVVGLSNCVVSCNVLESGEIVTPYTLRAENTSSYLTGVTIPTYITEAE
FT                   MKLACGEYVIFNPMLEQSVSMLNQRAICLITAIVDFKTNILNNVLSCNMFTANYPLLIE
FT                   HILREAKLYLNMIVRIQNREEIDVDKEIYEQELFWNRIMAEHSKFIRGLLDPTEDELIH
FT                   IANDFAKEFDALTAAVEEAIEKCLPIDKITDKSLEATKEVRNFNTQGTEGLLDCKIRSI
FT                   IIPLLGDHVLRESNHFIRLLKKFQKID"
FT   gene            complement(200611..202155)
FT                   /locus_tag="Clos_0173"
FT   CDS_pept        complement(200611..202155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0173"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; FAD dependent
FT                   oxidoreductase; KEGG: cth:Cthe_1461 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17739"
FT                   /db_xref="GOA:A8MFV0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFV0"
FT                   /protein_id="ABW17739.1"
FT                   /translation="MNQYYSPEKGFLKEPESYWIASSSTPNYPKLEENISVDVAIIGGG
FT                   ITGITSGYLLTKEGLRVAIVDADRILKGTTGHTTAKITSQHDLMYDKMIQQIGVEKSKQ
FT                   YAESNEKAIQVISKIIEEKNIDCDFSLQNAYIYTQSDVYIEDIKNEVKAALDLGIDAFY
FT                   TDTLPLPFPIKGAIGFKNQAQFHPLKFLSSLVEDITQGGSSIFENTKAVDIEELEDHQY
FT                   SVLMENGNNITASKVIIATHYPFSNIKGLYFSRIYQERSYIVALKAKSKFPEGMYINAE
FT                   EPGRSLRSQPFGDSELILVGGEGHKTGYGKDMDSHYKNLIDFANKTFDVEEILYRWSAQ
FT                   DCMTMDNIPFIGSISPKHPNIFVATGFKKWGMTSSTVSAMVLRDLIVKGESPWAEVYDP
FT                   SRFINTGSIWTFIKENLGVAVSFITGKLFSGSLDSHLEKGEGKIIDVDGQKVGAYKDEH
FT                   GKLYFVNTTCTHLGCEVQWNNAERTWDCPCHGSRFSPIGDVIEGPAFEPLERIEIE"
FT   gene            complement(202200..203192)
FT                   /locus_tag="Clos_0174"
FT   CDS_pept        complement(202200..203192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3459 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17740"
FT                   /db_xref="GOA:A8MFV1"
FT                   /db_xref="InterPro:IPR025893"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFV1"
FT                   /protein_id="ABW17740.1"
FT                   /translation="MYLIKKLWHPEMFQGKYKNKNYFEGWYYKLIDSKQENVWAVIPGI
FT                   AHGKSEDDHHAFVQVIEANSCNVHYFKYDISSFKFLENKFNVQIGNNLFTQDGIILDLK
FT                   DQNISIQGQLSFQNIIPFPKGILRPGIMGPFSFVPFMECYHGVVNIHHEIEGSIAHNGT
FT                   EISFNNGYGYIEKDWGKSFPESWIWIQSNHFPQGDVSLMFSIAKIPFLCSHFTGFLSFL
FT                   RIGDRMFSFATYTGAKITKLQYMKDTILIDIADAKYTLHIKAIFSKGGVLKAPKNGLMN
FT                   GEVTESITSTVMVSLHDHKSRANLFEGKGIHTGFEIGGNIEYFLQLGKS"
FT   gene            complement(203439..204023)
FT                   /locus_tag="Clos_0175"
FT   CDS_pept        complement(203439..204023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17741"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8MFV2"
FT                   /protein_id="ABW17741.1"
FT                   /translation="MQKYYLYVLLTRTNTMISKLIHNFTNDQYTHAAISLDKDLNRMYS
FT                   FGRKYTKNPFLGRFRRETLDTGVYKFHKNLPGLIMEIEVTKQQYEHVESMIHHFIKNKH
FT                   LYKYNYPGLIYGLFNKETHYEHRFLCSEFVYYLLNESNIVDFNLPRNLIRPQSLLEIKG
FT                   TVIYEGNLKELELENNHYILNGMQPVQFGNV"
FT   gene            204351..206003
FT                   /locus_tag="Clos_0176"
FT   CDS_pept        204351..206003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0176"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="KEGG: amt:Amet_4254 glutaminyl-tRNA synthetase;
FT                   TIGRFAM: glutaminyl-tRNA synthetase; PFAM: glutamyl-tRNA
FT                   synthetase class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17742"
FT                   /db_xref="GOA:A8MKS5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKS5"
FT                   /protein_id="ABW17742.1"
FT                   /translation="MENKPTASNFIRNIVVQDLESGKHKEIITRFPPEPNGYLHIGHAK
FT                   SIVLNFELADSFNGKTYLRFDDTNPAKEDIEYVESIKEDVKWLGFEWEELFFASDYFEE
FT                   MYNRAVLLIKKGLAYVCDLSAEEIREYRGTLTQAGKESPYRNRSVEENLDLFDRMRKGE
FT                   FQDGEKVLRAKIDMASPNMNMRDPVIYRIVHASHHNTGDKWCIYPMYDYAHPLEDAIEK
FT                   ITHSICTMEFEDHRPLYNWVVEQCEMEAQPQQIEFARLNMTNTVMSKRKLKQLVDENVV
FT                   DGWDDPRMPTISGLRRKGYTANAIRNFCREIGVSKNQSVVDEQMLEHFIRQDLSEMAPR
FT                   TMAVLRPLKVVITNYPEGQTEMLEAENNAEDPSMGVRQIPFSREIYIEQDDFMENPPAK
FT                   YFRLFPGNEVRLKNAYFIKCNDVIKDADGNVIEIHCTYDPETKSGTGFTGRKVKGTIHW
FT                   VDAANAVPAEFRLYEPLILDEEDEDDKHFLEQINENSLQILQGFVEDNMKDVKPQDKFQ
FT                   FFRHGYFNVDPKHTKDGKLVFNRIVSLKSSFKL"
FT   gene            206127..207506
FT                   /locus_tag="Clos_0177"
FT   CDS_pept        206127..207506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0177"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: cno:NT01CX_0285
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17743"
FT                   /db_xref="GOA:A8MKS6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKS6"
FT                   /protein_id="ABW17743.1"
FT                   /translation="MEIENQLTQGSISKALIKLALPIMGTSFLQTAYTITDMFWIGKVG
FT                   TKAAAAVGTGGFFTWLAMAFIILSKVGAEVGVAQSIGRNDIGEAKRYIRHTVQLNIFLG
FT                   ILYSIVLIVFKKSLIGFFNLGDAEVISMATTYLVIVSLGLVSYFINPVFTGILNGYGDS
FT                   KTPFYINMIGLVTNIVLDPLFIFGFGPIPAMGVAGAALATVIAQVAVTFAFIIRIVVAK
FT                   DELFKEIGFLQAPDMTHMRYIIRLSLPVALQNALFSIIAMFIAKIIANWGPTPIAVQKI
FT                   GSQIEAISWMTAGGFSTALSTFVGQNYGANKWDRIYKGYFIAIGLASIVGLGATLLLVF
FT                   GANPVFSVFLSEEEAVAQGINYLRILGFSQLFMCVEITTAGAFNGLGKTVPPSITGILF
FT                   NALRIPAAIILSATVLDLDGVWWSISMTSVFKGIILTSWFILFLKKQMKHSQDKNIEIA
FT                   L"
FT   gene            207679..209163
FT                   /locus_tag="Clos_0178"
FT   CDS_pept        207679..209163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0178"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   shn:Shewana3_4004 flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17744"
FT                   /db_xref="GOA:A8MKS7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKS7"
FT                   /protein_id="ABW17744.1"
FT                   /translation="MKNMKRVSIALLAIILSLSAVGCGDKNMEGVNTGKANKAGQEEVY
FT                   DVVVIGAGGAGLSAAIEIKGAGASVVVLEKMAFIGGNTLISGGELNAPETWIQEKLGIE
FT                   DSIDLYKEDTLKGGDHQADEKLVTVLANNARQAVEWLRDTVNVSFKEDYLMQFGGHSVP
FT                   RAAYPQGGSGNELIGKLGAKAEEMNIPVRKQTKAEEILADKDGKVNGVRAVDKDGNEII
FT                   FKANKGVIVATGGFGANVEMRKQYNSEYDERYMETVQPSSTGDGIIMAQKLGAALVGME
FT                   NIQTYPTCNPATGILSYVADTRFNGAVLINKEGNRFVEELERRDVISKAILAQTDGMGY
FT                   LIWDTTIKNNSHMDDYMEEFNQLVAQGMLIKADTIEEVAQFFDINVEQLKQTIEKYNQY
FT                   AVNGKDEDFNRRGEIIGLTEAPYYLQKVTPAIHHTMGGLKIDTEARVIDNEGNPIPGLF
FT                   AAGEVTGGIHGTNRLGGNAITDIIVFGRIAAESVLK"
FT   sig_peptide     207679..207747
FT                   /locus_tag="Clos_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            209304..211046
FT                   /locus_tag="Clos_0179"
FT   CDS_pept        209304..211046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0179"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: ctc:CTC01848 two-component
FT                   sensor kinase YesM"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17745"
FT                   /db_xref="GOA:A8MKS8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKS8"
FT                   /protein_id="ABW17745.1"
FT                   /translation="MKTLRAKILLYFATVTTIMIFLLVVLVRGQIKNTNLPLTIDLSQQ
FT                   IITAKSGEVGAWIRQRIVELQVLTENETLISMDMDKIKPYMRKMDESHNEDFESFAIIT
FT                   LDGQAWVTNDTYIDVNNRPYFEEIKAGNLDYIVSDPIISRSNDEPIVVIIHAIRDASGN
FT                   PVGYINGAIYVSKLSTIASEVRMYNGLAWICDRNGQVFTTDEEYINKSFNIFESEAYSY
FT                   EGAKHIGGKMVEGIEGIDRIQDSRGNNIIVLYTPIPYAEGWFLGIHFLEKDMTQDTDKL
FT                   LQMILVFGFFIIASLIVISLFLSASIVKPVKELQGLMKDVEGGNLDIVYSNPREDEIGQ
FT                   LGEGFNKMVGQIKNLIHTVYIEQKNKREAELKALQAQIQPHFLYNTLDTIQWMALEHQA
FT                   HDIVDMVDALTNLFRISLSGGEEIISCAEEIKHIESYLFVQKVRYEDKLEYEIIWDEQL
FT                   KECKVLKLVIQPLVENAIYHGIKRKKGPGRILIIGRILGKDMEVSVIDDGIGIEHKKRL
FT                   QIMDVLEGRSKGEGTGYGMFNVNERIKLMFGEEYGIHITSEYGQGTEVVLRHPLINMDN
FT                   KDMG"
FT   sig_peptide     209304..209393
FT                   /locus_tag="Clos_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.601 at
FT                   residue 30"
FT   gene            211099..211860
FT                   /locus_tag="Clos_0180"
FT   CDS_pept        211099..211860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0180"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: amt:Amet_1138
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17746"
FT                   /db_xref="GOA:A8MKS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKS9"
FT                   /protein_id="ABW17746.1"
FT                   /translation="MWKVLIADDEPKIRKGLKKILQSFNLDIEIVAEAEDGEIALNLAQ
FT                   EHKPNIILVDINMPFLNGLGFIEKIRDFLPNTMIIIITGYDEFYYAKKAIQLQVFEYLL
FT                   KPVNATELKEIMLKVITQLQKLPNNLDRIETKNKDAEYSPIVMGIKNYIDGNYMQEDLS
FT                   MQEVADRFDISLSYLGKLMKHELGKTFIEYLTEVRMESAKKILQEENINIKIHEVAQLV
FT                   GYSSQHYFSRVFKKEIGITPIEYKQNIKIEL"
FT   gene            complement(211938..212342)
FT                   /locus_tag="Clos_0181"
FT   CDS_pept        complement(211938..212342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0181"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   amt:Amet_3153 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17747"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT0"
FT                   /protein_id="ABW17747.1"
FT                   /translation="MFNKKQTTDFSSFDTLIGKNTSFEGTLTAEGTVRIDGKIQGDVEV
FT                   KGDVFVGDTCEVVGNITASNIIVGGHIKGNILAHEQLRLTSTGKITGDISVKSLIIDEN
FT                   GVFEGNSKMTSAEVNSKHHLKEVKSSRVEN"
FT   gene            complement(212378..213334)
FT                   /locus_tag="Clos_0182"
FT   CDS_pept        complement(212378..213334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0182"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: amt:Amet_3152 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17748"
FT                   /db_xref="GOA:A8MKT1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT1"
FT                   /protein_id="ABW17748.1"
FT                   /translation="MKKMKHIQNKTRSSLTFMILPNSSGKIFQFSIPKFSFKIIGISFI
FT                   CIIFSALLFSFGYFHTNQKLALAHSELSVLKLENENQKHEIAELRGYAVKVDEKLADLN
FT                   KVQSQVLNMVGLNSSDESTPVDTVDTLLPYSDSYVAVSRSAQGPIFSSDNYEEEINFLT
FT                   ELIEKEKENMQSLISSVEQQLEYLDALPNLIPNAGRISSPFGYRTSPTNRRKREFHNGV
FT                   DISNNSGSSIVAAGSGVVTFSGYNGSYGRVVMISHGYGYTSIYAHNRKNLVSVGDRVEK
FT                   GQPIAELGSTGRSTGPHVHFEVRLHNEPVNPLTLVQQ"
FT   sig_peptide     complement(213167..213334)
FT                   /locus_tag="Clos_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.727 at
FT                   residue 56"
FT   gene            213640..214485
FT                   /locus_tag="Clos_0183"
FT   CDS_pept        213640..214485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0183"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: cbo:CBO2018 probable amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17749"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT2"
FT                   /protein_id="ABW17749.1"
FT                   /translation="MKKFSKLFIASLIIGGILSLTACGNGGGATTGGETETGGKEVVSK
FT                   IEQIKKSGKLILGTSADYPPYEFHKEIDGKDTIVGFDIEIAKEIAKDLGVELEIKDMDF
FT                   DGLLLALNADKVDMVMAGMTPDPERIKVVDFSKIYYEAVHGVVINVANKDTFKTVEDLA
FT                   GKKVGAQKGAVQEDIAVNEIPDIELKSLAKIPDLVLEVKHNKIDALVMEKPVANSYVDH
FT                   NSDLALMDLTFDDGEGGSAVAIKKGNTDLMEEINKTLDRLMQDGSIDKFVAEATALVEE
FT                   "
FT   sig_peptide     213640..213714
FT                   /locus_tag="Clos_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.613 at
FT                   residue 25"
FT   gene            214522..215202
FT                   /locus_tag="Clos_0184"
FT   CDS_pept        214522..215202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0184"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: cbo:CBO2017
FT                   probable amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17750"
FT                   /db_xref="GOA:A8MKT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT3"
FT                   /protein_id="ABW17750.1"
FT                   /translation="MNFSFLPKYYQFFIIGAKNTVLLAFFTVALGVVLGIFLALMRISK
FT                   NKILNFIGTAYVEIIRGTPLLVQIFIVYYGLPMMGFKIPALSFLGSAGEEFIAGIIALS
FT                   INSGAYVAEIIRSGIQSVDKGQMEAARSLGMPYPMAMKHIIIPQAFKNILPALGNEFIV
FT                   VIKESSVMSVIGIHELMYNANTVRGNTFIPLEPLIVAAGIYFILTFSLSKLLGIAERRM
FT                   RVSD"
FT   gene            215195..215917
FT                   /locus_tag="Clos_0185"
FT   CDS_pept        215195..215917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: chy:CHY_0506 glutamine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17751"
FT                   /db_xref="GOA:A8MKT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT4"
FT                   /protein_id="ABW17751.1"
FT                   /translation="MIKVHELEKNFGKLNVLKNISTEIKKGEVVVVIGPSGSGKSTFLR
FT                   CLNLLEAPTSGDIWIDGKKITDKSANIDEIRQNIGMVFQQFNLFSHMTVLDNIILAPMK
FT                   LKNSSKEEATKMAMALLSKVGLSDKAVAYPNQLSGGQKQRIAIVRALAMTPEVMLFDEP
FT                   TSALDPEMVGEVLEVMKDLARDGMTMIVVTHEMGFAKEVGSRLMFMDEGSIVEEGKPAE
FT                   VFDYPKQQRTQEFLRKIL"
FT   gene            216167..217768
FT                   /locus_tag="Clos_0186"
FT   CDS_pept        216167..217768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0186"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dsy:DSY0350
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17752"
FT                   /db_xref="GOA:A8MKT5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT5"
FT                   /protein_id="ABW17752.1"
FT                   /translation="MKINIKLKIIVVILLFFSLSSALSVFFQLEKMVADSKVINDTGIV
FT                   RGGSQRLVKLELAGEESDQLMESIEKRIHGLINGDIELGLPKATDENFIAAMGDVSKGW
FT                   EDLKAQIYSNRTNPDGTGIVRTSEAFFETTNKAVDTAEEFSREKVTFLKTFQIIVFVLN
FT                   LIILIFIWIMSSKGISKPLMQLFEAIDSLDISEDIPEEFTRKKDEIGLLSNAFQRVIDR
FT                   LRNLTNEISGISNEVADFVEELNARINQSSITMEEIARVIEEVAKGATAQAEETESGVA
FT                   NVVDLGQLVEHEQKLLQELKSFTGEVRLLKNEGIDIVKELVEKTEANNEAIRNVRNVII
FT                   DTSKSAEKIEVSSHMIKNIASQINLLALNAAIEAARAGEAGRGFSVVAEEVRKLAEESN
FT                   NFTQEISTVVVDLIEKTENAVDIIKQLDEITSSQTKSVDLTNHKFEGIADSIEKIMEIA
FT                   EIINKSGLEMTSKKDEIINVVESLSAISEENAAGAQEASASIEEHTASMEEIANSSDAL
FT                   SALATTMKESILQFKS"
FT   sig_peptide     216167..216241
FT                   /locus_tag="Clos_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.627 at
FT                   residue 25"
FT   gene            218083..219456
FT                   /locus_tag="Clos_0187"
FT   CDS_pept        218083..219456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0187"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   tte:TTE0717 NtrC family transcriptional regulator, ATPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17753"
FT                   /db_xref="GOA:A8MKT6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT6"
FT                   /protein_id="ABW17753.1"
FT                   /translation="MLKRYIEDIPKLFKYMDMLVITDKEGYIEYYRVFHSLGNRIVENP
FT                   VGIHILDLHQHLSHENSTIMRVLKNREPIINEKQYLNIFKERTVTALSTTIPLMIGKKV
FT                   VGAMDINRYFDEDLAQLEEETSQYDMAQKHFFFTIDDIISKNPKMIEVKNQALKAAKTN
FT                   SSVIIYGETGTGKELVAQAIHNHSFRKNNPFIVQNCATIPSSLGESILFGTTKGSFTGA
FT                   ENKAGIFEMANGGTLVLDELNSMDINLQPKLLRVTENNCFRRVGGKDLINVDVRLISTL
FT                   NEDPYFMMETHKIRKDLFYRLGIVMINIPPLRERKEDISLLVNRFIEGYNKKMNKNIKG
FT                   ISKKAMDSFMEYHWPGNVRELKHTIERVFNFIDDEVIDEIHLPSHMISLDKGKKETLEI
FT                   GEEEQFNFNEVIKEYEIKYIKLALQSSKTLNEAAKLLKLSRQALKYKIDIYGIEVKQK"
FT   gene            219725..221104
FT                   /locus_tag="Clos_0188"
FT   CDS_pept        219725..221104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0188"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: cbo:CBO1101 sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17754"
FT                   /db_xref="GOA:A8MKT7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT7"
FT                   /protein_id="ABW17754.1"
FT                   /translation="MQTILDVLMSFSNWLWGVPMLVILVGGSVILTVRLGFVQFRYFPF
FT                   AMRETFGRIFKKSEGGEGTVTAFQAATAALASAIGASNIVGVPVAIAFGGPGAVFWMWL
FT                   VALIGAGAKFSEIVLGIKYREKNEDGEYVGGPMYYLTKGIKGNLGKALGFMFSFFLMIE
FT                   IAPSIAAQSVSVVQTAASINIPNWASGLALALVVGIVIFGGIKRIGKVTEKLVPFMALF
FT                   YVIGSLAIIIVNISELPNAIALIFKHAFTPMAAAGGFAGAGIAQAMRWGTARGVYSNES
FT                   GMGTAPIAHATAVTDYPVRQAMWGIFENVVDTLIVCTATALVVLVTGIYQTVPASQAAS
FT                   MPALAFQSLLGKGLGGIIVTGSISLFVLSTVIVIAYYGEKQAEYLFGTRFSKVMRIIYM
FT                   ASIVLGAYGGIEFLYQFLDLLLGLVIIPNMIGLLLLSSEVKELKDEFFNNLSLNKSRSK
FT                   Q"
FT   gene            221140..222786
FT                   /locus_tag="Clos_0189"
FT   CDS_pept        221140..222786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0189"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; KEGG: cac:CAC0367 arginine
FT                   degradation protein (gene RocB)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17755"
FT                   /db_xref="GOA:A8MKT8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT8"
FT                   /protein_id="ABW17755.1"
FT                   /translation="MHTDLSSKIKNLTIELTEVPSVVGFKEEIHVVEKIHEKFQEMKYF
FT                   KNNPEQLRYIDVINDVHNRKSVLAIVKGKKGNSNKTVVLIGHTDTVGISDYGDIKEYAT
FT                   KPLELKERLRNVLLTEEALKDLESGEYLFGRGIFDMKCGVAILMSIVESLSDDVENLEG
FT                   NLVFAAVCDEEGNSGGMLSVVPELVRLKREEGFDYQALVDTDYMAPRYEGDDSRYVYVG
FT                   TVGKIMPSFYIVGSEAHGGDPFKGLDPNHISSAIIEEIDFNTKYCDSAEGEVTVPPISL
FT                   RQQDLKPEYSVQTPRTSYLYFNFGTHSSTPNEIMEKIIDGSTLAFQKVVNSLNEEYRKY
FT                   CQYNQFPYTELPWEPRVLPYEELYQRVKAEKGEQVDKVIEDLNKKILLDKEVDERVYAL
FT                   KMVEAVHNMWSDKNPVVVTYFSPPYYPHIYVKGETPLEKKLLEVVNSVVGNTESKYDIK
FT                   MKKFYPYISDLSYGAAPREENAIESLKNNMPGFGVKYELPIEDMQDLNLPVVNIGPFGK
FT                   DAHKFTERLEEDYSFKVAPKLVYETIIGLLK"
FT   gene            223014..223736
FT                   /locus_tag="Clos_0190"
FT   CDS_pept        223014..223736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0190"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: dsy:DSY2398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17756"
FT                   /db_xref="GOA:A8MKT9"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKT9"
FT                   /protein_id="ABW17756.1"
FT                   /translation="MKKALKAAFPFTVPVMLGYISVGIAFGLLAEKSGLNFFWALLMSL
FT                   AIYAGSMQFIAINLIVSGMGLVEIGLMTLFVNIRHLFYGLSFIDRFKTMGRKKLYMIFS
FT                   LSDETYSLLCAAEAPEGINSDQFLFSISLLNQIYWLIGTLLGSMAGNLIKFNTAGIDFA
FT                   MTALFVVIFIEQWKSFKTHIPAFIGIVATIVSLVIFGPDNLIVPSMGFILVALAMFKKR
FT                   IEAEDSQSSKGDVINNES"
FT   sig_peptide     223014..223106
FT                   /locus_tag="Clos_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.487 at
FT                   residue 31"
FT   gene            223726..224061
FT                   /locus_tag="Clos_0191"
FT   CDS_pept        223726..224061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0191"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   bsu:BG11916 branched-chain amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17757"
FT                   /db_xref="GOA:A8MKU0"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU0"
FT                   /protein_id="ABW17757.1"
FT                   /translation="MNLNNHYILSAIFVSAVITFMIRVIPFILFGKGKTTPLYVTYIGK
FT                   YLPPAIMSMLIVYCLRNVQFSTAPFGIPEAIGIIAVAALHLWKRNNLISILGGTLVYMV
FT                   SIQFIFA"
FT   gene            224176..224319
FT                   /locus_tag="Clos_0192"
FT   CDS_pept        224176..224319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17758"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU1"
FT                   /protein_id="ABW17758.1"
FT                   /translation="MEDKNKLNELGEMPLANVSNQELKQIKELEQSFGDKYYLIALDKD
FT                   HK"
FT   gene            224561..225601
FT                   /locus_tag="Clos_0193"
FT   CDS_pept        224561..225601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0193"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: drm:Dred_3091 Ig
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17759"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU2"
FT                   /protein_id="ABW17759.1"
FT                   /translation="MNNRNKLVLVISILLVFTMLGTVGAFAENFTELTGVKLIEDGKVS
FT                   SEVLSGSTDIPLDATFKLNFSNGIYRVFNENENKIELYNVDNNNEKIDIELQIVKSDAY
FT                   GDLVNKEDNKQNKDDKNQGNKNKGNKEDKNKEGQNLEAEGLEKSQSIALRPVEALQEGT
FT                   KYQIVVHKDFKANNGATLKEDIHIGFTTMSLDKVVEVPFIDIADSSEKEAIESMFKRGY
FT                   IHGKSETHFAPNENITRAEIATIMCRILELNEKEDISEYKDIKADEWYSEYIAKALKAE
FT                   IIEAKDNMVRPNDNITKEEFKAIAYNGYKHMGKDIDNTLDFETKENVTRAEATAILNNL
FT                   VNTIKK"
FT   sig_peptide     224561..224644
FT                   /locus_tag="Clos_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            225648..226670
FT                   /locus_tag="Clos_0194"
FT   CDS_pept        225648..226670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0194"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: swo:Swol_1189
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17760"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU3"
FT                   /protein_id="ABW17760.1"
FT                   /translation="MNKVLKNNNVGILFLLVLSMCLSPVSVMASGAGDGSGGGHNEPLT
FT                   MESSSIKDGEENIALQPEIKLVFSKNVVNIKVKDHNRKSISLVTSQGDIVPVEVIMEDD
FT                   QIRPDKRREVVIKPKKRLNTNTKYVLNINTSFKSKSEISLKEPLKISFTTIKKDETDQS
FT                   FVDIKDHWARSHIESVANLNIMNGTRKGYFSPNKNITRAELSAILSRTLNLTETTDLNH
FT                   YKDFDSKAWYASDMEKAIKAGILKVEGGKVSPNAFVTREEMAIAFTNACKYKGVKLSTS
FT                   SSILFKDGKSIHPNAMDAVNAMYHLKVMQGREDSKFAPKDKITRAETATMLIRLYNILK
FT                   "
FT   sig_peptide     225648..225737
FT                   /locus_tag="Clos_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 30"
FT   gene            226698..227705
FT                   /locus_tag="Clos_0195"
FT   CDS_pept        226698..227705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0195"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   swo:Swol_1473 iron(III) ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17761"
FT                   /db_xref="GOA:A8MKU4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU4"
FT                   /protein_id="ABW17761.1"
FT                   /translation="MKRKKTYFLLLISPIFIVFFSLFVGNYSLSLTEVIRILVSKLSFA
FT                   PYDPGNKALYIVWNIRMPRIILGMLVGASLAVSGVAFQSLFKNPLVSSSILGVTSGAGF
FT                   GAALSILIFSSKNYTYLFAFGFGVLAVFLSYWIGKIYSSDSTVMLVLGGVIVSSVFSSL
FT                   ISLAKYMADPYNQLPTIVYWLMGSLSSASYKDMYLGGIPMIIGTTGLIASRWRLNVLSM
FT                   GDREAQTLGINVNLNKAFVISCATLATAGAVSVSGNIGWVGLIIPHIGRMMFSNDNKYL
FT                   IPISISLGASYLVLVDNLARTIGGAEIPLGILTSLLGGPFFVYLLKRTKGRGWA"
FT   sig_peptide     226698..226778
FT                   /locus_tag="Clos_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.370 at
FT                   residue 27"
FT   gene            227696..228511
FT                   /locus_tag="Clos_0196"
FT   CDS_pept        227696..228511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0196"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_1472 iron(III) ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17762"
FT                   /db_xref="GOA:A8MKU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU5"
FT                   /protein_id="ABW17762.1"
FT                   /translation="MGVMELIKVKNASFHYEKTEVFNDLSLKLNAGQVLCLIGSNGCGK
FT                   TTLLDCILGIKKLRKGEILINGVNISKLKASQRAREICYVPQFHRGTFPYKVLEIVVMG
FT                   RAVYTGFFHMPSQKDICIAMEALEMVGMDQYKDKPYTELSGGEVQLVMIARAMAQNASI
FT                   IIMDEPTSHLDMRHELIVLENIVKLVKDKGKAVIIATHAPNHAFHFENHNIATSVALMR
FT                   DGGFIDYGKPKDVVNEVNLDKLYKVKTKIVDVEVDNCYTMKQILPLKSS"
FT   gene            228538..229623
FT                   /locus_tag="Clos_0197"
FT   CDS_pept        228538..229623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0197"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   swo:Swol_2486 ferrichrome-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17763"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU6"
FT                   /protein_id="ABW17763.1"
FT                   /translation="MKRIKLLNFIVVLIITTLLTTACVGVKRSNTMVWDNHIVVVDSIG
FT                   RSVEINGKVKKVAVFYPLAGHGLTMLDRDIEIVAVSQGLKRDVLLEELNPSLTNAVIAG
FT                   SGKEVNIETLMAQNPDLIIVTKNMVSNEGEKQKLDHSNIPYLVIDYSNIREQQDVIAML
FT                   GKAIGKEERAKAYNEFYKDTVSLVKKSVENMPEPERVRVFHSISEATRTEIKGTISSDW
FT                   INTAGLMNVIEDEKLNIFENSKYFASLEQIYLWDPDAFLVNDIETAKYIMGDDKWAGLS
FT                   AVKNQKVYPLPTGISRWGHVSSLEIPLVLLWTGKIFYPDKFSHIDLNQQIKDYYKNFFD
FT                   YEVSDKQVESILKAEGMRLKK"
FT   sig_peptide     228538..228606
FT                   /locus_tag="Clos_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.615 at
FT                   residue 23"
FT   gene            229637..230386
FT                   /locus_tag="Clos_0198"
FT   CDS_pept        229637..230386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17764"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU7"
FT                   /protein_id="ABW17764.1"
FT                   /translation="MKLLICIDDTDSLDKSISTGRIAEIIIDEIEKEHLGKCEAVTRHQ
FT                   LLRHEDIPFTSHNSSMCFRASIDGCNYEKVVKKTIQLLYQYQAAGSDPGLCVVKEEELD
FT                   NPELLISYGYSAQEKILTKEEAYSLATKLKIHLTEHGGTGLGVIGALAGAGLRLSGEDG
FT                   EFKGTVKLGKEGTLVSIRDLEEYPFIDEVRMLNGDPMDRGKPVILGAKYKTILRNGKAI
FT                   FLIDDAPEQGENYYRSCTKKEIRSYGR"
FT   gene            230410..231870
FT                   /locus_tag="Clos_0199"
FT   CDS_pept        230410..231870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0199"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: tte:TTE2001
FT                   predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17765"
FT                   /db_xref="GOA:A8MKU8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU8"
FT                   /protein_id="ABW17765.1"
FT                   /translation="MYDIAIIGAGAVGGFVARELSRYNLKIVIFEKEVDVAGGVTKANT
FT                   AIIHSGYSPKPGTIKAKLNREAIEIFPQVCKELDISYKKTGSLLIAFNEESMEAVHKKY
FT                   TRGIKNGVKSLKILTKEEILAIEPNMNKNVYGALYSQDTGIVNNWDMAIAPCENAVDNG
FT                   VALRTREKVYRINKSEDTFYIDTEKDQYQSKVVINCAGLFSDEINQMVGKKSFKIEPKK
FT                   GQYFILDKNQGSMVNHVIFLAKSENDKNTKGMIIAPTINGNIIIGPSSQNPCNKEDMST
FT                   TVFGLNKVKSLAKDVIPNLDFSKTIKTFAGLRPKVDFAEDEENDFIIEEDQHVGGLINV
FT                   AGIKSPGLTCAPSIALMVKDIVENILGKLQPKDDFNPYRKKVIRFNELDEEERNKRIKE
FT                   NPLYGKIVCKCENISEGEIIDAIRRNPSPTTIKGLKFRTMVGMGRCQGGFCMCSLIEIL
FT                   SRESNKKRLRWDGDKNSLGDKSMEKMDG"
FT   gene            231889..232800
FT                   /pseudo
FT                   /locus_tag="Clos_0200"
FT   gene            232903..233247
FT                   /pseudo
FT                   /locus_tag="Clos_0201"
FT   gene            233636..234637
FT                   /locus_tag="Clos_0202"
FT   CDS_pept        233636..234637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0202"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   dsy:DSY0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17766"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKU9"
FT                   /protein_id="ABW17766.1"
FT                   /translation="MIFVFLFIVFIAGLILCYSSYLQTNAEEKEHKVYKIGVLTVNDER
FT                   LAKIEGMHEGLKQYGLSDNDVDIIIKNASGDVNRLDQLGQELVNIGVDVIITTGTSETT
FT                   AAKKATMDQEIPVAFIGVGCTVELDLVKDNISTACNITGVDSHYVQLSGKRLEFLKRLV
FT                   PNTKKVLVLYNPETTPFGPSSIFLYDAADKLDIQLDIVPVIDHKEVLAVLNEKGDSVDG
FT                   VMLMCSLLFESIIDSIVDITLEKQLPVMGVTDRQVEKGVLAFYGSTTYNEGIQAARIVV
FT                   NILKGQDPRIIPIESPEQLELYINLDTARKLKVDIETPDMPFVDHFIQNRER"
FT   sig_peptide     233636..233716
FT                   /locus_tag="Clos_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.483 at
FT                   residue 27"
FT   gene            234752..236506
FT                   /locus_tag="Clos_0203"
FT   CDS_pept        234752..236506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0203"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: chy:CHY_1856 sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17767"
FT                   /db_xref="GOA:A8MKV0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV0"
FT                   /protein_id="ABW17767.1"
FT                   /translation="MKIVKKEIEESIHKQHALTASRVSYAVSDLVKTLQISLETISLTN
FT                   SDVFEGNDAKKKENLLYGILKNFPHLEEIVMVSSRGEEVVKVSKRYAVSSKDLKKVSDE
FT                   PQFQKLKQGKSFIGSPKIDIDHQIVFDLGVPAGGINQDFRGGFIAKISLRQVMQEISSV
FT                   EISDGSYIMLVDEEGELIGHSDYSQVLRRQDVSSSKGVENLLKNKAQDRNQLRILEFNP
FT                   IIYKSYTGEDVLGVYGLIPMVGWGVVVEQPLVSAYITLRTMLLRLSLVLFLIILTITGL
FT                   GLIFIFHFIRPVEELAKGVACVKKGDLEYRIPKQSNDELGVVIEAFNDMIKEIKKKRDN
FT                   EKIAIQAEKRAAIGLLAAGVAHEINNPMNNLGFYADDLLERLEIENINELEAEGVFKEY
FT                   LLSIREQIHRCTNITQSLVNYSREVESQDKQVYIPNVVNEVLKLVKYPINKQNIEVDLK
FT                   WEEPLPYVLADESQLQQVILNLVTNALDAMPDGGKLTIKIRCEGNLIKIEIIDTGEGIL
FT                   KENLKYVFDPFYTTKPVGKGTGLGLAISQVIVERMRGILSLENNKDVGIKASVGLPIAA
FT                   EVIKNETM"
FT   gene            236493..237815
FT                   /locus_tag="Clos_0204"
FT   CDS_pept        236493..237815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0204"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: chy:CHY_1855
FT                   sigma-54 dependent transcriptional regulator/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17768"
FT                   /db_xref="GOA:A8MKV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV1"
FT                   /protein_id="ABW17768.1"
FT                   /translation="MRRCRVLLVDDEEKFIELLKQRLTRKGYSVEISNCSLKALNMIEE
FT                   TEFDVALFDIMMNGMDGLALLEKAKKIQPNLEIIMLTGYATVDTAIEAMKKGAYDYLTK
FT                   PIKPIELELILQKALDRKKLQDYSNNLIETIQRTNKKREIIGNSDAIISLKYMIDRVSD
FT                   SSLPVLILGESGTGKELVANALHYHSLRAHHPFVPINASAIPSQLLESELFGHVKGAFT
FT                   GAQVNKKGLVELADEGTLFLDEIGDMEASLQVKLLRFLDTGEFRPVGGTVTKKTNVRVV
FT                   AATNINLEQAIEEGRFREDLYYRLSVVTLNVPPLRERGRDALVLAEYFLRQSNSKKKLS
FT                   KEAEMFLLNYTFPGNVRELANLIERGILLSKDNDLYPNDFFARETYSKNNMKSLALQDI
FT                   EKEHICQVLEKTGWNKTEAAKILKIGLRTLYRKIEEYKLQQ"
FT   gene            238096..241161
FT                   /locus_tag="Clos_0205"
FT   CDS_pept        238096..241161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:238864..238866,aa:Sec)
FT                   /locus_tag="Clos_0205"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="Contains selenocysteine; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region;
FT                   KEGG: dsy:DSY0547 putative anaerobic dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17769"
FT                   /db_xref="GOA:A8MKV2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV2"
FT                   /protein_id="ABW17769.1"
FT                   /translation="MKRRTFLKLSALTVGASALGLGITGCNKETDVSIDGFPEMPQTLG
FT                   QGVEATVDPKSGEVKVNSDILVKSSVCMGCYSSCGVRAKIDKQTGRIMKLTGNPYHPKC
FT                   AEPALPYDTTIKESYQAFSLYGDQGHTHRATVCARGNAAFEQVYDPMRITTPMKRAGER
FT                   GSGKWKPISWEQLIEETVEGGKIFADLGDNTVVEGFRKVYSQDELINPDAPEMGPKSNG
FT                   LVWISGGSYGRINFAQRFVLNSFGSTNFYGHTGTUGGAWRPAWQVLYDNGAGGVYKPDL
FT                   QDAEFCLYQGAYPGHSGMSFQTLARKTVKGVMENKLKLAVIDPFMQGGTDIPGKTKWIP
FT                   IKPSTDGALVLGMMRYIFDNEKFDGKFLECSNEEAAKAIGFKSYTNATHLVIVDEKHPN
FT                   NRRFLKPEDLGLEGEGFFVIDKKTGKPELHSKASAGNLLYSGEIQGKTGTIKVATSLYL
FT                   LKQGIERHSLEEYAEICGIPAKQIEELAKEFTSHGHKVAVDTLGGTNSVNSLPFTVALW
FT                   ILPALMGAYNMKGGMAGNGPSFKAFADGPKYDLAAFEGQIKPSGVKISREQFPYEKTTE
FT                   YKNKVAQGKKPYPSKLPWHTNGMSLDGQAMFSALNKYPYQCKILVNCFANPLYGTPSLY
FT                   QETMLEELKKTSNIPLIISVDIVMGETTAYADYIVPDTSVYEQWAMVPVRANINTKMTA
FT                   IRYPMIEPMTPKVGSSNQPISMETYLIEVAKKIGMPGFGDNAIKDADGKLWPLNTREDY
FT                   FIKAIANMAYDGEAVSSITEEDDKITGLDSIPSDWQAAIKPDELFVVKNVIAKGGRFEA
FT                   DTNYHDGQFMKYGDLVKVCFYSENLANSRNSITGAYNEGSPVWAPETLADGTLVDQAYP
FT                   SEEYPFRVCSSKAKLRGVSMLNNCPTLQVLSDTNYIEINALDAKDFGLKDGQEVMVETP
FT                   SNKAKGVLKVREGVARGSLGISFGYGKWEYGSKDTTIDGKVVKGESIRAVGIASNPLAL
FT                   IDHSVKGKYGLSEVTSGTHNRNGIRAKIVPLS"
FT   sig_peptide     238096..238182
FT                   /locus_tag="Clos_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.639 at
FT                   residue 29"
FT   gene            241181..241912
FT                   /locus_tag="Clos_0206"
FT   CDS_pept        241181..241912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17770"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV3"
FT                   /protein_id="ABW17770.1"
FT                   /translation="MDNIQINSFERSALYEIFASLYLQIPTIDTVQGIPSILEEASKIL
FT                   SSIDFEPLIEEAQERSKRADGEDNTIKALQEEYYDHFFVPSTKHYIPPYESAVVEATVK
FT                   NGRKNIKWKYGSLWTNSTYHVSQCYDSVGFNPWDLNIGEGLKQSKVPDHIGFQLAFMAY
FT                   LCYKEAICNELIIENETNTDKEKEAAKMWKKLQKQFLEEHLQKFVLSYYEIAKDKFNPF
FT                   YLQVMNAVNRYIEWDLAAIVI"
FT   gene            241925..242485
FT                   /locus_tag="Clos_0207"
FT   CDS_pept        241925..242485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0207"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dsy:DSY4904 putative oxidoreductase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17771"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV4"
FT                   /protein_id="ABW17771.1"
FT                   /translation="MSRKWGMVIDVRKCVGCHACSAACRIENNVTKEGNRSWVTEDEVG
FT                   TYPEVHTLRVPQLCNHCDETPCVSACPVKATDKSEDGIVFVDREKCIGCFACVGACPYG
FT                   ARIQEEETKKVDKCDFCAHRLQHGLLPACVTTCTTQARYFGDLNDSNSLVSKLLKENKY
FT                   EVLLPEKELGANVYYIGIHEYRG"
FT   gene            242606..243235
FT                   /locus_tag="Clos_0208"
FT   CDS_pept        242606..243235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0208"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A-like protein"
FT                   /note="KEGG: amt:Amet_0989 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17772"
FT                   /db_xref="GOA:A8MKV5"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV5"
FT                   /protein_id="ABW17772.1"
FT                   /translation="MIKMDKKKISAVVLAGGNSSRMGKNKALLELGPHVVIEIVVEVLK
FT                   TIFEEIIVVTNTPQLYSMLKGVRFVSDALESTEKKSIIGLYTGILEAKNNYVFVVACDM
FT                   PFLNADLVHYMIDQMGDEDTLVPHINGYYQPLHAIYHKNSLSYIKALLDSSNYKISDLF
FT                   DCFEDLKVKKINDEILDRLKITENCFLNMNTHQDYIDIKNSWFSDK"
FT   sig_peptide     242606..242677
FT                   /locus_tag="Clos_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.829 at
FT                   residue 24"
FT   gene            243346..244437
FT                   /locus_tag="Clos_0209"
FT   CDS_pept        243346..244437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0209"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: amt:Amet_0993 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17773"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV6"
FT                   /protein_id="ABW17773.1"
FT                   /translation="MLIKYFIGKALQENRPNINQKRCVNRSSKMQRCTECKDACPVGAI
FT                   CMDNKIAHVDEESCKGCGICRAICPSQAISLKKDDEIKAIRQLEQKEIIVVGCHEEGNG
FT                   GNITVSCLNGLHQEYLAACLMALKGKKIYFNLCKCEDCYIKDGSKCFENSLKNVTAFLK
FT                   HFDIHPQIELLLNQENIPQYMNQTISRRDLFTLFKKQSTNVVSEIVDDAVGRESHFIQR
FT                   DFILEHMDNLIRKSREHIEIPRSESLFTNWRVHDNCSSCGLCQTTCPSKAWKVQKHKGH
FT                   VTISHNARLCTSCGLCEDLCPQKALSKDTFSTALFVGFTLKKEIPLSLCKQCGKEYVPN
FT                   KEDHKLCHICQKRRMVKQSILRT"
FT   gene            244516..245751
FT                   /locus_tag="Clos_0210"
FT   CDS_pept        244516..245751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0210"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein domain I
FT                   and II; MoeA domain protein domain IV; KEGG: amt:Amet_0996
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17774"
FT                   /db_xref="GOA:A8MKV7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV7"
FT                   /protein_id="ABW17774.1"
FT                   /translation="MRTNVTLEEALDILLSENNQTEAIHVPLLDSLGSVLAEDIRSDMN
FT                   MPPFDKSPLDGYAVRAEDIQGASKESPITLQVIDFVPAGYVSAKKIEKGEAIRIMTGAK
FT                   IPEGADVVIRFEDTEFTDKDVKIYTPLPPNSNISQLGEDMRVGDVVMKKGIRIDAPEVG
FT                   ILSTLGKSFVQVYRKPRVAILSTGDELVDIQDALTDGKIRNSNSYTIAAQIKKIGAKPL
FT                   MLGICDDGIETIKEKLKSALSWADMIITTGGVSVGDCDLVKEAFEQVGAEILFWRVRMK
FT                   PGTPIAVAKYENKLLFGLSGNPAAAYITFEQFVRPIVLKKMGREKYKLMEVESILQGSF
FT                   SKISNQNRFVRANTYYKDGKYYTQFPSKHSSGVLSSLSGTNSLFYIPAGTGPYEEGQKI
FT                   IVQLLDYPEVLQ"
FT   gene            245748..246239
FT                   /locus_tag="Clos_0211"
FT   CDS_pept        245748..246239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0211"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: amt:Amet_0997
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17775"
FT                   /db_xref="GOA:A8MKV8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV8"
FT                   /protein_id="ABW17775.1"
FT                   /translation="MIPVFSVVAKNSNTGKTTVLCNIIKELKSRGYRVATIKHDVHGFD
FT                   IDQPEKDTWKHGQAGSDMVMISSPEKFAMIEKVQVEYTLDEILEKINNVDIIITEGYKR
FT                   ENKPKLEVYRKEVADELLCKDEELFGIVTDVELDKDTPQFSFEQIKEVVDLIEKKFLKK
FT                   "
FT   gene            247015..247866
FT                   /locus_tag="Clos_0212"
FT   CDS_pept        247015..247866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17776"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKV9"
FT                   /protein_id="ABW17776.1"
FT                   /translation="MGTQSNEILNETIDQIRAVFGEEMNHITVERVTVGLFFTGVKLNN
FT                   GEGGICFTPIKDIPQGVCCPSSAKEMPLSGKMVGKNVEYFIEGMFKGSVLRKAIGIAVL
FT                   NALSATCWNQKNYSGNYEIIHNADPVDENTSIPQDKTVTVVGALLPYIKMLKKNKNKFF
FT                   ILELAPETLKADELDHFVPNDRAQEALGQSDLIIITGTTIINDTLEGLISMAKEGAEII
FT                   VVGPTASMLPDAFFKRGIKKIGSIAVTKSDELLDILAEAGSGYHFFGKSANKIVIAEKN
FT                   SI"
FT   gene            248000..249034
FT                   /locus_tag="Clos_0213"
FT   CDS_pept        248000..249034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0213"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: mta:Moth_1424 transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17777"
FT                   /db_xref="GOA:A8MKW0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW0"
FT                   /protein_id="ABW17777.1"
FT                   /translation="MVTAAQKKINNKYKLLLLTIIPIIAFFLSITLGRYSITIKEIFII
FT                   LTSKLLQKDIDYPKVMETVIFQVRIPRIIAAMIVGSSLTVSGAVYQGMFKNPMVSPDIL
FT                   GTSAGAGFGAALAILLSFSSLGIQATAFMFGLIAVLLTYTISTKVGKGGNIMFVFILAG
FT                   ILVSTVFQSFISLSKYVADPYDKLPAITFWLMGSLASISQRDVYTILIPFLLGIVPLFL
FT                   VRWHLNTLSFGEEEAKALGVDTKKLRFLVIICSTLLTASSISVAGMVGWVGLIVPHLAR
FT                   MVVGPDFKVLLPASALMGSTYLLLVDNIARSVAAIEIPLGILTSLVGAPFFIYLLLNTR
FT                   KGWN"
FT   gene            249025..249819
FT                   /locus_tag="Clos_0214"
FT   CDS_pept        249025..249819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0214"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mac:MA1198 iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17778"
FT                   /db_xref="GOA:A8MKW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW1"
FT                   /protein_id="ABW17778.1"
FT                   /translation="MELKLEINNVNCGYPKKTILENISFEIGTGDILCILGPNGVGKTT
FT                   LFKTILGFLKLQGGSILLDGQDINTWSRKDFAKAIGYVPQAHTPPFPYKVREVVVMGRT
FT                   AHLGIFASPSLQDYAIAEKVIDSLGISYLTDSVYTEISGGERQLVLIARALAQEPKILI
FT                   MDEPTSNLDYGNQVRVLKHIKELSKRNIGIIMTSHFPDHAFMASTKVLAINRGGEYRIG
FT                   TPKEVVTSQLLQRIYNIRVQIDTVVDRVHNDHLKVCVPILKD"
FT   gene            249885..250976
FT                   /locus_tag="Clos_0215"
FT   CDS_pept        249885..250976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0215"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   swo:Swol_1691 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17779"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW2"
FT                   /protein_id="ABW17779.1"
FT                   /translation="MKMIKNKSKVLLSTVLILTMVMSLMIGCTSKPTNSEPTVSKGAEE
FT                   IEPKTKTIIDSVGREVEIPTKIEKVVTVGPVGVLNCFVFTMGEGNTIANGLPPRFAKSK
FT                   NWKYHSIFNPAIATNPVVEDGNAVSMETLIEINPDIVLTMDEKTADDIWNKGMNAIVLN
FT                   WKNPEDVKEAVNLLGQIYNKPERAEEYSKYFDRTLAKVKDTASKISEEKRVRVLNTSLG
FT                   SLSQPHVIAEWWIEEAGGISVTGGIERKQRLEFSLEQLLEWNPEVMIVSSQDDKELAYS
FT                   DERFKDLEAVKNKRIYVTPSFGHVWANRTMEQPLTVLWAAKLFYPEEFKDINMNEELKL
FT                   FSEKFFSYKLSDEESKEILGDMN"
FT   sig_peptide     249885..249992
FT                   /locus_tag="Clos_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.706 at
FT                   residue 36"
FT   gene            250993..251874
FT                   /locus_tag="Clos_0216"
FT   CDS_pept        250993..251874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17780"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW3"
FT                   /protein_id="ABW17780.1"
FT                   /translation="MAMKRPNPLIEAYRYIKNIYEIESMDPGILEKIIFSPKWTGVFAD
FT                   RGQTGVAFNYAGEHLVYGPVKDLNSIEGLKRFIGQSLFSLAEYLLPLDEDIHMRSICLS
FT                   TLNALSRPLILRGYPKDQAITKFNASKDIDFILPEDIVVIIGYGRLIDQVYGRCKELHV
FT                   MDMRPKHKLTSMCIDKNIGYGSKNTFIHSSEENEEILSKADVVLITGATLVNGTFLELI
FT                   KYSKVARVIGMYGPSAQILPDILLNSGINYIGSSIVTKPDVLESILMDNFSTRHMFKDC
FT                   MDNYVIKGINQC"
FT   gene            251868..252689
FT                   /locus_tag="Clos_0217"
FT   CDS_pept        251868..252689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0217"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ0785 biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17781"
FT                   /db_xref="GOA:A8MKW4"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW4"
FT                   /protein_id="ABW17781.1"
FT                   /translation="MLNEIMEMSDEDLFLKAQEIGSYKRKINTGPAIITGACLTQPHCN
FT                   HCKWDSFKSGDHAFSQKNSLESVIERGKLMESIGVHRIFTATGWMGHTIPADYPLYIEA
FT                   LKAHTNMEVFGLFGAIDKESLKALQSAGMDGYLCGIESPNEDIYKKFRPGGDTLSDRLK
FT                   TLYDMKALGLKVWSGFLVGLGETKEDVMKGLEILKDLEPESLSILPFTPYPFTNMMGEN
FT                   PANPLHWARTVAQAHLYMPNANIFSDSKVGFYGKFSELTGANGSYIFPRKE"
FT   gene            252764..253897
FT                   /locus_tag="Clos_0218"
FT   CDS_pept        252764..253897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0218"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mac:MA1232
FT                   iron(III) ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17782"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW5"
FT                   /protein_id="ABW17782.1"
FT                   /translation="MKKCNRIISMILTIIMLSAMIVGCSNKTLEAQQLEGSKTETPAAS
FT                   SEAETKIVTNLNGTEIEVPVNVERVAALFGPSYEKIYLLNAEDKIVAAGDFHKGGWPWS
FT                   NQIYKRLDTVVGIENAHSSLNIENLLKYEPQVVFYFPNPEAVASINEAGMVAIPMASTG
FT                   KFEDTKNVLTVYADVLGGEAVDIAKKYANYFDEKVKLVTDITSKISKEDRPDVYFSNQN
FT                   ILWTAGKKSDMVEVIELAGGNCVHKEIEGGSKNEITIEQLLEWNPDYIFVDHAGSSGNA
FT                   TAEEVIKDMLDDNRYEQIKAIKNDNIYISPTGVFFWDAGQQKVLMLMWMAKHLHPEHFS
FT                   ALDMAQELKYFYKEFYRYDLTDQETDRILKHLNPMVN"
FT   sig_peptide     252764..252856
FT                   /locus_tag="Clos_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.386 at
FT                   residue 31"
FT   gene            253940..255145
FT                   /locus_tag="Clos_0219"
FT   CDS_pept        253940..255145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0219"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein domain I
FT                   and II; MoeA domain protein domain IV; KEGG: dsy:DSY3835
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17783"
FT                   /db_xref="GOA:A8MKW6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW6"
FT                   /protein_id="ABW17783.1"
FT                   /translation="MKEHKVVVPSREEYIELATSLAKFDRRTEIVSLKESVGRVTAKDI
FT                   YALHTLPNQPTSAMDGIAVRFEAFTSKEVDPTAWELGKEYVFSNTGVAIPTEYDTAIPI
FT                   EHVKFDNNNRLHINKIPSCRGENVVPRGKNMKEGELLVPAEYVITPLQLGVLASGGICE
FT                   IEVIAKPKVAIIPTGNELVPAGAVLPLGKNIETNSIVLEALIKEWGGEPIVYPIIPDDP
FT                   VYIYDILYHALKQSDMVIFNGGSSKGTHDFGKEILGKIGQVYAYEVAHGPGKHTSLTVA
FT                   GNKLIVGLVGPPGGTELTAPWYVKPLINKYLCKPDVQAPKLEVKLLNEISSSAPFDFYI
FT                   QLIVSQQDGEYVATRIKMFNATRAQLAVQANAILCVPRGVVFKKGETVAVELKIPIEYI
FT                   SA"
FT   gene            255210..256352
FT                   /locus_tag="Clos_0220"
FT   CDS_pept        255210..256352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0220"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   swo:Swol_2097 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17784"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW7"
FT                   /protein_id="ABW17784.1"
FT                   /translation="MFKKYSMKTSKMALLLIVVLLMVSMAGCTKKADEAINNTPEQVEQ
FT                   AQQDESTTRVIKDMAGREVEIPKEINKVFTTSGVGTIALYSINPSKMAGLNSKLTALEE
FT                   KYLTKEYQQLPILGSYKDASSGNAEEILKAKPDIIISMGNIDERWIKDADESQEKLGIP
FT                   FLMIDGDLENLHKTYEFLGDILGEEERCKKLSEYCKNTIEEVKTIASTIPMEERIKVYY
FT                   GTTQGPLVTNVTGSIHTQAIDLVGAINAAEVTVEKMSGGVEVSMEQVLNWNPDKIIAAK
FT                   GMEGNEGSYEIITKDSKWKDIKAVQNNQVYAIPNAPFNWFDRPPSVNRVIGVKWLGNLI
FT                   YPERFNYDMNKETKDFYEMFYHRALTDDEVAEILENAMPR"
FT   sig_peptide     255210..255305
FT                   /locus_tag="Clos_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.596 at
FT                   residue 32"
FT   gene            256380..257063
FT                   /locus_tag="Clos_0221"
FT   CDS_pept        256380..257063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17785"
FT                   /db_xref="GOA:A8MKW8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW8"
FT                   /protein_id="ABW17785.1"
FT                   /translation="MKIVTVSGPPSSGKTSITLKVIEILKREAFKIGVVKFDSLSTYDD
FT                   ILYEKTGVKVKVGLSGNLCPDHFYISNIEDCVQWGISEELDMLISESAGLCNRCSPHIK
FT                   DVLSICVIDNLSGVNTPKKIGPMLKLADIVVITKGDIVSQAEREVFAFRVKQANPRASI
FT                   IFINGITGQGSYDLAVKLKEAKAFNSLENKRLRFSMPSALCSYCVGETRIGEEYQSGNI
FT                   KKMKI"
FT   gene            257078..258088
FT                   /locus_tag="Clos_0222"
FT   CDS_pept        257078..258088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_2094 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17786"
FT                   /db_xref="GOA:A8MKW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKW9"
FT                   /protein_id="ABW17786.1"
FT                   /translation="MTLDIAKHPIKELFIKYPYSEDFFISFDIKDMDVNLSMEEVVINL
FT                   KDEILEDNGLSREQLIDNFISFIEKMEALKNLSDNTIESITIIGGKDKHGRDEDIKLEL
FT                   NVGEVISIVGPTGSGKSRLLADIECLAQRDTPTNRQILVNGKAPDPNKRFDIENKLVAQ
FT                   LSQNMNFVMDLSVEEFIKLHAESRLIANIEAVVEEIIICANNLAGEKFDRSTPLTQLSG
FT                   GQSRALMIADTALLSRSPIVLIDEIENAGIDRKNAIELLVKKEKIVLISTHDPVLALMG
FT                   DRRIVIKNGGIDQIITSSNEEKKYIDILDHVDRKMLDIRNHIRQGGIIEDHIINF"
FT   gene            258108..259307
FT                   /locus_tag="Clos_0223"
FT   CDS_pept        258108..259307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0223"
FT                   /product="ABC-type Fe3+ transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: swo:Swol_2096 ABC-type Fe3+ transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17787"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX0"
FT                   /protein_id="ABW17787.1"
FT                   /translation="MNITGATTIEKLLENEQAFEALLALGFNTSSKEELINLLGKNTML
FT                   QTVLKVKNINLDLFLKELKEKINNEMLEEGINNKYYNESETLNFLGNIICPLRIVFEDD
FT                   LKEKLEAFEKATGKTFNCYIMPKGGDDGRYDNLWKEKDIDKFPDIILSKGFDDFYRKEL
FT                   IDNLVSKGHFKSINNPNIDKKFIEAGCLDKDYTMYGAFLDVLLVDEEKLEGLPIPKTWG
FT                   DLLSPIYKDKIVTFETPDGISTAIPLYFYKEYGEDSIRSYAFNVKGFHSSAKMARLVGS
FT                   NNPEAGAIYTMPLMFAMSCVKKGVKLVIPEDGAIVFPFSMLVKKGKEEELRILTDYIFD
FT                   NYGLNLTKSHALSLSPNIENPFLKDHTIKWLGWEFIRSRDIIELGEYINEEFFKVWNKK
FT                   "
FT   gene            259613..259987
FT                   /locus_tag="Clos_0224"
FT   CDS_pept        259613..259987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbo:CBO3316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17788"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX1"
FT                   /protein_id="ABW17788.1"
FT                   /translation="MFFIMGISPRREELDFNQTVVCSRCGKYGRYNGIREYTALSLFFI
FT                   PVLKWGKKYYVRSSCCGSVYSIEKDLGDRIVKGENITLRDVDLSLIHGGEKYHGKRCAH
FT                   CNFQTHEDFTYCPKCGTPFE"
FT   gene            260210..260290
FT                   /pseudo
FT                   /locus_tag="Clos_0225"
FT   gene            260659..261393
FT                   /locus_tag="Clos_0226"
FT   CDS_pept        260659..261393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17789"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX2"
FT                   /protein_id="ABW17789.1"
FT                   /translation="MKNKIILATVICCMFVSGYLFSGLRMNNNKNINAYASEQIGSDTR
FT                   TIYREELISEMKKETNSLSLENQYLRAELSQLKKQLKSENKAVEPKFHGYTIYYTLDKR
FT                   YSSVFRENKWENGNFTVDGHTYMRGIGFDRKENGDRNHYVAKLYNYNGEYSRLTGLIGI
FT                   DDLAKDLDDAQITFAVYNNDVITKCYNEFYGDTLYKTQFKKSDGLQKIDVNLKGANSII
FT                   IEFSVNQKSNLNNFLLLEPQLK"
FT   sig_peptide     260659..260727
FT                   /locus_tag="Clos_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.878 at
FT                   residue 23"
FT   gene            complement(261460..262359)
FT                   /locus_tag="Clos_0227"
FT   CDS_pept        complement(261460..262359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0227"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: amt:Amet_4424
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17790"
FT                   /db_xref="GOA:A8MKX3"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX3"
FT                   /protein_id="ABW17790.1"
FT                   /translation="MKINLIGVPLTYGCGKDGAQYGPSVLRENNMIDLIKNNGHTLYDL
FT                   GDLVIPPASEEDQFKGHENIKYLDLITEVNTNLAHQVYCSLEGESFPFVIGGDHSLGMG
FT                   SIAGISKHFNEVAVIWIDAHSDINTHLTSPSGNPHGMPLAASMGVGHPKFTDIYFKGQK
FT                   VHPKNVYIIGVRDPDAGELALVDDLNLSYYSMKTVREKGLENVLNEVIENIKGSGVDGV
FT                   HISYDIDVFDKSIVPGTGTPVADGFTLEEGKFTIETLLKEKFVTSMDFVELNPLLDDAS
FT                   KTTVKTAVEFLNHTFKCL"
FT   gene            complement(262678..263427)
FT                   /locus_tag="Clos_0228"
FT   CDS_pept        complement(262678..263427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0228"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: amt:Amet_1709 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17791"
FT                   /db_xref="GOA:A8MKX4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX4"
FT                   /protein_id="ABW17791.1"
FT                   /translation="MDNNKVLATVGGREITQQDFDLLLGSLNPQQAMQFNSEAGKKQLV
FT                   QELVNQELFLLEALKNGLDKDEVFIQEAQRMHDNILKQYAMHNVLKNATVSEEDMLNYY
FT                   NEHTDSFKEPESMQASHILVESEEKANEVLKEINEGLSFEEAAKKHSTCPSNAQGGDLG
FT                   HFTRGRMVPEFENAAFDMEVGAVSAPVKTQFGYHIIKAVNKVEESVKPFAEVKMQLNQQ
FT                   LSMMKQQELYLNKVDELKKEYEVQINE"
FT   gene            complement(263629..265407)
FT                   /locus_tag="Clos_0229"
FT   CDS_pept        complement(263629..265407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0229"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: amt:Amet_1063 oligoendopeptidase,
FT                   PepF/M3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17792"
FT                   /db_xref="GOA:A8MKX5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX5"
FT                   /protein_id="ABW17792.1"
FT                   /translation="MRWSLNELYTSFDSLEFLQDMDKLSRFIPEFIQWVKQEFQNTKNP
FT                   KEKIEQYIEKQQEFTETYSRLMSYSYLTASTDAKNATALKIQDQLQSKASDLTEATVIF
FT                   EKWLGTVNDLEKIIESSTILKEHQFFLKEILLNNQYLLSEEEELLISKMSQSGARAWAK
FT                   LQALLASTLLVDITIDGVEKQLPLPMVRNMAYSSNADLRKIAYEAELKSYAKIEESSGA
FT                   ALNGIKGEALTLSEKRGFASPLEQTVIGSRMNTETLDSMLAAMKESLPFFHKYYRKKGE
FT                   LLGHSNGLPFYDLFAPVGNVNMVFTYEEAQKYIIENFNTFSQALGNFAQKAFDNNWIDA
FT                   EPRDGKRGGAFCFNLHPIKESRILANFDGSFSNMTTLAHELGHGYHGHCLKDASILNSS
FT                   YPMPLAETASIFAETIIINSALKNATPEEAFGILETSISDAGQVIVDIYSRFLFESEVF
FT                   KRRKNASLSVNEIKEIMIDAQKQAYGDGLDHNVLHDSMWINKSHYYSADRHFYNFPYAF
FT                   GLLFSKGLYSEYLKRGESFVKEYDALLEATGKNNIVDVAKVMNIDVTSIDFWRSSLGLV
FT                   QKDIERFIELADDRLK"
FT   gene            265624..266322
FT                   /locus_tag="Clos_0230"
FT   CDS_pept        265624..266322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0230"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cbo:CBO0365 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17793"
FT                   /db_xref="GOA:A8MKX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX6"
FT                   /protein_id="ABW17793.1"
FT                   /translation="MGHEKILVVDDEKEIRDLIEIYLKNEGFQIIKASNGREALEILEE
FT                   EEVHLIILDIMMPEMDGIKACMKIREEKNMPIIMLSAKAEDMDKIFGLTTGADDYVTKP
FT                   FNPLELIARVKSQIRRYTKLNNNAAAATGEEIEIDDLVINVSTHQVKINGEEIKLTPRE
FT                   FDILELLARNRGMVFSMERIYQKVWKEDFFDSPNTVMVHVRKIREKIEKDPRNPQYIKT
FT                   VWGVGYKIEN"
FT   gene            266390..268060
FT                   /locus_tag="Clos_0231"
FT   CDS_pept        266390..268060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0231"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bca:BCE_0295 sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17794"
FT                   /db_xref="GOA:A8MKX7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX7"
FT                   /protein_id="ABW17794.1"
FT                   /translation="MRRVVFFIRQRVEKSIRIQLMANFVICLISSMLVASISATYLARL
FT                   NRNAIIDYSEGIERIDYSARRIVENLNDYRNEFYDLRIEEERLEAEYPEDAEESSQSAD
FT                   MNLGSNSLAIESENSGTDTSQDGTVDSSVQDSKVNLMGKIESEFKVKFKEYIGEVLNEF
FT                   SYGMRALIVDLDGDVLYRSENATESKVDIHSIIRNAMNTRIDFQRLGGASEFTSFYPIN
FT                   LNDTRAYIVVSGVPEARIEYNEGQIGFIPIVLGFANFVLLFYFSTQKKMRYIEELADGL
FT                   LEISKGNLDHRIAGKSEDELGSLANNINFMAEALQTKIEEERAAEMLKNELITNVSHDL
FT                   RTPLTSIMGYLNLLKDKRYETEEEAYQYLNIAYGKSEKLKDLIQDLFEYAKLTNEGVKL
FT                   NLSEVHLNSLIDQLTEELVPILDEKQLSFKKDISKEDTIVLADADKMVRVFENLLTNAI
FT                   RHSSVGTEILVQTSVDEDNVIICVENTGEPISSEYLERIFDRFFKVEKSRTSNSAGSGL
FT                   GLAISKNIINLHKGSIWAESEGNIVRFYVRLSKFKSMLN"
FT   sig_peptide     266390..266497
FT                   /locus_tag="Clos_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.473 at
FT                   residue 36"
FT   gene            268679..269692
FT                   /locus_tag="Clos_0232"
FT   CDS_pept        268679..269692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0232"
FT                   /product="Aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="PFAM: aspartate--ammonia ligase; KEGG: cbo:CBO1504
FT                   aspartate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17795"
FT                   /db_xref="GOA:A8MKX8"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX8"
FT                   /protein_id="ABW17795.1"
FT                   /translation="MKERLIVPEGYEPSLSIKETEVAIKQLKDFFERELAKTLNLTRVS
FT                   APLFVCPETGMNDNLNGVERPVSFDIKDIKGQYVEIVHSLAKWKRMALGRYGFEVGEGL
FT                   YTDMDAIRRDEDLDNIHSIYVDQWDWEKIITKEERTEAKLKEIVERIYEVFKRTGDYVE
FT                   KLYPELKNILPEKITFITSQELEDRYPGLSSKDREHAIAKEYGAVFIMKIGGKLLSGER
FT                   HDGRAPDYDDWELNGDILFWNPLLNIGLELSSMGIRVDEDTLEKQLSIAGCEDRKKLDF
FT                   HRLVLEKKLPYTVGGGIGQSRICMFFLQKAHIGEVQASIWSKEMIDFCEKHHMPLL"
FT   gene            269819..271540
FT                   /locus_tag="Clos_0233"
FT   CDS_pept        269819..271540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0233"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: amt:Amet_4658
FT                   ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17796"
FT                   /db_xref="GOA:A8MKX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKX9"
FT                   /protein_id="ABW17796.1"
FT                   /translation="MIKRFAQYYKGHLPLFYLDFTCAFLMAGLELVFPSVVRLMIDDIL
FT                   PSKNLNSIIMTGVGLLVLYIASAALQYIVDYWGHVLGTRIEYDMRKDLFNHTQKLSFNY
FT                   FDNTKTGHIMSRIVNDLNEISELAHHGPEDLFIASVTLIGSFIILLNIHVPLALITFAI
FT                   VPIMLGYAIMKNKKMQATFRQMRMKIADVNAQVEDSISGIRVVKSFTNEWYEEEKFESG
FT                   NFSFRESKEDSYKVMASFFVGVSFFSNLINLVVMVFGGIFVYYNQLTPGELVGFLLYVS
FT                   MFMQPIRKLTTLIENYQKGMSGFARFVDTLNIDPDIKDDPKAICIEKVKGEVEFDNVTF
FT                   SYNNRENVLNNISLSIKPGETVAFVGPSGGGKTTLCSLIPRFYEVDKGSVKIDGIDIRM
FT                   ITQRSLRENIGIVQQDVFLFSGTVRDNIEYGHIGATEEEIIEAAKKANAHEFIMSLEDG
FT                   YNTYIGERGVKLSGGQKQRLSIARIFLKNPPVLILDEATSALDNETEKVIQDSLFDLSK
FT                   NRTTLIIAHRLATIKNADRIVVLTDEGIEEEGTHKELLEKDGIYTRLYTAQFDGFM"
FT   gene            complement(271706..272992)
FT                   /locus_tag="Clos_0234"
FT   CDS_pept        complement(271706..272992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0234"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   tte:TTE2455 TPR-repeat-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17797"
FT                   /db_xref="GOA:A8MKY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY0"
FT                   /protein_id="ABW17797.1"
FT                   /translation="MEYYVGYKIRALRKKKQMSQQELCGDFMNRSILSRIENNRMEPSL
FT                   HQIIYIANKLDTPIHYFFYDVDYTENIPSDVQSVTHELQNLFVKESFHKIIDFFNDNHD
FT                   EFKKLNDFNKYYYLGMSCYHDRINKESLRHLRKYVNLYIRNSDAIQSQYIINFGNALNT
FT                   LCKIMIVNNNYEKGRHYLYMAIKYLIKYNSSNSFIYFVVINNLSYIYNQILQYEKTILL
FT                   IENFLRLNTSLSYRSIVPQLHLLINKAYSSIGNYEMALHHIKKSILLLSYEEDQYELGR
FT                   CYINYINDLRYSLLFEDAFKVVSDCLNQYANDSTLYVRFLVQKVILLFYSEEYIAALES
FT                   IHKLNLKFLTKMDRNNCYFMMGHIHYLNRDFEVAHQFLLKSEKFFIQRGYSKDLVVLYD
FT                   DLYAITNYNSYKEKSNLYQNAVGRKNIFA"
FT   gene            273718..274317
FT                   /locus_tag="Clos_0235"
FT   CDS_pept        273718..274317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0235"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG:
FT                   mta:Moth_1580 accessory gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17798"
FT                   /db_xref="GOA:A8MKY1"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY1"
FT                   /protein_id="ABW17798.1"
FT                   /translation="MSIEKKLIDNLGKELDLSEDKIEVITFGYRLFIYSIWGYLLIILV
FT                   SYILGTLPITLTAAITASLFRIFSGGVHASSQKKCVVFGAVIFNLLGLIVNLFSNNISW
FT                   ELANWLVWITVGIALVSFILYAPADTPGKPITTKVQIKKLKSISMALLFIWFIFVHYVL
FT                   KGETNINKLYLLASTAGLAWQSVSLWPITYKLPIHK"
FT   gene            275185..276126
FT                   /locus_tag="Clos_0236"
FT   CDS_pept        275185..276126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0236"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   Motilin/ghrelin domain protein; KEGG: tte:TTE0562 sensory
FT                   transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17799"
FT                   /db_xref="GOA:A8MKY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY2"
FT                   /protein_id="ABW17799.1"
FT                   /translation="MFQLNTSNKAEAIKMIFLVQVFVIMGVIIYVSASQLDVVDEKLHP
FT                   VLGDTILMFLVILSGLVGIGSIFLFSELVKLIEKEQEYELKKLEVAQMEEANNLLRSQK
FT                   HDFSNNLQVIWGMLSLGDIDKTKEYINHYTNMLKIDEEDLQDISNINNEYLYTLFINKA
FT                   YKCKDMEIDIHYSIEPDLCFESYNPIDLIRIFGNLLDNAIYAVKGIEREDREILVDIYS
FT                   DENNYCFSISNKGPKIPDEIRRDIFKAGFTTKGEDGSGMGLYNVIKLANKYMGNVVLEN
FT                   NDYLGTQFVVQMPKLDPAKSSFRLGKKLSKAT"
FT   gene            276509..280027
FT                   /locus_tag="Clos_0237"
FT   CDS_pept        276509..280027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0237"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: amt:Amet_4657 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17800"
FT                   /db_xref="GOA:A8MKY3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY3"
FT                   /protein_id="ABW17800.1"
FT                   /translation="MARRMETLDGNSAAAHIAYAFTDVAAIYPITPSSNMAEEVDAMSA
FT                   TGKKNIFGQSVQVTEMQSEAGAAGAVHGSLSAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   LPGVFHVSARAIAGHALSIFGDHSDVMAARQTGCALLASGSVQEVMDLSAVSHLTAIKG
FT                   RVPFINFFDGFRTSHEIQKVEVIEYDELASLVDWEAVKAFRDRGLNPERPYQKGTAQNP
FT                   DIFFQAKEAANRYYEAIPDLVNDYMKEITKLTGRHYAPFNYYGAEDAENIIIAMGSVTE
FT                   TAEEVIDYLNARGEKVGIIKVHLYRPFSEKYFFDVLPKTAKRISVLDRTKEPGALGEPL
FT                   YQDIRTLFFDKENAPLIVGGRYGLGSKDTTPAQIKAVFTNLKAETPKNQFTLGIIDDVT
FT                   NTSLPVEENVVTAPEGAIRCKFWGLGSDGTVGANKSAIKIIGDHTDMYAQAYFDYDSKK
FT                   SGGITMSHLRFGKKPIKSTYLIDEADFIACHNQGYVYQYDLLKGLKKGGNFLLNCIWTP
FT                   EELEEKLPAKLKRFIADNDINFYTINATKIASELGLGGRINMIMQSAFFKLANIIPVEE
FT                   AMKYLKDSVDESYGLKGDKIVQMNYASIDRGVDALVKIDVPASWGSAVEEAAATVAKDE
FT                   PDFIKNILRPMAAQDGNSLPVSAFVGREDGSFPVGTSQYEKRGIAVNVPEWYSDKCIQC
FT                   NQCSFVCPHAAIRPFLLDEEEVKNAPEGFNTVKATGKEFDGLQYKIQVSPLDCTGCGNC
FT                   VDICPAKEKAIAMMPLEPQVAAQRENWEYATTITDKSHLTNKFTFKGSQFAQPLFEFSG
FT                   ACAGCGETPYVKLVTQLFGDRMIVANATGCSSIYGGSAPSMPYCQNKEGKGPAWANSLF
FT                   EDNAEYGYGMLLATKQMRRRLADLMTEALELDIAAELKDAFNAWLAGHDNAEASKKATY
FT                   DMLPLLDAAKGNAVIDEIIEKKDFLVKKSQWIFGGDGWAYDIGFGGLDHVIASGEDVNI
FT                   LVMDTEVYSNTGGQASKASPTAAIAKFASAGKRTKKKDLGMIAMSYGYVYVAQVSVGAD
FT                   KNQLMKAMKEAEAYNGPSLIIAYSPCIAHGIKAGMGKTQEQGKKAVEAGYWHLYRFNPE
FT                   LKEQGQNPFTLDSKEPTASFREFLLSEVRYNALTMTFPEVAEELFEKSEKEARERYESY
FT                   KRLAGK"
FT   gene            280402..281841
FT                   /locus_tag="Clos_0238"
FT   CDS_pept        280402..281841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0238"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   amt:Amet_4655 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17801"
FT                   /db_xref="GOA:A8MKY4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY4"
FT                   /protein_id="ABW17801.1"
FT                   /translation="MNLFQVFTTIYTIVNIIIAIDILLDNRDPSSTVAWIMVLFLVPGV
FT                   GIFLYFYIGRNHRKQKTFIKKRREDYEILNHLLSNQLGFIDYGEMFKRNFDDTRGKIIP
FT                   LLLNNTKAPITVNNKVKVLQNGESTFSEMIRAIENAKDHIHIEYFIIKDSHIGRMLQAT
FT                   LIKKAKEGVEVRLIYDAVGSFRLGKDFLNPLREAGVHLKVFLPVTLPFFGSRLNYRNHR
FT                   KILVVDGTIGFVGGLNIGDEYLGKNKKMGFWRDTHLMLQGEAVYVLQGIFLADWYFVSN
FT                   ENIDNLRYFPSQGYCGEKIVQIASSGPDSHWASIHQAYFSAINTARDRVYITTPYLVPD
FT                   EGILLALKTAALRGVDVRLLLPIKPDHRTVFLASKSHFEELLEAGVKIYQYGKGFVHGK
FT                   VFIVDHNFVSIGTANLDIRSFKLNFEVNAFIYDKEVNRKTAKDFFEDLRVSKRVYLEEY
FT                   VKRPVLHKIAESVARIFSPIL"
FT   gene            complement(281937..282311)
FT                   /locus_tag="Clos_0239"
FT   CDS_pept        complement(281937..282311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0239"
FT                   /product="Desulfoferrodoxin ferrous iron-binding region"
FT                   /note="PFAM: Desulfoferrodoxin ferrous iron-binding region;
FT                   KEGG: amt:Amet_4653 desulfoferrodoxin, ferrous iron-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17802"
FT                   /db_xref="GOA:A8MKY5"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY5"
FT                   /protein_id="ABW17802.1"
FT                   /translation="MKTLGQLLQTGDWKGEKHVPVIHAPEKVKAGEVFEIKVSVGDAIG
FT                   HPNTLEHYIAWFKVFFHADGGKFPVEIANFDFKAHGEDGNFTEPAGVARIKLDKSGTIH
FT                   AVSYCNIHGLWENSQEIVVE"
FT   gene            complement(282494..283120)
FT                   /locus_tag="Clos_0240"
FT   CDS_pept        complement(282494..283120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0240"
FT                   /product="putative proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /note="TIGRFAM: putative proton-coupled thiamine
FT                   transporter YuaJ; PFAM: thiamine transporter YuaJ; KEGG:
FT                   amt:Amet_4652 putative proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17803"
FT                   /db_xref="GOA:A8MKY6"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY6"
FT                   /protein_id="ABW17803.1"
FT                   /translation="MFQKFLEFKPITVIILATMVLLSIALIFRDRKQNKNSYYTKMIVY
FT                   GSLCIALSFVLSYIRLYRFPQGGSITPASMLPIYIFAIMFGPTAGILAGFAFGMIQLIQ
FT                   DPYIIHWAQFFLDYPLSFGALGLAGLYRKNLGISCLIGGFGRFVMNFLSGVIFFGSYAP
FT                   EGMNAFLYSLIVNGLVIGTDTLICVIVSFVPQIQNAVKEVQKISL"
FT   misc_binding    complement(283208..283301)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 53.25"
FT   gene            283530..285530
FT                   /locus_tag="Clos_0241"
FT   CDS_pept        283530..285530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0241"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   amt:Amet_2943 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17804"
FT                   /db_xref="GOA:A8MKY7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY7"
FT                   /protein_id="ABW17804.1"
FT                   /translation="MKSIRKRIIAIFGAAIIVLLSVLGVFIHGSVSDLTEVLINDLVVQ
FT                   ITDARSAEITKIIESSMNELRAIATQDVIRTGDMAIIKPYLDSREGTFSKNFSTMMFVD
FT                   LNGDFYATGGGQANIKGRADFEAIVRDGKDIYVSDPIIAKVSGKPIVNITTSVKNESNE
FT                   LVGVFAGVVGLNTIADASSEITIGGIGEGMIIDHTGLIIAHQDETMRLNSNLFDGMKKE
FT                   GKEFEALKEKIENNDNGAQVFVDNEGQYFIGIFSKIENTNGWHLFVKVPLQEIMKTSNA
FT                   SLKLILLFIGAIIAVTLLLFYIISGRISKPIVMLADYTKTIAELDAREDVPEKILKMND
FT                   EVGNLGQSIQEVVNSLRVFIEGVGDSAEKVLGSSEMLAIASKEAGLAAEEIARTVGQIA
FT                   EGATEQAKDTEQGVFMADELGRIIETDVSYTIELMEQAERVMKLQDDGTAVIDQLTEKT
FT                   RENIEAIESVYEGIVRTNESSVKINEASQVIKGIAEQTNLLALNAAIEAARAGESGRGF
FT                   AVVADEIRKLAEQSRASTNEIEEVVAELQQNSSITVDIIKNVAEITKEQEKSVEVTKNA
FT                   FDGISDAIVLTKEKITGINNSSKNMADKKDGIIGIIQELSAISEENAASTEQVSAATEE
FT                   QLATMEEISNASGNMEEIAEELKNIISMFKI"
FT   sig_peptide     283530..283628
FT                   /locus_tag="Clos_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.553 at
FT                   residue 33"
FT   gene            285714..286211
FT                   /locus_tag="Clos_0242"
FT   CDS_pept        285714..286211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0242"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   amt:Amet_4650 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17805"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY8"
FT                   /protein_id="ABW17805.1"
FT                   /translation="MSLYSQWTKIAFEHTEEKDAVEFWEKYCAVEKGIYEKVLEVPTTN
FT                   IKGQLSELAKEYGVDDVTFVGFIDGINTSLTSEIDLEKLAEDSNVELNIDLEKLYFNML
FT                   NANAEWLYTLPQWDAILTVEQRKEIKKSFNATKTVVNDEKIGRNDACPCGSGKKYKKCC
FT                   GK"
FT   gene            286291..286776
FT                   /locus_tag="Clos_0243"
FT   CDS_pept        286291..286776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0243"
FT                   /product="dUTPase"
FT                   /note="PFAM: dUTPase; KEGG: bha:BH3133 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17806"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="InterPro:IPR016947"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKY9"
FT                   /protein_id="ABW17806.1"
FT                   /translation="MNLTELYRIQSQLDERISREHGLEHKDLVPFKLLALQVELGELAN
FT                   ETRCFKFWSNKGPSSKDVILEEYVDCLHFILSIGLDLSLTHIQIERITNDATLAEEFQN
FT                   LFTYIASFKEEYTMDHYRRIWNHFLLLGRKLDFTEEEIFESYLEKNKVNHKRQDEGY"
FT   gene            complement(286792..288084)
FT                   /locus_tag="Clos_0244"
FT   CDS_pept        complement(286792..288084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0244"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; virulence factor MVIN
FT                   family protein; KEGG: pab:PAB1438 DNA damage-inducimle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17807"
FT                   /db_xref="GOA:A8MKZ0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ0"
FT                   /protein_id="ABW17807.1"
FT                   /translation="MFNNLIQTLYNLADTFWVSKLGTMPMAAMTLVSPVIFLTLSIGTG
FT                   INVAGTALISQYIGSNDEEKSIKVSTQMFTFSVILSIILGIIGYLLTPFIVTFMGGQDE
FT                   IFTYSSQYLTIMFWEIPGMFLFLVYTAIKQSQGDTFTPMVLNVLGVILNILLDPIFIFT
FT                   FNMGIKGAAIATVLSRMIFALYAIYTLFAHKDGIYLDRNNLKMEKDILKEIIAIGLPST
FT                   LGQSAASFGFVILNSFVISYGANTLAAFGIGNRINSLVLMPVMGIGSALATIVGQNLGA
FT                   DKKDRAKLAVQTALKLSTILMVIGGVIMVIVSSSIVSIFVKDDPDVLQQGTEYLRLVSI
FT                   SLPLMGFFQVFVGTFQGSGHTIYAMMMDMGRLWGLRIPMIILFKNFTQWGPNGVWYAML
FT                   LSNAITCVFGFIIFLSGKWQKQVIHKKKALA"
FT   gene            complement(288295..290247)
FT                   /locus_tag="Clos_0245"
FT   CDS_pept        complement(288295..290247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0245"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: amt:Amet_4646 nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17808"
FT                   /db_xref="GOA:A8MKZ1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ1"
FT                   /protein_id="ABW17808.1"
FT                   /translation="MKKIRTACSLDCWDACAIEITMEDHQVVKVQGDPNHPITKGFLCQ
FT                   KGMKHLERVLSEDRLTSPMKKENGTWIPIGWEMAIQEIGAKLKEIRDNFGSSSLLHYKD
FT                   SGHGGVVKSIDNAFFNSYGGATLPKGSLCWSAGIAAQKLDFGKPLSHNPDDYLNAKTIL
FT                   IWGRNPVDTNIHLVPYLKRAKENGANIVVIDPIKTATAYLGTHYYSIKPEADGFLAIAM
FT                   AKIILSEGDEDTTFIDDRSRGFQEYQQYIDTFSMDALVDKIGISLEEILELTALYKNKP
FT                   SAIILGYGLQRYYNGGKNIRFIDALAALTGNIGIAGGGVSYANKRVVEWIDDAYASNTL
FT                   AFEPPTFKRALFADYVLENAPNRIKGIFVTTSNPVVQLPDTTRTIEAFKAIPFKVTIDH
FT                   FMTDTAQLSDYVLPATHIYEEEDFIYSSMWQPYFRYTERVLPPRDGVKSEFEIFKLLAQ
FT                   EMGMTDFLQKYPDEKTYLNKSLAPLLEKLNLSLEEIQGKSLTIAEEDIPWKDKKFNTPS
FT                   GKFQFINPVEEDLEFISIQNHEYPLHLLSVHPKHSLHSQHFKDEDPNTLPKVYGSAKTF
FT                   QRYGVLEGQEITLSSKDGKIQALSIFSENIREDVLMIQEGWWLKNQGVNRMTSTGVSDI
FT                   GNQAVFNNCLCKIVK"
FT   gene            290586..291110
FT                   /locus_tag="Clos_0246"
FT   CDS_pept        290586..291110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0246"
FT                   /product="metallophosphoesterase, calcineurin superfamily"
FT                   /note="KEGG: amt:Amet_4641 metallophosphoesterase,
FT                   calcineurin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17809"
FT                   /db_xref="GOA:A8MKZ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ2"
FT                   /protein_id="ABW17809.1"
FT                   /translation="MHISDTTEGIYKYIDKVIQEINPQYIVHTGDIVDNIKLETNADYL
FT                   YLHQKGLSQFQDVIKKYRGNIYYALGNHDDRESVKNILNGGIIVGKELITIEGKVFSMS
FT                   HKYEMLQKKADYYLYGHSFDPCSYEKNGEIFLNGLMKINIIVLSTGRIYELGYPVGVNY
FT                   ERKMEKRSVGL"
FT   gene            291135..292136
FT                   /locus_tag="Clos_0247"
FT   CDS_pept        291135..292136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17810"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ3"
FT                   /protein_id="ABW17810.1"
FT                   /translation="MIFLRMGARLLFLRTEKIEELKDFIVENLDGKIEEFERAIDESTE
FT                   DYTIAFITDTAPEKTDVDDAKYIILIKEASTIILSALLSSHLSGLIHRADLGPACLIMR
FT                   IAGEEEKVIEKMKKFYGGETTTWRDGIRKGERMDTLVALTTKPIGERVIGEDFGEGILL
FT                   LSTPVNQVQKRLRADGIVFITQSMEDGQWYELRINIYDSRGNYTAHYRRLMIVLSYLEL
FT                   GLVLGEQWTRDHALMLYSVLAYQIRLFTLMHPRKIKEILVGLEYSENGDRLVDFDLYYR
FT                   NKKVSWLDVDIHEKKRNKVEEGKLFRKNLFSKLPNTVIEQLLEIETEVKEAK"
FT   gene            292253..293083
FT                   /locus_tag="Clos_0248"
FT   CDS_pept        292253..293083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0248"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: amt:Amet_4639
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17811"
FT                   /db_xref="GOA:A8MKZ4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ4"
FT                   /protein_id="ABW17811.1"
FT                   /translation="MTFINLVENRKSVREYQKKLLGAKEMKALEKALEEIDVLIKNVHV
FT                   DFAFIEDGWGKEEILRGRAGYVGNPVLAPHYIALISEEKEGYLLNSSYILEQIVLKAVE
FT                   LDIASCWISVENDAAGLKRDLGIDKPGEIVAMIALGYPKTHIPYTKKSGSSRIGVEDFV
FT                   FKGDWGNVPTHEELEQMGIEQALHSIRFAPSWANLQPWKLIIDKDQIILAVGGKEVSKK
FT                   HLMLDAGIMMLYMKKAFSSVGITADWSIYKEELDGSLSEYHIPSEYTAVGILHI"
FT   gene            293143..294000
FT                   /locus_tag="Clos_0249"
FT   CDS_pept        293143..294000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0249"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: cdf:CD0720 FolD bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17812"
FT                   /db_xref="GOA:A8MKZ5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MKZ5"
FT                   /protein_id="ABW17812.1"
FT                   /translation="MSNVLKGKPVADKISEGLIQEVEVLKEKGITPKLAILRVGARGDD
FT                   LAYEKGALSRCAKIGIDTEVKEFPEDITQEDFIEALRKTNGDPSIHGILIFRPLPKQLN
FT                   EDVIKYEIAAEKDIDCLSPINAAKLLEGDDTGFPPCTPMAVIEILKHYEVQMEGKKAVV
FT                   LGRSMVVGKPAALLLLKENATVTICHSRTKELSSVTKEGDILVAAIGKDRFVKEDFIKE
FT                   GAVVIDVGINVDAEGNMYGDVDFEGCKEKAGMITPVPAGVGSVTTSILAKHVLKACRLQ
FT                   HNIY"
FT   gene            complement(294092..296083)
FT                   /locus_tag="Clos_0250"
FT   CDS_pept        complement(294092..296083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0250"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   amt:Amet_4638 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17813"
FT                   /db_xref="GOA:A8MKZ6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ6"
FT                   /protein_id="ABW17813.1"
FT                   /translation="MKMSLRTKILTLLLIITLVQASAIGFLNFRTSSDILERELINSTT
FT                   NVVRRTSDTFNTFLTLTEEIAVLLSKDANVQQFHTLEDSKTWMVDSFKAIKDSHKNVQS
FT                   VYLGTRDKQTIIYPQADLPSDFDPQTRDWYKGAFSNNGIYWTKPYTDQATGDTTITVSI
FT                   PVYNERNNNEFVGIVGVDIYLNNLSAILKDLTVGKKGYLSLTDRDGIFITHSDASLVGS
FT                   PVPAPELMNTILKNDPNDNMVSYTYDETDRVAILDTLDKTNWKIIGTIMADEITEETSA
FT                   ILKQTVVTSLISVGIAAVVGFIFSQTITKSTGKLVNAMTQIGSGDFTILSRIESKDEMG
FT                   TLSATINQTIGNIRDVLLNVQKTSIEMNLAADSLAASSEETSASAEEVTRTVEEIAKGA
FT                   SDQARDAEQGAAAVNELSHKFDELNVEAMEMLTLSEYVVDANKNGIESVHHLTEKTDSN
FT                   KISLVRIDEAVKDLNEQTQSIGVILETIRSIADQTNLLALNAAIEAARAGDAGRGFAVV
FT                   ADEIRKLAEQSSLSTDEIRNITMEIAEKSDNVVSAMVEVRAHTDAQVSAVEDVSTSFDN
FT                   ISNSIEKITSRIHSLTGHVNEMTESSRTIVSFIENISAVSEETAAASEEVNASMEQTAS
FT                   AVQEVAQAANHLNDLAVSLRTQVELFKI"
FT   sig_peptide     complement(296012..296083)
FT                   /locus_tag="Clos_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.565 at
FT                   residue 24"
FT   gene            296309..297628
FT                   /locus_tag="Clos_0251"
FT   CDS_pept        296309..297628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17814"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ7"
FT                   /protein_id="ABW17814.1"
FT                   /translation="MKKMMSLYVMLICILINSIGCGNARNKEENTELNQKEVLIPVNSV
FT                   QGFTSMNGFKAEDGKFYFTGIQNNRWGFYELDLNTHAIKEVYGKIGEYDVFIPIEKYGA
FT                   IYVDVDGNLYIRQDGKDRKIDEEIYGTYSPNLLVSPDGKGILYTKGKQENASLYRYLIG
FT                   EASPIRIKEKISPDAFFTFSYTTHWSNQSHYFIFNNKEIYDEAGKLYATINGTAAKWAP
FT                   NDGRVAFIKEPKDLEKNQIFVGDWKSYIGTQFYLFDLKQKKEEVVYENQNGIIDAIDNI
FT                   QWAKDGSLVGLSVGEIQRTSNGALESIDYEKVFVHRIKDGWGKEIHKVPYNFYEILFDT
FT                   HIYGSSIGKRDQVEIVEISSDARKVFDQPVILNARDMFIISSKDRGYLANGRALIEIDK
FT                   EGRERKILELPWDINEMYLDHDSKKIIITNKEYLLFVINL"
FT   sig_peptide     296309..296389
FT                   /locus_tag="Clos_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.632 at
FT                   residue 27"
FT   gene            297830..299146
FT                   /locus_tag="Clos_0252"
FT   CDS_pept        297830..299146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0252"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   amt:Amet_4636 glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17815"
FT                   /db_xref="GOA:A8MKZ8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ8"
FT                   /protein_id="ABW17815.1"
FT                   /translation="MNCENNIESFTSIMKRGEKSPSQFKIGVEFEHIVVDKETLESVAY
FT                   YGEDGIEGILKKLLVKGYEGKYEENYLVGLVKEDREITLEPGGQFEVSFRPYKTIGELK
FT                   ERYFDFLNEIIPILDEKNLLLMAIGYHPKTSIAQLPFNPKKRYAYMSQYFEKTGKYAHN
FT                   MMKGTAALQVSSDFTNEEDFMRKFRVANFISPLLYLISDNSPIFEGQIYYKFGLRSLIW
FT                   ENTDQQRSGNVPNALNETFRYKDYANYILNTPPILMMKDGAFIGTGDRTVKELMKAYVF
FT                   SEDEIEHLMTMVFPDIRVKNYIEIRVGDSMPYPYNFSYITLIKGIFYNEVALEYLYKLS
FT                   QRLGDEHMARAKEMVREKGFDSKLGSKPTYDFIRIMFDLAKKGLSVEEKDMLAPLENLL
FT                   ITKNNLSTISKEKVRNEGIGALRWCSLNQWVKGEGHEYN"
FT   gene            299133..300464
FT                   /locus_tag="Clos_0253"
FT   CDS_pept        299133..300464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4635 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17816"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="UniProtKB/TrEMBL:A8MKZ9"
FT                   /protein_id="ABW17816.1"
FT                   /translation="MNTTKELYDVYEDIVRKNEGVFLQDHRAILKKVEESPAKYKGSPV
FT                   EFLYQPMLLSDEDFKRFQDLTDMLLVILNKVIQQYLEEPTFRSYFGFSPLLEKLILKDP
FT                   GYKINIPMGRFDIFYHLDGTFQFCELNADGSSGMVEARELQKIIGESFAVTELKKKYSL
FT                   KDFEVFNSWAEALLANYREFSKTEEKPQIAIIDWFDGQPPSEFMEFQKTFEAFGCKTII
FT                   TSPSELTYRDQKLYHGDFRIDCIYRRAVTWEIIEHQDQVQDFINAYLDGNVCVVGPLRS
FT                   QVIHNKIVFAILHDEEKTAFLNKEERAFVKKHIPYTREFYAADKELVNFAIENKDTLVL
FT                   KPMDRYASKGVCIGADFTKEEWAQIIENIAEEEYILQELCKIPRLPMAMVKENKVDFIE
FT                   NNYLIGLFMYNEKLQGLYTRTGTKNIIGSIVECYTAPNFVVSER"
FT   gene            complement(300534..301157)
FT                   /locus_tag="Clos_0254"
FT   CDS_pept        complement(300534..301157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0254"
FT                   /product="sporulation protein YtaF"
FT                   /note="KEGG: amt:Amet_4321 sporulation protein YtaF"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17817"
FT                   /db_xref="GOA:A8ML00"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML00"
FT                   /protein_id="ABW17817.1"
FT                   /translation="MTEIILITLAICIDSFVLGITYGIKKIRISKMAVFIINLVNIVVL
FT                   GVSIYFASVMRQYISQHTSSLISCLILVGLGIFFMLEGFIKYKIETTNDCRLAKFYIPK
FT                   LGIIIDIALDYTKADLDFSGNLDLKGALYLGFVLSIDALGIGFGLSLGGINYLYFLPLV
FT                   LFSNIISILYGQYLGTKITHYNSSLKTSLLPGSILIFSGLLKWL"
FT   gene            complement(301389..302321)
FT                   /locus_tag="Clos_0255"
FT   CDS_pept        complement(301389..302321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0255"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: oih:OB0443
FT                   hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17818"
FT                   /db_xref="GOA:A8ML01"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML01"
FT                   /protein_id="ABW17818.1"
FT                   /translation="MNLIPFIVLIVSFLAIIKSADWLIDASSALALYLGISPLIVGLTV
FT                   VAFGTSAPEASVNIIASFQKKSEIVIGNITGSNIINIGIVIGITSLIYTIKADWSVIRV
FT                   DIPFAFISSAAFILLVVDGLSNKDGLILAILLFIYLNYLWLTSKSSRKKGNDLNRQSMD
FT                   LIHILFYLVLGIIGLVISGYYIVDASVKIATLLGFSQAFIGLTVVAFGTSLPELITCLV
FT                   ACHKKNDDIAVGNIIGSNIFNILFVLSVSSLISPIAFSSHLIIDLAFMLLFTFLLFIFS
FT                   YTHKKISRLEGFVLMMLYLFYFVFIYLRR"
FT   gene            302667..303869
FT                   /locus_tag="Clos_0256"
FT   CDS_pept        302667..303869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0256"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   amt:Amet_4632 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17819"
FT                   /db_xref="GOA:A8ML02"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML02"
FT                   /protein_id="ABW17819.1"
FT                   /translation="MKIKLDRQYFKYSFYGFLTIGLSILFYLTLINLGNFSQWVYVQSS
FT                   RIGKVLNSVIIGISIAYILNPGVRWFETNVYNKSKKIKSIKKLPRALSIISVYLFLFSL
FT                   IAMVIIFVVPQIGGNIIEISRRVPEYLNATIDFADELIEKWAKDLPSTSNLNNVGEYIE
FT                   ANINTIFSNTKLVLDYIFNNLIMRVMNITSGILNFVMGIIISFYLLGDKESFKKGTERI
FT                   LRAVFSKKTVDRVVDLGREADTIFGKFVVGKFIDSFIIGVLCFIGLTILKIKYGLLISV
FT                   IIGITNMIPYFGPFIGAVPAVLITLFDSPINAIWVMIFIFILQQFDGLYLGPKILGDSV
FT                   GISPFWIIFSIVLGGGLYGVLGMFLGVPVVAIITTFSNRLIDWQLERKEEKEHQENIQM
FT                   K"
FT   gene            304213..304953
FT                   /locus_tag="Clos_0257"
FT   CDS_pept        304213..304953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0257"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: amt:Amet_4631 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17820"
FT                   /db_xref="GOA:A8ML03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML03"
FT                   /protein_id="ABW17820.1"
FT                   /translation="MRLDGKVAVVTGSTSGIGKATIVRFAEEGAKVVVWGITEAEVNPV
FT                   VAELEEKGAEVLGVVANVTDYEEVNRTMDQIKEHFGKIDIIVNNAGITADAQILKMTEE
FT                   QFDKVISVNLKGVFNTGQAAAKIMAEQGFGVILSTSSVVGLYGNFGQTNYAATKFAVIG
FT                   MTKTWAKELGRKGVRANAVAPGFIATEMTAKMPENVLTMMKEKSPLKALGEPRDIANAF
FT                   LFLASDEAKYISGAVLSVDGAVTL"
FT   gene            305004..306182
FT                   /locus_tag="Clos_0258"
FT   CDS_pept        305004..306182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0258"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: amt:Amet_4630 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17821"
FT                   /db_xref="GOA:A8ML04"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML04"
FT                   /protein_id="ABW17821.1"
FT                   /translation="MREVVIVGAARTPIGSFGGALKDVSAADLGAIAIKGALDRAGVSP
FT                   DMVDEVFMGCVLQGGLGQNVARQSAIKAGIPNEVSSMTLNKVCGSGLRAVSLGAQTIIA
FT                   GDNDIVVVGGTENMSQAPYVLKDMRWGARMGDAKTIDTLTNDALTCAFNNYHMGMTAEN
FT                   LAEKYSISREEQDLFAVGSQNKAEAAQKAGLFDAEIVPVTVQTRKGDIVVDKDEYIKYG
FT                   TTIESVSKLRPAFKKDGTVTAANASGINDGAAALIIMSKEKADELGIKPLAKIVAYASG
FT                   GVDPAIMGYGPVASTEKVFKKSGWAVEDLELIEANEAFAVQALSVAQGLNFNKDIVNVK
FT                   GGAIALGHPVGASGARILVTLLYGMEQRDAKKGLATLCIGGGMGTSLLVERI"
FT   gene            complement(306314..307177)
FT                   /locus_tag="Clos_0259"
FT   CDS_pept        complement(306314..307177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0259"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: amt:Amet_4626 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17822"
FT                   /db_xref="GOA:A8ML05"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML05"
FT                   /protein_id="ABW17822.1"
FT                   /translation="MTDRNKGILYMLSSSLFFALMAAAVKFSGDIPTMEKVFFRNIIGF
FT                   LFSGYRIFKMGESFKGNNTRYLSYRGILGFLGVLLYFYAIDHLPLADAVVLNQLNPFFV
FT                   ILLAALFLGEKIKKLQIPAIVSALMGVLFIAQPQFDYAFLPAALGIASSIFAASAYTMI
FT                   RHLRLTDTPNLIVFYFTGISTIITIPFITVGDFIIPNTITFLSLLSVGIFSTAAQYLMT
FT                   IAYRYAEAGDLSIYSYGNTVFSILIGILLWGEVPNLMSSIGVIFVLGGAYINYIARRGI
FT                   SDGATS"
FT   sig_peptide     complement(307109..307177)
FT                   /locus_tag="Clos_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.589 at
FT                   residue 23"
FT   gene            307418..308578
FT                   /locus_tag="Clos_0260"
FT   CDS_pept        307418..308578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0260"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Glycosyltransferase 28 domain;
FT                   Monogalactosyldiacylglycerol synthase; KEGG: csc:Csac_2337
FT                   monogalactosyldiacylglycerol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17823"
FT                   /db_xref="GOA:A8ML06"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML06"
FT                   /protein_id="ABW17823.1"
FT                   /translation="MKRDRYKVMIMTASVGLGHDQAANAIKKNLLNKYHNVDIEIVDFI
FT                   EIFPSYLGGIIKSTYLKMIDIVPSWYNILYQGTTNLNRSSKVTSIFAYKYIKKIREVIE
FT                   ASNPDMILFTNPFPSTLVSHLKRKNKINIETATVITDYTVHGVWIDPTIDHYFVGSNIL
FT                   KQEMISKGVEGSKIHATGIPIDTKFSAPVDRESVLSDLGLHKDLPTVLIMGGGLGLGSM
FT                   EEILETTDSVDRMLQIIIVAGKNQVLMNSLENRPYNTKHHVKVLGFCENIHELMDVSHL
FT                   LISKAGGLTMTEAISKELPVLVFDPIPGQEVKNAQYFSDIGAAMYLKDLKELRNSIEEL
FT                   LFINPEKREKMVKCCATIKKLDGAEDISKIIVENMSQMYYRDLFFL"
FT   sig_peptide     307418..307486
FT                   /locus_tag="Clos_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.582 at
FT                   residue 23"
FT   gene            308694..309632
FT                   /locus_tag="Clos_0261"
FT   CDS_pept        308694..309632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0261"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: cbo:CBO1522 C4-dicarboxylate/malic
FT                   acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17824"
FT                   /db_xref="GOA:A8ML07"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML07"
FT                   /protein_id="ABW17824.1"
FT                   /translation="MGSKVIKKISIPIGGLMLGLAALGNLVQSYGELYRNIFGIIAAII
FT                   FVLIAVKTITDFNSIKESLNNPVVASVAPTISMGIMILSTYVKPYFPAVAYGVWIAGLA
FT                   LHGLLIIYFTGKYILNFNIQKVFPSYFIVYVGIVVGSVTGPAFNQIQLGRGLFWFGLVS
FT                   YLVLLPIVIYRVVQVKNIPEPAMPTIAIFAAPASLCLAGYMNSFENKNTTMIAFLAGLS
FT                   ILMLVYALLNMPKLLKLPFYPSYSAYTFPFVISGIALKLTNGFLVKSGSPIAWLKYLVK
FT                   FEEAVALILVVYVLIKYVIFLMDSPKEVAKA"
FT   sig_peptide     308694..308783
FT                   /locus_tag="Clos_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.521 at
FT                   residue 30"
FT   gene            complement(309749..310219)
FT                   /locus_tag="Clos_0262"
FT   CDS_pept        complement(309749..310219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0262"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: ctc:CTC02474 carbon monoxide dehydrogenase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17825"
FT                   /db_xref="GOA:A8ML08"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML08"
FT                   /protein_id="ABW17825.1"
FT                   /translation="MMKVLCPTVFTLNINGEDRRVSVKPSDTLLHTLRQELGLTGAKPG
FT                   CENGDCGACTVLVDHLPIKSCLMLTVEAVDKKILTVEGLQNAPIQKAFVENFGFQCGYC
FT                   TSGFLMVCHSLAHMHPNASDATIEAWLQSNICRCTSYEEIEAAIKSILNINE"
FT   gene            complement(310216..311055)
FT                   /locus_tag="Clos_0263"
FT   CDS_pept        complement(310216..311055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0263"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   ctc:CTC02475 putative carbon-monoxide dehydrogenase, middle
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17826"
FT                   /db_xref="GOA:A8ML09"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML09"
FT                   /protein_id="ABW17826.1"
FT                   /translation="MIPFDFKYYRPETLEEAIELYREVKKQGAKPMYYGGGTEFISMAR
FT                   MHNVYSDAIIDIKGIPECNVHEIRDDRLYLGAALTLTQIAELNFFPLLSLTIERIADHT
FT                   IQGKITLGGNLAGTIIYREAILPLLVAESNVVLAGYSGIHTVPLKDVFQEKLLLSEGDM
FT                   ILQVIVGKEFLSLPYFHVKRTKYEKIDYPLITASALQKNKNIQIAFSGLCDSPFRSILV
FT                   EEILNNGDYSFQEKIRRVLENIPAPILEDVSGSSEYRKFVVQQILQDVLKRFEVSHP"
FT   gene            complement(311042..313378)
FT                   /locus_tag="Clos_0264"
FT   CDS_pept        complement(311042..313378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0264"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: ctc:CTC02477 putative
FT                   carbon-monoxide dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17827"
FT                   /db_xref="GOA:A8ML10"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML10"
FT                   /protein_id="ABW17827.1"
FT                   /translation="MDTIGVHISRKEAWNKVTGAAKYNGDTPVAGILYAKVLTSPYAHA
FT                   LIKKIHIAPAMKAAGVKAVITGDYMPTLSGPILKDRPPIARNRVRYWGEPVALVVASSE
FT                   AEAMSALQLIKIDYEPLPIVRTIKDAVQPDAVLLHENLGSYSCAVQDVYPIPGTNISTH
FT                   EKIRKGNMNLGWQQSDVIVASSFSMPSSDHIALETRNAQAQILPNGNVIIDTSSQMPFT
FT                   IKEDLSQLFSIPEGNIIVRVPLVGGAFGGKSSLNLEILAYLASLAVGGKLVRIANTREE
FT                   DIGTSPAKISVEAQIKIGATKEGYIQALECTYYVDCGAYTDSGPRMAKAISADCSGPYR
FT                   IENLWCDAFSVYTNKTYVTAYRGFGHCASTFCMERILDQLSARLKMDPMELRMKNLIQP
FT                   GDLSPTQTTMTLSNMGNLSQCLEKLKLTMDWKKGSRIVKKNGMVISKGISCFWKTSSSP
FT                   TNAISGVVLSLHSDGTVQLNFGAVEIGPGMKTTIAQIVAHKLRMNINKVYVTMEVNTQF
FT                   SPKHWKTVASMTTFMAGNAALKAAEDLKKKLCTIGAAILQCAPEDLDIGNEQVYVTSNP
FT                   SISIEFKDLAQGYQYANGNAIGGQIIAYGSYTMKHLTPLHQETGEGRSGLSWTVGAQAV
FT                   ELEYDPKNYTYRILRAATVIDAGTVINPKAAKGVLMGGMSMGLGLGTREEFIYDLHNVL
FT                   ENTSLRTYKLIRLGEQPEYSVDFVETPQQDAPLGAKGLGEHGILGIPSAFANALSLAAE
FT                   ADFNKIPISPEDIWKIKTGGHYDTL"
FT   gene            313587..315704
FT                   /locus_tag="Clos_0265"
FT   CDS_pept        313587..315704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0265"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   tte:TTE2231 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17828"
FT                   /db_xref="GOA:A8ML11"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML11"
FT                   /protein_id="ABW17828.1"
FT                   /translation="MGFRHKILTKILWIFLSIQFVSLIALITYQSIQSKQLIERFSKQS
FT                   ESLLVTQIERSAEILFSTVEKSILAVSREESVTDILVDKKYEEQIIKDFKKYGEANGSI
FT                   RALMLGTHNDQFYRYPFNDKKLANYQPTEEIWYKKAMENKGRVIYTSPFKDEITGETVI
FT                   AIAKTVNKDGNVNGVIGATLSIDLFQQILQDITIGQSGYAFAVNQEGTITAHKDSEMIA
FT                   QSILQSDLYTKMVSADEGSVYYAEKGNQQFVEYVTNERTGWRFAVTMGYYEIQNQIWTS
FT                   ILRNLVIFVVALILCTVSSLWIVKGIVSPILQVVKAMKKVEQGDLAVGLDIHTQDEIGQ
FT                   LVQGFNHMVIQIKNLVLEISLACRTLLDVSGQFSMVCENNVASVQQINTSIEDMWVGLE
FT                   NQAQQGENVLNRMEAFTKCIESVVNNIHIINRETSFNKKISEEGMKSVEALNKASKLNL
FT                   DNVEHMLIETQGLHEKSRMIITIIDHIEKIAKQTNLISLNASIEAARAGEHGRGFAVVA
FT                   SEIHNLAEENGQLVKKTRTYLSNMLTQVDKTVETMEGMKLTSHSEYESMLKAKEVFMEI
FT                   DRRTNQIFLEMDNLNQSVLLMKGHNKEVLSEVRNIAEATDNFAHASKGIYQSVGVQTAG
FT                   IEQLFVAGEDITQMTRLLEEKISRFYLEEEELVEDIAIDEEIEEVTEKEEVEEAVPERE
FT                   VVEGILIEEAS"
FT   gene            315870..316721
FT                   /locus_tag="Clos_0266"
FT   CDS_pept        315870..316721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0266"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   drm:Dred_2106 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17829"
FT                   /db_xref="GOA:A8ML12"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML12"
FT                   /protein_id="ABW17829.1"
FT                   /translation="MKKVMSVILVIMAMAVIFVGCSSKSSDIGTKTSGETPTETKLQGT
FT                   VSIIGSTSVQPIAQTLADEFSSIETGIKVDIQGVGSTAGVKAANDGTANIGTASRELKT
FT                   EEKEWGLTEHVIALDGIAIAIHPENTITDLTKEQAAQIFKGEITNWKEVGGADAEIIVV
FT                   SREDGSGTRGAFEEILKMEGELSEKALIAEGNGAVKQNIATKTNAIGYVSLGYLDNSIK
FT                   ALKIDGVEATVANIQSNQYTVSRPFLMLTKGEPTPETKAFLNFIMSSEGQKIVAEDYIP
FT                   VK"
FT   sig_peptide     315870..315941
FT                   /locus_tag="Clos_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.348 at
FT                   residue 24"
FT   gene            316840..317775
FT                   /locus_tag="Clos_0267"
FT   CDS_pept        316840..317775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0267"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: csc:Csac_1611
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17830"
FT                   /db_xref="GOA:A8ML13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML13"
FT                   /protein_id="ABW17830.1"
FT                   /translation="MKDSSNALMMKKEKLNIQNVDHQLKRNKTKDLGEQVIETFFFVCA
FT                   LVAVLSVVIITVYIFVKGVPAISEIGLRNFTLGQKWKPLQGVFGIFPMIIGSIYATLGA
FT                   IVMGVPIGVLTAVFLAEVAPGWLVKIVKPAVELLAGIPSVVYGFFGLVVIVPLISKHFG
FT                   GPGNSLLAVNVMLGIMILPTIVNISENAIRSVPKEYKEASLALGASQIQTIFKVILPAA
FT                   RSGILTSVVLGIGRAIGETMAVILVAGNTPAIPKALTEPMRTLTANIAMEMSYAQGLHQ
FT                   EALFGTGVILFIFIMILNIALNIFTNKAGE"
FT   gene            317777..318598
FT                   /locus_tag="Clos_0268"
FT   CDS_pept        317777..318598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0268"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: vpa:VPA1459
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17831"
FT                   /db_xref="GOA:A8ML14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML14"
FT                   /protein_id="ABW17831.1"
FT                   /translation="MISRQKQDALIKSFIWISAFITVGVLAWILIYIISNGISEISWDF
FT                   LTNDAKGKNAGIFPMILNTLYLILLSLAISTPIGVCSAIYLVEYAKAGKIVRVIRFATE
FT                   SLAAIPSIIYGLFGMIFFVIALKLNFSIVSGAITLSMMVLPTIIRTTEEALKSVPNSYR
FT                   EGSLALGASKLKTILSIILPSAMPGIITAVILSIGRVVGETAAVYLTAGMVPRVAGSIM
FT                   ESGRTLSVHLYILAKEGISFQQADATAFVLILIVSIINFIANKIASRLKRI"
FT   gene            318648..319400
FT                   /locus_tag="Clos_0269"
FT   CDS_pept        318648..319400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0269"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: amt:Amet_4621 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17832"
FT                   /db_xref="GOA:A8ML15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML15"
FT                   /protein_id="ABW17832.1"
FT                   /translation="MSKIVVEDLDLYYGAFQALQDISLNIEEKKVTALIGPSGCGKSTF
FT                   LRTLNRMNDLIDNVRIEGKLELDGKDIYSKDLDVVALRRRVGMVFQKPNPFPKSIYENV
FT                   VYGPRSYGVKSKIELDSIVEKSLKKAALWDEVKDRLNKSALGLSGGQQQRLCIARALAM
FT                   EPEILLMDEPTSALDPIATAKIEELVSEIKKEYTIVIVTHSMQQAARISDFTAFFLMGQ
FT                   LIEVGKTKEIFTMPRDKRTEDYITGRFG"
FT   gene            319412..320062
FT                   /locus_tag="Clos_0270"
FT   CDS_pept        319412..320062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0270"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   amt:Amet_4620 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17833"
FT                   /db_xref="GOA:A8ML16"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML16"
FT                   /protein_id="ABW17833.1"
FT                   /translation="MREKFTNQLRELNLKMLKMGAMVEHIIDLSIEALVKRDLELAGKI
FT                   NKLDDEIDELELEIEIECMQILALQQPMAKDLRVIGTILKIITDLERMGDHAVNIAKTT
FT                   IKIGNAPLIKPLIDIPRMSKLSQDMVSKSLDAFMKEDIELSRAIAAEDELVDKIYEDIY
FT                   MELIGMMIEKPEIIEQATHLLFIGRFLERIADHATNIGERVIYMVTGERVEIN"
FT   gene            320233..320823
FT                   /locus_tag="Clos_0271"
FT   CDS_pept        320233..320823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC3379 uncharacterized protein, YQFW
FT                   B.subtilis homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17834"
FT                   /db_xref="GOA:A8ML17"
FT                   /db_xref="InterPro:IPR009206"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML17"
FT                   /protein_id="ABW17834.1"
FT                   /translation="MKLNLCIDIDGTITDAYYWLERANQYFGKNLKPKDVTTYDIHEVL
FT                   RIPREEYDKFYELYSKEIHLEAEVRENAQNALVSLNSKNNIFYVTARSQRMKSITEEWF
FT                   HKNNLPKGKLYLLGSHYKVDQAKELSCHIFIEDRYENALEIAAAGFKVLLMDCYYNRKE
FT                   LMPGITRVFNWVEVYNEIEKYREEIIKGTIKIA"
FT   gene            complement(320882..321079)
FT                   /locus_tag="Clos_0272"
FT   CDS_pept        complement(320882..321079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0272"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cbo:CBO1403 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17835"
FT                   /db_xref="GOA:A8ML18"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML18"
FT                   /protein_id="ABW17835.1"
FT                   /translation="MLNGLKVRELRNIKGYTTLDISNLTHISKSYIEELERGAKKNPSL
FT                   NKVVVLAKVLGVKVDELILN"
FT   gene            321364..322722
FT                   /locus_tag="Clos_0273"
FT   CDS_pept        321364..322722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0273"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   amt:Amet_4619 FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17836"
FT                   /db_xref="GOA:A8ML19"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML19"
FT                   /protein_id="ABW17836.1"
FT                   /translation="MDKQQKAALIIMPIVAIGILAGGMFMSNKGATASAATYTDGVYEG
FT                   VGEGFAGPIKVKVEVAGGKIASIDLLEHSETPGIGDVGAQNVIDSIIAEQKADVDVSSG
FT                   ATFSSNGVMEAVKNALSAAGGTQSFTDGEFEGTGEGFGGPIKVKVVVSGGKITGIELLE
FT                   NSETPGLGDVGAQNVIDSIIAEQKTDVDVSSGATFSSNGVMEAVKNALAGGTAGAKEEP
FT                   AEEAVEEVEFIDGVYEGAAEGFHGDIKVKVEVKDGKLVSIEVLEHGETEGLGDVALTEL
FT                   SNAMIEKQTVAVDGKTGATYSSKGIQAAVINALKSEAMATAEATDKKAEEVKVEDKKEE
FT                   AKEEPKKEEPKKEEAKPAEPAKADGFKDGTYVGKAEGFYGNIEMKVTIAGGKISDVTIN
FT                   KMDETEGIGDVAVKKIAENAKAKNTGNLDTISGATVSSTGAITAIKNALSQAK"
FT   sig_peptide     321364..321465
FT                   /locus_tag="Clos_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.468 at
FT                   residue 34"
FT   misc_binding    322806..322996
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 89.37"
FT   gene            complement(323124..324554)
FT                   /locus_tag="Clos_0274"
FT   CDS_pept        complement(323124..324554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0274"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: amt:Amet_4617
FT                   Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17837"
FT                   /db_xref="GOA:A8ML20"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML20"
FT                   /protein_id="ABW17837.1"
FT                   /translation="METKKQATLLHALIPIVVLVASLFVAITKFEADPHIPIIVAIAVA
FT                   SLVAIISLGYKWDEIETGAIETIQMSMQAILILMVIGSVIGTWILSGTVPTMIYYGLKV
FT                   LSPGIFLVATTLICSIVALATGSSWTTAGTVGVALIGVGQGLGIPSAIVAGAIVSGAYF
FT                   GDKMSPLSDTTNLAPAMAGTTLFEHIRHMFYTTVPSLLISLVLYGIIGAKYAGATLDTA
FT                   NIDIILEGISANFNVSPLLLLPPVIVIILVVLKVPALPGLLAGTALGGIFAMIFQGSGL
FT                   GDVINAAHYGFEIESGVEMVDELLNRGGLDSMMWTVSLILLAMVFGGIMERTGMLGSIG
FT                   NAILKFANNTGSLILATILTSLAVNILAADQYLSIVIPGRMYKDVYRDRGIHPKVLSRT
FT                   LEDAGTLTSALIPWNTCGAFMQSALLVSPLAFAPYAFLNWINPLVAILYGYIGFSITKI
FT                   DKDGNELDKNGKVVVTSK"
FT   gene            324971..325483
FT                   /locus_tag="Clos_0275"
FT   CDS_pept        324971..325483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0275"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: amt:Amet_3094 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17838"
FT                   /db_xref="GOA:A8ML21"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML21"
FT                   /protein_id="ABW17838.1"
FT                   /translation="MSCCEGKSRKLAMEISAQDEDKLKSILSKYEGKKGSLISILQDVQ
FT                   EYYNYLPMDALNYISVETGIKPAKIHGVATFYTQFRLKPVGEKLIMLCQGTACHVNGSK
FT                   AVEEAIKEELHIQDGETTEDNLFTLINVACLGCCSLSPVMMINDDTYGNLTPEKVKSII
FT                   REIKSAQ"
FT   gene            325504..327252
FT                   /locus_tag="Clos_0276"
FT   CDS_pept        325504..327252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0276"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; KEGG: csc:Csac_0620 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17839"
FT                   /db_xref="GOA:A8ML22"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML22"
FT                   /protein_id="ABW17839.1"
FT                   /translation="MKIIVGQGSCGIAAGANKVYSVLKEQIEHRNLDIELKSTGCIGMC
FT                   YLEPIVDLIDENGHKETFVKVDGDMANAIVAAIAERQGNSSTIEEVDREILSKQKRVAL
FT                   KNCGIIDPENIDEYIATGGYEAMKKCLETMTPEDVIEEIKISGLKGRGGAGFPTWFKWN
FT                   AAKQSPGSVKYVVCNADEGDPGAFMDRSVLEGDPHNLIEGMIINGYAIGANEGIIYVRA
FT                   EYPLAINRLNHAIEEARSRGYLGKNILGLDKFDFDLRIKAGAGAFVCGEETALIESLQG
FT                   ERGMPRLKPPFPAQRGYWDKPTNINNVETFANVAWIINNGGAAFGHMGTENSKGTKVFA
FT                   LTGKIKKGGLVEVPMGITLRDIVYDIGGGIKGDKEFKAVQMGGPSGGCIPAELLDTSVD
FT                   YESIAKIGAIMGSGGMVVMDETTCMVDMARFFLDFTRKESCGKCIHCRIGTKRMLEILT
FT                   RICEGEGKEGDIELLEDLGEKIKEGSLCGLGQTAPNPVLSTIRYFREEYESHIHRKKCP
FT                   AKQCRNLLEYNILDEKCIGCGLCRRNCPVEAISGETKKVHSINQELCIQCGKCYEVCKF
FT                   GAVIVD"
FT   gene            327274..330852
FT                   /locus_tag="Clos_0277"
FT   CDS_pept        327274..330852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0277"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: ferredoxin; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; molybdopterin
FT                   oxidoreductase; molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: amt:Amet_3096 molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17840"
FT                   /db_xref="GOA:A8ML23"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML23"
FT                   /protein_id="ABW17840.1"
FT                   /translation="MPNIRMNINGIEVMGHKGQTILEVAKANDIEIPTLCYDEKVKVYG
FT                   SCGLCVVEVEGIPKLLKACATEISDHMIIRTNTTRVKESRKIALELLLSDHVGDCRPPC
FT                   VLACPGGTDCQGYVGLIGNGQYREAVELIKEKLPLPASIGRVCPHPCETACRRQALDEP
FT                   ISIAWLKSFVADIDLKNPNVFIPELKPATGKSVAIIGGGPSGLTAAYYLAVAGHKPVIY
FT                   EGMPELGGMLRYGIPQYRLPKEVLDQEIDIIRQMGAEMITNTKIGRDVQLDYLREKHDA
FT                   VYVAIGAWNSTKLNCPGEDLEGVIGGIDFLRKVTLNEPIKTGERIAVVGGGNTAMDACR
FT                   TAVRLGAKEVYNIYRRTKEEMPAEDIEILEAEEEGVIFKFLVNPIEIIGEDGKVTKIRL
FT                   QKMKLGEPDERGRRRPIPIEGEEETIEVDCVIAAIGQQVDVTGLEEIELTKWGTICADE
FT                   NSYRTNLPDVFAGGDGTNNGPDIAIAAIGEGKRAADVMCRYLEGKMIPYEKPFYVTRDQ
FT                   VPVEEFAHRKRENRPAMAHLSPEERRRNFEEIVAGYTEEAAKKDAMRCLECGCHDVFEC
FT                   KLLDYSNEYKVEPERLYGEMHYRMEDDGHPFIVRNSDKCILCGLCVRVCDEVIGATALG
FT                   LIDRGFDTIVKPPFNQKLKETDCISCGQCISICPTGALGERLAIEKPVPVTLESTATVC
FT                   SHCSVGCKVDLNTKGNLLIRALPKKETPLGDELLCVKGRFGFDMTKAGTRITKPLIRKN
FT                   GKLEEASWDEALLYTAKKTQSIGALYGSSAIGISVSDRYTNEEIYLISKLGKDVFKTEN
FT                   IGSFNGKSGGIGEVFGYDASPNTFDELVNTDTILLVGTNIMDHNTVAGLKIKKAVEQGA
FT                   KLIVISPNKSKIDAYAQVKATPKNDIVFLKEILKAMIESGFVAGQQNCENFEALKKSLA
FT                   GIAISPQAADIAQIYGHSKKAMIVFEEKTITSDAAAILGNLAAISGHIGKPRSGMIQLK
FT                   QNSNSQGLKDMGIEKGYEELENSLENKTVKALLVFGEDLSQVDFGTLDFLMVQDTHLTE
FT                   TAKKADVVLPAVGFAESRGTYTNTERRIQRLNKAIAPLVAYENWEIVEKLAEILDQSFQ
FT                   YRNLEEIQLDMEKAIPEYFGLSRVEGTEVFWPINNSRVLYGNGFNFADGKARLKVVEGG
FT                   PLFVADINTNHLTNSFVEYLKKEELM"
FT   gene            331121..332620
FT                   /locus_tag="Clos_0278"
FT   CDS_pept        331121..332620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0278"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: amt:Amet_4616 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17841"
FT                   /db_xref="GOA:A8ML24"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ML24"
FT                   /protein_id="ABW17841.1"
FT                   /translation="MKIQVMKDQIKEIMADAIVIGIYEGTKSLNDNLKSMDLQLDGIIT
FT                   EMISSEAFKGKEGETLVIYSLGRIPAKKIMLLGLGKETDLKEDTIRRLTAKVVREAEAM
FT                   KAKVVAMTAIGLDRGIAPELVGQCMMEGADLAAYKFDKYKTTDRNSGEGVQELYLLNEE
FT                   ESINKDLEKGFQTGAKLAQGTIIARNLVNEPSNVLTPTAMADKAIEIANNHGLEISILE
FT                   KEDMEKLGMGSFLGVTKGSEEPPKLIAIKYFGNKEDEEIIGLVGKGLTFDSGGISLKPG
FT                   AGMDAMKSDMGGAAAVLGAMDVIGALKPKVNVIAIVGACENMPSGKAYKPGDILTSMNG
FT                   KTIEILNTDAEGRLVLIDCITYALKQGATRIVDLATLTGACIVALGHVTTALVSNDDDF
FT                   VQQMYLAAERAGEKVWQLPSFPEYKELIKSDIADLKNVGDKGAGTITAGLFLGEFVEGR
FT                   PWIHMDIAGTAMALGTKGYYAKGGSGVGVRTLYHLVKSMEK"
FT   gene            332759..332932
FT                   /locus_tag="Clos_0279"
FT   CDS_pept        332759..332932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17842"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML25"
FT                   /protein_id="ABW17842.1"
FT                   /translation="MSLEEATQHDVVKDVNGVKFVIDKMLDNRFDEVKVDYGTVMFRKG
FT                   FIVALENGGGGC"
FT   gene            complement(333055..333216)
FT                   /locus_tag="Clos_0280"
FT   CDS_pept        complement(333055..333216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4613 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML26"
FT                   /protein_id="ABW17843.1"
FT                   /translation="MKCPICGNEHTGKLSKSRYFCSNCFVEIFLSKKNKLELLKISEDG
FT                   STYPIYAN"
FT   gene            333663..335096
FT                   /locus_tag="Clos_0281"
FT   CDS_pept        333663..335096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0281"
FT                   /product="SpoIID/LytB domain"
FT                   /note="TIGRFAM: SpoIID/LytB domain; PFAM: cell wall
FT                   hydrolase/autolysin; KEGG: amt:Amet_4611 SpoIID/LytB domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17844"
FT                   /db_xref="GOA:A8ML27"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML27"
FT                   /protein_id="ABW17844.1"
FT                   /translation="MYEEDKKIYINIYDKGQDKIVTKELEEMVKVLLAWSVPISFHMEA
FT                   LKAQSIIIRTNLVREMKVYGGYGCKENKEADISSAYFKEALPLENYKELWEGNYEGYLE
FT                   KLGVAVEETEGSVILFNNKPIDARTHLVCGGSTENSEGVEGNVVQYLRKVLCAHCQGSP
FT                   YFINHKDIPLQEVEKKLGVKLTRDDVLNAASIDDIIDDVVRDEDGRVIKIKIGGKEFKG
FT                   KEVMDKLKISSTRFSWRPELIRFFTLGEGDGLGLCQYGSNTMACSGRTAEEILKYYYTG
FT                   VEIKKIKNPSIHKPLKDRILVIDPGHGGEESDDYTGMQGLREKDVNLSIALYLKEELKN
FT                   LGATVYLTRETDEMVHLNDRAIMANDIAPDFFISIHQNYFSHPSKSGTEIYYFRGDGRA
FT                   KALGREIMIALNEDLKTLDKGIKQADFFLLRQVMVSSIHLETAYISNPVEEKMLMEEEN
FT                   RKKAAKAIAKGIVHFYRYL"
FT   gene            335404..335691
FT                   /locus_tag="Clos_0282"
FT   CDS_pept        335404..335691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0282"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   amt:Amet_4610 protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17845"
FT                   /db_xref="GOA:A8ML28"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML28"
FT                   /protein_id="ABW17845.1"
FT                   /translation="MASRNPLDGKNQLQEIRKNIEGYVGQKIVLKANKGRKKTTVREGI
FT                   LEETYPSIFIVRIDGKFDDSVRRVSYSYSDILTETVEITICNDGEETRVS"
FT   gene            335768..336031
FT                   /locus_tag="Clos_0283"
FT   CDS_pept        335768..336031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0283"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: cpf:CPF_1697 GIY-YIG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17846"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML29"
FT                   /protein_id="ABW17846.1"
FT                   /translation="MNYVYILECSDRSLYTGWTNDLVKRLKAHGEGKGGKYTRAKLPVK
FT                   LVYFEEYEDKIEAQKREYEIKQKKRDWKLQLIERGSALEKFK"
FT   gene            336162..337736
FT                   /locus_tag="Clos_0284"
FT   CDS_pept        336162..337736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0284"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   amt:Amet_4605 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17847"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML30"
FT                   /protein_id="ABW17847.1"
FT                   /translation="MSVELIKDVLKLEQVIGENIAQTIVEGDILVPDTKPDITRVLSAT
FT                   GKVQLTKQEIGENKITAEGVTYFKILYVSEKGDQPLYSIDSSTEFKQSIDIDGVTPQMK
FT                   GEVTAEVEHIDFTINNDRKIGIKAIINLASKVIEEKSIEITKDIAGIEDIQVLKESFQY
FT                   TDTAGYSKSEALIKDGFEMMEEEYEIKEVLKWDLAVIERESKITDGKVIVGGVANIEFL
FT                   YIDDDYDNPLKVIKREVPFTHFVEIPNIFGDMTYHLKLTPKELYYDIKENIRGERKIVE
FT                   IESIIQADVKVMDTQSKEFLVDTYSPSQNLQISKKQMVLRESIGMSRSNVLLRETMDTP
FT                   YGQPPISEVFSVNIRPILTDYTALENKMAIEGILEATVLYKAIEGAQSLYSFMQEIPFR
FT                   YHGDLYGLNEDMEAEVDLFVEEITYNVINGEQVDVKVSIAALCKGYCNKSIDIISEIDV
FT                   LEEDTNSLKQPSLTVYFMKDGDTLWNVAKRYHTTVQQIMETNQIEDPAAVKVGENIIIE
FT                   KVHNFKL"
FT   gene            337864..338742
FT                   /locus_tag="Clos_0285"
FT   CDS_pept        337864..338742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0285"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: amt:Amet_4604
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17848"
FT                   /db_xref="GOA:A8ML31"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ML31"
FT                   /protein_id="ABW17848.1"
FT                   /translation="MKQIYLKSRAKINLSLDVRRKREDGYHEVEMIMQQIDLYDNILIR
FT                   ERMDSEIVLSTNCIFIPTTSSNIAYKAAHKLKQRLDITRGIDIFIDKQIPVSAGLAGGS
FT                   SNAAAVLMGLNHLWSLGLSTKELMEIGVTIGADVPFCLLGGTALAEGIGEVLTPINSDI
FT                   KNTWIVLVKPAISVSTGDVYGSLDLSKIVDRPPTAQLLEAIKEGNIYDVSSKMCNVLET
FT                   VTVNKYPIITEIKKKMMEYNALGAMMSGSGPTVFGIFKSYERAKSAYEHLSLFYKQSYM
FT                   VQTYNGGTEIG"
FT   gene            338735..339421
FT                   /locus_tag="Clos_0286"
FT   CDS_pept        338735..339421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0286"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: amt:Amet_4603 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17849"
FT                   /db_xref="GOA:A8ML32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML32"
FT                   /protein_id="ABW17849.1"
FT                   /translation="MDKLEKLDIENYKPLREIVFEYLRQAILDGRLEPGKRLMEIQMAE
FT                   QLGVSRTPVREAIRKLELEGLVVMVPRKGAYVADVSIKDVSDVLEVRMVLEGLAASLAA
FT                   EKMSDDEIKELTAICNDFKLCAQQNDIDGLIQKDVEFHDCIFSATGNSKLNQISQSLRE
FT                   QVYRFRVRYISRYDRAKDLVDEHQAIYEAIVKRDAELAYKCGTKHIENLTNHMMEQLDI
FT                   YSQEEQ"
FT   gene            339472..340206
FT                   /locus_tag="Clos_0287"
FT   CDS_pept        339472..340206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4602 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17850"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML33"
FT                   /protein_id="ABW17850.1"
FT                   /translation="MKAIILAGESPQDIETFGQGKALIHFNDRPLIQYTIEALVQSGLV
FT                   EEILVIGNKEVLSPRIGYKVDKIIDGNKELLDNLITALSYFPQEENLLIATCDIPFIGG
FT                   EAVSNFIKEAHSLQADLYYPIIRRAVCEQRYPAAKRTYISMKDGEFTGGNLIMVNPQKI
FT                   MFMEDEIRLLITHRKNPIKMLKALGPSLVVKMLAKRLTIKDLEKYIEEKFGIKGRAFVT
FT                   PYPEVGTDIDRLEDIKILEKYI"
FT   gene            340708..342288
FT                   /locus_tag="Clos_0288"
FT   CDS_pept        340708..342288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0288"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   amt:Amet_4600 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17851"
FT                   /db_xref="GOA:A8ML34"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML34"
FT                   /protein_id="ABW17851.1"
FT                   /translation="MGLWGNLFGKEDKKVTISAEETKVFKNIEDNLDRIKSILEDCGDV
FT                   IYREFVIGEGKGCKAALVYIDGLVKTDVLNDYVLENLMVESRMAPPNKKINREELSDTI
FT                   KEKTLAVSEFKEVETIEEAVLNVLSGDTAFLLDEYEKMLIIATKGWSSRGISQPETEAV
FT                   VRGPRDGLVENLRVNTASIRRRIRDPKLKLKGKQIGKRSKTDICVMYIEDIVNQKCLEE
FT                   VNKRLDTIDIDAIMDSGYIEQLIEDNWRSPFPQIQSTERPDVVAASLYEGKVIILVDNS
FT                   PFALIAPASFNAMMQSAEDYYDRWGIASFIRVLRYIGAIISLYAPSLYIAITAFHPQML
FT                   PSNLSHSIASNREGVPFPSVIEAIVMELTLEMLREAGVRLPGPIGATIGIVGGLVIGQA
FT                   AVEAGIVGPIMVIIVAITAISSFSIPRYNLAIGLRLLRFFLIIASAILGLYGVMLVTIF
FT                   IIIHLCSLKSFGIPYLTPFTTYISKYTDLKDTLIRAPLSAMHLRPTLVNPKQKVRMKDR
FT                   RKEDFNKEE"
FT   gene            342294..343403
FT                   /locus_tag="Clos_0289"
FT   CDS_pept        342294..343403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0289"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: amt:Amet_4598 spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17852"
FT                   /db_xref="GOA:A8ML35"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML35"
FT                   /protein_id="ABW17852.1"
FT                   /translation="MEDNNDIIPIGQMIFILVLTMVGTGILTLPRDLAEAVPHDHWLVL
FT                   LAGGGAAIASTFIHGNIIKLQPREQFFDVLSHGFTRPVAYVLGAIYMLYFLTFCALVTR
FT                   VFGEVMKAFLFKNTPIEVINVSFLAASVYLGRKGIEVLGRVLEFLIPLLILFIVFIFGL
FT                   SFIRSDLYNLLPTFQISFNEFIKGIPTTILSFAGYEILLVFGPYLKKPKDATKGYIAVV
FT                   SVLIFYLLITTATLAQFGPLQVKRLLWPTLDLFDTIETPGLFIENVQVIVMTLWVLTAF
FT                   TTASPFHLGATIMLKSLTKSKDQAYLSAPLLPIIYFVSIIPESVSETYEFLKACTRYGT
FT                   TALVFVVPLLLLISLLIQDKMKKGARSNV"
FT   gene            343396..344553
FT                   /locus_tag="Clos_0290"
FT   CDS_pept        343396..344553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0290"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: amt:Amet_4599 spore germination B3 GerAC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17853"
FT                   /db_xref="GOA:A8ML36"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML36"
FT                   /protein_id="ABW17853.1"
FT                   /translation="MYKKILLILICILVLLTGCWDKVEINERAHISAIGIDRYAPSSGA
FT                   HKADNQDSPSGHEDKRNQFKFIFAFPKHSLEETDDIIVATIGDTLYGVSKILADRTNRE
FT                   MFLGHLRTIILGKSVTEDEHLFRQILDGIETNELLSRRVILAMTEDDVADIINITPSME
FT                   PRIGQFISEIFNRKDRTPRAPEGSIGDILKDLYESKNAVIPKITAGKNDVKVAGAGVIS
FT                   NYKFKGWLNEVQTAQLMMIKGEAKSAGGISIVYKDTIVPIDLKVQKSKMKLVDDNKRIK
FT                   ILINIDAEGDIKQTYFGSNYDLLEAKTIREIEDVFNKYMSDRLKETVRVIQEDFRADIL
FT                   GVDRFLRQRHYKLWKEVEQEWPEIFPNIEIDVKINIDIRRVGLVR"
FT   gene            344673..345356
FT                   /locus_tag="Clos_0291"
FT   CDS_pept        344673..345356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0291"
FT                   /product="Sporulation stage II protein R"
FT                   /note="TIGRFAM: Sporulation stage II protein R; KEGG:
FT                   amt:Amet_4592 sporulation stage II, protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17854"
FT                   /db_xref="GOA:A8ML37"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML37"
FT                   /protein_id="ABW17854.1"
FT                   /translation="MYKKWMSGFVICFLTGIVFINFLYLREERQELGKIGENLIRFHVL
FT                   ANSDSPEDQELKLKVRDKIIHTMAEELEKSRDINETREILRTHLHKIEEIAEEEIKSRG
FT                   ENYSVTASLGESIFPTKRYGNVVFPAGIYEALRIEIGEAKGQNWWCVMFPPLCFVDVKH
FT                   GLTDEETQRELKNALTEEEYHLVYSDINNKELPIQLKSKISEIFQESKVQIKGRFDRIA
FT                   SIFKI"
FT   gene            345812..346918
FT                   /locus_tag="Clos_0292"
FT   CDS_pept        345812..346918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0292"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: amt:Amet_4591 D-alanine--D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17855"
FT                   /db_xref="GOA:A8ML38"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML38"
FT                   /protein_id="ABW17855.1"
FT                   /translation="MSKINVMVVFGGRSGEHEVSLMSATSVLRAMNKEKYNITTVGITK
FT                   KGIWKLYRGSIDKIQSGEWEGIADNWAKENNFSTNISVLPSEEGKGIINFGDGKTEKID
FT                   VVFPVLHGPFGEDGTIQGLFEMMNIPYVGTGVLASSLAMDKAMSKKLFELEGIPQAKYH
FT                   AFLVKEYKENEKEVLDTIEEKFTYPVFVKPANMGSSVGITKVHNREKLEKAIELAAKYD
FT                   RKIVVEEGINGREIECSVLGNDEPIASLPAEIIPSAEFYDYNDKYFAGTSKFEIPANLP
FT                   EDVIEGIRSLSVKVYKLLDCSGLSRVDCFIERDSNRILLNEVNTMPGFTQISMYPKMWE
FT                   ATGIEYEELIDRLIELAIERFNERSILG"
FT   gene            346948..347373
FT                   /locus_tag="Clos_0293"
FT   CDS_pept        346948..347373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0293"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   amt:Amet_4590 domain of unknown function DUF1934"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17856"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML39"
FT                   /protein_id="ABW17856.1"
FT                   /translation="MKAMRMIKVIGVQTGLDGEESTIELMTEGTFYIKNGSYYILYDES
FT                   EISGLEGATTRVKVENNNKVYMKRFGTTATDLIFEKGSKYESNYMTAYGEFHISVVTNS
FT                   LDIEISEETGKGKIEIDYDLNILSGTKLSNKLQIQLM"
FT   gene            347455..348096
FT                   /locus_tag="Clos_0294"
FT   CDS_pept        347455..348096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0294"
FT                   /product="Formiminotransferase-cyclodeaminase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   amt:Amet_4589 formiminotransferase-cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17857"
FT                   /db_xref="GOA:A8ML40"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML40"
FT                   /protein_id="ABW17857.1"
FT                   /translation="MLLIDKPVKEFLDVLESKEPTPGGGSVAALSGSLGAALTAMVGNL
FT                   TVGRKAFEALDEPTKEHFKKNFNAVIELKRRLNVLVDKDVEAFDLFMAALKMPKETEEE
FT                   KAIRSKAMEEATIEALEVPLTTANECLNILKLQKVFAENGNVNAITDVGVGALMAYAGV
FT                   EGALFNVIINLKSLSDNAYIEKKKAECEGILAEAKALKEEVLSITYAKLA"
FT   gene            348243..349898
FT                   /locus_tag="Clos_0295"
FT   CDS_pept        348243..349898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0295"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   amt:Amet_4588 transcriptional regulator, CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17858"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML41"
FT                   /protein_id="ABW17858.1"
FT                   /translation="MSRQNGITVEDILKMECMEKCRLIAGFNGIYNTVSKVNIMADSEI
FT                   LDWINEGEFLLTTAYSFKLGGLEDQKSFIKECSSKGLAGLGIKVYPYLEMLPQEIIDLA
FT                   NRLNFPIIDLYYGTPFADIMTSVFKEIFNKQTSLLQRLEKVHEQLMNVVLEGGSIEDIG
FT                   RVTRENLRNPLIIKIGYPEQWFLQLGTVDAEMGGHLLEDAKRFYDPNSNKSMEYKLNEG
FT                   IEIIRGVPIRRMVMPIILKDSIYGHIFSWAANTPLGGFDLSVLENASTIISLDILKQLS
FT                   VRDVENRYRWEFLEDLLSMEERRKEKAEEKAHLFQLDVNDHFVLILIHIEEQEKAIRKD
FT                   FVHGQTSLYSSLEGLIESHNLKGFIASKTDSLYVLLSFSQKNKGNVALKAFSKDLEEFF
FT                   IYHFKEVNYRLGVGREYKGLRQVHKSYEDSVKAIQVGTLLKERKIIFFEDLGVYKILCQ
FT                   DHLTEELERFYNKTIEPLVKYDEKKSTELIKTLEYYFEYHGNLKKISEALFTHYNTTLY
FT                   RIERIKQITGLNIECSNDRLNLEIGLKIKNILNR"
FT   gene            complement(349968..350507)
FT                   /locus_tag="Clos_0296"
FT   CDS_pept        complement(349968..350507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0296"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   amt:Amet_4328 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17859"
FT                   /db_xref="GOA:A8ML42"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML42"
FT                   /protein_id="ABW17859.1"
FT                   /translation="MAERMVGLKAPYFEMNTANGDGKDFGKISLEDYKGKWLVMFFYPL
FT                   DFTFVCPTEITAISKRVAEFNKLNAEILGVSTDSEHSHKAWINAAQDKGGLGQITFPLA
FT                   SDRTQSVARDYGILIEEEGIALRGLFIIDPEGVLRYSVVHDLNVGRSVDETLRVLQGLQ
FT                   SGGLCPIDWHPGDNTL"
FT   gene            350750..351922
FT                   /locus_tag="Clos_0297"
FT   CDS_pept        350750..351922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0297"
FT                   /product="ATP-grasp protein-like protein"
FT                   /note="KEGG: sfu:Sfum_0958 ATP-grasp enzyme-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17860"
FT                   /db_xref="GOA:A8ML43"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML43"
FT                   /protein_id="ABW17860.1"
FT                   /translation="MKNKAVILGSNYYIGLSTIRCLGIHNIYTVAVDYSDQDRYGSDSK
FT                   YCSERLISPHYRNEKEAFIEFLKDYARKEIVPPVLIPCHDSYVEVIDEYLDELREFYLI
FT                   PQTEQGLYTKAMNKETLERMAKEQGVLVPETIRVNEDNFFEKVDSIIKYPCIVKPTDSP
FT                   SFVAKFRKKIFKVHNRAELEDALEKAQNAGLEVIVQRIIPGFDDHMYTFDAYLNQDAKV
FT                   THWTTCQKFRQYPINFGASVYTGQRHVPELYEIGAPFLEAIGYKGFGEIEFKKDAETGE
FT                   YYLIEINVRITNLNNLLYKVGMNIPYITYRELTGEPLAPKAITENTNRVFWYAYEDLLA
FT                   IKGYIQTGQLSLGEVMKSFFKPKAYAIWSLDDPKPFFSYCKMMVGKIFKR"
FT   gene            351968..353479
FT                   /locus_tag="Clos_0298"
FT   CDS_pept        351968..353479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0298"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: amt:Amet_1618
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17861"
FT                   /db_xref="GOA:A8ML44"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML44"
FT                   /protein_id="ABW17861.1"
FT                   /translation="MMKLKELLSSIEIKNMDDERDLEIYGISYHSGKVEKGHLFVCVRG
FT                   YKTDGHQYLGKAAQNGAVAAIVEELQEDVDIPQYVVSNSRIALAKLGARFYGDPSQKMK
FT                   LIGITATNGKTTTSFMVNAILEKSGRKTGLIGTVVIKIDEESTPAELTTPESLDLQHYL
FT                   SQMVDKGVSHVTMEVSSAALETHRVESVAYDIVTLNNISREHIDSHGSFEKYFEAKSSL
FT                   IRNASENSIAVLNLDCPYSASLVDQTKAEVITFGVNSKEGHIACKDLDLTTGRAKFTLE
FT                   ILKPFTANGQQYEPSEFEVQLLVPGLHSVYNSMVAITVSLLCGVSTATIQETLKTFAGV
FT                   ERRFQFIFEEDIKIIDDHFANSGNIDVTLGTLKYMDYEKLHLVYAIRGERGPTVNRENA
FT                   EAIARWAPKLGITEIIATKSVSHVTHKDRVTEAELTVFQEVMRDAGIKVDLFDELPDSI
FT                   CYAIGKANEGDLILLGGCQGMDFGAEIALKHLASRKATNKGKSII"
FT   gene            complement(353601..354830)
FT                   /locus_tag="Clos_0299"
FT   CDS_pept        complement(353601..354830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0299"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="KEGG: cno:NT01CX_0717 peptidase T; TIGRFAM:
FT                   peptidase T; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17862"
FT                   /db_xref="GOA:A8ML45"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ML45"
FT                   /protein_id="ABW17862.1"
FT                   /translation="MKNMVQRFLKYVTIDTKSDHESESFPSTKSQFDLAKLLVEELKAL
FT                   GLEDAVMDENCYVMATLPSNCNTDKTIPTIGFIAHMDTSPDMSGKDVKPQMVENYDGQD
FT                   IVLNQEKNIILSPTDFPDLKNYVGKTLITTDGTTLLGADNKAGIAEIISALEYLVQNPE
FT                   VQHGTIKVAFTPDEEVGHGADRFDVEKFGADFAYTIDGGEIGELEYENFNAAGVKILVH
FT                   GRNIHPGTAKNRMVNSMEIAMELHAMLPENQKPQYTEGYEGFFLLTGIRGDVEETKCGY
FT                   IIRDHCKNKFEEKKSLIKNAVDFLNGKYGEGTINLTVTDNYFNMKEKIEPVMHIVETAR
FT                   TAMEEVGVTPIIKPIRGGTDGARLSFMGLPCPNIFTGGHNFHGKYEYICVESMYKATEV
FT                   ILKIIELYSK"
FT   gene            355035..356336
FT                   /locus_tag="Clos_0300"
FT   CDS_pept        355035..356336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0300"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; SCP-like
FT                   extracellular; KEGG: cth:Cthe_0779 copper amine
FT                   oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17863"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR029410"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML46"
FT                   /protein_id="ABW17863.1"
FT                   /translation="MKNRGRSLFSIILVLLVIFSSLMLVSAEGEITIRLNNSQIEFPDA
FT                   KPYMDKRAGRVLVPVRFISEGLGAEVRWDQANGTVYILKDESNIRLKLEEKSYSLNGVQ
FT                   KTMDTAAFLKDNRTFVPIRLISEGLGLDVSWDEQTSTVLLNEKNRKNFSVQGITIGTSE
FT                   KELIAKLGEPARKDFSKYGFQWYIYNQDYTSYIQVGVSDGTVVGLYSNTDHWLYANSIK
FT                   IGTSRKDVEKLLGEPLKSIKKGNTIYHLYNTEEKGLYFIDGSYVSFYYDLHEGNTVTSI
FT                   HVVREDIELGLNGFYGKYSEKLKEGFERQIFDLANVVRVRNGLEPFQWSDRARDSARKH
FT                   SRDMAHNNFFEHVNLKGESPAARMEKEGINYRLAAENIAAGTSDAIEAHEGWMNSLGHR
FT                   QNILGKAKNLGVGVAYNSNSTYQYYYTQNFFTEM"
FT   sig_peptide     355035..355115
FT                   /locus_tag="Clos_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 27"
FT   gene            complement(356431..357150)
FT                   /locus_tag="Clos_0301"
FT   CDS_pept        complement(356431..357150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0301"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: amt:Amet_3731 PHP C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17864"
FT                   /db_xref="GOA:A8ML47"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML47"
FT                   /protein_id="ABW17864.1"
FT                   /translation="MKALIDLHCHSIASGHAYSTIEENLAQARNKGLKIVGVADHAPSM
FT                   QGGPNIFYFYNLQAIPREVHGLTLLKGVEANIMDFQGNIDMPVEVLEKLDYAIASLHPP
FT                   CIDPGTMEENTAAILGAIHNPYVKIIGHPDDSRYPLDYEVIVKAAKEHNVALEINNSSL
FT                   MPYSFRSGAHENVKIILNLCEKYGTHVILSSDAHFSTAVGDFSNCMDIIDEVHFPKALI
FT                   INFNEALINQLMGKELL"
FT   gene            357577..358728
FT                   /locus_tag="Clos_0302"
FT   CDS_pept        357577..358728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0302"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /note="KEGG: sat:SYN_00365 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems,
FT                   periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML48"
FT                   /protein_id="ABW17865.1"
FT                   /translation="MKRKKGRKLLAMVMAIAIVALTGCSGGDIASTKPQPIEEPAKNEI
FT                   PTFNVGWSSELHTGNMHLNFLKPELFESNSVHLKPISDSQLELVKDGSVIAYVNYMYSK
FT                   GAAESATLMSQGHMDIAYCSSTAMLTAYDSGVDVSILCPIQSGGVSVVAAADAPYTTFE
FT                   ELVQYAKKSDKPIVGGYHSAVSSPRIVLEYALKDAGLTVTEDAADYSADVLLMDLKGIS
FT                   NLIPSLSSGQVELWAGPVPNPQNAEAQNIGKIIATLNELPEGKWVDFPCCTMNVRNEIK
FT                   DKYPEAVQAMVQVTSDVADYAQNNRKETAELMAEFIGLEKEVLMKNDTTYQTEITEHFT
FT                   NGMATYHEAMSKIGKFSGRLKDKPVNEVMDAVFDFTFIEELSK"
FT   sig_peptide     357577..357669
FT                   /locus_tag="Clos_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.563 at
FT                   residue 31"
FT   gene            358728..359636
FT                   /locus_tag="Clos_0303"
FT   CDS_pept        358728..359636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0303"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_00366 sulfate
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17866"
FT                   /db_xref="GOA:A8ML49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML49"
FT                   /protein_id="ABW17866.1"
FT                   /translation="MYTSKLKKCEKGLSKKESSVLTHINKIKIKKSIISMILPVLFLLI
FT                   WNYYATKIGNNAILPTVGKVFYNFLHAFDNFIGLGSIPRNIGYSIVRVLLGYIIGASVA
FT                   FPLALLMGYFKPIRNLCENFINLFKPIPSIAWQPLVLGWFGISSLARILGMPYGPQFAI
FT                   MDNFKLSMIFLIALGAFFPIWGNIIFGVTNVRKVLIETAKVLGASQIDIFFHILIPAAG
FT                   PTIINGMRMGLTASWVCLVSAEMLPGSMSGVGYLITHAYELARMDLVITGMICIGIIGA
FT                   LLDGVFRIVISKNFSWENKVK"
FT   gene            359647..360414
FT                   /locus_tag="Clos_0304"
FT   CDS_pept        359647..360414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0304"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_00367 sulfate transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17867"
FT                   /db_xref="GOA:A8ML50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML50"
FT                   /protein_id="ABW17867.1"
FT                   /translation="MVQSIISVDKITKTFTVEGNRQDLTVLENININIKENEFVCIVGP
FT                   SGCGKSTLLRLIAGLESATEGHVFYRGEKLIKPRKEIGMVFQNYSLMPWLNVEDNISMG
FT                   LNFKRVSKSEKKKTVDEFLKIIGLEDFRKSYPHELSGGMQQRVAIARALANSPDVVLMD
FT                   EPFGALDAYTRILLQKELLRIWEYDKKTIIFVTHSVDEAIYLADRIILMSRRKGSIDRE
FT                   IFVDIPRIRERSDLRYAKLTQELLEELEQLNDR"
FT   gene            360674..360934
FT                   /locus_tag="Clos_0305"
FT   CDS_pept        360674..360934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0305"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   rrs:RoseRS_2875 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17868"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML51"
FT                   /protein_id="ABW17868.1"
FT                   /translation="MECRAGCAACCIAPSISSPIPGMNDGKLAGIRCIQLSTDNRCMIF
FT                   GSAERPAVCGNLQASQEMCGNNDEEAYAYLEYLEKATAIKK"
FT   gene            complement(360989..361378)
FT                   /locus_tag="Clos_0306"
FT   CDS_pept        complement(360989..361378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17869"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML52"
FT                   /protein_id="ABW17869.1"
FT                   /translation="MITVYLAGIPAYYEGEDIEIRYGIYRNEDLLERQALLKDYKKPAV
FT                   VGPFALLTILKELEDYQEEDITIIVNDPALDELMEGTSTTKNAGVLKMTNMAKDQLRKF
FT                   PNAITVRDISEDSKALAKWDEILKF"
FT   gene            complement(361537..362274)
FT                   /locus_tag="Clos_0307"
FT   CDS_pept        complement(361537..362274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0307"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: amt:Amet_4675 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17870"
FT                   /db_xref="GOA:A8ML53"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML53"
FT                   /protein_id="ABW17870.1"
FT                   /translation="MNNAIIENICYPRPNAEVLHTVYDFEITLINTILNGQVEKALNLY
FT                   HKFFALESNYTAVSNNDIHILKTYLISVSMLISHRVIQKGVSTYSSKSKYQAFAKAIHK
FT                   TSSKIEALNMGKTMVTAYATQVKKSLNKVDNISIRRAIDYILNNLGETLTLEEVANHAN
FT                   LSKCYFCTQFKKEMKMSFTDYLSHARIEKSKYLLCNSNKSILDIAILIGFNSQSYFTTQ
FT                   FKKYTGVSPKEFRAKKEDNEYVF"
FT   gene            362477..362977
FT                   /locus_tag="Clos_0308"
FT   CDS_pept        362477..362977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0308"
FT                   /product="flavodoxin family protein"
FT                   /note="KEGG: tde:TDE1177 flavodoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17871"
FT                   /db_xref="GOA:A8ML54"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML54"
FT                   /protein_id="ABW17871.1"
FT                   /translation="MIINIIFSSLTGNTKQVAYEILKSLPENTAIYDLKELAQMPEGDV
FT                   FVLGYWVDRAKPNQEMYQFMETLKGKKVLTFGTLGAYPDSEHAKETKENTHRLLEKNNQ
FT                   VLGHFLCQGKIDPKLTEMFKKNAGGHAMTPERLKRHEDAAKHPNEEDFINARKFIETLL
FT                   NHL"
FT   gene            362992..363738
FT                   /locus_tag="Clos_0309"
FT   CDS_pept        362992..363738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0309"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="PFAM: NifH/frxC-family protein; KEGG: cbo:CBO0690
FT                   nitrogenase iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17872"
FT                   /db_xref="GOA:A8ML55"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML55"
FT                   /protein_id="ABW17872.1"
FT                   /translation="MKKIAIYGKGGIGKSTTVSNLSAALSHLGYKVMQVGCDPKADSTK
FT                   NLMKGAFIPTVLNVLRDQGDDIGLEDIVFKGYNDVLCVEAGGPTPGIGCAGRGIITAFE
FT                   KLEELEAFEEYQPDIVIYDVLGDVVCGGFAMPIRNQYANEVYIVTSGEMMSMYAASNIS
FT                   RAVMQFKSRGYAELKGLILNAKNVENESALVDKLCEEIDTNVFHYIPRNPLVQEAENSG
FT                   KTVIEAFEDSEMAQIYMDLAKKIMEG"
FT   gene            363741..364649
FT                   /locus_tag="Clos_0310"
FT   CDS_pept        363741..364649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0310"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: bce:BC4546
FT                   ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17873"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML56"
FT                   /protein_id="ABW17873.1"
FT                   /translation="MKKFKSLMALALCVTMGMVGCSSPTDTGKVEAKNEPQIEEGMAEK
FT                   KIIAGTFMSAELLDLFDINPVGVLTSEKALPERYKDVAKIGSPMKPDLEVVASLSPELY
FT                   VSDSNLKEALDEMFKGMAFETMYLTNNSYENVFQNIENVGERLDKTNKANEIIKEMRDQ
FT                   EKKIMDAIAGKEAPKVLILFGTPESFMIATPHSYTGSLVEKLGGINVAEGMAAGRPSPY
FT                   LPYSLETVAELNPDIILRLTHVSPEVSRKAFDAEFAKGFWTNLDAVKNGEVYDLDNENF
FT                   GVSANLRAVKALEKMAKILYK"
FT   sig_peptide     363741..363809
FT                   /locus_tag="Clos_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.480 at
FT                   residue 23"
FT   gene            364661..365650
FT                   /locus_tag="Clos_0311"
FT   CDS_pept        364661..365650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0311"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ctc:CTC01196 putative ferrichrome ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17874"
FT                   /db_xref="GOA:A8ML57"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML57"
FT                   /protein_id="ABW17874.1"
FT                   /translation="MVKSLRENKHRYIVGSLFILMFIALLSVRMGSVEYSYSRILNVLF
FT                   SPEMTSDKNVVFNIRLPRIAIAALVGANLAVAGALLQAVMQNPLADPGLTGVSAGSSLA
FT                   AIIVMLLFPQYSYLVPVVAFIGGAVACALVYVLAWKNGIKPIRIILAGVAVNAILGGGT
FT                   SLLSILYSDRIQGVLLWVNGSISGKTWDDVRVLAIYSVIGLTMAMFCIRKANILQLGDD
FT                   MSANLGVDTNQYRVMISLVAVFLAAISTALVGIIGFVGLIVPHIARLVIGSDYKYMLPF
FT                   SVIVGSGLLLLGDTFARTVARPVELPVGVIMAVVGGPFFLYLLRRGKA"
FT   sig_peptide     364661..364756
FT                   /locus_tag="Clos_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.520 at
FT                   residue 32"
FT   gene            365650..366462
FT                   /locus_tag="Clos_0312"
FT   CDS_pept        365650..366462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0312"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cno:NT01CX_1448 ferric enterobactin transport
FT                   ATP-binding protein FepC"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17875"
FT                   /db_xref="GOA:A8ML58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML58"
FT                   /protein_id="ABW17875.1"
FT                   /translation="MIEAKNLCIGYEERIVVHNFSFHIGEGEMVSIIGPNGSGKSTILK
FT                   AVSRLLKQKSGAIYLEKEDMSAMNIKKIAKKMSALSQHNRSPEDIKVKELIYYGRLPHK
FT                   KWHERRNEEDEEIIQWAMDQTSLNGYEDKLVMALSGGERQRVWIAMALAQQPRILLLDE
FT                   PTTYLDICHQLEVMELVKKLNRELNLTVIMVLHDLGQAAKYSHRVVVLKKGNLIAEGNP
FT                   YDVLTEELIKEVYQVEVCIRKDILKGEVIIHPMGVCKNCEEGCKNDKV"
FT   gene            366449..367756
FT                   /locus_tag="Clos_0313"
FT   CDS_pept        366449..367756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0313"
FT                   /product="oxidoreductase/nitrogenase component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   cbo:CBO0691 nitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17876"
FT                   /db_xref="GOA:A8ML59"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML59"
FT                   /protein_id="ABW17876.1"
FT                   /translation="MTKFDLNTLSKLDEISKNEDIKALSHAIFPGTHCPLFGVAMIASF
FT                   VEDLVVVVAGTQECTYYVKDFAYQRQYGKDNFYSVVTNKHDITFGCESKIKDVLLEIDR
FT                   TIQPKAIMLVSTCVLELIGEDVASLGSAMQDEIHAKILVVPTEHFKCNSHIPGMERSLE
FT                   QFVTLMEPCAIDQHSINILGHRQHGVEGTELMQLLIEEGIHINAVIPSKTTIEGLKSAP
FT                   KARFNIVTDFVALPMAKKMEEIFGTPYVYFDKHLSMERIRSAYQQLGDILKIDVLSKLS
FT                   HKEKELRELMKEAKEVLKGKTFIYGNTPMMAFEVSSFLCDLGMEPILVQVRDLYENDPI
FT                   YMGEIKSHQYNPYISRIANIAPMQYVYDQCKPNFYIGHENPMNLAKRNIIQVTLDEVTK
FT                   KLGYEIPIDSIKKILLSYGQHNEMKEKMMKMASRGA"
FT   gene            367760..369013
FT                   /locus_tag="Clos_0314"
FT   CDS_pept        367760..369013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0314"
FT                   /product="oxidoreductase/nitrogenase component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   cbo:CBO0692 nitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein NifE"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17877"
FT                   /db_xref="GOA:A8ML60"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML60"
FT                   /protein_id="ABW17877.1"
FT                   /translation="MAFYKFFPTPSDRMGTIWTLSTIKDAYIIEFGPAGTTHFAIEGMM
FT                   QFNADHNANVYTTHINETDISFGKQDRLENAILEIDGQYGPKYIFVMASSISAIIGTDI
FT                   ESVCYELQPKVKAKLIPITTGGYHGDHTLGIEATMDMLCKEVVQETVQKKPNTYNIVGN
FT                   NGDVFNFLSDVEEIKNLMKSAFNFDVNTTFTAYTSMEEIEKAGEAQFNLVLRGEGLKAA
FT                   DTLKKNHGMGYHYGRPYGLEGTTFWLKSLEKALGIPADEQYIAKKTAEIRKHLMNYRFM
FT                   TRGLNKKNVLLVGDYDVVVGLAALVEELGLTVEAIILKHKMNRKAKKHLPEKWERVMKL
FT                   DYSEREMEAYLSETPSYLLLADEATLKLENKSKLHFQIANPNFSKHSIYPYTPFVGYHG
FT                   ALYFMQCLYELQKGNPEA"
FT   gene            complement(369260..370378)
FT                   /locus_tag="Clos_0315"
FT   CDS_pept        complement(369260..370378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0315"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: amt:Amet_0512 spore germination B3 GerAC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17878"
FT                   /db_xref="GOA:A8ML61"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML61"
FT                   /protein_id="ABW17878.1"
FT                   /translation="MLKKVIKLLIVALISLPLLSCWDSKDLEELLIVYGLGIDISEENP
FT                   DNYVFTIAFPTIIEDAPEKKVTFSAEASSISRGRSNPQKKVYRDLSFDNIKIVVFNEDV
FT                   AKQGLLFHMDSMFRVPLFRGTTRFAVSGGSANGLLQFQPPVSLLVTNFLFDSIGQNYNA
FT                   TNVPVTTLRGFSNQYYTTGIEPSMPFISYGDTQNDLKIDRIALFKEDKMIHVLTGINSR
FT                   AFMMLKGEIKDGVHTFEFFSEETGRKEFLSVNVIDGKSKIKTEIKDNQLHIYQEVSINA
FT                   HLGEYTAREKIFSTDRIKRLEDIINHELKLGLDETLKILQKDLECDNIGYGKYVKGNHP
FT                   EYFDSEDWNSQFAEAMIHINPTIQIRTVGVTP"
FT   sig_peptide     complement(370316..370378)
FT                   /locus_tag="Clos_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.922 at
FT                   residue 21"
FT   gene            complement(370359..371465)
FT                   /locus_tag="Clos_0316"
FT   CDS_pept        complement(370359..371465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0316"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: amt:Amet_0513 spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17879"
FT                   /db_xref="GOA:A8ML62"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML62"
FT                   /protein_id="ABW17879.1"
FT                   /translation="MYQKYNNGEISAQQSFILLINMIVGTGILGLSRTVAEVSRQDAWM
FT                   SVLLNGAFLSGVMVIMVYTISKFPQYNFVQYTSYLLSKPVGYLISFAYVLYALFATGIT
FT                   IAYLCEMTATWLLSETPNYIIRFIIVITVVYMTRNGLTVVARFAQATVFILIPLGLLML
FT                   IGLPETQFINLKPIGGAGIINILKGTRPSFYAFAGYESLLVYYPYISNKEESVMKKSVW
FT                   ALILVTLFYTTNVITQIALYGSDEIQTVLYPAINYLTSVNFPVIERSEIFFTIFWTFTV
FT                   LCTSGVQYLVSSVLLQNIFKIKRTRIFTYALAPVIFLISIYPRNTVAVVEFAGKIGTAN
FT                   IFFGFLLPVLLFTMYLIKGRDTSVEKSH"
FT   gene            complement(371499..373037)
FT                   /locus_tag="Clos_0317"
FT   CDS_pept        complement(371499..373037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0317"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   amt:Amet_0514 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17880"
FT                   /db_xref="GOA:A8ML63"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML63"
FT                   /protein_id="ABW17880.1"
FT                   /translation="MKLLSRLFTVAEASQGNKEKNTTPILPNPVQVYQQNLEEIFEQCS
FT                   DITYTPVKLNVGKEMIEGLLIYSNVLVNLDVINKNIIHPINSYESERLSHGPQEPSLIY
FT                   DKDHTPSKGNIRSLEIFAEIITTSNIKKIDHWSQVVQSILYGNTVLFTNYCSTALVLET
FT                   KGKEGRSIAESTVESAIRSPRDSFIEDIDTNIGLIRKRIKSSHLKVMNMIIGSESHTTI
FT                   SVLYMENKVNHHLLENIIDLITNIETEVVLESAYIEQHLEQYPYSPFPQTQITERPDKV
FT                   CGDLMEGRIIILTDGSPIALVLPITFFQLFHSSEDYYTRIISSNLTRFFRFMGFFIATS
FT                   LPSIYVALISFHHEMIPMNLLIDLSKNRTNVPFPPVIEALLMEVAVELIREASNRLPQS
FT                   IGQTIGIVGAIVIGDAAIQSNFASPTMVIVIGITVIGSYIFPHYNTSYALRILRIPIII
FT                   MAATFGAFGIVISWCWVIIHLCNLESFGYPYLFPLAPLDNSVVKDGIIKKGLKN"
FT   misc_binding    373263..373442
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 126.48"
FT   gene            373607..374659
FT                   /locus_tag="Clos_0318"
FT   CDS_pept        373607..374659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0318"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: dsy:DSY3874
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17881"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML64"
FT                   /protein_id="ABW17881.1"
FT                   /translation="MKKNRILSMILILVMAVSFVGCSTTDQEVKGENNPGVGQETKQDP
FT                   NKQGNENNPYPEYVLEVTDETVTFMSSEGEITVTKKPKKVAILMNSYLDLWYMAGGEAI
FT                   ARIDGTSNIPDAAMDIVQLGKMNAISVEQLVALEPDLVIMSTSISSQMDMIPILKDNGI
FT                   EYMPMSGNIAPYQAFQKNLYLFTQILDRQDIFYNEVAKITAEVDQIRNKVKDADKPTAV
FT                   ILFASTSKVQAELANSLTGEMADLLGVVNIVPEVPIDGTNKIDFSMEKLVEADPDYVLI
FT                   TTMGDVDKCKERIEQDVISNDAWASLTAVQEGRVYYLPKELFMYRPNADYPKAFTELGK
FT                   IVYPEVFAGE"
FT   sig_peptide     373607..373684
FT                   /locus_tag="Clos_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.584 at
FT                   residue 26"
FT   gene            374652..375680
FT                   /locus_tag="Clos_0319"
FT   CDS_pept        374652..375680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0319"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein;
FT                   inner-membrane translocator; KEGG: dsy:DSY3873 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17882"
FT                   /db_xref="GOA:A8ML65"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML65"
FT                   /protein_id="ABW17882.1"
FT                   /translation="MSRNHSAIGVQKSHKYKITVILVLVFMVVLSFLISVAMGAYKISV
FT                   KEVLQAIFIDQEGLSRNIIWKIRVPRTLIAGIVGVCLSLSGGILQGVMRNPLASPNIIG
FT                   VSSGAGLAASITLVLFPNYAYLLTPAAFIGAFATTLFIYMLSWKDGINPLRMILSGIAI
FT                   SSLIGAIINTILIFYPDRVQNTLGFTIGSLAAKSWIHFRLMWPYALAGFILTLIMAKKI
FT                   NILMLGDEIASSLGLNIERVRMILIIISSLLAASAVSVVGMLGFVGLVVPHITRLIIGS
FT                   DYRYLFPASALLGASLMMICDTIARTVVEPIELPVGIIMAIIGAPFFLYLLRGGLKNRA
FT                   RG"
FT   sig_peptide     374652..374771
FT                   /locus_tag="Clos_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.645 at
FT                   residue 40"
FT   gene            375667..376470
FT                   /locus_tag="Clos_0320"
FT   CDS_pept        375667..376470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0320"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC01197 ferric enterobactin transport
FT                   ATP-binding protein fepC"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17883"
FT                   /db_xref="GOA:A8ML66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML66"
FT                   /protein_id="ABW17883.1"
FT                   /translation="MLEVKNLSLGYDDSIIVKDVSFNISDKSITTIIGPNGCGKSTILK
FT                   ALSKNKKPIQGDIVFQDRNIQEFQTKQLARKMSILPQSPRVPDDFTTRDLVGYGRYPHL
FT                   SWTGRLSKKDQEIIDWAIAETKLEKLQHRQVSTMSGGERQRAWIAMALAQQPEILLLDE
FT                   PTTFLDICHQFELLELIKKLNREMGITIVMVLHDLNQAARYSKKIIVVKDGEKYMEGIP
FT                   RDVIKKQVLEEVFNIEVNILEDQDNECPYFIPINIKTGEKFNGAL"
FT   gene            376520..377365
FT                   /locus_tag="Clos_0321"
FT   CDS_pept        376520..377365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0321"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pth:PTH_1476 ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17884"
FT                   /db_xref="GOA:A8ML67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML67"
FT                   /protein_id="ABW17884.1"
FT                   /translation="MINVSGLTKKFGEKTVVNNLSFHIDKGCIYGLLGPNGAGKTTTFR
FT                   MLTTLLKPDSGMVEINHKEIRRKSSDIKRMIGMVSQHFSMHSDLSVWEILELHGKLHSI
FT                   KKEERHKRIKELLKFADLSEDKDKIAKKLSGGMKRKVMIIRAILHQPDILFLDEPTVGL
FT                   DPLSRKNIWFLLEQLKESGMTIILTTHYIEEAEKLCDRVLLINKGKILMEGVPKELILN
FT                   AGEYTVEVFDRAEPEYHFFSSRKDALEFSSNIESKYIVRESNLEDVFIQMNKEGEKYGF
FT                   "
FT   gene            377355..378089
FT                   /locus_tag="Clos_0322"
FT   CDS_pept        377355..378089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0322"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pth:PTH_1475
FT                   ABC-type multidrug transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17885"
FT                   /db_xref="GOA:A8ML68"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML68"
FT                   /protein_id="ABW17885.1"
FT                   /translation="MDFEAVLWEEWIVFKRRFWKITSSALVSPLLYMIAFGWGMGKDVH
FT                   VNGYPYINFIVPGIVAMTTMNTSYSAVSVLLSINRIYDKTFEQFLIAPISSHRYVAAKV
FT                   LAGALRGMYAGFLILTVAFLSGAHIKINSMFLLIMFVNGLAFSCLGFYAALAVDSHADM
FT                   NRFSTYILTPMTFLCGTFFSPENMPGVVKKVIYALPLTHASGGLRSIATVGSAQWMNVA
FT                   VLFAYFIILFIICIKKYNSVTA"
FT   gene            378105..378893
FT                   /locus_tag="Clos_0323"
FT   CDS_pept        378105..378893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0323"
FT                   /product="anaerobic cobalt chelatase"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG: cdf:CD3422
FT                   sirohydrochlorin cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17886"
FT                   /db_xref="GOA:A8ML69"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML69"
FT                   /protein_id="ABW17886.1"
FT                   /translation="MNKKALLVISFGTSYKDTFEKTIQAIEEDLKTAYPDHDFFRAYTS
FT                   RRIIKKLKARDGIAIDLPAEALEKIREMGYEEVLCQTTHIINGFEFELTVKDLLPYSKD
FT                   IQIKMGSALLTSHEDYLGAVEAVMGSIPPLKEEEALILMGHGTYHHANAAYPCLDYVFK
FT                   SEGHTNVYMGSVEGFPYIDDVVKQLKKQSQIKKLYLMPFMVVAGDHALNDMAGDEEDSW
FT                   KEVLKNQGYEVEIIMKGLGELEGIRKIFVEHSQKASSLQP"
FT   gene            379224..379898
FT                   /locus_tag="Clos_0324"
FT   CDS_pept        379224..379898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0324"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: swo:Swol_2177 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17887"
FT                   /db_xref="GOA:A8ML70"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML70"
FT                   /protein_id="ABW17887.1"
FT                   /translation="MKVLLVEDEKHLAEALLQILKKNKYTVDGVYNGEDGLDYALTGIY
FT                   DVIILDIMLPKLSGLEILKSIRKKKISTPVLLLTAKSEVSDRVKGLDLGADDYLPKPFS
FT                   TEELLARLRALTRRKGEVINEDTLSFSNFSLNLSTYLLEGEKTSVRLALKEVEILKYFM
FT                   LRPRIIVNKEDLIIKVWGYESEAENNNIEVYISFLRKKLQYIEARAKITTIRGVGYKLE
FT                   EE"
FT   gene            379895..381106
FT                   /locus_tag="Clos_0325"
FT   CDS_pept        379895..381106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0325"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: swo:Swol_2176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17888"
FT                   /db_xref="GOA:A8ML71"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML71"
FT                   /protein_id="ABW17888.1"
FT                   /translation="MMFKELRRKFVLINMSLLTFVFIAIFTAIYVLTAFSGEHQLDMTL
FT                   EKVMNSSPTPFPGESRTATSLVVELNRFNEIIVFSSFLTMDEEVIKEAVIKAIEIPDAT
FT                   GKIKVGDFHYSFLKKDVIFGTRIAFVDRGPLQDSLRSILVIFAGVAGGSLIILFLISVF
FT                   LANRAITPIREAFEKQEQFIADASHELKTPLAIIKTNLALILESKKDTVENQLKWIGYI
FT                   QGQIERMSNLIKDMLTLAKMDSPEQPLFFETLDISNILEGALLYFEAGLFENGIVLETN
FT                   IQPNLRLYGERYSFEELVHILMDNAIKNTNENGTISVCLNATKTNIELVVKNTGAGIAP
FT                   ENIPRIFERFYREDFARGREGGGYGLGLAIAKSIVQKHGGKIYAESNLGVDTSFIVKLP
FT                   KGKQ"
FT   sig_peptide     379895..380005
FT                   /locus_tag="Clos_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.779 at
FT                   residue 37"
FT   gene            381292..381762
FT                   /locus_tag="Clos_0326"
FT   CDS_pept        381292..381762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0326"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: cac:CAC1604 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17889"
FT                   /db_xref="GOA:A8ML72"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML72"
FT                   /protein_id="ABW17889.1"
FT                   /translation="MECDRCSKIKMEKQKNIALVAHDNRKEDLANWVKENRQRLEQHSL
FT                   CGTGTTAKLVADTTGLPVIAFKSGPLGGDQQIGSRIVEGHIDFMIFFWDPLEAQPHDPD
FT                   VKALLRIAVLYDIPVANNASTADFLISSPLMDKEYERTIVNYSKIRSSRTKE"
FT   gene            381805..382974
FT                   /locus_tag="Clos_0327"
FT   CDS_pept        381805..382974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML73"
FT                   /protein_id="ABW17890.1"
FT                   /translation="MKKTLLIGLLVISMLAMVGFTPVEASYWQTMKEMYEWNGTEGETA
FT                   LEIKLAIPDMEKEYKVQIISKSNLKEFITYSEIHIEDVKEGKNIPTIKMYTNGSNIYLN
FT                   KEAAIAFVTATGFGETVEIAEDYVMLEGSQNTVKFDSNILNDAIQFIEGMDLGIDLGMK
FT                   KDGDTFKLTLDSDQLIDLFDAYMRYVLTNMDKMPKSFMPEEIVISEEEKQEMLEQYDAF
FT                   VTLYKDTAKEFMKGSKFYQESTLTNNKYSAKSEVLLKTPMGELEVKTVGTSVKLDSANI
FT                   ELPSSVKKITEEELSSLILGQIMPDVDVDTGLKAIVELDGSYIKFGELDFEEGNITLKI
FT                   EEGKAYITAEDALELLGVEVEGVSHIRDLEDYGFFVEWNEELKTIEIYQ"
FT   sig_peptide     381805..381882
FT                   /locus_tag="Clos_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.810 at
FT                   residue 26"
FT   gene            383199..383765
FT                   /locus_tag="Clos_0328"
FT   CDS_pept        383199..383765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0328"
FT                   /product="metal dependent phophohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; KEGG:
FT                   amt:Amet_3102 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17891"
FT                   /db_xref="GOA:A8ML74"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML74"
FT                   /protein_id="ABW17891.1"
FT                   /translation="MKTRQEAYELLTKYNKNESLIKHGLAVEAVMRYFAKQFRENEEYW
FT                   GNIGLVHDLDYELYPEEHCHKTKEIMEKEGVHEDIIRAVISHGWNICIDVKPEHKMEKV
FT                   LYTIDELTGLITATVYMRPNKSILDLEVKSVKKKFKQASFAAGVNREVILAGCEMLGMD
FT                   LDTVILWTIDGMKEAAEALDLVGTI"
FT   gene            384234..385199
FT                   /locus_tag="Clos_0329"
FT   CDS_pept        384234..385199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17892"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML75"
FT                   /protein_id="ABW17892.1"
FT                   /translation="MERKRITVLLIFLLTLSSITTAFAYAPDVKQNINFDRLNENYSKA
FT                   ITELENIIPLHKYNFKAKRLNLFSDNLVVNNSEVEYTEYFEDNNTILIVTENDYAIATK
FT                   RGDGILIIDYNNGKRQELIIDLDKILSSQNKKEISTDIGPYSHDYTTEVFSPKGYYEYY
FT                   EMRGGGNYRLYTLTIPRSNGSSRSNSRGTSSSSTQTFEYMADQFLENIYEAQDLESSVE
FT                   DGVIDLGVGLFLKWLSNRAKDIEKAISITMSVVEVTSTLTNTGAKAGLMAAIDEGIGYA
FT                   SDEIGEIKEYADYLFKAYDFIQYRLIFEILNDNFELFGDV"
FT   sig_peptide     384234..384308
FT                   /locus_tag="Clos_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            386025..386274
FT                   /pseudo
FT                   /locus_tag="Clos_0330"
FT   gene            complement(386375..387745)
FT                   /locus_tag="Clos_0331"
FT   CDS_pept        complement(386375..387745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0331"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ctc:CTC00443
FT                   Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17893"
FT                   /db_xref="GOA:A8ML76"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML76"
FT                   /protein_id="ABW17893.1"
FT                   /translation="MNIEKVHGSKLGNSSFYNTLLKLAIPIVVQNFITSSINMVDTLMI
FT                   GKVGEIEIAAVGIANQYFFLFNILLVGITSGSGIFLSQYWGKKDIKNIRKILGISLISS
FT                   VIASILFTIIALIAPSGIIRLFNKDPYVIQLGVDYLLIVCFSYIFTAISMAFGVASRSV
FT                   EDSVAPMLVSILALLTNATLNYAFIFGHFGFPVMGVKGAALATLIARVVEAIALVLYLY
FT                   GKKSPLAAKLKEMVDSNAEFIKRAMRTILPVVINDFCWAIAAVIYSICYGSLGTQAMAS
FT                   IQITTTVQNTFMVLSFGIANGSAVMIGNKVGAGDLEEAEEYTKKFLKISMLSGLLIGLL
FT                   MSSSSKIVLSFFNVSAEVHTSALRILYINSAIMFLKVLGIVIIVGILRGGGDASYALKV
FT                   EMFTMWLVGVPLALLGAFVFKLPVEIVVFLVGFEEAAKVFFSMRRLKTNLWIKQVTE"
FT   gene            complement(387917..388633)
FT                   /locus_tag="Clos_0332"
FT   CDS_pept        complement(387917..388633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD1748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17894"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML77"
FT                   /protein_id="ABW17894.1"
FT                   /translation="MDTYSRHALYELEKWKTKMRKRPSIIDRASKGIQSKFNTVLPQGY
FT                   NDIMTSAIKTLTRAVLFGSKYITKPPVKNISLIEREKLVTEKTKFYRTTAVIEGAATGA
FT                   GGLILGMSDLPLLLSIKIKYLYDVASIYGFDVNDYRERLYILNIFQLAFSSKGHMNTVF
FT                   KKMENWDDYSDYLPDDIHNFDWDTFQQEYRDYIDIAKLLQLIPGIGAVIGSYANNKLMN
FT                   KLHDTAVQAYRMRILN"
FT   gene            complement(388863..389795)
FT                   /locus_tag="Clos_0333"
FT   CDS_pept        complement(388863..389795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0333"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: cbe:Cbei_4356 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17895"
FT                   /db_xref="GOA:A8ML78"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML78"
FT                   /protein_id="ABW17895.1"
FT                   /translation="MSKIYKSLTELIGKTPLLELSNYNAKHNLGGKIIAKLEYFNPAGS
FT                   VKDRIAYAMVVDAEEKGLLKPNSVIIEPTSGNTGIGLASVAAARGYKVILTMPETMSVE
FT                   RRSLLKAYGAEIVLTEGALGMKGAIAKAEELAAEIEHSFIPSQFSNPANPLVHMKTTGP
FT                   EIWEDTDGNVDVFVAGIGTGGTISGVGEYLKSKNPNIKIVAVEPVDSPVLSEGRAGAHK
FT                   IQGIGAGFVPDTLNTKIYDEIMTITNEEAFNTGKEIAKEEGLLVGISAGAAVLAAAKLA
FT                   NRPENKDKNIVVILPDTGERYLSTPLFEE"
FT   gene            390036..391262
FT                   /locus_tag="Clos_0334"
FT   CDS_pept        390036..391262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17896"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML79"
FT                   /protein_id="ABW17896.1"
FT                   /translation="MGLIKAISSAVGGSLADQWLEVIEPDDMGDNTVFTSGVAVRKDDR
FT                   RGSNKRGTADTVSNESIIHVYPNQFMILVDGGKVVDYTAEEGYYKVDNSSLPSLFNGSF
FT                   KDSLKETFNRIKFGGVTPTTQRVYYINLQEIKGIKFGTPNPLNYFDNFYNAELFLRTFG
FT                   TYSIKITDPLLFFTEAVPRNKDRVEIQDINEQYLSEFLEALQAAMNQMSVDGIRISHVA
FT                   SRGGELSKYMANILDEEWKKTRGMEIQAVGISNISYDDESKELINMRNKGAMLGDPSVR
FT                   EGYVQGSIARGIESAGSNQGGSTQAFMGMGIGMQNAGGFMDAASSANQRQVERQQEERR
FT                   REASSSQRVDSAKSEGKSWFCTECGAKNAGNFCAECGTKRPAPSQCSNCGYKPTGDTPK
FT                   FCPECGNKF"
FT   gene            391302..392324
FT                   /locus_tag="Clos_0335"
FT   CDS_pept        391302..392324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17897"
FT                   /db_xref="GOA:A8ML80"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML80"
FT                   /protein_id="ABW17897.1"
FT                   /translation="MTTKSYKCPSCGAGIHFKPARGKFHCDYCLSEFLEEELQNKVENN
FT                   SEDTLQSVNAYHCNSCGAEVVTDETTTATFCYYCHNPVIISSRLSGEFKPNKLIPFSVD
FT                   KEKAKQIFLSWAQNKRFIPRDFTSNSQLEKITGVYLPYWWADCTADVHYVGEGRNIRVW
FT                   RSMGREYTETKKYEILREGQINLNNVEEVAFSKIDKNLLNGIAPYNTSQVKAFSMPYLS
FT                   GFFAEQYDIAKDRVFPMMKNQVDRYSKSLIKESVNGYQHVHNIRNNVDVSIREWHYTLL
FT                   PAWILTYRYRGKTYVYAVNGQTGKSFGELPLSRSRVLTTFGVISGITSIALLLGGRFIW
FT                   "
FT   gene            392318..393157
FT                   /locus_tag="Clos_0336"
FT   CDS_pept        392318..393157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0336"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   bha:BH1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17898"
FT                   /db_xref="GOA:A8ML81"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML81"
FT                   /protein_id="ABW17898.1"
FT                   /translation="MVKMLQKPKGICLLIVICIFAFYPITVSGQKPLVFDDALLFSTEE
FT                   KIDLDTKANELSDQYNMDIVVVTTNDANGKSTRAYADDYFDYGGFGVGENYDGLLFLID
FT                   MDHREAYISTSGIGIKYLTDERVEAILDRVFEYGLSQGNYYGAAMEFLNGAEMFLEKGI
FT                   PSDQYNEVEKIKVPNRITEMDVIISLIGGLATGSIFYFSVRSKYKGKSNSNQYSYKNNS
FT                   IVRFTSNQDRLVNTFVTHRVIPKPQPKNNSSKPSTSGRSTVHKSSSGRTHGGGGRKF"
FT   sig_peptide     392318..392407
FT                   /locus_tag="Clos_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.702 at
FT                   residue 30"
FT   gene            393196..394041
FT                   /locus_tag="Clos_0337"
FT   CDS_pept        393196..394041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0337"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: cbe:Cbei_0552 apurinic endonuclease Apn1;
FT                   TIGRFAM: apurinic endonuclease Apn1; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17899"
FT                   /db_xref="GOA:A8ML82"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ML82"
FT                   /protein_id="ABW17899.1"
FT                   /translation="MLNIGCHLSSSKGYKAMGKDAISINANTFQFFTRNPRGSKAKAMD
FT                   LKDVEGLLQLMEENKFAKILAHAPYTLNPCSADERTREFAMEVLVDDLARMEYLPNNFY
FT                   NFHPGNHLKQGVEVGIEYIVNSLNDVLKPDQTTTVLLETMSGKGTEIGKNFEELKQIID
FT                   GIKLSNKVGVCLDTCHVYDAGYDIVQDLDGVIQEFDRIIGLDKLYAIHLNDSKNPFASH
FT                   KDRHAKIGEGYIGEEGIVRIINHPKLRHLPFFLETPNDLEGHGEEIKMLREAYRDESIL
FT                   "
FT   gene            394247..394879
FT                   /locus_tag="Clos_0338"
FT   CDS_pept        394247..394879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML83"
FT                   /protein_id="ABW17900.1"
FT                   /translation="MRVNQEVNPIRKIFCMCLLLVMILTGCSRRIKPIKVTTTDFNIQE
FT                   AEIIMKRAWQPVHDMTSSDYETRPNIKISSKEEFFNLYDFSFMDQSYMCDMIYENIATF
FT                   KYDKEENDSKEIKDNEGYVVFTEGKYIPTIHDKGVFIKRAYLRESRYSKEHSYFDRVEL
FT                   VVDESRNEKISGYASGFSRKNIFIQNEEGEWILHSIEGHISTSWTRE"
FT   gene            395017..395823
FT                   /locus_tag="Clos_0339"
FT   CDS_pept        395017..395823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0339"
FT                   /product="histidinol phosphatase"
FT                   /note="KEGG: tte:TTE2610 histidinol phosphatase and related
FT                   hydrolases of the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17901"
FT                   /db_xref="GOA:A8ML84"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML84"
FT                   /protein_id="ABW17901.1"
FT                   /translation="MIDMHVHLERGAYTEEWLMEFVRYAQERGITKLHLLEHSHRFDEF
FT                   QNIYECISKDVDDGECQKEWLERKTKIKLWEYKNFINEMRKMDFPIEINFGLEICYFPD
FT                   KEKEIEECVSNFHWDFLTGSIHWVDGWGFDNPENKESWHKKDIDHIYMRYYGLMIQLVK
FT                   SGIFDVLAHPDSIKCFNYYSSIALDDVYKKLALALKDHKVQVEFNNGLFINYNHEELGT
FT                   NRKLLKILLENGVEIVTASDAHTPEDVGRFILEANDIINKFKEKDF"
FT   gene            396048..397031
FT                   /locus_tag="Clos_0340"
FT   CDS_pept        396048..397031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA2899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17902"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML85"
FT                   /protein_id="ABW17902.1"
FT                   /translation="MLKLKYLFDNRDLAEMILKNWDYDLDSIKLFDFYRISANAVYPFR
FT                   YNEKVRFLRFSPTTEKDRNNLVAELEFIDYLKTKDYAALCIVASKHNRKLEEVTTPWGD
FT                   YFAVVFEKVSGRSLEEIEYTEEICRKYGTYLGKLHKLSSEYQPQNYSHWSYEDVLTWIE
FT                   KELIKFPDEILAKQEVDTIRKALEELPKNNQNFGLIHYDFELDNVFYDQDTDTLSVIDF
FT                   DDAMYHWYAMDIQKALDSIESEIDSEGYTIMKENFIEGYRQEFNVSDEMLSYMPIFKRF
FT                   SNLYAYLRMLSSSEEIWLNEPKWLNELRGKFSMAMKQRSVSFGEPI"
FT   gene            397157..397714
FT                   /locus_tag="Clos_0341"
FT   CDS_pept        397157..397714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0341"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   amt:Amet_3366 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17903"
FT                   /db_xref="GOA:A8ML86"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML86"
FT                   /protein_id="ABW17903.1"
FT                   /translation="MTDRNGLDFPIIETDRLILKEIKVEDAMSIFSIFSNEEIMKYYGQ
FT                   FPMNSLGEAENLIEIFNDNFRSGRGIRWSIFLREENRQIGTCGYHNWNKRHSRAEIGYE
FT                   LSIDAWGKGYIKEALKVIINYGYEFMNLNRIEAVVYPENEASIKCLMNLGFKQEGLLEE
FT                   YAFFREVYQNLIMFSLLKNNIK"
FT   gene            397839..398330
FT                   /locus_tag="Clos_0342"
FT   CDS_pept        397839..398330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0342"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: rci:RCIX623
FT                   hydrolase (isochorismatase family)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17904"
FT                   /db_xref="GOA:A8ML87"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML87"
FT                   /protein_id="ABW17904.1"
FT                   /translation="MKIGFLIIDMQEIFLRNQVEKKMIDKTCEYINYTADLLRSKDHVV
FT                   IHIQDIEGMEASNQQNYDFIPEIEVMDKDLKITKENSNAFWKTQLEQILLENGIDFLII
FT                   SGFAAEYCVLSTYNGAGERGFKSVILQQGVLSTDNDAITSIYKYRNVISYPVVEYLVDR
FT                   "
FT   gene            398476..399114
FT                   /locus_tag="Clos_0343"
FT   CDS_pept        398476..399114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0343"
FT                   /product="HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: amt:Amet_2262 HAD-superfamily hydrolase,
FT                   subfamily IB (PSPase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17905"
FT                   /db_xref="GOA:A8ML88"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML88"
FT                   /protein_id="ABW17905.1"
FT                   /translation="MKKFKVVCFDMDGTLITNTNSVEYLCILNGRREEVKEIEEREGND
FT                   EISWIDADYIKSKLIAGLPVQSVEDRFKDHIKLIDNIEKVLQELKSNNILSILVTAGPV
FT                   QVAQVLGKIFKFDKICGSIYETKNDVFTGKILKHLGDDGKLDRLISFCDENNIDLDQVA
FT                   SIGDSASDIKVFEKSGKSIAINYSSKLVGKANVYIKTDDLYDVLDHIIQ"
FT   gene            399392..400201
FT                   /locus_tag="Clos_0344"
FT   CDS_pept        399392..400201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0344"
FT                   /product="adenylyltransferase"
FT                   /note="PFAM: Streptomycin adenylyltransferase; KEGG:
FT                   bha:BH0322 aminoglycoside 6-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17906"
FT                   /db_xref="GOA:A8ML89"
FT                   /db_xref="InterPro:IPR007530"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML89"
FT                   /protein_id="ABW17906.1"
FT                   /translation="MNGSRTNPNVPKDIFQDYDIVYVVTETESFIEDRQWINIFGEFIM
FT                   VQEPDRLDKAIGMKVDFSQSYAYLMLFVDGNRIDLQIETKEYMMKNYLKDKLTVPLLDK
FT                   DHCLPDIPLPTERGYYIKRPTEGHFISCTNDFWWCLQNVAKGIWRDQLPYSKYMFECIV
FT                   RTNLEYMISWWIGIAYDFQVSLGAMNKYFKKYLPKEYWKMYEKTYADSNYDHIWEAIFV
FT                   ACQLFRILGRDVATAFDFSYPEEDDLKMIKYLRCVKDLPVDAKEIIT"
FT   gene            complement(400261..400767)
FT                   /locus_tag="Clos_0345"
FT   CDS_pept        complement(400261..400767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17907"
FT                   /db_xref="GOA:A8ML90"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML90"
FT                   /protein_id="ABW17907.1"
FT                   /translation="MSEKTNAKRYLTSTKRIKFNIFGGVGTLCLGLLYLNIISKWQIPG
FT                   IFYLLTLSISIPILFLSSDPSRYNVIEVDDHGIRFIPIYNKEDYISFEWQYIKVCIAGK
FT                   LGLSNGLIPYVGKGLEIHYLYGTGVNKSIVSYRYPLGHIADYDGLLEDIQHRCTQYHIS
FT                   FEEIE"
FT   gene            complement(400797..401381)
FT                   /locus_tag="Clos_0346"
FT   CDS_pept        complement(400797..401381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17908"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML91"
FT                   /protein_id="ABW17908.1"
FT                   /translation="MIKVKYFLLGLIILILCFPTIGCKKLSHPINKIEATPAEMNYAHD
FT                   NSDKIHLQKDILDIDQPEIAEYLSYDSSRETKFLYIAHLKIFKEFGTENEGFVLLYPGE
FT                   NILNFRITKTTGTITGAVDGPFISFDLDLSRNTILRKESISAPHYGAYERPEFAEHSNK
FT                   VIEITDERMIEIGNYFYELMARFEDIIQNPK"
FT   sig_peptide     complement(401313..401381)
FT                   /locus_tag="Clos_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.729 at
FT                   residue 23"
FT   gene            401707..402312
FT                   /locus_tag="Clos_0347"
FT   CDS_pept        401707..402312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17909"
FT                   /db_xref="GOA:A8ML92"
FT                   /db_xref="InterPro:IPR035406"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML92"
FT                   /protein_id="ABW17909.1"
FT                   /translation="MIILMDLIGYSFISPVVQNIFYMFYILTSFYILYGIKKENQVRIS
FT                   HWALTILSLILFIIILRNSIIGFPLLFIFPILASKKSPMILKLISWIAYIAVCLFFCLC
FT                   VFIRHGFARTYVLSNEISPDKRYNAAVIVQDQGALGGAIEVRAERLYGGIVKKSRVIYT
FT                   DRLSEPKIQWVNDHTIKINDLEIDLNERNILGKKTINL"
FT   gene            402347..402787
FT                   /locus_tag="Clos_0348"
FT   CDS_pept        402347..402787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0348"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bld:BLi01189 YitI"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17910"
FT                   /db_xref="GOA:A8ML93"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML93"
FT                   /protein_id="ABW17910.1"
FT                   /translation="MLEVRTIDAEMTYDIRHKILRPHQSLADCKYDTDLYEGAFHVGGF
FT                   YEGKLISIVSFCIENHPDFSLEKQYRLRAMATLEDYRKLNAGRKIVAYGEEILKEQGIQ
FT                   FLWCKGRTGVQEYYSKLGFKPHGEVFDYPPIGPHIIMYKKLI"
FT   gene            402812..403849
FT                   /locus_tag="Clos_0349"
FT   CDS_pept        402812..403849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0349"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   btl:BALH_2911 possible microcin C7 self-immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17911"
FT                   /db_xref="GOA:A8ML94"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML94"
FT                   /protein_id="ABW17911.1"
FT                   /translation="MKELKKPKKLKVGDKVALVSLSWGGAGDPDLQWRYRQGKERLEKV
FT                   FGLEVVEMPHTLAGTEYVYNHPEKRAEDLMKAFEDDSIKGIIACIGGIDSVRMLPYIDF
FT                   DVIHKNPKIFMGYSDTTTTHLICHKAGVSSIYGPTLFMDFAENVSMDAYTVEYIQKTLF
FT                   SAEPIGEIGPAEMWTSEFLSWEEKNKEIRRKYKKNQGYELIQGKGTVQGRLIGGCIEVF
FT                   YMLRGTEIFPELEDFEDTILFLETSEEKPQLWFVECALRNYGITGILEKIKGLIFAKPQ
FT                   DEVYYEEYKEVIKKVMKEFNKEDMPVLYNMNFGHTEPKICLPYGALAEIDCEKVSFSIL
FT                   ESGVI"
FT   gene            404098..404628
FT                   /locus_tag="Clos_0350"
FT   CDS_pept        404098..404628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0350"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bsu:BG11573 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17912"
FT                   /db_xref="GOA:A8ML95"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML95"
FT                   /protein_id="ABW17912.1"
FT                   /translation="MEENDLDFTFSTGGEYELSQVIEIYGQPLLRYCHNILCDYFEAQD
FT                   VVQTTFIKAYDRRKSFQVGTSLSAWLYRIAYNTCIDSLRKKKLLFFMPHREKKEASNFI
FT                   GEDLKRALLSLRPEERALVFSRVIDEKTYEELERIYQIPSATLRKRYERAKKKLSKNLK
FT                   EMNSYYRGLEETK"
FT   gene            404625..405968
FT                   /locus_tag="Clos_0351"
FT   CDS_pept        404625..405968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY1733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17913"
FT                   /db_xref="GOA:A8ML96"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML96"
FT                   /protein_id="ABW17913.1"
FT                   /translation="MKYDCDEIMIKTALDTIETPTYNMNFEVEKKIKTRDSRKYLNQSK
FT                   FMIVSLSLFLILSVSVAAATMDSFNRLISMVSPEIALLLQPIGVISEEDGIKVEVVGAF
FT                   HDDEMAVVYFTMQDLVGDRVDETLDIYDYSFSGARMFNIQLVHYDEITKTATLRMEANG
FT                   GKKLSGKKVSFLIRSFLSDKTTFDEVDMGINLLEIQQTNAFQRVPLNMNNIPGGGGPDL
FT                   DLYGELKEKGIIDVLKTDEMKIQLPNMDFMYISNIGYIDEYLHIQIKWSGDGVDDHGYL
FT                   YFVDALGNKIYYNASVTFGADELGNTVYGSEYVEYIFDMSSIHADEVRLEGNFVSDNKY
FT                   TEGSWKTTFKLESAEEKRVNCSLQSDTWKIHKVSVSPIGITFEGNGEVDDLQEISPSIT
FT                   MMDGSVQTFHGSRSYAEDHEFRLKFVSDTPLDISKIKSITIDGQVIML"
FT   gene            406034..406498
FT                   /locus_tag="Clos_0352"
FT   CDS_pept        406034..406498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0352"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cac:CAC3374 predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17914"
FT                   /db_xref="GOA:A8ML97"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML97"
FT                   /protein_id="ABW17914.1"
FT                   /translation="MRTIDYITGGSELLEFVRPLWNLLNEHHQINSMYFSDRYRNLDFD
FT                   TRKKKFMTDTNKELRIDLVKDVERQVFIGYCISTVTIDFVGEIDSLYIEPDYRKFGIGH
FT                   QLMELALEWLDRKNVKTKIIGVAEGNEEVFDFYSKYGFFKKTTILEQVKN"
FT   gene            406666..407562
FT                   /locus_tag="Clos_0353"
FT   CDS_pept        406666..407562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0353"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; Protein of unknown function DUF250; KEGG:
FT                   ter:Tery_2183 protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17915"
FT                   /db_xref="GOA:A8ML98"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML98"
FT                   /protein_id="ABW17915.1"
FT                   /translation="MNMSRIGEIAALATACCWTISATSFEIAGKKVGSLSVNYIRLVIG
FT                   FIFISVYSYFTRGMFFPIDATASNWIWLTISGLIGFFIGDLFLFQSYLEVGSRISMLIM
FT                   AASPPITAILGFFIMKERIDMIGVLGMSITMVGIAMVILSKNPEDKNIEVKYSVKGLTY
FT                   AFLGALGQSVGLIFSKIGMGDYSPFAATQIRIIAGFISFTVLFIILNKWEDLKAALKEK
FT                   QAMVHITVGSVFGPFVGVSLSLISIKYTSAGISSTITSIVPVLIIPLSILVFKEKVKTK
FT                   EILGAVVSVVGVALLFI"
FT   sig_peptide     406666..406740
FT                   /locus_tag="Clos_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.680 at
FT                   residue 25"
FT   gene            complement(407614..409632)
FT                   /locus_tag="Clos_0354"
FT   CDS_pept        complement(407614..409632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0354"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dsy:DSY3380
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17916"
FT                   /db_xref="GOA:A8ML99"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ML99"
FT                   /protein_id="ABW17916.1"
FT                   /translation="MEKNQRNKSIAREITLYISAFAAFICIIIGGTSIFMSRSSMIKQA
FT                   ESSLTTINELGAEKVKIVIDDRLLILQELAHSARTQTMDFSVQQESLKGDVERLGYLDM
FT                   AIVNLKGEAHYILDNHTANLSDREYVKRALDGEANVSDVLISKVTNSAVLMYAVPIEVD
FT                   NKVVGALIARRDGNALFDVIDQIVYGETGYTYILNTHGIVVAHPNRDYVMNQFTPIEDA
FT                   KTDPTLEDLARAVGEILANPYGLSRYNFNDKEMYNAYTAIEGTHWILVSTAPQNEVLSS
FT                   VNALIKTLSLILAVILVVSILISLVLGRTLTKPILSLTKLVNRQADLDFSPIDQGTIQA
FT                   VVKRKDEIAQMAVALQSMAQNVRGLIVNVAETSEQVSATSEELTATSQQTATASQEVAQ
FT                   TIIDIAEGATEQASNTLEAAAALESLSLEIEKNRARTGSLSQAFSKINEHVSAGLKAIQ
FT                   LLNAKTRENSTASDIVFNSILKTNDSSLKISEASNLILSIAEQTNLLALNASIEAARAG
FT                   EHGRGFAVVADEIRKLAEQSRSSTEIINQIVTNLLGDAEMAVAKMKEASAIVEEQAQSV
FT                   DLTGNVFNLITHAIKDSERLVGEIDDSSKKMKQSNDRVSNNISMLSAVAQQNAASTEEA
FT                   SAAIEEQTASAEEIASASEDLSEMAQSLQELIHKFNI"
FT   gene            410018..410707
FT                   /locus_tag="Clos_0355"
FT   CDS_pept        410018..410707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0355"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ctc:CTC01895 metal dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17917"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA0"
FT                   /protein_id="ABW17917.1"
FT                   /translation="MNIIVLNIEFKFAHIEDTIHPVILQDDKEMILVDCGYTGFMPMIE
FT                   EAMAAENLDCNQLTKIIITHHDHDHMGALADFKKKYPQIRVVASEIEAPYIEGKKKSLR
FT                   LEQAEALQHTLSHEEKPFGEAFCKVLRAVEPVKVDQVVKDGEAMDWCGGCVVISTPGHT
FT                   PGHLSIYLKEEKTIITGDAAVLENNELVIANPKFTMDIEQAHKSMSKILDYDANTYICY
FT                   HGGIFKR"
FT   gene            410779..411357
FT                   /locus_tag="Clos_0356"
FT   CDS_pept        410779..411357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17918"
FT                   /db_xref="InterPro:IPR025365"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA1"
FT                   /protein_id="ABW17918.1"
FT                   /translation="MAHKFIDIEYLLQGNPKQKMAYDVIKKLKVMEILKKHGPILAGTI
FT                   PIDIDIDSSDLDIICEVHHPEEFIHRLNSEFGDLLNFSLETLWIDGKITVLCSFVADGL
FT                   TLEIFGQPTKSMDQNAYRHMVVENRILEILGNTAKEEIRGLKREGYKTEPAFGVYLNIV
FT                   ENPYEFLLSMYDWDYNQFLEYLKDRRVSI"
FT   gene            411434..411760
FT                   /locus_tag="Clos_0357"
FT   CDS_pept        411434..411760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17919"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA2"
FT                   /protein_id="ABW17919.1"
FT                   /translation="MSKYIFNVSVSPVEAMEIVKDRQSADLVHEELLDLGDGRYVATLI
FT                   YEKYYFRANNRAALIVIMDNVHGTTSIRSISTGSSEGFFFNFDWGAADDFAGSVERIFK
FT                   DFMI"
FT   gene            411784..412800
FT                   /locus_tag="Clos_0358"
FT   CDS_pept        411784..412800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0358"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: dsy:DSY1229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17920"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA3"
FT                   /protein_id="ABW17920.1"
FT                   /translation="MKNVHQNLKEKIDHMPLKPGIYQMKDIEGNIIYVGKSKSLRSRVR
FT                   SYFYGEHESEKINRMVFHIEDIHYIVTDTHLEAQILECALIKKLQPIYNQQFKNDQRYM
FT                   YLKIEAYNRFKPLSAVYEKEGHYCLGPFRNKNVLFDTVQFFQNIYPLCKNDHGYEFIYK
FT                   IFPESIEKEGFEINRNSLIEIFSNKDCMEGFITELQTQMNGFALELRFEMATMYRDMIH
FT                   HMNYLYHNIHWSKEAENRKLLLGEKIHHGYKLFYISGDRILLKEKLEAPTCQSVEQFLE
FT                   RAQDVEIKNGPIANEKRNLDFKKIIQSEIKDQSQKVLLFLDEEYDLAGFVQLLYNLE"
FT   gene            412826..413884
FT                   /locus_tag="Clos_0359"
FT   CDS_pept        412826..413884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0359"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   cac:CAC0196 NADH-dependent flavine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17921"
FT                   /db_xref="GOA:A8MLA4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA4"
FT                   /protein_id="ABW17921.1"
FT                   /translation="MHKAFTPYKIKDLEIKNRMVLPPMVAFTFAGEDNFVSEKNIDHYA
FT                   SIAKGGAGLIIVEATCVSKDGRLSEDQLGIWSDDFIPGLRKITEACHQHDAKVFIQLHH
FT                   AGLRASKKIKEDTVTSWNYDNGKVSARALTKEEIHGIEKDFIDAAIRAEKAGFDGIELH
FT                   GAHSYLLTQFFSSKVNQRTDEYGGSLENGMRMATEIFKGIKEKVQDDFVIGIRMGSNEN
FT                   DLQTSIEMAKKFEALGMDYLHISTGFDNTPIETELPEDFPCNWIVYGATKIKEAVNIPV
FT                   VAVNSIKTAEHIQYLVDGDLVDFVAIGRAQLADYNFVKHLQEGNGIISCLECNPCQWFT
FT                   NGENCPRHKIIN"
FT   gene            complement(414424..415116)
FT                   /locus_tag="Clos_0360"
FT   CDS_pept        complement(414424..415116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0360"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: chy:CHY_0702
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17922"
FT                   /db_xref="GOA:A8MLA5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA5"
FT                   /protein_id="ABW17922.1"
FT                   /translation="MALRLIDLSQEIFQGMSVFPMHQPTFIMTNMTHEENMVATGSKKL
FT                   GFSARNLLISEHGGTHCDAVWEYKPSGATIDKMPLNYFWGSAICIDVSHIPPTRRIEPK
FT                   DLEAAVAKSKQELQRGDIILLYTGHYERSFGTDRWQTTYTGLSYDGAKWLAEKGVVNIG
FT                   VDAPAIDHPEDLDFSGHLICGEYDITNTENLCNLDQLVNQRFLYFGLPLKIRDGSGSPI
FT                   RAVALLEE"
FT   gene            415471..416379
FT                   /locus_tag="Clos_0361"
FT   CDS_pept        415471..416379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0361"
FT                   /product="glutamate formiminotransferase"
FT                   /EC_number="2.1.2.5"
FT                   /note="KEGG: chy:CHY_0695 glutamate formiminotransferase;
FT                   TIGRFAM: glutamate formiminotransferase; PFAM:
FT                   Formiminotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17923"
FT                   /db_xref="GOA:A8MLA6"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA6"
FT                   /protein_id="ABW17923.1"
FT                   /translation="MSDEKKYVLAVPNFSDGRRMEVIEAIVKELQNVEGVKLVSYEPEH
FT                   DFNRTVVTVIGEPEPLKEALLNMAGKSYELINMEEQKGTHPRIGAQDTIPLFPFKNITI
FT                   EECKEMAEAIGKEVYERYHVPVYFSGLNARCEERKALSFIRKGQYEGLKEVAHLDERKP
FT                   DIGPAALHPTAGATIVSADYEGLTAYNVFLATEDLEIAKQIAKGVRGPSGGFSTVRAVG
FT                   IKFPERTGVVVSMNMFDCANTPLYRAFNFVKNEAARYGVAVTGSELVGPVKLDYLLNSL
FT                   EYYLGLENFRKDQILENHLIQ"
FT   gene            416403..417818
FT                   /locus_tag="Clos_0362"
FT   CDS_pept        416403..417818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0362"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: chy:CHY_0678 allantoinase; TIGRFAM:
FT                   dihydroorotase, multifunctional complex type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17924"
FT                   /db_xref="GOA:A8MLA7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA7"
FT                   /protein_id="ABW17924.1"
FT                   /translation="MKYDVIIKNARIPQGDDTMLTNILVKDEKIAGFLQDLEGIEYGRE
FT                   IDAEGNLTIPGCFDSHTHFMDPGFTHRENFLTGTSSAAAGGITTIMDMPCCSKPSVRSI
FT                   PELESKLNAIKDKAIIDFAFWGGVTGEDVRNDNLEHVKAQADYGVCAFKVYMTPSVPTY
FT                   ERVTDPEMLEAFRAVAKTGLPVGIHAENYAMCDYYVKKFQKEGRLDGPAWAEARLELAE
FT                   KAAIQLGISFAEETGARLHIVHMSTGIGAKLVGEAKKKGLDVTSETCPHYLTLNYQDAM
FT                   TEHKQYAKIAPPLRTKRDNEELWEGLQNGSVDFIATDHAPYEIETEKEAEGVNIWTAFP
FT                   GIPGVETMVPILVSEGYNKGRLTLSRLVEVLSTSAAKQYGLYPKKGAMHIGSDADFTII
FT                   DLNKEWTIDQKKTYSMAKYNPLHGIQLKGKPVKTVVRGTLVYDDKEGIVGKEGFGQFVK
FT                   RQNIQKLDRVIKY"
FT   gene            417831..418433
FT                   /locus_tag="Clos_0363"
FT   CDS_pept        417831..418433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0363"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: chy:CHY_0679
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17925"
FT                   /db_xref="GOA:A8MLK8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK8"
FT                   /protein_id="ABW17925.1"
FT                   /translation="MPRHAILVIDMLNDFVGEKAPLRCPGGETIIPDLQKLFKWVRGRE
FT                   NDDVHLVHIQEAHRKNDADFRVRPVHAVDGTWGSDFIQELYPEEGEYIVKKRRHSGFAH
FT                   TDLDLYLREENIDTVVVTGVWTNVCVRSTATDALANAYKVITLSDGCASKTEEMHEYGL
FT                   NDLSIFTKVMTIDEYVAAWERGEDPWLGGGDRENKVE"
FT   gene            418533..419087
FT                   /locus_tag="Clos_0364"
FT   CDS_pept        418533..419087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0364"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: chy:CHY_0680
FT                   putative 3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17926"
FT                   /db_xref="GOA:A8MLK9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK9"
FT                   /protein_id="ABW17926.1"
FT                   /translation="MKIIVGLSGGSCAIYGVGLLKVLKELEIETHLVVSTMGEYVANHE
FT                   CGISLEELKQMATYFHENKNLAAPIASGSFKTDGMIIVPCSMRTLGAVANGLSDNLLTR
FT                   AADVVIKERRKLVVVPRETPLSVIHLENMLKLAKIGVTVMPAAPGFYHQPETIGDIVSI
FT                   MVGRILDQMDIQHNLFKPWGD"
FT   gene            419108..420463
FT                   /locus_tag="Clos_0365"
FT   CDS_pept        419108..420463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0365"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: chy:CHY_0681
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17927"
FT                   /db_xref="GOA:A8MLL0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL0"
FT                   /protein_id="ABW17927.1"
FT                   /translation="MEEQMLRGALKKLEDRGQLLKCNREVDPKFELGAVLKHFNNEQPI
FT                   LFNKIKNHSMPVIGAMFGNRDLYYEMLGATRKDRIFKMMNAIANPKPTKLLSKGPVMEN
FT                   IISRNIDLTKMFPVPTFHGGDSSSYITAGIVALKDPETGQRHISVRRLQINGGNEMSIL
FT                   VASPLAKEQFAFMEAQNKPLEVAIILGYDYHLLLASQISAATYGVDKYEVDSALRGEAL
FT                   ALVKCQSIDLEVPAYAEIVLEGIMPPHKRVAEGPFGELMGYYGERAMHPIVQVKTVMHR
FT                   HHPIFQTSFPCREEHLANGLIREIELYSILKNLVDVKDVNVTVSGGCRFHTFISIHKRF
FT                   EGDGKTAIIGALASSKDVKHVVVVDEDVDIYRHDEIEWAIATRFQASKDMVVVEGALGS
FT                   GLEPSHIQRGVTDKVGIDATKPLGEAGKGFTRAIIPEYEEIDIHKYFPELNG"
FT   gene            420510..420776
FT                   /locus_tag="Clos_0366"
FT   CDS_pept        420510..420776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0366"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: lre:Lreu_1741
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17928"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL1"
FT                   /protein_id="ABW17928.1"
FT                   /translation="MMKQALGMIETRSLVAAIEAADTMVKSADVKIVDLNYVGSGIISV
FT                   IVSGEVAAVQAAVSNGTEAVKGIGEIISTNVIPRPHDEVSKIL"
FT   gene            420795..421109
FT                   /locus_tag="Clos_0367"
FT   CDS_pept        420795..421109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17929"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL2"
FT                   /protein_id="ABW17929.1"
FT                   /translation="MILTNLLIKKVMDNMARQYRKENGISDSMSTMNEISGNISKAEEA
FT                   LLVNIIKNKEESSAMKSCTGQKVSLGELATYQEKDSERKKNAPSKISLEELAKKQCKTN
FT                   "
FT   gene            421122..421499
FT                   /locus_tag="Clos_0368"
FT   CDS_pept        421122..421499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0368"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: chy:CHY_0684
FT                   bacterial microcompartments family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17930"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL3"
FT                   /protein_id="ABW17930.1"
FT                   /translation="MKAALGLIEAIGLTTAITALDAASKAADIKLVGYEKVIGAGKAVS
FT                   VTIQIAGDVAAVKASVDAGVAAANKIGQVLSYHVIPRPHEEVDLLIKAFEKNLKSKDQK
FT                   SLEGMEENKKNKDKKTKKEEE"
FT   gene            421503..421778
FT                   /locus_tag="Clos_0369"
FT   CDS_pept        421503..421778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0369"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: amt:Amet_4577
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17931"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL4"
FT                   /protein_id="ABW17931.1"
FT                   /translation="MSQALGMVETKGLVGAVEAADAMVKAANVTLVGYEKIGFGLVTVM
FT                   VRGDVGAVKAATDAGAEAARAVGELHSVHVIPRPHSEVERVLLKGE"
FT   gene            421811..422230
FT                   /locus_tag="Clos_0370"
FT   CDS_pept        421811..422230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17932"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL5"
FT                   /protein_id="ABW17932.1"
FT                   /translation="MSSYNKARGIMEELGLRAKKSTSKKVFVVVLEGTEAEFDEIRRLG
FT                   GVELDDMSVLSRLPKVLTNLVRSTYASDVKSRDNDGYDKSIQKNVSISTESVVTERDVA
FT                   QMPEEVQEIVLKGRGIITPLARDLAQKRGIRINKA"
FT   gene            422262..422552
FT                   /locus_tag="Clos_0371"
FT   CDS_pept        422262..422552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0371"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   amt:Amet_4575 ethanolamine utilization protein
FT                   EutN/carboxysome structural protein CcmL"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17933"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL6"
FT                   /protein_id="ABW17933.1"
FT                   /translation="MHIGRVIGTVVATRKDERLIGCKLMITQPVNVEREPIGEALITVD
FT                   TVGAGIGELVIYTMGTAARYAADKLQSPIDASIVGIIDNMDVYIGKEGDDS"
FT   gene            422549..424357
FT                   /locus_tag="Clos_0372"
FT   CDS_pept        422549..424357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0372"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: amt:Amet_4574 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17934"
FT                   /db_xref="GOA:A8MLL7"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL7"
FT                   /protein_id="ABW17934.1"
FT                   /translation="MNASMIKQAMEYRQLVDVLMSNKEFADIVLAGGNVINVLTREVYS
FT                   TDVAIKGKYILLVGDSRNLIGPETIVVDVTGRFISPGFIDSHMHFESSMLTITEFSRLS
FT                   IPSGTTTLVADPHEIGNALGPIGMKAMAMEASTVPNHVYLVVPALTPDCPSLETAGYDV
FT                   TSKDMEEILNYPNVIGIGELQGFSNAKHVYNHTPEIITDLIASTIYAKSMGKVVDGNAP
FT                   ELFGSELAAHIIATGGKCSCHETTTKAECVEKLRQGVYVFMREGSTQRNMAECIRAVTE
FT                   DGLDSRRCILATDDMVAEDLEKLGHMNEIVKRTIAEGVNPIEAIQMVTINPATYFGLED
FT                   VGVLAPGKLADIAIIQDLENMAVEAVFLEGKLVASKGELLIDLPKYTYPEEVKSSVKRL
FT                   PVEEEDLKIYAEGREAEVRCIELIPDQNLSGSLEVKVKVQNGTVLSDTAQDVLQIVCLE
FT                   RYGRNGNIGKAFVKGFGLKDGAFAESVAHDTHNIIAMGTNLKDIAEAVNHVIKMKGGIA
FT                   VTKGGKVIEELRLPVGGLITDELTGPEVSRKIAKLESVVREQLGCRVHAPFMHLSFLAL
FT                   STSPKWKITDKGLIDVNNFEILPPVL"
FT   gene            424476..425801
FT                   /locus_tag="Clos_0373"
FT   CDS_pept        424476..425801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0373"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   amt:Amet_4573 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17935"
FT                   /db_xref="GOA:A8MLL8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL8"
FT                   /protein_id="ABW17935.1"
FT                   /translation="MSVNTSKEASFLERQFKLSVHKTNVKTEVIAGITTFMTMAYILIV
FT                   NPLILSDAGMDFGAVFTATALSAAIATFMMAFLANLPFALAPGMGLNAFFAYTVVIGMG
FT                   YSWEFALTAVLFEGIIFIGMSFFNVREAIINSIPMNLKHSVSVGIGLFIAFIGLANAGV
FT                   VVSGGGTIIGLGEITAPAPILALIGIIVTGFLLAKGIKGALLLGIVITTIIGIPMGVTT
FT                   LPEQLKFISMPPSLSPIFFKFDFSQIFSLDMLIVLFSFLFVDIFDTVGTLVGVSSKADM
FT                   LDKEGRVPNVKQALLSDAVGTTIGACLGTSTVTTFVESAAGVSEGGRTGLTALTTAGMF
FT                   VLALLFSPLFIMIPGAATAPALVIVGLFMMSPIKKIELDDVTEAIPAFLTIIMMPFAYS
FT                   IAEGIVFGMVSYVLINALTGKWKKISPVMLILAILFVLKFII"
FT   gene            425996..427330
FT                   /locus_tag="Clos_0374"
FT   CDS_pept        425996..427330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0374"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   amt:Amet_4572 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17936"
FT                   /db_xref="GOA:A8MLL9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLL9"
FT                   /protein_id="ABW17936.1"
FT                   /translation="MRLLIQNGTIVTMNAGREILKGDLLIEGDEIKEVGGTIDIEADHR
FT                   IDATGKVVIPGLIQTHIHLTQTLYRGQADDLELLDWLKKRVWPLEGSHTAESNHISAKL
FT                   GIAELIKGGTTSIIDMEAVHHTEPAIEAIYESCIRAMTGKCMMDYGDGVPKSIMENTED
FT                   SIKESLRILKTWHGKGNGRIQYAFAPRFVVSCTEELLIKVRDLAKEYDVAVHTHASENR
FT                   GEIELVQQDRGMRNIQYLHKLGLTGKKLILAHCIWLDDEEMRILADTGTHIVHCPSSNM
FT                   KLASGIAKIPELLEMGANVSIGADGAPCNNNLDIFKEMSAAALIQKARLLSPTVMPAQQ
FT                   VFEMATLGGAKALGMGDRLGSLEKGKKADLAIVNLDQLHSTPSVEVDIVSQLVYAAKAS
FT                   DVETTIIDGKVVMENRKLITLNEKTIKEEANRLIKQQISLAGVQK"
FT   gene            427484..428371
FT                   /locus_tag="Clos_0375"
FT   CDS_pept        427484..428371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0375"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; FAD
FT                   linked oxidase domain protein; KEGG: amt:Amet_4571
FT                   molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17937"
FT                   /db_xref="GOA:A8MLM0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM0"
FT                   /protein_id="ABW17937.1"
FT                   /translation="MVEKVIKAEGLEEVLDLLHQHRAEAKLIAGGTDIIIQLRNGKIKP
FT                   KVLIDISGIQELRYIKEKDGLIEIGAGTTFRDLEESFDIKKKLTGLWKAAKMVGSPQIR
FT                   ATATVGGNICNGSPAADMVPPLLSLEAIATIQGLEKIREVSLKDLFVGKGKVALEPDEI
FT                   MTSVRFKTLEEGCGFSFSKLGLRKALAISRICTAVMVQLGEDGMVEDIRISNGSLGEYG
FT                   LREKTVEEFYLQKRITEQTMAEGLNILRNSIHERLHGRSSLPYKIEAIEGTFMEAMKDA
FT                   VAMAQRERLCACSN"
FT   gene            428383..428859
FT                   /locus_tag="Clos_0376"
FT   CDS_pept        428383..428859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0376"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: amt:Amet_4570 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17938"
FT                   /db_xref="GOA:A8MLM1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM1"
FT                   /protein_id="ABW17938.1"
FT                   /translation="MKEIILNVNGVNHRIDIHEEDRLIDVLREKLYLTGTKEGCGEGEC
FT                   GACTVIIDGETVNACMILAFQGEGRKIITIEGLNRNDGLHPIQQAFLEEGAVQCGFCIP
FT                   GMVLSAKVVLDKNPSPSRGEIRESISGNLCRCTGYNKIVDAIERASRLLKEESL"
FT   gene            428856..430112
FT                   /locus_tag="Clos_0377"
FT   CDS_pept        428856..430112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0377"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: amt:Amet_4569 aldehyde oxidase
FT                   and xanthine dehydrogenase, a/b hammerhead"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17939"
FT                   /db_xref="GOA:A8MLM2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM2"
FT                   /protein_id="ABW17939.1"
FT                   /translation="MKTLEVVGKSIIRVDGLSKVKGRAIYPDDILMEGMCYGKTLRSTK
FT                   PHAYIKVDTSKAESMEGVLRIFTAKDVPTNSHGVLFKDHEVFCSKKVRRIGDPIALVVA
FT                   TSKRIAEMAMDQIAVVYTEIEAVFDPITAMKEDAPKVHDVDNIAHHCKIRKGNVEEGFK
FT                   KSVVIVEDEYRSAMVDHAFLQTEAGVAYIEDGKIVVCAATQYTHFDQEEIAEALNVPKE
FT                   DVKVINPAVGGAFGGREDLTLQIHIALAAKELKRPVKMVYSRSESFVAHCKRHPMIMRY
FT                   KTGADQNGMLLAMEAEIIADTGAYASWVNNVVRKATTHATGPYEIPNVKVDGYGVYTNN
FT                   PFAGAMRGFGAAQTPIAHELQMDKLAEKLNMDPISIRIKNGFRVGSITATGQILHESVP
FT                   FIKCMEAVAKSLNILGEVE"
FT   gene            430112..431098
FT                   /locus_tag="Clos_0378"
FT   CDS_pept        430112..431098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0378"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding"
FT                   /note="KEGG: amt:Amet_4568 aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17940"
FT                   /db_xref="GOA:A8MLM3"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM3"
FT                   /protein_id="ABW17940.1"
FT                   /translation="MKRRGTGIGSIMYGTGYGNGFPDVSKAVAELCMDGRVAIYVGATE
FT                   VGQGAKTIMSQIPAEALGIAVEDIVFICEDSSITPDAGTAAASRQTYNTGNAIKIAAEN
FT                   LREQILVKSKEALGLNTTVGLDIKGGRVFIKSFPSKTITLKELGEMLKAQPLRAEGQFT
FT                   AQTTQIDTETGQGAPYWPYTFSVYGIEVEVDTNTGIVEILHAVCAQDVGRAINPRLIEG
FT                   QMDGGFAMGLGYAIFEDLNLQKGAIRNNAFSSYLIPTAMDVPELEKIIIEDPESTGPFG
FT                   AKGIGEPVMLGVAPAILNAIYNATGVRINEIPVTPDIVLKALKEKPI"
FT   gene            431142..432860
FT                   /locus_tag="Clos_0379"
FT   CDS_pept        431142..432860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0379"
FT                   /product="adenine deaminase"
FT                   /note="TIGRFAM: adenine deaminase; PFAM: amidohydrolase;
FT                   KEGG: cac:CAC0887 adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17941"
FT                   /db_xref="GOA:A8MLM4"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM4"
FT                   /protein_id="ABW17941.1"
FT                   /translation="MKEVIKKRIDIAAGRIKSSLVLKNGKIVNVFSGEIIDGDIAIEEG
FT                   TIVGIGKYEGLEEIDLKGKYVSPGFIDGHVHIESSMATPSEFAKAIIPRGTTTIIADPH
FT                   EIANVCGMSGIEYILESSKNIPLNVYVMLPSCVPATTFENSGAILKAEDLKQLIDHESV
FT                   LGLGELMDYPNVIQGEDGILDKLVMAEGKVIDGHGPVIKDKELNAYVVSGIRTEHECST
FT                   AEEMLDRLRLGMYILIREGSAARNLKELIKAVNQDNVGRCLLCADDKHPEDILLNGHID
FT                   HNIRLAVEAGISPVNAIRMATLNAAQCYGLKNLGAIAPGYDADIVILEDLQKFKVDAVF
FT                   KKGNLVAKEHKALFTLTPEDHSKVMDTVNIKSVAEADLKIKLKSNQVHVIRLLPHSLVT
FT                   KKVVREVEIEDGFFKYSDHTDILKLAVVERHKATGNIGLGFVENFKLKGGAIASTIGHD
FT                   SHNLIVIGDNDGDIIAAIEEVVKVGGGITIAADGQILKTLELPIAGLMSKEPIEKINGD
FT                   LGEMLEIAYEKLGVNREIEPFMTLAFLALPVIPDVKLTDMGLFDVQSFQFIDLEA"
FT   gene            432911..433723
FT                   /locus_tag="Clos_0380"
FT   CDS_pept        432911..433723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17942"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM5"
FT                   /protein_id="ABW17942.1"
FT                   /translation="MKIKEALKLNDPILITFIGGGGKTTTLFRLGEELSAEEQPILLTT
FT                   TTSILMPPPSAYDLAIVTEDVAEAIRQVRNNENKGRILLGKNITTENKLKGFLPEEMDR
FT                   IYKENRERWFLVEGDGSNGRSLKIPEDHEPQVPSFSSITVILIGADILGKEINKENVHR
FT                   HHLIQPLTQRTQQYVDKSLIFDLISHPLGITKGIPEDSKKVILFNKISTQGKESLEILR
FT                   GLSEEMINEGKDAPIHPQCRISSILLGEVQDKEPIIEIVGEDRWSALF"
FT   gene            433705..434277
FT                   /locus_tag="Clos_0381"
FT   CDS_pept        433705..434277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbo:CBO2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17943"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM6"
FT                   /protein_id="ABW17943.1"
FT                   /translation="MVGIILGAGYARRMGKDKLLLPFKETTIIETIIKEGVASELERIY
FT                   LVCRDNQVKEIAKKYPIHVIINENAGEGQSTSIVKAMEAVGDIVPSYMFLMGDQPLISK
FT                   DFINSMMDFYRQNHASILVPVYNGKPGTPTIFSNRWQEHLLKLKGDEGGRSIIRAHPKE
FT                   VQLYPVENGILGKDVDSLEQYIEILNL"
FT   gene            434384..435196
FT                   /locus_tag="Clos_0382"
FT   CDS_pept        434384..435196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0382"
FT                   /product="S-adenosylmethionine decarboxylase related"
FT                   /note="PFAM: S-adenosylmethionine decarboxylase related;
FT                   KEGG: cpr:CPR_0513 S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17944"
FT                   /db_xref="GOA:A8MLM7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLM7"
FT                   /protein_id="ABW17944.1"
FT                   /translation="MLGLEKKLTLYGFNNLTKTLSFNIYDVCYAKSEKAQKAYIEYIDE
FT                   QYNSERLTKILCDVTEMIGAHVLNISKQDYEPQGASVNILITEEALPLHLIDESCNKGE
FT                   GIAAQRDTIHAHLDKSHVTVHTYPEYHPDNAISTFRVDIDVSTCGMISPLNALDYLIGS
FT                   FDSDIITIDYRVRGFTRDVEGKKFYIDHNITSIQDYIDDETLKKYDAIDVNVYQSNIFH
FT                   TKMLIKEIELQNYLFNKDVNELLPKQRLEITNNLRKEMIEIFSGMNIY"
FT   gene            435215..436669
FT                   /locus_tag="Clos_0383"
FT   CDS_pept        435215..436669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0383"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: aminotransferase class V; Orn/Lys/Arg
FT                   decarboxylase major region; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; Orn/Lys/Arg
FT                   decarboxylase domain protein; KEGG: dsy:DSY0236
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17945"
FT                   /db_xref="GOA:A8MLM8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLM8"
FT                   /protein_id="ABW17945.1"
FT                   /translation="MKKLSQDKAPIYEALVKHKSNRVVPFDVPGHKGGRGNKELTEFLG
FT                   QDCLKVDVNSMKPLDNLCHPTSVIREAEVLAAEAFGAADAFFIVNGTTAAVQAMIMSTC
FT                   KAGDKVIMPRNVHRSAINALVVCGAVPVYVNPGVEKNIGIPLGMSVQDVEKAILENKDA
FT                   KAILVNNPTYYGICSDLKAIVALAHKHNMLALVDEAHGTHFYFGENMPLSAMAANADMA
FT                   AISMHKTGGSLTQSSFLVCGKNMDASYVRQIINLTQTTSGSYLLLSSLDLARKNLALNG
FT                   KEIFKQADDLANYAREEINKLGGYNAFSKELINGDTVFDFDTTKLSIHTRDIGLAGIEV
FT                   YDILRDEYGIQIEFGDIGNILAIISAGDRMLEIERLVSALYEIKRRYSKDKTGMFDHEY
FT                   INPEVVLAPQKAFYSSKKSVPIAESSGKISGEFVMCYPPGIPILAPGERITDEIVNYIS
FT                   YAKEKGCLVTGPKDMDILNINVVEEC"
FT   gene            436670..437524
FT                   /locus_tag="Clos_0384"
FT   CDS_pept        436670..437524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0384"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: dsy:DSY0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17946"
FT                   /db_xref="GOA:A8MLM9"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLM9"
FT                   /protein_id="ABW17946.1"
FT                   /translation="MELWYTEQHTEDVRFSIKVDNQLYSGQSEFQRIDVFESKEFGKFF
FT                   TLDGLMMVTEKDEFIYHDMITHIPMATNPKIKNVLVIGAGDGGTVRELTRYETIENIDM
FT                   VEIDKLVVDICKEYLPQTASKLEDPRVHIYYEDGLKFVRTKENEYDLIIVDSTDPFGPG
FT                   EGLFTKEFYGNCFKALKEDGILVNQHESPYYASYAKSMKRAHKRIKEFFPICKVYQAHI
FT                   PTYPSGHWLFGFASKKYDPIEDLNSEAWNALGLQTKYYNTDLHMGCFALPNYVKELLEK
FT                   EEE"
FT   gene            complement(437663..439132)
FT                   /locus_tag="Clos_0385"
FT   CDS_pept        complement(437663..439132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0385"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   ctc:CTC01155 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17947"
FT                   /db_xref="GOA:A8MLN0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN0"
FT                   /protein_id="ABW17947.1"
FT                   /translation="MLQNPFRKAPCHEAECILSYVNNTLAGIVTEAPSVDYPLHTQILS
FT                   TFEQLLSNEAKMSNVAKEVLDIASSLSSFDVGMSHISQQLIDFSEEMASVSQSNSALIE
FT                   ETTASMNEVNEYIDITSKTLHQLARDSQSLTKKNDESIQLLEHVKSLKDQVTHDTEVMN
FT                   EKIQLLVHLATEVGKIVDSVQGIAEQTNLLALNSAIEAARAGEHGRGFAVVADETRKLA
FT                   DDTKQNLVGMKQFVNSIHTAANEGMESLQSTLKSTEEISDKIELVSNTIGENVNMLKNV
FT                   VVDVENVHRHMEHITFSTNEINQAMEASSADAEKLTYMTQSIYEDAAKSIEFSKQISKI
FT                   DDQLSTMVTSMLDGLKGSNNAIKNYELQEVIEKAMASHKDWVVTLHKIVTEMQLYPLQT
FT                   NSKKCAFGHFYHAVDVEHPKLKSDWKQIESIHHEFHSLGDKVIAAVKGNDTADAHRYYE
FT                   EAKNLSSQILELLDKIHKNIEQLTKENIRIF"
FT   gene            439401..439817
FT                   /locus_tag="Clos_0386"
FT   CDS_pept        439401..439817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0386"
FT                   /product="acyl-CoA hydrolase"
FT                   /note="KEGG: tte:TTE1604 acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17948"
FT                   /db_xref="GOA:A8MLN1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN1"
FT                   /protein_id="ABW17948.1"
FT                   /translation="MKKIHASRLVKSEDLNHHGTLFAGRMAEWFVENCFICGAMETEKP
FT                   ENIVCVKVHGLSFGSPVQKGSIINMKSYIAKVGRTSFTVYGKVTKNNAKDTVSDGFISF
FT                   VFVDSNGKPIPHSIVLDEAADPEEIEIREKALNL"
FT   gene            complement(439954..440850)
FT                   /locus_tag="Clos_0387"
FT   CDS_pept        complement(439954..440850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE2679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17949"
FT                   /db_xref="GOA:A8MLN2"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN2"
FT                   /protein_id="ABW17949.1"
FT                   /translation="MKIKRFIGLPKLGILGMILLLFLFNMGCSAKSTEFSRDMAPNMDL
FT                   AESSSHSEMLKLDGDAKRSSLEPEKVITNVYLTLETLEFEATTNQLGQLISKYNGFVEN
FT                   SNIYSNHHVGDKILKNGQYTVRIPKENVEPFMKDTQGIGNLVSQNTSKQDITKQYYDTE
FT                   SRLNVLKIKEERILALLEKADKIEDVIAIENQLSDIIYQKEDLTKSILDMDDQVSYSTV
FT                   SLNISEVEKLTNGVTKETSFATKLANAWKDSLYFFKIGIEQFIISAIFVLPYLFLIAPF
FT                   AFIAYKVIQKKNNSNRE"
FT   sig_peptide     complement(440758..440850)
FT                   /locus_tag="Clos_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 31"
FT   gene            complement(440926..441621)
FT                   /locus_tag="Clos_0388"
FT   CDS_pept        complement(440926..441621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0388"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcl:ABC3641 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17950"
FT                   /db_xref="GOA:A8MLN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN3"
FT                   /protein_id="ABW17950.1"
FT                   /translation="MAKEKILIIDDEESIRKLVRRSLINENYLIEEASNGEEALERLRN
FT                   NTFDLIILDVVLGDEDGFELIQEIKVLGIKTPIIFVSGRCEDHDQILGLGLGATNYITK
FT                   PFSPAILCAHVKAQLRTSREYVAEKTRSSNYIMEGPFKFDLKTYKLYKNNEFIELSSKE
FT                   NLLIKFFMENPGQVFTKEQLYENIWNNSIIDDNAIMVYIHQLRKKLEDNVKSPKHIVTV
FT                   WGIGYKFIA"
FT   gene            441856..443670
FT                   /locus_tag="Clos_0389"
FT   CDS_pept        441856..443670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0389"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: cph:Cpha266_1787
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17951"
FT                   /db_xref="GOA:A8MLN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN4"
FT                   /protein_id="ABW17951.1"
FT                   /translation="MIFSIFLCLILVTVIVLIGYNNFQNHKETIIRQQQEHLLTIAKSI
FT                   SRSFDVFLNYKMNNLSMLSKDEVVLKAFKMNNEGGLYNQHEDVLKSFFEKYREEMDGVA
FT                   LLNKEGTLIYGYPSVDAIQEASIEMSTINNVLNSKQVHISKEYLSKPNQFSIDIIQPVI
FT                   EKDEVIGLIMNTINLNKIYKVLIDLVQPGEKGYSMVKNREGFIVMHPVINQVGIESIKV
FT                   RKEKFPQLDWSELEELNRRQVEYGEGYFVYNSKWWQDDEGSLTKKINSYTTFKQGDIAW
FT                   IISVQMDYKEVEKPIKGALINILLISLLIIFIIVGGFYIFFKVDKKRRELQIETKYLKE
FT                   LNKTWEELIKSESRLRHSQKLQTIGVLTSGIAHEFNNLLSPILGYSEILLGQIEEHHPI
FT                   YEDLLEINKSSLAAKEIAKQILRFSKEDGSSPEFTYLESSSVIRESIHLIRSILPKRIQ
FT                   IVECINSSQILYGNSVQIQQVLINLYTNAYHAMREKGGTLEIASEDVCISKEDGEKLNL
FT                   HEGNYIKIQVKDHGVGMDEKTLEKIFEHFFTTKGNEEGTGLGLAVVKSIVQNHKGQIVV
FT                   KSQVGIGTVVEVYFKAVDKNYMEILKEF"
FT   gene            443766..445529
FT                   /locus_tag="Clos_0390"
FT   CDS_pept        443766..445529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0390"
FT                   /product="flavocytochrome c"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: fnu:FN0050 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FMN-binding domain protein; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17952"
FT                   /db_xref="GOA:A8MLN5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN5"
FT                   /protein_id="ABW17952.1"
FT                   /translation="MKRMKRSLAVLLTLVLILSLAACQKSNNNENNKPEQGKDLITGTF
FT                   EGEGRGKGGVVKLEVSLENSEIKDIKVLEQKESAYTKPVIADLKNQIIDTNSTNVDIIS
FT                   GATLTSHAIINAVKDAINKSGATLVAKEGTNLAEKAEDVSTDIVIVGTGGAGLSAAIEA
FT                   SNQGAKVIVVEKNAFMGGNTNYATGGMNAANTKYQREKGIEDSPELYYKDTMEGGHKKN
FT                   DPSLLKVLTEKSADTIYWLEELGANLSQVGRSGGQSVDRIHKGPEGMPVGTHLMDVFDQ
FT                   QVEKMNIDVRLNTKAIEILSEGNKATGIKVQNRDGNTYNINAKAVILATGGFGANPELV
FT                   TKYKPELEGFGTTNQPGATGDALAMVEKLDVALTDIKEIQTHPTVVPKINEMITEGVRG
FT                   DGAILVNREGKRFINELETRDTVSKAILSQEGKTAFLIFDQQVVDTASAIKKYKDAGLL
FT                   TEADSLKELGEKLKINATELENTVNTYNAYYKDQNDKEFGRRTLTVELTKPSFYGVEIS
FT                   PAIHHTMGGLKINTKTEVINNSGEVIEGLYAAGEVTGGVHGGNRIGGNAVTDITVFGKI
FT                   AGENAASFVKE"
FT   sig_peptide     443766..443840
FT                   /locus_tag="Clos_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.441 at
FT                   residue 25"
FT   gene            complement(445655..446674)
FT                   /locus_tag="Clos_0391"
FT   CDS_pept        complement(445655..446674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0391"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   cac:CAC3229 NADH:flavin oxidoreductase, Old Yellow enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17953"
FT                   /db_xref="GOA:A8MLN6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN6"
FT                   /protein_id="ABW17953.1"
FT                   /translation="MSKLFHPYTLKNLELKNRIVMAPMCQYSADEEGFPTSWHTVHYAT
FT                   RAIGGVGLIILEATAVEPRGRISANDLGIWKEEHVDGLKALVAECKKYGAQMGIQLAHA
FT                   GRKCSINSENIVAPSPVAFSHDYQTPRELTKKEIQTIVQSFKLGAQRSLEAGFDIIEIH
FT                   GAHGYLINEFLSPLSNQRTDEYGGSLENRVRFLKEILEAVRTVWPKELPMILRVSAEDY
FT                   VAEGNHPEDLAAMINLLKDYEVDIVNVSSGAVVPAPIKAYPGYQIPFSEIIKRETNLPT
FT                   IGGGLVTTPLMAEEILQNNRADLIFLGRELLRNPYWALHAAKEVRDDVPWPVQYERGK"
FT   gene            complement(446793..447686)
FT                   /locus_tag="Clos_0392"
FT   CDS_pept        complement(446793..447686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0392"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: cdf:CD3520
FT                   putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17954"
FT                   /db_xref="GOA:A8MLN7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN7"
FT                   /protein_id="ABW17954.1"
FT                   /translation="MDNNQSKIRSIHRIVLITIALNIFLLLIKVIAGIASNSTALIADG
FT                   LHSGSDVITSVGVIIGMAMASKPRDEHHHYGHEKIETITTFLLSIVLIYVGAQIGYSAL
FT                   SAILRKEQVLFSYFGLFAALVSIIIKEIQYQIAYRVGTREKSAALIADAWHHRSDALSS
FT                   IASFIGILGAKFGISILDSMAGFIVSLIVIKVGVHIFKECFQELIDVSIHLDEVSNLKK
FT                   IILKETSVKYISDLRTRKHGAKVLIDIRICVDPTMDVHQGHEIAEKVERIIKREIENAK
FT                   DVIVHVDPCKFNIFNP"
FT   gene            complement(447819..448334)
FT                   /locus_tag="Clos_0393"
FT   CDS_pept        complement(447819..448334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0393"
FT                   /product="tryptophan transport protein"
FT                   /note="KEGG: cbo:CBO2919 tryptophan transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17955"
FT                   /db_xref="GOA:A8MLN8"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN8"
FT                   /protein_id="ABW17955.1"
FT                   /translation="MKLKNNIFTALLLAIGFILHQITPGILGGMKFDFLLSFLFISLIV
FT                   NTSFKNAVLTGLMGGLLSAITTTFPGGQIPNMIDKLLTSILLFLIIQFIRRFSMNTLAV
FT                   GTISILGTLISGATFLLSALIIAGLPTSFSFLFKTVVLPTVLVNAALTIFIYHIIGQAM
FT                   RVSGIQIE"
FT   sig_peptide     complement(448269..448334)
FT                   /locus_tag="Clos_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.556 at
FT                   residue 22"
FT   gene            449200..449688
FT                   /locus_tag="Clos_0394"
FT   CDS_pept        449200..449688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0394"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: cac:CAC3572 biotin
FT                   carboxyl carrier protein of acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17956"
FT                   /db_xref="GOA:A8MLN9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLN9"
FT                   /protein_id="ABW17956.1"
FT                   /translation="MDAKDIKELILTIDKTSIEKLELEKNDIRIVITKKAFNESQNSIT
FT                   SDMKNLEEKIAPSNAENFKRAKEEMDHREGMRTTTNDENTWIVKSPIVGTFYSASSPDA
FT                   PPFVKIGDVIEKGQSLCIIEAMKIMNEIESEAEGEIVEILVRDEDIVEYGQPLMKIRR"
FT   gene            449695..451062
FT                   /locus_tag="Clos_0395"
FT   CDS_pept        449695..451062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0395"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: cbo:CBO3596 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17957"
FT                   /db_xref="GOA:A8MLP0"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP0"
FT                   /protein_id="ABW17957.1"
FT                   /translation="MFKKILVANRGEIALRIIRTCKEMGIKTVAVYSEADTDSVHVHFA
FT                   DEAICIGPAPSKKSYLNLNHIISAALVTGCEAIHPGYGFLSENPALVDACESNGIRFIG
FT                   PYKEHIEKMGNKAEARKTMIEAGVPVVPGSKNATNEAIEALGIAEEIGFPVMVKAASGG
FT                   GGRGMRVIHNRDEFINKFNMAKSESSTAFNDDAMYVEKFIEEPRHIEFQILADTFGNII
FT                   HLGERDCSLQRRNQKVLEEAPCQIISEELRNKMGQMALRAAKAVGYVNAGTIEFLLDKH
FT                   HNFYFIEMNTRIQVEHPITEMVTGIDLIREQIKIAYGEKLNRTQEEIKIQGHAIECRIN
FT                   AENPLENFRPCPGEIEGYLSPGGYQVRLDSHIYSGYTVPPTYDSMIGKLIVWGKNRTEA
FT                   IQRMKRALDETVVTGILTNIDFQKTILNNDKFLINQIDTSFIEREILSNSLNVKEG"
FT   gene            451064..451891
FT                   /locus_tag="Clos_0396"
FT   CDS_pept        451064..451891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0396"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: drm:Dred_2315 acetyl-CoA
FT                   carboxylase, carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17958"
FT                   /db_xref="GOA:A8MLP1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLP1"
FT                   /protein_id="ABW17958.1"
FT                   /translation="MLKDIFGKKKYATITLYKDNAGPAVPSNTHSSKSNGNPVSEMKEN
FT                   KRMGARSRIAALIDKDTFIEYDSELESCNPLSFPKYAEKILAAMETSMEKDAVITGEGT
FT                   IRGESCVLCVMNPDFMMGSMGSVVGEKITRAIEKAIEKKLPVIIFCASGGARMQEGILS
FT                   LMQMAKTSAALGRLGEAGLLYISVLTDPTTGGVTASFAMLGDIIIAEPGALIGFAGPRV
FT                   IEQTIRQKLPEGFQRSEFLLEKGFIDQIVSRKDMRNTLASLLRIHRLGGEMHA"
FT   gene            451884..452834
FT                   /locus_tag="Clos_0397"
FT   CDS_pept        451884..452834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0397"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="2.7.7.72"
FT                   /note="KEGG: bha:BH3165 acetyl-CoA carboxylase carboxyl
FT                   transferase subunit alpha; TIGRFAM: acetyl-CoA carboxylase,
FT                   carboxyl transferase, alpha subunit; PFAM: acetyl-CoA
FT                   carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17959"
FT                   /db_xref="GOA:A8MLP2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLP2"
FT                   /protein_id="ABW17959.1"
FT                   /translation="MHNFLESEKAIHELEGKIIELINFADKNKVDLTYEIEILSQKLEQ
FT                   MQKEMYENLNPWSKVKLARLQERPTTLDYIEKLISGFTEFHGDRFYGDDTAIVGGIGLF
FT                   EGIPVTVIGHQKGKDTKDNIRRNFGMPHPEGYRKALRLMKQAEKFKRPILTFIDTSGAY
FT                   CGIGAEERGQGEAIAVNLIEMSKLKTPIIAIVIGEGGSGGALALGIGDRVCMLEHSIYS
FT                   VISPEGLSTILWKDATLAQRAADMMQLTAQDLWSMKVIDQVIKEPLGGAHKNADLVADQ
FT                   IKTYVLQELKDLRMLKTEELLEKRYTKIRNIGIWK"
FT   gene            complement(453022..453837)
FT                   /locus_tag="Clos_0398"
FT   CDS_pept        complement(453022..453837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0398"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: oih:OB0532
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17960"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP3"
FT                   /protein_id="ABW17960.1"
FT                   /translation="MKNIVSQQWLKNNLSLDHLVLLEARETFDATDSSANQHIPKAQYV
FT                   LLEEHMSGELQPHGGRHPLPDMEKFVRDMEAFGINDESIVVIYDSGSMAPAGRLWWLFK
FT                   YIGKDQVFVLEGGLTKWMENGFTVTTEQFVPKPSGHLSLNINDAMLVDMQYVKDTIGSK
FT                   NIALVDARASERYAGEVEPIDRVAGHIPGAINYPWMNLTVNQEIMEREALEKYFEPLKE
FT                   FEEIIVYCGSGVTAVVDILFMEEVGLNPKLYAGSYSDWISYEDNEIITK"
FT   gene            complement(453932..454600)
FT                   /locus_tag="Clos_0399"
FT   CDS_pept        complement(453932..454600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0399"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: ctc:CTC00586 hemolysin
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17961"
FT                   /db_xref="GOA:A8MLP4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP4"
FT                   /protein_id="ABW17961.1"
FT                   /translation="MRNTLENATPIKRYSIKEEVANGITHGLGVLFGFVALTILLVLSI
FT                   MKKEPLSIVSFSIYGSCIILMYLSSTLYHSIPHENVKKILRVFDHSSIYLFIAGTYTPI
FT                   ALLTMDGALRIGVLVAVWSIALFGITFKISTYKKMDRFKKLSLGLYLFMGWIAVFTVKP
FT                   IIQTTSFRFFVWILVGGLLYTLGTIFYAMKKIPYSHAVWHVFVLSASVVHFLGIFLYLA
FT                   "
FT   gene            454716..455591
FT                   /locus_tag="Clos_0400"
FT   CDS_pept        454716..455591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0400"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_1435 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17962"
FT                   /db_xref="GOA:A8MLP5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP5"
FT                   /protein_id="ABW17962.1"
FT                   /translation="MDQGLESNKMKKRATFYLIISAFLWSLGGVFIKLIDWHPIAIAGT
FT                   RSGISALFIWAYVKKPQFNWSKAQILGAISYATTVISFVVANKMTTSANAILLQYTAPI
FT                   YVAIFGIFLVKERTSKVDWLTIFAVIVGMVLFFIGDLDTRNMWGNFWAIISGISFAGVA
FT                   LSLRMQKDGSPVESVILGNILAFIISLPFMFQTAPMGNSWIGLVLMGTIQLGFPYILYS
FT                   KAIKSVSALEATLIPVLEPIVNPIWTFLFVGEVPKKGAIIGGAIVIIAITARSLYMVHY
FT                   EKTHAIEETQ"
FT   gene            455683..456612
FT                   /locus_tag="Clos_0401"
FT   CDS_pept        455683..456612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0401"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   bld:BLi01397 YkfA"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17963"
FT                   /db_xref="GOA:A8MLP6"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP6"
FT                   /protein_id="ABW17963.1"
FT                   /translation="MIKPNALKFGDVIGIVAPSGPTTKERVKLAKDQLEGLGFQVKLGH
FT                   SCYEKHGYLSGKDEVRARDLNHMFEDQEVQGIICLRGGYGASKILNRIDLEQIAKRPKV
FT                   FVGYSDITALHLAMNQISKLVTFHGPMGSSDIAGGLDDFTREGFLKAVMGSSPMGEIQN
FT                   PKGKKMQSLVGGKANGILVGGNLSLIAATMGTPYEIDTKGKILFLEEIGEEPYRVDRML
FT                   TQLLLSGKLGDAEGILLGDWMDCEPEEPEKSLSLMAVFEEIIGPLGKPTIYDVEAGHCS
FT                   PMITLPFGVRSFLDAEEGRLIIEEGGTV"
FT   gene            456612..457805
FT                   /locus_tag="Clos_0402"
FT   CDS_pept        456612..457805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0402"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: tte:TTE0596 metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17964"
FT                   /db_xref="GOA:A8MLP7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP7"
FT                   /protein_id="ABW17964.1"
FT                   /translation="MRDYHDLLNEAKKIEDWLISIRRDFHRHPELGMAEFRTREKIIGY
FT                   LEELGIRYQSHVAGTGVVGFIEGKQEGRTIALRADMDALPIEDRKEVPYGSTIPGKMHA
FT                   CGHDAHMTILLGAARLLKERADELKGQVKLFFQPAEETVGGAKPMIEAGVMENPKVDCV
FT                   IGLHVSSQIETGEIGIRYGQMNAASDTIKIVLHGKSSHGAYPQEGVDAILMAGQVLTAL
FT                   QSIVSRNVSPIKSAVITIGVIHGGTQGNIIADRVELIGTVRTLEAETRVFVINKIEAIV
FT                   KNIAAAMGGKAEFFREEGYTALINTDSIVDMVRFNGEKILGYGKVHRIEHPSLGVEDFA
FT                   YFAEKAPGAFYILGCRNEEKGIIHEAHYGLFDIDEECLSVGVAMQVGNVLTFLKEEN"
FT   gene            457880..458440
FT                   /locus_tag="Clos_0403"
FT   CDS_pept        457880..458440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0403"
FT                   /product="Formiminotransferase-cyclodeaminase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   ctc:CTC02303 formiminotetrahydrofolate cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17965"
FT                   /db_xref="GOA:A8MLP8"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP8"
FT                   /protein_id="ABW17965.1"
FT                   /translation="MKIADKSIDEFLEDIATKPCTPAGGCVAALCAASSSALMEMVARH
FT                   TLRNKEASSEVVDFMEEVVHIAASTRKNFLAYMDKDTEAYMKVIDAKDQEGPMEEYHKD
FT                   SVRVPFEMAREIFRMIDLIRKTTQDGSEILVTDGVAALLMAKVTLNTLVYHIKFNLNYV
FT                   KDKKFAEHILAQLSLMADEKMPF"
FT   gene            complement(458469..458948)
FT                   /locus_tag="Clos_0404"
FT   CDS_pept        complement(458469..458948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17966"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLP9"
FT                   /protein_id="ABW17966.1"
FT                   /translation="MENKKMNLLMFSGEYDKAMAALILANSAREMDIEVTMFFAFWGLC
FT                   LLREPEKVSSDDKSIYEKMLGAMTPKGPEDLPLSKMNFSGIGKEMMLDMMADKEAPRLI
FT                   DFLNGARKKGVRFRGCKLSMEIMGFKKEELIPELEIIEAKEYLKDAMASDMQLFI"
FT   gene            complement(459083..460420)
FT                   /locus_tag="Clos_0405"
FT   CDS_pept        complement(459083..460420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0405"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; KEGG: cbo:CBO0362
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17967"
FT                   /db_xref="GOA:A8MLQ0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ0"
FT                   /protein_id="ABW17967.1"
FT                   /translation="MEHINFLSPYKDFVVGVDTKVPLADQTFTTAINFDNAATTPPFDC
FT                   VMNDLVEFSPWYSSIHRGAGYKSQYSTKLYEESRKIISSFIGADMDYHSIIFLKNTTEA
FT                   INKLSNKLLALHKDGVVLSTCMEHHSNDLPWRNKYTVDYIAVDKYGELSMEDLKNKLIS
FT                   YGKKVQLVTITGASNVTGYINPIHEIAELVHQHGAKLLVDGAQLVPHGPVNMKPVEHPQ
FT                   HIDYLVFSAHKMYAPFGTGVLIGPKDTFRESPPDYTGGGTVQFVSHDHIKWLDPPEREE
FT                   AGTPNIMGVLALSSAIKKLLSIGMAQVESYERALTRHAYESLSNIPNVELYTNKSHLHR
FT                   TISIIPFNIKGLHHSIVAAALSKEFGIAVRNGCFCAQPYLQRLLNVSAEDSEEYMKDPT
FT                   LPMPGMVRLSFGIYNSIEEINILTKALFHISRNRDLYLQKYNIQEI"
FT   gene            460573..460968
FT                   /locus_tag="Clos_0406"
FT   CDS_pept        460573..460968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0406"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   gsu:GSU2929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17968"
FT                   /db_xref="GOA:A8MLQ1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ1"
FT                   /protein_id="ABW17968.1"
FT                   /translation="MFWWSSELETGITSIDEQHRTIFNRAGDFLSLDSSTDLQEIHRAF
FT                   VFLMDYCINHFTEEEQIMMDADYESLEGHRAQHNHLVDRLYELGNEIKDTGINEELIDQ
FT                   FKFLVIEWLVNHINESDKHLAKFLLEK"
FT   gene            complement(461121..462146)
FT                   /locus_tag="Clos_0407"
FT   CDS_pept        complement(461121..462146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0407"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: cpr:CPR_1501 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17969"
FT                   /db_xref="GOA:A8MLQ2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ2"
FT                   /protein_id="ABW17969.1"
FT                   /translation="MSKTVDIDWGKLGFSYMKVGLRYISKWSNGSWDEGKLVEDNTLAI
FT                   SEASTALHYGQQCFEGMKAYRTKEGKIQLFRPDRNAARLNDSCRRVLMPEIPEEKFIDA
FT                   CIQLVKANAEYVPPYGSGATLYLRPFVIGVGDNLGVRPAPEFIFSIFAVPVGPYFKGGM
FT                   VPVNFITSDFDRAAPYGTGAAKVGGNYAGSLMPHKVAVDKGFADCIYLDPATHTKIEEV
FT                   GAANFFGITKDNKFVTPKSPSILPSITKYSLLHVAKEYLGLEVEERDVLVDNLDEFKEA
FT                   GACGTAAVITPIGGIEHKGKFHVFHSETEVGPVTKKLYETLCGIQFGDVEAPEGWIVEV
FT                   K"
FT   gene            complement(462296..463438)
FT                   /locus_tag="Clos_0408"
FT   CDS_pept        complement(462296..463438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0408"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18;
FT                   Peptidoglycan-binding LysM; SMART: chitinase II; KEGG:
FT                   cac:CAC2747 protein containing LysM repeats (N-terminal
FT                   domain) and domain related to chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17970"
FT                   /db_xref="GOA:A8MLQ3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ3"
FT                   /protein_id="ABW17970.1"
FT                   /translation="MYIHIVQPSETIWSVSNLYGISTYQLIGDNGLEGLSQLVPGQSLV
FT                   IIQDPPPPQRKNIEVNGYIVPNTPEADTATVSEVGQYLTYITPSSYVVNPDGSIRPLND
FT                   EAVISAAKSYHVAPLLSITNEGESNFDPALAHEFFINLQLQYILFNNVLHVMQSKGYYG
FT                   LNINFERLYPEDRYLYNDFLRNAVDFFHQYNYPVSTALVSKTYDMTTGEWWGGHDYKAQ
FT                   GEILDFVIIMTYDWGCVACPPMAVAPVNEIRKVLDYAVTVIPREKILMGMPFYGFDWTL
FT                   PFAPGDRANLVSYREALQLAIQYGATIQYDALFQAPFFYYVSESQEQHMVWYDDARSFQ
FT                   AKYNLVMEYDLLGVSYWSLNTSAPQNWPVLNYMFHIVQQI"
FT   gene            463708..464088
FT                   /locus_tag="Clos_0409"
FT   CDS_pept        463708..464088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17971"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ4"
FT                   /protein_id="ABW17971.1"
FT                   /translation="MANDREGDRYLENRIEGNKKAEINMRFSEFEVPPMQDVLIVGKRA
FT                   PIGPEAARRMVDILSPDQYEILKIEHDYFEAIVVRRSLLNMLPQEKLIAIIMDEGGKIA
FT                   NDSMIIRAQVNITLNVSRSIDL"
FT   gene            464085..464939
FT                   /locus_tag="Clos_0410"
FT   CDS_pept        464085..464939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0410"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; CBS domain containing protein; KEGG:
FT                   drm:Dred_1016 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17972"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ5"
FT                   /protein_id="ABW17972.1"
FT                   /translation="MIKNVSDIAEKGFKKINILNGAKKIQDIFSEEEIECFCAYDHDEL
FT                   VGVVTKKELVVAHPNRIVADIMSDRYRCIDSATPIWKVKEIFDTYKNIEIILLEDQGEL
FT                   VGYVTRTILNMELNKSIDLLTGLYRSDYIFYNAYNLLKEAQEVSVIFMDVDNFGCIDKQ
FT                   YGHIIGDDILRSIARILKENTDQKSFLCRYAGDEFAIVAPYSMEHSERIAKNIIKAIHS
FT                   YTFPKDIQVSVSIGISGYTLDKENSLNTLKPIMNMINDASLLSTKAKEKECSAIITNMG
FT                   VIA"
FT   gene            465099..466241
FT                   /locus_tag="Clos_0411"
FT   CDS_pept        465099..466241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0411"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: drm:Dred_2939 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17973"
FT                   /db_xref="GOA:A8MLQ6"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ6"
FT                   /protein_id="ABW17973.1"
FT                   /translation="MRKIDLIATATFGLEAIVGREVKALGYEDVKVENGRVDFTADASA
FT                   ICRTNLWLRTADRILLKVGEFKAFSFDELFEKTKALPWGDILPENAIFPVNGKSINSKL
FT                   SSVPDCQAIVKKAIVEKMKQKYKREWFEENGATYSIEVALLKDVVTLTIDTSGAGLHKR
FT                   GYRTLSNRAPLKETLAAALISLSYWNPDRVLIDPFCGSGTIPIEAALIGKNIAPGINRN
FT                   FVSEDWGLIPKELWRNARKETHDLAKYDRPLRIYGSDVDGEVLSIARYHAREAGVDEDV
FT                   HFQKLGVADLRSRFEYGCIITNPPYGERIGERDEVEELYKTMGKVFGEMETWSKYIITS
FT                   NSDFEKLYGTKADRRRKLYNGRLECQYYQYQGPRPPRREE"
FT   gene            466319..466552
FT                   /locus_tag="Clos_0412"
FT   CDS_pept        466319..466552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BG12731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17974"
FT                   /db_xref="GOA:A8MLQ7"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ7"
FT                   /protein_id="ABW17974.1"
FT                   /translation="MKNMAFIVALFICPVITIICSIIGYSLTKKWFIMPIFTLFLFTIL
FT                   TFTIFNESFFFWTIVYTVISIIVSLVINFIKK"
FT   gene            466591..466974
FT                   /locus_tag="Clos_0413"
FT   CDS_pept        466591..466974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17975"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ8"
FT                   /protein_id="ABW17975.1"
FT                   /translation="MGIKSNRKTILFLIVAVVLTKMFLFSNNETTVVINNQTDQTLENL
FT                   MFLSNAGEKDRIFTLAPHSKVSFQYDLGGFNENAASFHQIDPSGRRRSYSIIGYIHRLY
FT                   TEIHIEITSIDQNGELKFDVEVF"
FT   sig_peptide     466591..466677
FT                   /locus_tag="Clos_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.313 at
FT                   residue 29"
FT   gene            467095..467637
FT                   /locus_tag="Clos_0414"
FT   CDS_pept        467095..467637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0414"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   oih:OB1038 chromate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17976"
FT                   /db_xref="GOA:A8MLQ9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLQ9"
FT                   /protein_id="ABW17976.1"
FT                   /translation="MKVVAIVGSISEQSKNKKLAEFMQKRFKDKLDIEIMLLNDMPMYN
FT                   EDIELNPPAVVDEMRKQIRESEGLLILTPEYNHSIPGVLKNALDWFSRVERVMLNKPTM
FT                   IVGASMGALGTVKAQLHLREILNSGGVGAITLPRNEVFIGSIQDKVDEEGYLNDESTIQ
FT                   FLDTVVEQFIDWAKKIQ"
FT   gene            467822..468637
FT                   /locus_tag="Clos_0415"
FT   CDS_pept        467822..468637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0415"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bce:BC2476
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17977"
FT                   /db_xref="GOA:A8MLR0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR0"
FT                   /protein_id="ABW17977.1"
FT                   /translation="MNRHIVKGVLAVLAFTIFCVWQNNHIQITEINYENKKIKEDLKGY
FT                   KIVQISDLHNKRFGKDQKRILNKIKSIHPNMIVITGDLVDSRRTDMEVAMEFVKGAIEI
FT                   APVYYVSGNHEIRGRIYEEVKEQLLAVGATVMDNAKTEIEVGNSKIELLGLLDPLYRGR
FT                   AYLKNNLEELTKEESDTLRILLSHRPNFMEIYAESKVDLVFSGHAHGGQVRLPFLGGMI
FT                   APDQGLFPKYTSGTHTIGDTTMVISRGLGNSIVPIRIFNRPEIIVLNLK"
FT   gene            468814..470226
FT                   /locus_tag="Clos_0416"
FT   CDS_pept        468814..470226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0416"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: tte:TTE0717 NtrC family transcriptional
FT                   regulator, ATPase domain; TIGRFAM: PAS sensor protein;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17978"
FT                   /db_xref="GOA:A8MLR1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR1"
FT                   /protein_id="ABW17978.1"
FT                   /translation="MKDLFTKKQFEKILNHVGEGVQLIDAQGRIVFCNAVAAQLDNIQR
FT                   EEAIGKYILDIYPSLTEETSTIMRAIRTKEPVLNVQQSFINYKGHKITTVNSSIPILDG
FT                   DRILGALEVSRDITQVKALSEKLLDLQEKLYANTKSVKNARENSLAKYTVKDLIGSSDI
FT                   MVKLKNRILKAGETGSPVMVFGETGTGKELVAQSVHNASKRREQPFIAQNCAAIPASLL
FT                   ESILFGTVKGSFTGAEDRIGLFELANGGTLFLDEINSMPLELQAKLLRVLQEGYIRRVG
FT                   DVRTKHVDVRIITAMNMDPVEAVQTERLRKDLFYRLNVVSIKVPDLSERKGDIKDLVQF
FT                   FIQKFNYMLHKQALGVTDEVMKIFMLYDWPGNVRELEHVIEGAMNVMEGRFITAEDISY
FT                   QLQGIDLREKEDCNTENLDSKGLDLKSKLEKMEERYIRDALEDCHGNITVAAKILGIPR
FT                   QTLQYKKMKYDL"
FT   gene            470471..471508
FT                   /locus_tag="Clos_0417"
FT   CDS_pept        470471..471508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0417"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: pgi:PG1069 alcohol dehydrogenase,
FT                   zinc-containing, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17979"
FT                   /db_xref="GOA:A8MLR2"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR2"
FT                   /protein_id="ABW17979.1"
FT                   /translation="MKKGCPYGTHRVIEPKGVLPQPALKISNDMEIYDNEILIDVQTLN
FT                   IDSASFTQIKEEANGDLEKIKEIMLNIVETKGKHQNPVTGSGGMLIGTVEQIGPAMEGK
FT                   TNLKVGDKIATLVSLSLTPLRIDHIKEIRKDIDQVDIEGKAILFESGIYAVIPEDLPEN
FT                   LVLSVLDVAGAPAQTAKLVRPGHTVVIIGGTGKSGMLCLYEAKKRAGVTGKVICVDYSE
FT                   KNLERAKSANLADAYIAADATDAVGLMEKIKAATNGEMADIVINCVNIPNTEMGSILSA
FT                   KNDGLVYFFSMATSFTKASLGAEGVGQDTTMMMGNGYTKGHGEIALQIMRESEVLNRMY
FT                   QELYA"
FT   gene            471571..472821
FT                   /locus_tag="Clos_0418"
FT   CDS_pept        471571..472821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0418"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: fnu:FN1866 lysine 2,3-aminomutase; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17980"
FT                   /db_xref="GOA:A8MLR3"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR3"
FT                   /protein_id="ABW17980.1"
FT                   /translation="MSNYKNIEMWANVTEEEWNNWQWQVKNRITNVEDLKKVINLTDEE
FT                   EKGIKECLKTLRMGITPYYASLMDKDDPNCPVRKQAVPIMTELHKSDADMDDPLHEDAD
FT                   SPVPGLTHRYPNRVLLLITDMCSMYCRHCTRRRFAGQNDTAMPMDRIDAAIEYIRRTPE
FT                   VRDVLLSGGDCLLVSDEKLEYIISKLREIEHVEIIRLGSRTPVVMPQRITPELVGMLKK
FT                   YHPIWLNTHFNHPKELTEETKRALTLLADAGIPLGNQSVLLRGVNDCVHIMRDLVHGLV
FT                   KNRVRPYYIYQCDLSMGIEHFRTPVSKGIEIIEGLRGHTSGYAVPTFVVDAPGGGGKIP
FT                   VMPNYVVSQSHNKVILRNYEGVITTYTEPEKYVENCTCPVCKGEKKVKLHGVAGLMQGN
FT                   AIALEPAELDRHNRGNK"
FT   gene            472905..473936
FT                   /locus_tag="Clos_0419"
FT   CDS_pept        472905..473936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17981"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR4"
FT                   /protein_id="ABW17981.1"
FT                   /translation="MALFNLIYPHYKVVSLIGMAKNAGKTMTLNHIIESAMEQNVTIGL
FT                   TSTGRDGEKEDIVTRTEKPTIYVERGTIIATAKELLLKCEAKIEILEVTEYNTSLGSVV
FT                   IGRVRSAGLIELAGPDVNAYMKDVVDKIRGYGAELVLIDGAIDRKSAASPWLAEAAVLS
FT                   TGATISRSVEVVKNETLHQVELFRLEQIEDEAVKEIAMKIHEKKGYAFINKDGSVEELS
FT                   IQTALNSGCIIGSAINEHTKYVIVSGSLVARTLADMMEVCPYYRDITFIVQDATRIFID
FT                   RKYWKAFRMRGVKVKVVHPINLLAVTTNPYGPEGYFFEPRAFVELMRTALDPMPVIDVK
FT                   LEG"
FT   gene            473940..475472
FT                   /locus_tag="Clos_0420"
FT   CDS_pept        473940..475472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0420"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="PFAM: DNA mismatch repair protein MutS domain
FT                   protein; KEGG: tte:TTE0725 MutS-like ATPase involved in
FT                   mismatch repair, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17982"
FT                   /db_xref="GOA:A8MLR5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR5"
FT                   /protein_id="ABW17982.1"
FT                   /translation="MLDHWMSIQTKKEIGLVDVLEKLVIISAYGLWKKNSLQPFCPDSI
FT                   QCLNGELEAVAQMKGLIENSPSVSNGIIRLLREIKDVRGSLERSIRDEILNEVELFEIK
FT                   NQLMVMMEIRKLLLKEERISIEKVKLMEMDDIVKLLDPENSGMRTFYIYDQYSTLLTDI
FT                   RDKIANIEKQMWILKKKNKRVLEKDSEASIPEYIDEDLNRLTLALDQLKMQEEEEELRI
FT                   RQWLSQEIKNHYDIIFQNIHAIGELDFILSKARFAIESKSVRPEIIQNQKIRFVEGRHI
FT                   PLESHLKEKGAVYTPVDIKIHKGVTVITGANMGGKTISLKLIALITAMAQLGFYVPAKS
FT                   ATVGLFDFIYFSSGDQQSLQSGLSTFGGEIHGISQVLGRNGEKGLLLIDELARGTNPME
FT                   GYGISKGIITYLKKSTFISIITTHFDGLSNMEDIQHLQVVGLKNINLEEMKRELSKVDG
FT                   KKQVLEKYMDYRLEEMKSSAEVPRDAILVARLMGLNEEILNIAKEAVSEANR"
FT   gene            475484..477037
FT                   /locus_tag="Clos_0421"
FT   CDS_pept        475484..477037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0421"
FT                   /product="D-Lysine 56-aminomutase alpha subunit"
FT                   /note="PFAM: D-Lysine 56-aminomutase alpha subunit; KEGG:
FT                   tte:TTE0726 D-lysine 5,6-aminomutase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17983"
FT                   /db_xref="GOA:A8MLR6"
FT                   /db_xref="InterPro:IPR015130"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR037086"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR6"
FT                   /protein_id="ABW17983.1"
FT                   /translation="MSKLNLDQNLIQKARNAAFHITNDVQDFIESHTTVAVERTICRLL
FT                   GIDGVDETETPLPNVIVDHIVQGGGLSQGVAYWIGNAMVQTGKTPQEIAEAVGKGELDL
FT                   IKLSAGDRSAIAAAINEIAVKTADRIRENRRTRENYIDTLGEGKKPYLYVIVATGNIFE
FT                   DVIQAQSAVRQGADVIAVIRTTGQSLLDYVPYGPTTEGFGGTYATQENFRIMRKALDEV
FT                   GKEVGRYIRLCNYCSGLCMPEIAAMGAMERLDMMLNDALYGILFRDINMQRTLVDQYFS
FT                   RIINGFAGIIINTGEDNYLTTADAVEEAYTVLASQFINEQFALKAGIPEEQMGLGHAFE
FT                   MDPNLTNGFLFELAQAQMAREIFPKAPLKYMPPTKFMTGDIFKGHIQNALFNITSIWTN
FT                   QGIQLLGMLTEAIHTPHMHDRALSIDNAKYIFNNCRDLGEEIEFKQDGLIQKRAQEVLK
FT                   DATALLEQIEKDGLFVTIEGGKFGGVKRSRTGGKGLHGVVRKTEGYFNPFIDLLLRGER
FT                   "
FT   gene            477039..477794
FT                   /locus_tag="Clos_0422"
FT   CDS_pept        477039..477794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0422"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   pgi:PG1074 D-lysine 5,6-aminomutase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17984"
FT                   /db_xref="GOA:A8MLR7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR028991"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR036843"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR7"
FT                   /protein_id="ABW17984.1"
FT                   /translation="MLVQQVDLTKVKPYGDTLNDGMTQLSFTLPVPFGEEGKEAARQLV
FT                   AKMGLTEPSVVNMQDLGDGYTYFIVYGKCQHSVDYTSIVVPKVEGDVMEKEEVEEYIEK
FT                   NIGRNVVIVGACTGTDAHTVGIDAIMNMKGYAGHYGLERYKGIEAYNLGSQVPNEELIA
FT                   KAIELKADALLVSQVVTQKDVHIMNMTNLVELLEAEGLRDKLIVVGGGPRISHELAKEL
FT                   GYDAGFGSGSYAEDVASFVVTQMVERKLI"
FT   gene            478041..478349
FT                   /locus_tag="Clos_0423"
FT   CDS_pept        478041..478349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17985"
FT                   /db_xref="GOA:A8MLR8"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR8"
FT                   /protein_id="ABW17985.1"
FT                   /translation="MFWRYNSTVKLRELEDKNLLKLESENLKNRAGMEPTRTLKQSVRM
FT                   ILIGIFFAITLTAFEYALKNFEISDFLRKVFQFGFFGSLVGILSVPYGLYHLIKSLK"
FT   gene            478539..479096
FT                   /locus_tag="Clos_0424"
FT   CDS_pept        478539..479096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17986"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLR9"
FT                   /protein_id="ABW17986.1"
FT                   /translation="MNKKSRLILSVFMIVTMILSLNITVFAEELVTDKIKAETIEIQIL
FT                   NSEDFSETPIPGMELENSNFRANNTIVPFLIRSGNTEEVEVYIHYAGTKMANAVRFKSL
FT                   TLKECNLVLPEKTYKTFKPAPPYLYSTHTFPAGIIGSVKIGDILVPTNKSSVKVNTSDL
FT                   QVFYMTEGWNSYSNIVGCWTLN"
FT   sig_peptide     478539..478622
FT                   /locus_tag="Clos_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            479121..479585
FT                   /locus_tag="Clos_0425"
FT   CDS_pept        479121..479585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17987"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS0"
FT                   /protein_id="ABW17987.1"
FT                   /translation="MGDFLENLIETYKHKVVPGKKSVEEIIRLLSLKLTLAEMDSTSVS
FT                   QSYLDIVKCNMVHSMLNEEKKLDKESLDIVIYKVIEDERSAIYYKDIKRTNQKEIIIFC
FT                   ERNLEFFESNSNSLIMKIWLIQGVDFYDYNNNTWKLINYLSLLYRYETDC"
FT   gene            480190..480915
FT                   /locus_tag="Clos_0426"
FT   CDS_pept        480190..480915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0426"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: cdf:CD1089 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17988"
FT                   /db_xref="GOA:A8MLS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS1"
FT                   /protein_id="ABW17988.1"
FT                   /translation="MKLTIGICDDDSVHVDLIKSYIESMNIPCKVDYILAYSGEELLEQ
FT                   LNKNIVDIVFLDIEMKTLNGIETGKKIREFTEDTIIVYLTGYRHYAVEAFEIESFHYLI
FT                   KPIMETKFVKLMERILTRIEEKKTFRDREKILSIKTRDHLIQLQYDTIYYFEKYFRKLK
FT                   VHTSDKTIEFYGSMNDLLEEIDTSYFIRCHQSYIVNKHKIRGIQGNTIVLDRAENFCIP
FT                   ISRTYKKEIMSIFYAKLFS"
FT   gene            480979..482325
FT                   /locus_tag="Clos_0427"
FT   CDS_pept        480979..482325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0427"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: cbo:CBO1052 two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17989"
FT                   /db_xref="GOA:A8MLS2"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS2"
FT                   /protein_id="ABW17989.1"
FT                   /translation="MENLLMMNIFTNTLDIYALYYFLKKILGKTEKNEISVFSLLSIAI
FT                   VLSTLINTKAGLVKITSITTMTIVLTLIFNWIFSKSKLSKSFALVIMGLTLMFLIELIV
FT                   VNGLSVFFKISPKLLLEVNFYKLMAVILTKLLFITVVSQGENLFKEMYTWIKQLNIYPV
FT                   SILIIVNLCIVFMTFIFYSYIDIGGHRELIYIIGMGGAAVVVSCVIAWIIKKMIEQQNK
FT                   EFLFQIKEKEYENQQIYLDHIQEVIQTLRAQRHDFNNYVSTIYGLIHLGKIEEAKKYIL
FT                   NLSKDVVDLNEIVNACHPVVGAILNMKKEKAARSKIDFNVDVDLPTKLPFEFVDISTIL
FT                   GNLLDNAIEACEKISNDCKKIYIQIYIKDFHMIIKIENSKSDQVILKSDNLIGYLTTKL
FT                   DKENHGLGLKNVRKAVLKYDGMLNIEDKGKEFLVDIALPLKEVLVEVEA"
FT   gene            482516..483121
FT                   /locus_tag="Clos_0428"
FT   CDS_pept        482516..483121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0428"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG:
FT                   cth:Cthe_1310 accessory gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17990"
FT                   /db_xref="GOA:A8MLS3"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS3"
FT                   /protein_id="ABW17990.1"
FT                   /translation="MIKINFVAEGLVNRLIDNQIISKEDRDIYKFGLEVFLSLVTKIIL
FT                   LTMIAYIFDVMVEMFIFATTFFVLRINAGGYHAKTFLGCFITTVIFTFVTINVLSNIPT
FT                   PFYFTLIILAIANVLIFLYAPVDTPNKRSTPKEYAIYRRRSLRFAALFTLGIIVIYFAD
FT                   ASKLYYCNIGVFAFFIESITLIPLVNKKNIKQKKGDSP"
FT   gene            483416..484150
FT                   /locus_tag="Clos_0429"
FT   CDS_pept        483416..484150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17991"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS4"
FT                   /protein_id="ABW17991.1"
FT                   /translation="MERDVMIKQMILVTDGQSNVGGSPIIAAEKAYRNGIIVNTIGIVD
FT                   GKESNEDALNEIVEIAKAGGGTYEYSYINELFQTMQSLTYQTVNKTLQEVVSKQLKEMI
FT                   GQEIHSMEPASRSKILNYIDDFSEDVGVQCCILLDSSGSMANKIHLARHSILDLIHSFK
FT                   GRRGKVEIAVIAFPGENMEICKVLHDFNEDSARLERGLYNISPKGGTPTASAIEEGIKL
FT                   IHKQSMSRLTSNEVIEVSEYIV"
FT   gene            484266..485171
FT                   /locus_tag="Clos_0430"
FT   CDS_pept        484266..485171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0430"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   bsu:BG10129 probable serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17992"
FT                   /db_xref="GOA:A8MLS5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS5"
FT                   /protein_id="ABW17992.1"
FT                   /translation="MFLPLLMPNTTIVGKWNKKTYRVMEKLGEGGIGAVYRVVDVLDGR
FT                   NYALKLSEDNLSLNREYELLKKFEAIDTIVRVYEIDDMHVGDKIYYFLLMEYIPGITLN
FT                   EYRKNRSISVAESIGIVIILLKVMGEIHRRGYILGDTKLDNIMVNGEGKVTKIIDLGGV
FT                   VKINAGIKEFTPAYDRASWQCGHRVAEESYDIFSAAMILTQLLLAKFTFNPKVKSIHRV
FT                   KEELMNKKINGELKESLIPILNGEKKGVKDFANTLLTIYNKERALEVMRKNKSRDKKIN
FT                   VYFFCSLSFFIYTVILILRK"
FT   gene            485269..486660
FT                   /locus_tag="Clos_0431"
FT   CDS_pept        485269..486660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0431"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: ExsB
FT                   family protein; PP-loop domain protein; Protein of unkown
FT                   function DUF1946 PP-loop ATpase; KEGG: cdf:CD3560 putative
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17993"
FT                   /db_xref="GOA:A8MLS6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS6"
FT                   /protein_id="ABW17993.1"
FT                   /translation="MIDKIKKTIHENNLIEWGDRIIVAISGGPDSVCLLHNLYQLREEY
FT                   NLELYGAHLNHNFRGIDAQVDAQYVANLCEELNILCFIKSMDVPQYAKEKGLSSEEAGR
FT                   ILRYEFFDEIAEQVGANKIAVAHNENDQAETVLMRLLRGTGLQGLTAIHINRGRIIRPL
FT                   LGVDRKSIEEYCEKYQLSPRIDKTNLESIYKRNKIRLELIPYLEEHYNPNIIENLVRTA
FT                   EILKEDFDFIEEQSREIYSGLMTNQNEFSLTLPLEAIRNLHPAIKSRVIRLAAEQLLGR
FT                   QEILEYKHVQNVLDLVEKGATGKKTALPLGLIAKISYENLCFTTEAEESRAYEYELPLE
FT                   DFLYLEELDGTFEARVFERNQTQEISRDKYCKCFDYDQIKNTLNVRNRREGDKFYPLGL
FT                   TGSKKLKDFFIDYKIDRDERERMPLVCDGNEIMWVVGLRISEKYKITDKTTRILEVTFN
FT                   RGDSE"
FT   gene            486756..488711
FT                   /locus_tag="Clos_0432"
FT   CDS_pept        486756..488711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0432"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: cdf:CD3559 cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase central domain protein; peptidase M41 FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17994"
FT                   /db_xref="GOA:A8MLS7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS7"
FT                   /protein_id="ABW17994.1"
FT                   /translation="MKKFFRGASFYILLFLVLLIIVQQFGSQPQQTVDVEFSRLYRALL
FT                   AEDVHEIYMVDRSIEGVMTIDNAKVNFKSFIPEVFNENEFTELIDAQIKSGTLELKAAS
FT                   PAGTPWFINLLPSALMILIFIVFWFVFMQQSQGGGNRVMSFGKSRAKLHKDDEKRKVTF
FT                   KDVAGLDEEKEELQEIVDFLRNPKKYMDLGARIPKGILMVGPPGTGKTYLTKAVAGEAG
FT                   VPFFSISGSDFVEMFVGVGASRVRDLFEQAKKSAPCIIFIDEIDAVGRKRGAGLGGGHD
FT                   EREQTLNQLLVEMDGFGANEGIIIVAATNRPDILDPALLRPGRFDREVMVGVPDIKGRE
FT                   EILKVHSKGKPLAEDVDLKVIARRTPGFTPADIENLMNEAALLTARKSQKVIGMATVEE
FT                   AITKVIVGVEKKSRVISEKERKLTAYHEAGHALIARLLPNLDPVHQVTIIPRGRAGGFT
FT                   MTLPQEDKYYATKKEMEERIVELLGGRMAEKLVLHDISTGAQNDLQRVTAIAKGMVTKY
FT                   GMSEKLGSMSFGSDEEVFIGRDYHSTRNYSEAVAAEIDSEIRRIVDEAYDRAEKLLTEH
FT                   MDKLHTVAKALLKVETLDADQFEIIFSGEASIEEEDTVDEALEKINAAVKAKKDSTLTL
FT                   DKEENKVDLDNDDKIK"
FT   sig_peptide     486756..486836
FT                   /locus_tag="Clos_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.844 at
FT                   residue 27"
FT   gene            489103..490491
FT                   /locus_tag="Clos_0433"
FT   CDS_pept        489103..490491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0433"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; KEGG: cdf:CD2344 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17995"
FT                   /db_xref="GOA:A8MLS8"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS8"
FT                   /protein_id="ABW17995.1"
FT                   /translation="MLGLIRFDLIGWIMSPYILMFVAVFTGILLGNIKIGKFNFGASGC
FT                   LFTGLFIGWAVYGYGIKIQEGQKGLEAAKSMISVGVVPSTFFNLFLVFFVVAVGLLAAK
FT                   DLGAVIKKYGSKFVVLGFIITLSGAIATYSMVLLSPIDNPYEVSGVYTGALTSSPGLAA
FT                   AIETARDHATVRVNGFGDAGSQEREKFMKILDPSGEVYQESLDSLTNEQESQFIKNAES
FT                   GIGLGYAVGYPFGVIIVILAINFLPKIFKMNLEEEKERFHKEMQEARAMVKAGKEIVET
FT                   KFDIVAFTFACFFGYSIGIIEIYLGSMIGYFSLGATGGALIGSLILGYIGKIGPMSFRM
FT                   DMKVLGIVRELSLCFFLGIVGLRYGYQVFDAILGTGASLAIISLFVGAVAILVGFLVGR
FT                   YVFKLNWIMLAGSICGGMTSTPGLGVAIDALDSDDPAAGYGAVYPFALLGMVLFTIILH
FT                   KLPM"
FT   gene            490576..490905
FT                   /locus_tag="Clos_0434"
FT   CDS_pept        490576..490905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_3178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17996"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLS9"
FT                   /protein_id="ABW17996.1"
FT                   /translation="MEPFEIFISGYAKLPMGTTAEELYKVIAVGILVDKNTGEILDADC
FT                   TLVTSVAKNLVNKLLVGKNILRFEEIEKAINERYFGTVKKSLISSIKKCHDKLKIILEE
FT                   GPVEV"
FT   gene            491094..492638
FT                   /locus_tag="Clos_0435"
FT   CDS_pept        491094..492638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0435"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   cdf:CD2343 succinyl-CoA:coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17997"
FT                   /db_xref="GOA:A8MLT0"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT0"
FT                   /protein_id="ABW17997.1"
FT                   /translation="MKDRIRKDDLKEKVMSAESAAMLIKDGMIVATSGFTPSGYPKAVP
FT                   LALEKRVNEGEAIGITVLCGASVGDELDGALTRCGVMKRRYPYQTNNDLRNAINESQVS
FT                   YQDMHLSHVTQFIDYGFFGKIDVALVEALAITEEGGIIPTTSIGLMPQAIKNSDMVIVE
FT                   INMSQPMELEGMHDIYMTEKPPYRKAIPIEQTGDRVGTHYIPCPPEKIAAIVFTDIPDK
FT                   VRPLGPIDEPSKLISGHIIDFLKYEVRKGRLPKNLLPLQSGVGSVANAVLGGLVNSDFK
FT                   DLTCYTEVIQDSMLDLIDAGKVTIASGTALTPSIEGLKRLHENMKHYAKHCILRPMEIS
FT                   NNPEVIRRLGIISMNTAIEVDIYGHVNSTNIMGSRMMNGIGGSGDFTRNAYLSIFTTVS
FT                   TAKNGEISSIVPKASHIDHTEHDVSVVVTEQGLADLRGTSPRERARKIIQNCAHPDYRD
FT                   MLMDYLERAEKTKFKYQPHLLDEALSWHDRFLKTGSMKVDKNQSRDISDLIASSKE"
FT   gene            493029..494708
FT                   /locus_tag="Clos_0436"
FT   CDS_pept        493029..494708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0436"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: tte:TTE1217 Methylmalonyl-CoA mutase,
FT                   N-terminal domain/subunit; TIGRFAM: methylmalonyl-CoA
FT                   mutase, large subunit; PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17998"
FT                   /db_xref="GOA:A8MLT1"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT1"
FT                   /protein_id="ABW17998.1"
FT                   /translation="MFEKENIKNLKQKQADWNEKKVGKALAKFPERREQFVTGSNQEVE
FT                   RLYTPADIPDFNYEEDLGFPGEFPFTRGVQPTMYRGRFWTMRQYAGFATAEESNKRYKY
FT                   LLEQGQTGLSVAFDLPTQIGYDSSHPLSEGEVGKVGVAIDSLKDMEILFDGIPLDKVST
FT                   SMTINAPASVLLAMYIAVAEKQGVSSDKLRGTIQNDILKEYIARGTYIFPPEPSMRLIT
FT                   DIFEYCSKEVPQWNTISISGYHIREAGSTAVQEVAFTLADGIAYVEAAIKAGLDVDTFA
FT                   PRLSFFFNAHNDLLEEVSKFRAARRLWAKIMKDHFGAKDPKSMQLKFHTQTGGCTLTAQ
FT                   QPDNNIVRVAIQTLAAVLGGTQSLHTNSKDEALALPTEDSVRIALRTQQIVAHESGVAE
FT                   TIDPLAGSYYVESLTNKIEAEAMAYIDKIIELGGAPKAIEKGFIQKEIMDSSYEYQKQI
FT                   ESGDRVVVGMNKFKIQEASPKGLLRVDPVVGQLQKQKIKELQEERDNAAVAEKLASLKE
FT                   AAEGTSNLMPFILDAVRAYATLGEICGVLRDVFGEYQQSVII"
FT   gene            494767..495165
FT                   /locus_tag="Clos_0437"
FT   CDS_pept        494767..495165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0437"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   tte:TTE2388 methylmalonyl-CoA mutase, C-terminal
FT                   domain/subunit (cobalamin-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABW17999"
FT                   /db_xref="GOA:A8MLT2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT2"
FT                   /protein_id="ABW17999.1"
FT                   /translation="MERPIRVLVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLRQTPE
FT                   QIVAAAIQEDVEVVALSILSGAHNHLLPKVVELLKGEGAYDDILVIGGGVIPDEDIPFL
FT                   KENGIAEIFTPGTPTATTIDFIKNNLKR"
FT   gene            495211..496152
FT                   /locus_tag="Clos_0438"
FT   CDS_pept        495211..496152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0438"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="KEGG: tte:TTE2387 putative periplasmic protein
FT                   kinase ArgK and related GTPases of G3E family; TIGRFAM:
FT                   LAO/AO transport system ATPase; PFAM: ArgK protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18000"
FT                   /db_xref="GOA:A8MLT3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT3"
FT                   /protein_id="ABW18000.1"
FT                   /translation="MSLAQRLLDGDKRAAARLITMFENNDKEAIDILKDLYQHTGKAQV
FT                   VGITGPPGAGKSTLTDKLAKALRKEGKKIGIIAIDPTSPFTGGSILGDRVRMSDLYTDP
FT                   DVFIRSMGTRGHLGGLSKATLGATKILDIYGCDYIFIETVGVGQSEVDIVKAADTVLMV
FT                   MVPGLGDDIQAIKAGIMEIGDVFAINKADRDGAARTKVEIEMSLDFNHSEWRPPVCEVV
FT                   AIHNKGVDQLLEDLKKHRAYLESTGHLMQRRIKNSEMEILELTQQELMKKILGNSESKN
FT                   NIYTLSQLVANRDMDPYSASEKILDKIMHNQY"
FT   gene            496175..496582
FT                   /locus_tag="Clos_0439"
FT   CDS_pept        496175..496582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0439"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pth:PTH_1363 methylmalonyl-CoA
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18001"
FT                   /db_xref="GOA:A8MLT4"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT4"
FT                   /protein_id="ABW18001.1"
FT                   /translation="MNVKKVDHIGIAVKNLDEALKFYKDILGLDCVGTEVVEEQKVKVA
FT                   FLPVGDTEVELLESTAEDGPIAKFIEKKGEGIQHIAFRVDSIEAAIEEMKENGVKMIDE
FT                   TPRYGAGGARIAFCHPKSTGGVLVELSERED"
FT   gene            496585..498132
FT                   /locus_tag="Clos_0440"
FT   CDS_pept        496585..498132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0440"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: tte:TTE2385
FT                   Acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18002"
FT                   /db_xref="GOA:A8MLT5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT5"
FT                   /protein_id="ABW18002.1"
FT                   /translation="MTMSKLEDLKQRKTKVEEGGGAKRIAAQHERGKLTARERINLLFD
FT                   EGSFVELDAFVKHRCVNFGMDEIEIPGEGVVTGYGLVDGRPVYAYAQDFTVLGGSLGEM
FT                   HAKKICKVQDLALKMGAPIVGLNDSGGARIQEAVDALAGYGEIFYRNTIASGVVPQISA
FT                   IMGPCAGGAVYSPALTDFIFMVDKTSQMFITGPQVIKSVTGEEVSSESLGGAMTHNKTS
FT                   GVAHFVSANDEECIAEIRRLLGFLPSNNMEAAPEVYSADDLNRIIPELNEIVPENPNKP
FT                   YDMKEIIQAIADDNDFFEVQPYYAQNMITGFIRINGQSVGVIANQPKVLAGCLDINASD
FT                   KAGRFIRTCDCFNIPVLTLEDVPGFLPGTSQEYGGIIRHGAKMLYAYSEATVPLVTLIT
FT                   RKAYGGAYLAMGSKHLGADMVFAWPTAEIAVMGPEGAANIIFKNEIAAAEDPQATRTEK
FT                   IEAYKGEFATPYKAAERGFVDDVIEPSMTRIRIADALNMLASKRESRPAKKHGNLPV"
FT   gene            498163..498555
FT                   /locus_tag="Clos_0441"
FT   CDS_pept        498163..498555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0441"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18003"
FT                   /db_xref="GOA:A8MLT6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT6"
FT                   /protein_id="ABW18003.1"
FT                   /translation="MNLLETMKTSMDGLTFGERFLGSLQVTLLGMGIVFISLAVLYFSI
FT                   VFMNFVINGGKNAKPNPVKPIVVEETPEEEVVVDDTELIAVITAAIAASLQTTTSNIVV
FT                   RNITRVHDTTPSWARIGRVEQINSRF"
FT   gene            498615..498998
FT                   /locus_tag="Clos_0442"
FT   CDS_pept        498615..498998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0442"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: cth:Cthe_0700 biotin/lipoyl attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18004"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT7"
FT                   /protein_id="ABW18004.1"
FT                   /translation="MKKFNITVNGVSYEVEVEEMKDGVAAPAPREAAPVQKPVAAKPAP
FT                   KAAPAPKAAPAGATSIEAPMPGNIWKIEVKEGQQVKSGDVLLILEAMKMENEIMAPVDG
FT                   IVASIHVAEGAAVNSGDVLVSLK"
FT   gene            499103..500167
FT                   /locus_tag="Clos_0443"
FT   CDS_pept        499103..500167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0443"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="KEGG: csc:Csac_2482 sodium ion-translocating
FT                   decarboxylase, beta subunit; TIGRFAM: sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   Na+transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18005"
FT                   /db_xref="GOA:A8MLT8"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT8"
FT                   /protein_id="ABW18005.1"
FT                   /translation="MIVVSCILFYLAVAKGFEPLLLIPIAFGMLLTNLPLSGVLEPSGS
FT                   DGTPGGLIHYLYYGVKLGIFPPLIFLGVGAMTDFGPLIANPKSLFLGAAAQAGIFFTFI
FT                   GATLLGFTAQEAGSIGIIGGADGPTAIFLTSKLAPHLLGPIAVAAYSYMALVPIIQPPI
FT                   MKALTTKEERMIKMEQLRQVSKIERVVFPIMVTIIVSLIVPSATALVGMLMLGNLFKES
FT                   GLTDRLSKTAQNELINIVTILLGVSVGATAKAEAFLKLETLKIIALGVIAFGVGTAAGV
FT                   LLGKLMNKLSGGKVNPLIGSAGVSAVPMAARVSQVVGQKENPSNFLLMHAMGPNVAGVI
FT                   GSAVAAGVLLSLFG"
FT   gene            500402..501382
FT                   /locus_tag="Clos_0444"
FT   CDS_pept        500402..501382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0444"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: cno:NT01CX_0898 BirA bifunctional protein,
FT                   putative; TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; Helix-turn-helix type 11 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18006"
FT                   /db_xref="GOA:A8MLT9"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLT9"
FT                   /protein_id="ABW18006.1"
FT                   /translation="MRNKILEALYANKGNYVSGEILKEKLGISRTAVWKHIKILQDQGY
FT                   NIQTAPRKGYVLFEADDKLLSKEIESLLWGHTMGRELIVFDSIDSTNTYGKNNADHLMD
FT                   GTIILSEEQLAGRGRRGKDWSSPKGTGIWMSMVLKPDIPPTEGVKTTQIAAAAVCKAIR
FT                   DLTGLDALIKWPNDIVVNGRKVCGILTEMAGQLNKIDYIVVGIGINVNNTEFPEGISAV
FT                   ATSLQIEYGKKIDRKELIVRIIKNFEALYHSYIENLNLTEVVAIVRDYSAVIGKEIKVI
FT                   HGTSERIVTVHDIDEEGFLIVESGDGKREVIFSGEVSIRGKNGYI"
FT   gene            501560..502069
FT                   /locus_tag="Clos_0445"
FT   CDS_pept        501560..502069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0445"
FT                   /product="membrane protein"
FT                   /note="KEGG: tte:TTE2382 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18007"
FT                   /db_xref="GOA:A8MLU0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU0"
FT                   /protein_id="ABW18007.1"
FT                   /translation="MIQSTKMSTKKVTIAGMLGAFSVVLSMTPIGFIPIPFLGINATTM
FT                   HIPVIIGAIIGGPFVGTLVGLIFGVSSFLRVGSPFFADPLVSILPRLFIGVMSYYTYKA
FT                   TKHAIPTAIVGTLTNTAGVMSMAYFRGYLPLNVIIGIVTLNGVTEAIVSSVIVYLVMKS
FT                   LKRYTI"
FT   sig_peptide     501560..501640
FT                   /locus_tag="Clos_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.906 at
FT                   residue 27"
FT   gene            502101..502898
FT                   /locus_tag="Clos_0446"
FT   CDS_pept        502101..502898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0446"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bvg accessory factor; KEGG: cdf:CD3555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18008"
FT                   /db_xref="GOA:A8MLU1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLU1"
FT                   /protein_id="ABW18008.1"
FT                   /translation="MILVFDVGNTNIVLGVYRGKELIENWRIATDKDKSSDEYAMVIHQ
FT                   FFHYNGLNIHDVDDVIISSVVPNIMYSLENASRKLFKREPLIVGSGIKTGMNIKYDDPK
FT                   QVGADRIVNAIAAYEKYGGPLIIVDFGTATTFCAVSEDGEYLGGAISPGIKISSEALFE
FT                   KAAKLPRVELINPKKVICKNTVSSMQAGIVYGYIGLVENIVRNMKKELKSSSCKVIATG
FT                   GLSTLIAGGTDSIDVVDKFLSLDGLNIIYERNRKDRILSNKKS"
FT   gene            502960..503934
FT                   /locus_tag="Clos_0447"
FT   CDS_pept        502960..503934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0447"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase DuS; dihydroorotate
FT                   dehydrogenase; KEGG: cdf:CD3554 tRNA-dihydrouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18009"
FT                   /db_xref="GOA:A8MLU2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU2"
FT                   /protein_id="ABW18009.1"
FT                   /translation="MKIENLNLENPVFLAPMAGVTDLSFRLICKAMDCGMVYMEMVSAK
FT                   GLYYKDKKTEELLKIHDHEKPVALQIFGSEPDIMARAAYMLNDRANAILDINMGCPTPK
FT                   IVKNGDGSALMKDIKLAGEVIKAVVKESIKPVTVKIRKGWDEHSVNAVELAKVIEDSGA
FT                   KAVAVHGRTREQFYAGKADWSIIKEVKEAVTIPVIGNGDVFTIEDGIRLLEYTNCDGIM
FT                   IGRGSQGNPWLFKRLVHYMKTGEVLPEPRAEEKVLMALKHLDLVIRNKGEYIGVKEMRK
FT                   HIAWYLKGLRGTASLRNQINTTGTKADIEELLMNYLESEGIEI"
FT   gene            504023..504946
FT                   /locus_tag="Clos_0448"
FT   CDS_pept        504023..504946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18010"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU3"
FT                   /protein_id="ABW18010.1"
FT                   /translation="MKKIVSISIGSSKRDHHVTANIMGEDFSIERIGTDGSMERAMDLV
FT                   RSLDGKVDAIGMGGIDLYLQAGKKSYEIREAARLKNMAQITPVVDGSGLKNTLEKQVIH
FT                   YLKNKDIVDFKNKRTLITCGMDRFGMAEALVNCGAHILLGDLMFALNINIPIGSLKNLQ
FT                   RVAAILAPIACRLPFHLLYPTGEEQNKNVSNKYGTYFDDSEIIAGDFHYIKRFMPEEMG
FT                   GKILITNTVTEEDIEMLEKRGVAMLVTTTPEFQGRSFGTNVMEAVVVSLLRDRGRACTS
FT                   NEYYKIIEELSLKPRIEYLNNMKGLL"
FT   gene            505333..505812
FT                   /locus_tag="Clos_0449"
FT   CDS_pept        505333..505812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0449"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: cth:Cthe_2897 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18011"
FT                   /db_xref="GOA:A8MLU4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLU4"
FT                   /protein_id="ABW18011.1"
FT                   /translation="MMADREVVLTAQGLKKLEDELELLKTVRRKEIAERIKQAIAFGDI
FT                   SENSEYDEAKNEQAQVEDRINKLETMLRKAVIIDEEDINTDIVSIGSIVQVNDLEFDEI
FT                   VEYTIVGSTEADPYELKISNESPVGRALLGTKVGDVVEVQIPDGVTKYEILKITR"
FT   gene            505828..507315
FT                   /locus_tag="Clos_0450"
FT   CDS_pept        505828..507315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0450"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: cdf:CD3552 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18012"
FT                   /db_xref="GOA:A8MLU5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU5"
FT                   /protein_id="ABW18012.1"
FT                   /translation="MINEEQNLNELLKIRRDKLKHLQEIGKDPFKIEKVYVTHYSQQII
FT                   EDFEQLEGQNATIAGRIMTKRGHGKASFINIQDKDGQIQVYVREDKIGAEDYELFVTYD
FT                   IGDIIEIKGEIFKTNKDEISVRANEVRLLTKSIQILPDKWHGLKDHDLRYRQRYVDLIV
FT                   NPEVKKTFVTRSKAIKAIKEFLDNRGYLEVETPILGTLAGGANARPFITHHNTLDIDMY
FT                   LRIANELFLKRLIVGGFDKVYEMGRMFRNEGMSIKHNPEFTSIELYEAYADYNDMMDIT
FT                   ENIVAYAAEKALGTTKINYQGQEIDLTPPWNRMTMVEACRKYANVDFDEVKTDEEAIAI
FT                   AKKLGLEVNPAMKKGHIISLVFEEFGEKHLIQPTFITQHPVEISPLAKRNPEDPAFTNR
FT                   FEAFINTWEIANAFSELNDPIDQRGRFMDQLEQREAGDDEAHVLDEDFLNAIEVGLPPT
FT                   GGLGIGIDRLMMLITNSPSIRDVLLFPTMKPLDHHKE"
FT   gene            507715..509219
FT                   /locus_tag="Clos_R0016"
FT   rRNA            507715..509219
FT                   /locus_tag="Clos_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            509448..512383
FT                   /locus_tag="Clos_R0017"
FT   rRNA            509448..512383
FT                   /locus_tag="Clos_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            512433..512549
FT                   /locus_tag="Clos_R0018"
FT   rRNA            512433..512549
FT                   /locus_tag="Clos_R0018"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 96.92"
FT   gene            512797..513309
FT                   /locus_tag="Clos_0451"
FT   CDS_pept        512797..513309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18013"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU6"
FT                   /protein_id="ABW18013.1"
FT                   /translation="MIVQQLFESGMSFEVFAPNDHDVNMEKLLKIYEQIQLDEEFINKI
FT                   KFIHKNIYILVFAELWCPDCIINLPAIKKISEVNPNITFRILPRDGYEQYMEPYKIGGK
FT                   PKIPTCVIFNDKFEEIGAFIEYPKILRDIVNKGNQVEVIVAKRKYHKGEYVVDTIKEIF
FT                   DLIMKAI"
FT   gene            513703..516057
FT                   /locus_tag="Clos_0452"
FT   CDS_pept        513703..516057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0452"
FT                   /product="ribonucleoside-triphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: rrs:RoseRS_4577 ribonucleoside-triphosphate
FT                   reductase; TIGRFAM: ribonucleoside-triphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18014"
FT                   /db_xref="GOA:A8MLU7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR013345"
FT                   /db_xref="InterPro:IPR040763"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU7"
FT                   /protein_id="ABW18014.1"
FT                   /translation="MIQVMKRNGRLVEFNPSKITNAIKKAMAETKLGVDHNLSVKITEE
FT                   IKEKIQNNAKPIHVEEIQDIVEMLLMSSDRKDVAKRYIIYRNERAKIRANQKSSDEKLL
FT                   TDEFISQYKHQIPPLNQLGNFVYYRTYSRWLQEEGRREYWWETVRRAVEYNCSLVPTRR
FT                   EEAEKLFDNVYNLRQFLSGRTFWVGGTSVAKNYPMSNYNCSFVVIDSFEAFRDLFYLLM
FT                   IGSGVGARVLKEDVQNLPKIRTDYEIIHKDYVNISIKDREDNTSLVFSHNNSVKITVGD
FT                   SKEGWIQSLDFFFKLLYSNEYRNIKTIIVDYDHVRPKGAKLKSFGGTASGHESLKNMFY
FT                   KIDKVIKNSRKVNGSGKIKLRPIDCLDIANIIGENVVVGGVRRTAEMILIDADDKECVE
FT                   AKSNLYKQIDGQWIVDQNIIHRQMSNNSIYYTEKPSREKLHWQIQQMRYSGEPGWINAE
FT                   AAAKRRPNMNGVNPCGEILLDSQGLCNLTTINVMAFVKEDGTLDLEGIIEAQKLSVRAG
FT                   YRMTCVELELPHWDKVQQRDKLVGCSLTGWQDLVNATTMDIEAQKKLLSMLRKAARNEV
FT                   DAYAKEIGQNIPLLVTTVKPEGTLSQLPTVSSGVHYSHSPYYIRRIRISAHDPLVKVCE
FT                   ELEYPVYPEVGQDWDTCSTKVVEFPVKAPAGRTKYDISAIEQLENYKLFMESYVDHNCS
FT                   ITIHVRNHEWEEVEEWVWNHWDDVVALSFLALEDNFYQLLPYESIDEEEYNKRLRSMKA
FT                   FIPSLISKYEEKEMDLDIGSDSCDNGICPIR"
FT   gene            complement(516103..518169)
FT                   /locus_tag="Clos_0453"
FT   CDS_pept        complement(516103..518169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0453"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: tte:TTE2333 translation elongation and release
FT                   factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18015"
FT                   /db_xref="GOA:A8MLU8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU8"
FT                   /protein_id="ABW18015.1"
FT                   /translation="MKGYQADQIRNIAFLGHGGCGKTTLTEAVLFSAKLTNRMGRVEDG
FT                   NTVSDFDKEEVSRSISIGTSIIPVEWHNHKINLLDTPGYFDFIGEVQSALKAAGGAVIL
FT                   VDATSGIEVGTEKSWDLLADSSKPRFIFVNKMDRENANFDKVLSDLREKFGKKIAPFQI
FT                   PLGANENFIGNINVVKMIAREYTGKDCVEKPIPPELLSEAEAIREMLIESVAESDEALL
FT                   EKFFAGETFTEKEIQEGLRKGVINGDIVPVICGASSKNIGTHTLLDMLIDYSPSPMDMP
FT                   SKKGTNPYTEETVERTLEPNEPFSAQIFKTIVDPYVGKISLFKVISGKLTPDLEVLNAN
FT                   KDEKEKISSLFLLRGKNQIEVKEIVAGDIGAVAKLQYSSTGDTLCSVNHPIVFSNIEFA
FT                   KPQLALSVEPKAKGDEEKISSGLQRLAEEDPSFLFERNPETKQTLVYGQGELHIKIITN
FT                   KLKNKFGVDVDLKDPKVPYRETIKGKSDVQGKHKKQSGGHGQYGDVKIRFEPCASEFEF
FT                   AEEIFGGSVPKSYIPAVEKGLRECLDTGALAGYPVVNLKATLYDGSYHDVDSSEMAFKI
FT                   AASLAFKKGVEAAKPVLLEPIVKVEVVVPEDFMGDVMGDLNKRRGRILGMEPQPKGMQL
FT                   VVAEAPQSEMFKYATDLRSMTQARGSFTMEFVRYEEVPQMISDKVVESARAEK"
FT   gene            518566..519072
FT                   /locus_tag="Clos_0454"
FT   CDS_pept        518566..519072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0454"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: mta:Moth_0160
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18016"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLU9"
FT                   /protein_id="ABW18016.1"
FT                   /translation="MLCDDCKNKEANVHVTKIINGKKQEKNLCEDCARKNEKTNFENNF
FT                   SMPNFLTSLLEGNLGFNMDYKEDKRCPQCNATYEDYKRSGRLGCGVCYETFSDMLLPLI
FT                   RKIQGSTKHGGKIPKKSGAVIRLKNELKASKAKLQQLIMQEEFEEAAKIRDEIRTLEGE
FT                   INKGI"
FT   gene            519083..520105
FT                   /locus_tag="Clos_0455"
FT   CDS_pept        519083..520105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0455"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   gka:GK0077 creatine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18017"
FT                   /db_xref="GOA:A8MLV0"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV0"
FT                   /protein_id="ABW18017.1"
FT                   /translation="MPKWVKEIGPESDIAISSRIRMARNIESMPFPNDLNEAQSKNILE
FT                   MVHHTITNANSSFKKEFELIEMNRQDKIERLNYIEKHLISPALAQNTTGGAALINKEET
FT                   ISIMVNEEDHIRIQCLLPGLQLTECLDLGNKIDDLLEESIRYSFDENLGYLTSCPTNVG
FT                   TGVRASVMLHLPALSLTGYINGVFNVASKIGLAVRGIYGEGSQYTGNIYQISNQITLGP
FT                   PEEELVSTLHDVTMQIIQNERAVREHLLASKNIELSDRVFRAYGILKSARLLTSTEAMQ
FT                   LISDLRLGVNLNLIQDVSIEKINELMVTIQPGYLQKYFNSDLSGIERDIKRAQLVRETL
FT                   "
FT   gene            520136..522577
FT                   /locus_tag="Clos_0456"
FT   CDS_pept        520136..522577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0456"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: tte:TTE2327 ATPases with chaperone
FT                   activity, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18018"
FT                   /db_xref="GOA:A8MLV1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV1"
FT                   /protein_id="ABW18018.1"
FT                   /translation="MAMFGRFTERAQRVITLSQQIAQQLGHSYVGTEHLLLGLVREEEG
FT                   IAAKALKNLGVEVEDIQQIIVQSIGVGNKPVELLGYTPRTKKVFELSVAEARNLNHNYV
FT                   GTEHLLLGLISEGDGIASKILVQLGVNLQNVREAVLKLLNSNSSASNAKNYTASSDKET
FT                   PTLNQFGRDLNDLAREGKIDPVIGRSKEIDRVIQVLSRRTKNNPCLIGEPGVGKTAVAE
FT                   GLAQQIVEGNVPDILKDKRVVTLDLASMVAGAKYRGEFEDRLKKVMEEIRSVDNVILFI
FT                   DEMHTIIGAGAAEGAIDAANILKPALARGEMQVIGATTLNEYRKHIEKDAALERRFQPI
FT                   TVEEPSIEDAIRILEGLRDKYEAHHGVKITDEALKAAVELSARYITDRFLPDKAIDLID
FT                   EAASKVKIFTVTTPPDLRDLEERLEKLSNEKEEAISVQDFERAAKLRDEEKQTKEALAE
FT                   RKNDVNKRHKDAIVSSEEIANIVSDWTGVPVRRLQQGESEKLLNMEEILHNRVIGQEEA
FT                   VKSIARAIRRARVGLKDPKRPIGSFIFLGPTGVGKTELSKALAESMFGNEDDMIRIDMS
FT                   EYMEKHTVSRLIGSPPGYVGFDEGGQLTEKVRRKPYSVVLFDEIEKAHPDVFNILLQIL
FT                   DDGRLTDAQGRTVDFKNTVIIMTSNVGAHTIKKQKILGFAASQEESAQNEYEKMKENIM
FT                   DELRRTFRPEFLNRIDDIIVFHGLEREDIGKIVDLLLVDLKSRLKALEIDLEISEEAKN
FT                   YIADKGFDPQFGARPLKREIQRTVENQLSEELLRGSIKAGSTVLVDLSDGKIVIRPKVG
FT                   L"
FT   gene            522707..524077
FT                   /locus_tag="Clos_0457"
FT   CDS_pept        522707..524077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0457"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: cpr:CPR_2430 DNA repair protein RadA; TIGRFAM:
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18019"
FT                   /db_xref="GOA:A8MLV2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV2"
FT                   /protein_id="ABW18019.1"
FT                   /translation="MAKIKSKFVCQECGYESVKWLGKCPGCNNWNTMEEEMLESKKDFK
FT                   RSPTIVSQSKPQPIKEVKSGAYERYDTQINELNRVLGGGLVKGSLTLITGEPGIGKSTL
FT                   ILQASSTIANRYGKTLYVSGEESEEQIKMRGERLNSLSDDLYIVSETNVDVIEKYIEEY
FT                   APVFIIIDSIQTLFKEDLSSAPGSVSQVKECANNLMRIGKSKNIPMFIVAHVTKQGELA
FT                   GPRVLEHMVDTVLHFEGERTQEFRILRALKNRFGTTSEIGVFEMREEGLVEVSNPSAMF
FT                   LESLSTEAEGAIVVVTVEGTRPLLVEIQALVAPTNAGFPRRAAVGIDINRLNLIIAVLE
FT                   KKIGLPLMNQDIYVNVVGGLKLEGTSADLGVAMAIYSSMRGIPIASRAMVVMGEISLTG
FT                   ELRPISHLEKMLKEAEKMGFTRSVIPQKNKFKFDGIHMKCKGVDTLKDALEMLTLHN"
FT   gene            524187..525263
FT                   /locus_tag="Clos_0458"
FT   CDS_pept        524187..525263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0458"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: cbo:CBO3507 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18020"
FT                   /db_xref="GOA:A8MLV3"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV3"
FT                   /protein_id="ABW18020.1"
FT                   /translation="MKEPRIEEMQLLDTIKMVAPGTPLREGLENVLRAKTGALIVIGDS
FT                   EDVRSMIDGGFAINVDFSPAYLYELCKMDGAIVLSSDSKKILYANTQIMTDPSISSAET
FT                   GTRHRTAERVAKATGQVVVSISQRRNIITLYRGYSKYIIQDTNKILTKANQAIQTLEKY
FT                   KSVLDQAMINLSALEFEDLVTVYDVCTVIQRTEMVVKVVQEIEKYIYELGNEGRLVSMQ
FT                   MKELVANVVEDGRLVVKDYMIHLDAEESNIHKVLRGLSSEDLLDLSSIAKILGYGSNMN
FT                   ALDISVSPRGYRILNKIPRLPLTVIDNLLKQFISFQKILKASTEQLDDVDGIGEARARA
FT                   IKDGLRRLQEQVLLDRHI"
FT   gene            complement(525631..526026)
FT                   /locus_tag="Clos_0459"
FT   CDS_pept        complement(525631..526026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18021"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV4"
FT                   /protein_id="ABW18021.1"
FT                   /translation="MNPFSFNEFQDQVDEVLIRHKSILDILTKLQESSSKINRAVAKSV
FT                   TDCGCIQVHSQKQSAPTDISFSELQNYLTNHVEGYLCDVCKEKIGEEISNNIFYIAALC
FT                   NTFNINIDDMLANYASQLKTLGTYGLL"
FT   gene            526414..526917
FT                   /locus_tag="Clos_0460"
FT   CDS_pept        526414..526917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0460"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: drm:Dred_0185
FT                   transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18022"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA8"
FT                   /protein_id="ABW18022.1"
FT                   /translation="MFNIGEKVVYPIHGAGVIESIEEREILGERRKYYIMKMPIGDMQV
FT                   MIPLDQIDDIGIRKVIDVEEIGSVLEILASDTTKMHQNWNRRYRANMDLIKTGDIYEVA
FT                   DVVRNLTLMEKEKGLSTGERKMLNNARQILLSEIVLVAEISEEEASKLVEKVILQQEMP
FT                   DTAL"
FT   gene            527079..528185
FT                   /locus_tag="Clos_0461"
FT   CDS_pept        527079..528185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0461"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: cdf:CD0029 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18023"
FT                   /db_xref="GOA:A8MLA9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLA9"
FT                   /protein_id="ABW18023.1"
FT                   /translation="MINKIIRGILTALGAVAGMALYIYIVNVMAMVNIKSDLKTYIIGI
FT                   IISSLTSGAMLFILSPWLIRQGRNIANWIEKELSKVPTVDILLGSVGLIIGLIIAYLIS
FT                   NLITGIVPFTIFGSILSTIIYIFMAYLGVKVATKKIIELPNIQEILKRNLTKEKASKKE
FT                   NQGCPKVLDTSVIIDGRIADICRTGFVEGPLIIPGFVLEELRHIADSSDALKRNRGRRG
FT                   LDILNMIQKELDIEVKMYEKDFPDIAEVDTKLLKLAQVLDGKVITNDYNLNKVAEFQGV
FT                   AVLNINELANAVKPVVLPGEEMIVQVVKDGKESGQGLAYLDDGTMIVVESGKKYIGQTI
FT                   DVLVTSVLQTAAGRMIFAKPKALVERSA"
FT   sig_peptide     527079..527171
FT                   /locus_tag="Clos_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.964 at
FT                   residue 31"
FT   gene            528330..529184
FT                   /locus_tag="Clos_0462"
FT   CDS_pept        528330..529184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0462"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; nitrite and sulphite reductase 4Fe-4S region;
FT                   Proto-chlorophyllide reductase 57 kD subunit; KEGG:
FT                   ctc:CTC01213 anaerobic sulfite reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18024"
FT                   /db_xref="GOA:A8MLB0"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLB0"
FT                   /protein_id="ABW18024.1"
FT                   /translation="MEWTSEAELKIKKAPFFIRAMARRKAEEVAKNRGKIVVDVEDIEA
FT                   AKGSRELEDLSAMDLSIEGIESSKFLDIGLCGGVKGCPFTLFNDEEVTRVFYRVIQNEN
FT                   LELFMEKALEGPVLFHNKFKIAISGCPNSCSQPQIKDISIVGYHIPKIEKGRCVGCKQC
FT                   VRSCPDRMITAEDEPKIDMEGCIHCGRCIQACPTGAIKRFQEGYRIYVGGRLGRKPHLA
FT                   KPIADIEDFDELAKILSKVIVFYKECVEEKKSFSKVIEAMELEEIKNRIHERTSLESIE
FT                   SIL"
FT   gene            529215..529925
FT                   /locus_tag="Clos_0463"
FT   CDS_pept        529215..529925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0463"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   cth:Cthe_2941 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18025"
FT                   /db_xref="GOA:A8MLB1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLB1"
FT                   /protein_id="ABW18025.1"
FT                   /translation="MENISKTSVIIVAAGKGKRMGRDYNKQYIQLEAQPIVAHTIKVFE
FT                   EMDCINEIILVVGAGEVEFLKKSIIEVYGFQKVSAIVEGGLERRDSVYNGLKAVSQDCS
FT                   IVLIHDGARPLITKDIIEESIIVAKESGACIAAVPVKDTIKISNDNMEVIHTPKRDNLW
FT                   SVQTPQTFQYDLILEAYNHQQPKDSTATDDAMILEALGHTVKIIHGSYNNIKITTPEDL
FT                   IVAEEILKTRREGR"
FT   gene            529927..530400
FT                   /locus_tag="Clos_0464"
FT   CDS_pept        529927..530400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0464"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: cpf:CPF_2616 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18026"
FT                   /db_xref="GOA:A8MLB2"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLB2"
FT                   /protein_id="ABW18026.1"
FT                   /translation="MRVGIGYDVHKLVADRKLIIGGVHIPYEKGLLGHSDADVLLHAIK
FT                   DAILGAAALGDIGKHFPDTDERYKGANSLELLKEVSNLIKSKGYKIHNLDATIIAQKPK
FT                   MASHIEQMRANIAAAINVDMDSVNVKATTTEGLGFVGVGEGIAANAIASIIKA"
FT   gene            530826..532268
FT                   /locus_tag="Clos_0465"
FT   CDS_pept        530826..532268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0465"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Prolyl-tRNA synthetase; KEGG: cdf:CD0050 putative
FT                   dual-specificity prolyl/cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18027"
FT                   /db_xref="GOA:A8MLB3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLB3"
FT                   /protein_id="ABW18027.1"
FT                   /translation="MSKKEKQFVEEITPMEVDFAQWYTDVIKKTDLVDYSPVKGFMVIK
FT                   PYGYAIWENIQNYMDKRFKETGHKNCYFPLLIPESLLKKEAEHVEGFAPEVAWVTHGGN
FT                   EELAERLCVRPTSETIICEMYSKWLTSYRDLPFLYNQWCSVVRWEKSTRPFLRTSEFLW
FT                   QEGHTLHETYEEAQAETLQMLNIYRETAENLLAMPVVIGQKSEKEKFAGAYATYTMEAL
FT                   MHDGKALQAGTSHNLGQHFTTAFDITYSDRNGELKHPYHTSWGVSTRLIGGIIMVHGDN
FT                   RGLVLPPGIAPTQVVIVPVASHKEGVLDKANELRDRLKDKFRVELDDRDNYSPGWKFNE
FT                   WEMKGVPIRIEIGPRDIENNQAMLFRRDELEKDAVSLDDLEEAVEKLLEDINNNLLYKA
FT                   KMMRDEKTYIVKTFDEMKEVMEIKPGFVKAMWCGERACEEHVKAETGVTIRCIPFEQEN
FT                   LGHTCAFCGKEAKHMVYLAKAY"
FT   gene            532475..533353
FT                   /locus_tag="Clos_0466"
FT   CDS_pept        532475..533353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0466"
FT                   /product="protein of unknown function DUF1002"
FT                   /note="PFAM: protein of unknown function DUF1002; KEGG:
FT                   tte:TTE1117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18028"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLB4"
FT                   /protein_id="ABW18028.1"
FT                   /translation="MKNKGLIQCITILVIFISIFNIVAYADNTVVVTLGKNLNESQRNQ
FT                   ILDLFNVSEGAVTIIEVNNQEERAYLEGIATEAQLGKITMSSAYVEILEEGSGIQVETY
FT                   NISWVTKEMYQSALVTAGVKDAKVIAAAPFPVSGTGALTGILKAFEKATGKKISEEQKK
FT                   VANEEVFQTGRLGEQIGQEKAAELIKVVKEEVIEKRLKNNEEIKKVVVDMAGRLDINLN
FT                   MEQIEEISKLMEKINKLNLNMKEVRQQLKGIGEKIDQTIKDNEEVKSLLQKIIEMIGNL
FT                   FRSLFGKFTNK"
FT   sig_peptide     532475..532555
FT                   /locus_tag="Clos_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.967 at
FT                   residue 27"
FT   gene            533439..534926
FT                   /locus_tag="Clos_0467"
FT   CDS_pept        533439..534926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0467"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: cdf:CD0051
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18029"
FT                   /db_xref="GOA:A8MLB5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLB5"
FT                   /protein_id="ABW18029.1"
FT                   /translation="MSVRVRFAPSPTGFVHIGSLRTALYNYLFAKKSNGKYILRVEDTD
FT                   QSRYVEGAIEGMLRSMAWAGVHHDEGVVFTGETLGQKGDFGPYIQSERLEIYKKYMDIL
FT                   LEKGHAYYCFCSKERLDEVREKQKVEGLNAGYDGHCRNLSKEEIEEKLNAGQPYVIRLR
FT                   LPENKDIQFHDIVRGDVVMNTADLDDQVLMKSDGFPTYHFAVVVDDHLMEITHVIRGEE
FT                   WLPSTPKHVYLYEAFGWEAPQYVHLPNILNADRKKLSKRQGDVAVEDFLKKGYLPEGLV
FT                   NYIALVGWSPEDNNEIFSMEELEANFSLERVSKSGGVFDVHKLNWVNGHYIRESSVERI
FT                   TDLAIPHLIEAGYITESDAQERYEWLKDLVSVLQDRISYVAEIKEKAGIFFNAEIELKD
FT                   EESKELIQVEHLPQLLDVLKAKVEAAEVIDEEFGKSVFKEIQKETGIKGPNLFKPIRVV
FT                   LTGEVHGPDLPLVMKVLGSKNILDRIEYVYDLIQSMK"
FT   gene            535248..535913
FT                   /locus_tag="Clos_0468"
FT   CDS_pept        535248..535913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0468"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   tte:TTE2316 serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18030"
FT                   /db_xref="GOA:A8MLB6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLB6"
FT                   /protein_id="ABW18030.1"
FT                   /translation="MIRFFRTIKDDVDAIFERDPAAKGMIEVILCYPGLHAILIHRISH
FT                   YFYKRGLSLLPRMISNIGRFFTGIEIHPGAKIGRKVFIDHGMGVVIGETAEIGNNVTIY
FT                   QGATLGGTGKEKGKRHPTIGDNVVISSGAKVLGPFTVGENSKIGAGSVVLKEVPPNCTV
FT                   VGVPGRIVVKDNVKINSCDNGIDLDQIKLPDPIMDELTCLKEKIAELQNKIIEMEERK"
FT   gene            535913..537307
FT                   /locus_tag="Clos_0469"
FT   CDS_pept        535913..537307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0469"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: cno:NT01CX_1093 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18031"
FT                   /db_xref="GOA:A8MLB7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLB7"
FT                   /protein_id="ABW18031.1"
FT                   /translation="MKLYNTLTRKKEEFIPLEEGKVRMYACGPTVYNYFHIGNARTFMV
FT                   FDALRRYLIYRGYDVTFVQNFTDVDDKIIRRANEEGVAPEEISERFIKEYFYDAGTLGI
FT                   EKADIHPKVTENMAEIIAFVAKLVEKGHAYESNGDVYFDVSKYEEYGKLSKQSLEDLQA
FT                   GARIEINEYKKNPLDFALWKSAKAGEPSWESPWGNGRPGWHIECSAMAKRYLGETIDIH
FT                   GGGGDLVFPHHENEIAQSEACSGKKFANYWLHVGYLNVDNKKMSKSLNNFFTPREISEE
FT                   FDLENLRFFMLSAHYRNPINFSRDLLEAAKNGLDRLYTGKNNLEYLLENAAEREVSEEE
FT                   KNFIHGLQSFKNQFIDAVDDDFNTADGIAVIFDLVREINSHISEKNSKKAVEASYDLLM
FT                   ELTGVLGLLKREAEDLEEEIERLIAERQQARKDKNFALSDKIRDDLKEKGIVLEDTAQG
FT                   VKWRKL"
FT   gene            537325..537774
FT                   /locus_tag="Clos_0470"
FT   CDS_pept        537325..537774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0470"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: cdf:CD0053
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18032"
FT                   /db_xref="GOA:A8MLB8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLB8"
FT                   /protein_id="ABW18032.1"
FT                   /translation="MDEFIKKMQDHTKVKSEAEARMMAPLVLAYIGDALYEVFIRNYLI
FT                   NEMTVSVNQYHKRATHYVRAKAQSHVVHALESELSEPEWTIVKRGRNQKSATVPKNADL
FT                   TEYKYATGFEALLGYLFYIGQYDRLHYLMSKAVALINHDLGDQNG"
FT   gene            537767..538144
FT                   /locus_tag="Clos_0471"
FT   CDS_pept        537767..538144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18033"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLB9"
FT                   /protein_id="ABW18033.1"
FT                   /translation="MDKRSKSMIVVTVVLACILIVKSNILDPVGPLEGELELYRQYTLQ
FT                   TAPLSSNILKNTGLLTYRVVKVNKTSMEGSTEILIRSEDEKEWVHQTLEGQYTGKVRSY
FT                   LLNFIPVKDINFKGGVTKDGK"
FT   gene            538134..538916
FT                   /locus_tag="Clos_0472"
FT   CDS_pept        538134..538916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0472"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: cdf:CD0054 putative thymidylate synthase;
FT                   TIGRFAM: thymidylate synthase, flavin-dependent; PFAM:
FT                   thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18034"
FT                   /db_xref="GOA:A8MLC0"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC0"
FT                   /protein_id="ABW18034.1"
FT                   /translation="MESKMKVSLITYTPEPEKLVAGAAKLCYSPSGINELMSNLEEGNV
FT                   EKFIAMLAIMGHESPFEHINFTFGIEGVSRSLTHQLVRHRIGSSYSQKSQRYVNEGGFE
FT                   YIIPPQIGGIPEAKALYIKTMENDQLAYDELTNILFEKHYKDYLDKGKNEKAAKSAAEK
FT                   QAIEDARYVLPNSCETKIVVTMNARALFNFFRKRCCNRAQWEIRDLAIEMMKLVVDVAP
FT                   NVFKIAGPGCVTGKCPEGNMSCGEMEAVREKFKSISNR"
FT   gene            538945..539697
FT                   /locus_tag="Clos_0473"
FT   CDS_pept        538945..539697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0473"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: cdf:CD0055
FT                   putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18035"
FT                   /db_xref="GOA:A8MLC1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC1"
FT                   /protein_id="ABW18035.1"
FT                   /translation="MSMDNIAGRNPVMEALKSGREIDKILIAKGTEGGSLIKIIGKAKD
FT                   RGIPIQYVERQKLNEMSSSDVHQGIIATVAAYEYCEVEDILENAKSKGRDPFLLILDEI
FT                   MDPHNLGSMMRTADAVGVDGIIIPKRRSVGLTSTVAKSSAGAIEYVPVAKVSNIAQTID
FT                   KIKDMGIWVAGADMSGSKEHYNMDLKGPLALVIGNEGEGISRLIKEKCDFLIKLPMVGQ
FT                   VSSLNASVAAAVLMYEVFRQRSHSDIQK"
FT   gene            539709..540221
FT                   /locus_tag="Clos_0474"
FT   CDS_pept        539709..540221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0474"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   cdf:CD0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18036"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC2"
FT                   /protein_id="ABW18036.1"
FT                   /translation="MKEYLILDGYNVINSWPELERLMSQSLEVARTDLIGKMAEYRAYK
FT                   GINVIIVFDAYLVKGSNRSNEKLQGVEIVFTKEKETADAYIERLITQLSSNRNRVSVVT
FT                   NDWVEQQMVLGGGATRVSVREMVLEFDQIKNKIHKKIESTKKQKETLSDRIDPAILEKL
FT                   EKIRRKL"
FT   gene            540306..540947
FT                   /locus_tag="Clos_0475"
FT   CDS_pept        540306..540947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0475"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H type; RNA polymerase
FT                   sigma-70; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: pth:PTH_0301 DNA-directed RNA
FT                   polymerase specialized sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18037"
FT                   /db_xref="GOA:A8MLC3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC3"
FT                   /protein_id="ABW18037.1"
FT                   /translation="MSVGIAKDTAENYEVLDEVMVEIAKEGDLEALEYLIKKYKNFVRA
FT                   KARSYFLIGADREDIVQEGMIGLYKAIRDFKPDKLSSFRAFAELCITRQIITAIKTATR
FT                   QKHIPLNSYVSLNKPIYDEESDRTLLDVISGQKVTDPEELVVSREELGHIEDKIGEILS
FT                   DLELKVLMLYLEGRSYQEIAGDLERHVKSIDNALQRVKRKLEKYLESRDE"
FT   gene            541105..542298
FT                   /locus_tag="Clos_0476"
FT   CDS_pept        541105..542298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0476"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: cdf:CD0071
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18038"
FT                   /db_xref="GOA:A8MLC4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLC4"
FT                   /protein_id="ABW18038.1"
FT                   /translation="MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITNTLNTRYGTGAA
FT                   VAFDKIDKAPEERERGITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLNEYE
FT                   FPGDDTPIVRGSALQALNDPAGPWGDKIVELFEHIDTYIPEPTRAIDKSFLMPVEDVFS
FT                   ITGRGTVATGRVERGIIKVQDEVELVGLQEDSRKIVVTGVEMFRKLLDQAQAGDNVGLL
FT                   LRGIQRTEIQRGQVLCKPGTIKPHTKFKAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGATKLPDGMEMVMPGDNVTMEIDLIHPIAIEEGLRFAIREGGRTVGSGVVASIIE"
FT   gene            542533..542682
FT                   /locus_tag="Clos_0477"
FT   CDS_pept        542533..542682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0477"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: cpr:CPR_2415
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18039"
FT                   /db_xref="GOA:A8MLC5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLC5"
FT                   /protein_id="ABW18039.1"
FT                   /translation="MRVNITLACTECKQRNYNTSKNKKSNPDRMELKKYCKFCKTHTAH
FT                   RETK"
FT   gene            542723..542938
FT                   /locus_tag="Clos_0478"
FT   CDS_pept        542723..542938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0478"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: drm:Dred_0201
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18040"
FT                   /db_xref="GOA:A8MLC6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC6"
FT                   /protein_id="ABW18040.1"
FT                   /translation="MTTPTNTNSEKSRDFSKFIKGVRSELKKVNWPNKKELTNNSVVVV
FT                   ITVTLATVAIWAIDSILGYGLNLIIR"
FT   gene            542997..543515
FT                   /locus_tag="Clos_0479"
FT   CDS_pept        542997..543515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0479"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: cno:NT01CX_1102 transcription
FT                   termination/antitermination factor NusG; TIGRFAM:
FT                   transcription termination/antitermination factor NusG;
FT                   PFAM: transcription antitermination protein NusG; KOW
FT                   domain protein; SMART: NGN domain protein; KOW (Kyrpides
FT                   Ouzounis Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18041"
FT                   /db_xref="GOA:A8MLC7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLC7"
FT                   /protein_id="ABW18041.1"
FT                   /translation="MSEKARWYVMHTYSGHENKVKMNIEKMVENRGMEDIILEVKVPTE
FT                   EKIEIKNGKKKVKESKLFPGYVLVKMFMTDESWYLVRNTRGVTGFVGPSSKPIPLTDQE
FT                   IKSMGVEEPRIEIDVKVGESIKVISGPFETFIGTIDHINLEKQTLKVRISMFGRETPVE
FT                   LEFDQIEKI"
FT   gene            543595..544020
FT                   /locus_tag="Clos_0480"
FT   CDS_pept        543595..544020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0480"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: cdf:CD0061 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18042"
FT                   /db_xref="GOA:A8MLC8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLC8"
FT                   /protein_id="ABW18042.1"
FT                   /translation="MAKKIVGQIKLQINAGKATPAPPVGPALGQHGVNIMGFCKEFNAK
FT                   TADQAGLIIPVVISVYQDRSYSFITKTPPAAVLIKKAIGIQSGSGEPNKKKVAKISKDK
FT                   IREIAELKMPDLNAASLEAAMSMISGTARSMGVVVED"
FT   gene            544091..544789
FT                   /locus_tag="Clos_0481"
FT   CDS_pept        544091..544789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0481"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: cth:Cthe_2721
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18043"
FT                   /db_xref="GOA:A8MLC9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLC9"
FT                   /protein_id="ABW18043.1"
FT                   /translation="MAKKGKKYQEALKLVDKTNLYDPKEAIELAKKTATAKFDETVEAH
FT                   IKLGVDSRHADQQVRGAVVLPHGTGKTVRILVFAKGEKAIEAEKAGADYVGGDELVAKI
FT                   QGENWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDLTKAVNEIKAGKVE
FT                   YRLDKTNIIHVPLGKASFEETQLVENFRTLLDAVVKAKPAAAKGQYLKSITVTSTMGPG
FT                   IKINPLKVME"
FT   gene            545042..545545
FT                   /locus_tag="Clos_0482"
FT   CDS_pept        545042..545545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0482"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: cdf:CD0063 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18044"
FT                   /db_xref="GOA:A8MLD0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD0"
FT                   /protein_id="ABW18044.1"
FT                   /translation="MVKAIDIKKEQVAEITDKLQRSASAIVVDYRGLKVEEVTELRKQC
FT                   REKGLEYKVYKNTLTRLAAENAGMKELVGELVGPNAIVFSYDDPVAAAKVASEFAKTHK
FT                   NLELKAGLVEGVLYKDAQLEEFASIPSREVLIAKLLGSFKAPISNFAYLIKAIADKKEA
FT                   EGQA"
FT   gene            545606..545971
FT                   /locus_tag="Clos_0483"
FT   CDS_pept        545606..545971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0483"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: cdf:CD0064 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18045"
FT                   /db_xref="GOA:A8MLD1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD1"
FT                   /protein_id="ABW18045.1"
FT                   /translation="MTIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVVVGGPVAG
FT                   AAVEEEQTEFDVVLENAGASKINVIKVVRELTGLGLKEAKEAVDGAPKTLKEGVSKEEA
FT                   EQIKAKLEEAGAAVTVK"
FT   gene            546551..550276
FT                   /locus_tag="Clos_0484"
FT   CDS_pept        546551..550276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0484"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: cdf:CD0066
FT                   DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18046"
FT                   /db_xref="GOA:A8MLD2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD2"
FT                   /protein_id="ABW18046.1"
FT                   /translation="MMPHPVQLGKKTRMSYSQIDEVLEMPNLIDLQKDSYQWFLDEGLK
FT                   EVFDDVSPIEDYTGNLILEFVDYSLDENPKYNIEDSKERDVTYAAPLKVKVRLINKTTG
FT                   EVKEQEVFMGDFPLMTDTGTFIINGAERVIVNQLVRSPGVYYSREFDKTGKQLFSATVI
FT                   PNRGAWLEYETDSNDIVSVRIDRTRKQPVTVLLRALGYGSDAQIKELLGEDERLLATLE
FT                   KDSTKTTDEALLEIYKKLRPGEPPTVENAKSLLRTLFFDPKRYDLAKVGRYKFNKKLSL
FT                   ANRILGKKAAANIVDPSTGEILVEEGTKIDRETSIMVQDSGINEVFIYAEDNKVIKVLG
FT                   NHFVNINKHIPFNIEELKISDKVYYPVLKEILDTFSQEEDIRDALKERAKELSPKHIII
FT                   ADIIASISYEFNLAHDTGNIDDIDHLGNRRSRSVGELLQNQFRIGLSRMERVVKERMTI
FT                   QDVDLATPQALINIRPVAAAIKEFFGSSQLSQFMDQNNPLSELTHKRRLSALGPGGLSR
FT                   ERAGFEVRDVHNSHYGRMCPIETPEGPNIGLINTLSTYARVNEYGFIESPYRKVDKKRG
FT                   VVTNVIEYLTADEEDLLVIAQANEPLDEEGRFVNKRIACRMQFGAIDIAPANEVDYMDV
FT                   SPKQVVSVATAMIPFLENDDANRALMGANMQRQAVPLLITDAPIIGTGMEYQSAKDSGV
FT                   VILAKHDGVIDRLSSNEIVIKRDKDGQKDRYKLLKFKRSNQGTCINQRPIVSKGERVKA
FT                   GDVIADGPSTNQGEIALGRNCLIGFMTWEGYNYEDAILINEKLVKEDSLTSIHIEEYEA
FT                   EARDTKLGPEEITRDIPNVGEEALKDLDERGIIRIGAEVQSGDILVGKVTPKGETELTA
FT                   EERLLRAIFGEKAREVRDTSLKVPHGESGIIVDIKVFSRENGDELPPGVNELVRAYIAQ
FT                   KRKINVGDKMAGRHGNKGVISRVLPAEDMPFLADGTPLEIVLNPLGVPSRMNIGQVLEV
FT                   HLGLAAKSLGWNVATPVFDGANEHDIMDALEMAGFSRSGKVKLYDGRTGEPFDNDVTVG
FT                   YMYMLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTL
FT                   QEILTVKSDDVVGRVKTYECIVKGENIPEPGVPESFKVLIKELQSLCLDVKVLTEEDSE
FT                   IEIKESVEDDSGELSIEYGDLTYEADGELEIIEPAEEEQDTDVDYITEDDFESPDPEID
FT                   FDEKYLEDDFNSYDDF"
FT   gene            550374..553913
FT                   /locus_tag="Clos_0485"
FT   CDS_pept        550374..553913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0485"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: cdf:CD0067 DNA-directed RNA polymerase beta'
FT                   chain; TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18047"
FT                   /db_xref="GOA:A8MLD3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD3"
FT                   /protein_id="ABW18047.1"
FT                   /translation="MYELNNFESIKIALASPEKIRQWSKGEVKKPETINYRTLKPEKEG
FT                   LFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRSLEKVLYFAAYIVIDPGETGLTEKQVLTEKEYSEAIEKYG
FT                   SGSFKAGMGAESVKKLLENIDLEELYKDLRSKLKESTGQKRIRTIRRLEVVDAFKHSGN
FT                   KPEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDII
FT                   VRNEKRMLQEAVDALIDNGRRGKPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYS
FT                   GRSVIVVGPELKFYQCGLPKKMALELFKPFVMKKLVEDNHAHNIKSAKRMVEKVKPEVW
FT                   DVLEEVIREHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAYNADFDGDQMAV
FT                   HVPLSVEAQAEARFLMLAPNNILAPKDGQPITTPTQDMILGSYYLTIEQEGVQGEGMIF
FT                   KDHDEMLMAYANKAVHLHARVKVRRKLHPEDKGRLVESTVGRFIFNEEIPQNLGFVDRK
FT                   KDPYALEVDFLCDKKALGKVIDKCFRKHGNTITAIMLDYIKKTGFRYSTQGAITIAVGD
FT                   MEVPKEKGELISLAEEKVDKYEKAFRRGLISDEERYEKVIETWSETTEKVTEALMATLG
FT                   SMNNMFIMAHSGARGSKNQIRQLGGMRGLMANATGKTVEIPIKANFREGLTVLEYFIST
FT                   HGARKGLADTALRTADSGYLTRRLVDVSQDVIIREIDCGSQEGSNIKALKDGNEVIEEL
FT                   YDRIVGRYTLEEVIHPETGEVMIGKNEMILEDMAEEICALGIESVKIRSALKCQTRHGV
FT                   CAHCYGRNLATGEAVKVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGADITQGLPRVE
FT                   ELFEARKPKGLAIISELSGTVKVVETKKKREVIVTDEHGESNTYTIPYGSRMKVRDGEF
FT                   VELGDEITDGSVNPHDILRIKDVAGVQNYIIKEVQRVYRLQGVDINDKHIEVIVRQMLN
FT                   KVKIEEAGDTNLLPGSLETIFKYEEENARTIAAGGEPADGKPVLLGITKASLATESFLS
FT                   AASFQETTRVLTEAAIKGKEDHLIGLKENVIIGKLIPAGTGLKRYKNIALNTEEVAQEE
FT                   IEDTIEEIVEENL"
FT   gene            554042..554284
FT                   /locus_tag="Clos_0486"
FT   CDS_pept        554042..554284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0486"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="KEGG: cth:Cthe_2726 ribosomal protein
FT                   L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18048"
FT                   /db_xref="GOA:A8MLD4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLD4"
FT                   /protein_id="ABW18048.1"
FT                   /translation="MLEKLETQNKTVGIKQSMKALNQDRVAVLFIARDAEDYLVQNMKQ
FT                   MADGKHVQIVDAASMKELGKACGIDVGAAVAAVLK"
FT   gene            554446..554868
FT                   /locus_tag="Clos_0487"
FT   CDS_pept        554446..554868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0487"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: cdf:CD0068 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18049"
FT                   /db_xref="GOA:A8MLD5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD5"
FT                   /protein_id="ABW18049.1"
FT                   /translation="MPTINQLVRKGRYVEEYKSTAPALQKGMNTLRKKATDISAPQKRG
FT                   VCTSVKTVTPKKPNSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVANRQQSRSKYGAKKPKAAKK"
FT   gene            554994..555464
FT                   /locus_tag="Clos_0488"
FT   CDS_pept        554994..555464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0488"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: cdf:CD0069 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18050"
FT                   /db_xref="GOA:A8MLD6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD6"
FT                   /protein_id="ABW18050.1"
FT                   /translation="MPRKGSVPKREVLPDPIYGSKVISKLINGIMLDGKKGVAQKIVYD
FT                   ALALINERTGEDALEVFEKAMNNIMPVLEVKARRVGGANYQVPVEVRSDRRQTLGIRWL
FT                   VNYTRARGEKGMVEKLAKEIIDASNSTGATVKKKEDTHKMAEANKAFAHYRW"
FT   gene            555545..557617
FT                   /locus_tag="Clos_0489"
FT   CDS_pept        555545..557617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0489"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: cdf:CD0070 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18051"
FT                   /db_xref="GOA:A8MLD7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD7"
FT                   /protein_id="ABW18051.1"
FT                   /translation="MPRQISLEKTRNIGIMAHIDAGKTTTTERILFYAGKIRKVAETHE
FT                   GGAQMDWMEQEKERGITITSAATTCQWKEHKVNIIDTPGHVDFTVEVERSLRVLDGSVA
FT                   VFCAKGGVQPQSETVWRQADKYRVPRMAFINKMDILGADFYQTIGMIKDRLGTNPVPLQ
FT                   LPIGKEDTFVGIVDLIKMNAVIYKDDLGQDMETTEIPEDMKELAREYREKLVEAAAETD
FT                   EELMMKYLEGEELTEEEIVAGIRRGTVNVQFTPVICGSSYKNKGVQLLLDAVVAYMPSP
FT                   LDIPAIKGITPDDEEEVERHSDDNEPFSALAFKIMADPYVGKLAFFRVYSGVLDAGSHV
FT                   LNSTKGKRERIGRILQMHANTREEVSTVYAGDIAAAVGLKDTTTGDTLCDPDHVVILES
FT                   MVFPEPVIHVAVEPKTKAGQEKMGIALQKLAEEDPTFKTYTDEETGQTIIAGMGELHLE
FT                   IIVDRLLREFKVEANVGKPQVAYKETITQAVEVECKYARQSGGRGQYGHVKIRVIPQEP
FT                   GKGYEFANQVVGGTIPKEYIPAVDAGIQGAMQAGVLGGYEVVDVRVELYDGSYHDVDSS
FT                   EMAFKIAGSMAFKDGMRKGKAVLLEPYMKVEVTTPEDYMGEVIGDLNSRRGKIEGMEAR
FT                   SNGMQVINAYVPLSEMFGYATDLRSKTQGRATYSMHFDHYEAVPASIAEKITASK"
FT   gene            557737..558930
FT                   /locus_tag="Clos_0490"
FT   CDS_pept        557737..558930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0490"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: cdf:CD0071
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18052"
FT                   /db_xref="GOA:A8MLC4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLC4"
FT                   /protein_id="ABW18052.1"
FT                   /translation="MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITNTLNTRYGTGAA
FT                   VAFDKIDKAPEERERGITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLNEYE
FT                   FPGDDTPIVRGSALQALNDPAGPWGDKIVELFEHIDTYIPEPTRAIDKSFLMPVEDVFS
FT                   ITGRGTVATGRVERGIIKVQDEVELVGLQEDSRKIVVTGVEMFRKLLDQAQAGDNVGLL
FT                   LRGIQRTEIQRGQVLCKPGTIKPHTKFKAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGATKLPDGMEMVMPGDNVTMEIDLIHPIAIEEGLRFAIREGGRTVGSGVVASIIE"
FT   gene            559256..559570
FT                   /locus_tag="Clos_0491"
FT   CDS_pept        559256..559570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0491"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bcl:ABC0149 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18053"
FT                   /db_xref="GOA:A8MLD9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLD9"
FT                   /protein_id="ABW18053.1"
FT                   /translation="MAKNNQKIRIRLKAYDHMALDQSAEKIVETAKKSGAEVSGPVPLP
FT                   TEKQIITILRAVHKYKDSREQFEMRTHKRLIDILNPTPKTVDALMRLDLPAGVDIEIKL
FT                   "
FT   gene            559665..560297
FT                   /locus_tag="Clos_0492"
FT   CDS_pept        559665..560297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0492"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: cdf:CD0073 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18054"
FT                   /db_xref="GOA:A8MLE0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE0"
FT                   /protein_id="ABW18054.1"
FT                   /translation="MKGLVGRKIGMTQMFDETGLVIPVTVIEVEANAVTQVKTIEKDGY
FT                   NAIQVGYGQINERNVNKPSKGHFDKAGVTPKRSLQEFRLESTEGFTAGQELKADLFKAG
FT                   DKVDISGVSKGKGFQGVIKRHNQSRGPMAHGSRYHRGPGSMGAASYPSRVFKGKKLAGH
FT                   MGHENVTIQNLEVVKVDVERNLLIVKGAVPGPKKGLLTINTSIKQGK"
FT   gene            560324..560947
FT                   /locus_tag="Clos_0493"
FT   CDS_pept        560324..560947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0493"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: cdf:CD0074 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18055"
FT                   /db_xref="GOA:A8MLE1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE1"
FT                   /protein_id="ABW18055.1"
FT                   /translation="MPKVAIYNVSGQQVSEIELSENVFGVEVNEHAMYEVVKNQLANRR
FT                   QGTQSAKTRAEVRGGGRKPWKQKGTGRARVGSIRSPLWVGGGIVFAPKPRDYSYTIPKK
FT                   VRRLALKSALTSKVNSNELIVLDELKLDAPKTKEMVNILKNLNVDKKALIVMGEKSEAV
FT                   IKSANNIQGVQTALVNTINVYDILKYDKLIITKDAVQKVEEVYA"
FT   gene            560947..561237
FT                   /locus_tag="Clos_0494"
FT   CDS_pept        560947..561237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0494"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: cac:CAC3131
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18056"
FT                   /db_xref="GOA:A8MLE2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE2"
FT                   /protein_id="ABW18056.1"
FT                   /translation="MTNPHDIIIKPIITENSMDDMASKKYTFAVNKKANKIQVKQAVEA
FT                   VFGVKVEKVNTMNMIGKVKRMGAKEGKRADWKKAIVTLRPDSKEIEFFEGM"
FT   gene            561272..562102
FT                   /locus_tag="Clos_0495"
FT   CDS_pept        561272..562102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0495"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: cth:Cthe_2906
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18057"
FT                   /db_xref="GOA:A8MLE3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE3"
FT                   /protein_id="ABW18057.1"
FT                   /translation="MAIRKLKPTSPAKRQMTVSTFEEITTNQPEKSLLEPIKNSGGRNS
FT                   YGRITVRHRGGAQKRHYRIIDFKRNKDGVPAKVATIEYDPNRSANIALLHYVDGEKRYI
FT                   IAPQGLKVGDMVESGPNADIKTGNALPLANIPVGTMIHNIEMKPGKGAQLVRAAGNSAQ
FT                   LMAKEGKHALVRLPSTEVRYLPIDCKATIGQVGNQEHENITIGKAGRKRNMGIRPTVRG
FT                   SAMNPNDHPHGGGEGRTSIGRPAPVTPWGKPALGYKTRDSKKASNKMIVSRRKK"
FT   gene            562148..562429
FT                   /locus_tag="Clos_0496"
FT   CDS_pept        562148..562429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0496"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: cpr:CPR_2395 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18058"
FT                   /db_xref="GOA:A8MLE4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE4"
FT                   /protein_id="ABW18058.1"
FT                   /translation="MSRSLKKGPFIHQGLLKKIEEMNAKNEKKVIKTWSRASTIFPQMI
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFALTRTYRGHDDNEKTTKRK"
FT   gene            562461..562793
FT                   /locus_tag="Clos_0497"
FT   CDS_pept        562461..562793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0497"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: cdf:CD0078 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18059"
FT                   /db_xref="GOA:A8MLE5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE5"
FT                   /protein_id="ABW18059.1"
FT                   /translation="MEAKAIVRYVRIAPRKAQQVVDLVRGKKVDEALAILKYTPKAAAP
FT                   IVEKLVKSAVANAENNNGMDIDRLYISEIYANQGPTMKRFRPRAMGRATTIRKRTSHIE
FT                   VVLKEK"
FT   gene            562812..563528
FT                   /locus_tag="Clos_0498"
FT   CDS_pept        562812..563528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0498"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: cth:Cthe_2909 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18060"
FT                   /db_xref="GOA:A8MLE6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE6"
FT                   /protein_id="ABW18060.1"
FT                   /translation="MGQKVNPHGLRVGIIKDWDTKWYANKRDFGDLLVEDNEIRKFVKK
FT                   KLFLSGVSRIEIERAANNKVKVNVHTAKPGMVIGKGGQGVEDLRKDIEKISKKNVAVNV
FT                   IEVKRPETDAQLVAENVAFQLERRVSFRRAMKQVMQRAMKSGAKGIKVATSGRLGGAEM
FT                   ARTEGYSQGNVPLQTLRADINYGFAEADTTYGKLGIKVWIYKGEVLPTKGRVASNNEEV
FT                   VGNVEKNTRGKKREAK"
FT   gene            563561..564004
FT                   /locus_tag="Clos_0499"
FT   CDS_pept        563561..564004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0499"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: cdf:CD0080 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18061"
FT                   /db_xref="GOA:A8MLE7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE7"
FT                   /protein_id="ABW18061.1"
FT                   /translation="MLMPKRVKRRRVHRGKMRGQAHKGNTISYGEYGLMAMEPAWITSN
FT                   QIEAARIAMTRYIKRGGKVWIKIFPHKPVTKKPAETRMGAGKGSPEYWVAVVKPGRVMF
FT                   ELSGVSEERAREAMRLAMHKLPIKCKFVTREDQEVKGGEANEN"
FT   gene            563994..564197
FT                   /locus_tag="Clos_0500"
FT   CDS_pept        563994..564197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0500"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: tte:TTE2284
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18062"
FT                   /db_xref="GOA:A8MLE8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE8"
FT                   /protein_id="ABW18062.1"
FT                   /translation="MKTKEMRDMTNAELDQRLAELKGELFNLRFQLATGQLENPLRIRN
FT                   VRKDIARAKTIIRENELKQARA"
FT   gene            564232..564486
FT                   /locus_tag="Clos_0501"
FT   CDS_pept        564232..564486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0501"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: cpf:CPF_2705
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18063"
FT                   /db_xref="GOA:A8MLE9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLE9"
FT                   /protein_id="ABW18063.1"
FT                   /translation="MERNLRKTRVGRVVSDKMDKTITVLVEDFVRHPLYGKAVKRTKKF
FT                   KAHDEMNECRIGDRVRIMETKPLSKDKRWRLVQIVEKAK"
FT   gene            564513..564881
FT                   /locus_tag="Clos_0502"
FT   CDS_pept        564513..564881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0502"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: cdf:CD0082 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18064"
FT                   /db_xref="GOA:A8MLF0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF0"
FT                   /protein_id="ABW18064.1"
FT                   /translation="MIQQESRLKVADNSGAKELLCIRVLGGTRRKYAHIGDVIVCSVKS
FT                   ATPGGVVKKGQVVKAVVVRTTNTTRRKDGSYIKFDENAAVIIKDDKQPTGTRIFGPVAR
FT                   ELRDKNFMKIVSLAPEVL"
FT   gene            564900..565208
FT                   /locus_tag="Clos_0503"
FT   CDS_pept        564900..565208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0503"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: bcl:ABC0161 50S ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW domain protein;
FT                   SMART: KOW (Kyrpides Ouzounis Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18065"
FT                   /db_xref="GOA:A8MLF1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF1"
FT                   /protein_id="ABW18065.1"
FT                   /translation="MHVKKGDTVVVITGKDKGKKGKVLQVLPKKNRVIVEGVAMVTKHQ
FT                   KPNQQMQQGGRIEQEAAIDASNVMIWDKKANQGVRVGYKLENGKKVRVSKKTGEVID"
FT   gene            565237..565776
FT                   /locus_tag="Clos_0504"
FT   CDS_pept        565237..565776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0504"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: cdf:CD0084 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18066"
FT                   /db_xref="GOA:A8MLF2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF2"
FT                   /protein_id="ABW18066.1"
FT                   /translation="MARLKDMYKSEVAPAMMEKFGYKSVMEIPKIEKIVVNMGLGDSKD
FT                   NPKGLEAAVKELGIITGQKPVVTRAKKSVANFKLRQGMPIGAKVTLRGEKMYEFADRLL
FT                   NIALPRVRDFRGVNPNAFDGRGNYALGIKEQLIFPEIEYDKVEKLHGMDIIFVTTAKTD
FT                   EESRELLKLMGMPFAK"
FT   gene            565789..565974
FT                   /locus_tag="Clos_0505"
FT   CDS_pept        565789..565974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0505"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cth:Cthe_2916
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18067"
FT                   /db_xref="GOA:A8MLF3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF3"
FT                   /protein_id="ABW18067.1"
FT                   /translation="MAKTSLKVKQQRTQKYQTREYSRCKICGRPHAYLRKFGICRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            565998..566396
FT                   /locus_tag="Clos_0506"
FT   CDS_pept        565998..566396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0506"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: cdf:CD0085 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18068"
FT                   /db_xref="GOA:A8MLF4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF4"
FT                   /protein_id="ABW18068.1"
FT                   /translation="MTMTDPIADMLTRIRNGNMAKHETIDIPASNMKKEIANILLEEGF
FT                   IKGFDVIEDGKQGIIRMQLKYGKNKEKVITGIKKISKPGLRVYAKKDEIPRVLGGLGIA
FT                   IISTSRGIITDKVARKEGVGGEVIAYIW"
FT   gene            566426..566965
FT                   /locus_tag="Clos_0507"
FT   CDS_pept        566426..566965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0507"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: cdf:CD0086 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18069"
FT                   /db_xref="GOA:A8MLF5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF5"
FT                   /protein_id="ABW18069.1"
FT                   /translation="MSRIGLRPIEIPQGVEVKIDEKNFAVVKGPKGTLEQQLSKDMEIK
FT                   IEENVINVVRPTDNKKHKSLHGLTRTLLSNMVEGVTKGYEKKLELVGVGYRANKQGDKL
FT                   VLTLGFSHPIEMVDPEGITVEVPSQTEIFVKGINKQVVGNYAAKIRELRKPEPYKGKGV
FT                   KYANEVIRRKVGKTGK"
FT   gene            566985..567353
FT                   /locus_tag="Clos_0508"
FT   CDS_pept        566985..567353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0508"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: cdf:CD0087 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18070"
FT                   /db_xref="GOA:A8MLF6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF6"
FT                   /protein_id="ABW18070.1"
FT                   /translation="MFKKVSKNANRLSRHQRVRNKITGTPERPRLNVYRSLTNIYVQLI
FT                   DDVAGKTLVAASSLDKEIKDQVSATGNAEAAKLVGQLVGKRALEKGIDTVTFDRGGNIY
FT                   HGRIQALAEGAREAGLKF"
FT   gene            567372..567878
FT                   /locus_tag="Clos_0509"
FT   CDS_pept        567372..567878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0509"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   cdf:CD0088 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18071"
FT                   /db_xref="GOA:A8MLF7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF7"
FT                   /protein_id="ABW18071.1"
FT                   /translation="MHNKRIDASQLELKEQVVDIKRVTKVVKGGRNFRFSALVIVGDEN
FT                   GYVGVGSGKAMEIPDAIRKGIEDAKKNLIHVPIVGTTVPHETIGIFGAGNVLIMPAKEG
FT                   TGIIAGGPVRTVLELAGFKDVRAKSLGTNNAKNMVNAAINGLSQLKRAEEVAKLRGKSV
FT                   EELLG"
FT   gene            567892..568071
FT                   /locus_tag="Clos_0510"
FT   CDS_pept        567892..568071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0510"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: cdf:CD0088A 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18072"
FT                   /db_xref="GOA:A8MLF8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF8"
FT                   /protein_id="ABW18072.1"
FT                   /translation="MAKVSIKLTKSVIGTKPNQRKTVEALGLKKIGQVTEKEMTPQLRG
FT                   MIDVVQHLVEVKEI"
FT   gene            568090..568533
FT                   /locus_tag="Clos_0511"
FT   CDS_pept        568090..568533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0511"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: cbo:CBO3462 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18073"
FT                   /db_xref="GOA:A8MLF9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLF9"
FT                   /protein_id="ABW18073.1"
FT                   /translation="MKLHELRPAEGAVRDRKRKGRGTASGLGKTAGRGSNGQKARSGGG
FT                   VRPGFEGGQMPLYRRLPKRGFTNIFANVYNEINIDRLNAFENGTVVTAELLKETGVIKK
FT                   IEKDGIKILGNGNLEKSLTVQAQKFTKSAIEKIEAAGGKAEVM"
FT   gene            568535..569809
FT                   /locus_tag="Clos_0512"
FT   CDS_pept        568535..569809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0512"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: tte:TTE2272 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18074"
FT                   /db_xref="GOA:A8MLG0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLG0"
FT                   /protein_id="ABW18074.1"
FT                   /translation="MIQTLKNAWKIPDLRRKILYTFMMLAIFRLGSVIPVPGVDINYVK
FT                   SIVNNAGLLSFFDLVSGGAFGNMTIFALSISPYITSSIIMQLLTIAIPSLEALAKEGEE
FT                   GSKKIAQYQRYATIILALIQATGISVGLFRGALINQDTFSIIVVILTLTAGTAFLMWLG
FT                   EQITEKGIGNGISLLIFAGIIASLPSSLFTTFALTKAGQINPLAIILFIVIAIAMIVAV
FT                   VAIEAGTRKIPVQYAKRVVGRKMYGGQSSHIPLKVNQSGVMPVIFAMSLLQFPHTIAYF
FT                   IGSEGGFAKFLNTWLSPTGMPGVFIYNLLSAVLIIFFTYFYTAITFNPVEISNNMKQNG
FT                   GFIPGIRPGKPTADYINKILTRITLSGAVFLAIITIVPTIVLGITHIPISFGGTTIIII
FT                   VGVALETMKQIEAQLLMRHYQGFLK"
FT   gene            569871..570521
FT                   /locus_tag="Clos_0513"
FT   CDS_pept        569871..570521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0513"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein; KEGG: cdf:CD0091 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18075"
FT                   /db_xref="GOA:A8MLG1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG1"
FT                   /protein_id="ABW18075.1"
FT                   /translation="MRLILLGPPGAGKGTQAASIVEKYHIPHISTGDIFRYNIKQGTEL
FT                   GKKAKSYMDQGLLVPDEVVVEIVEDRLKKEDCENGFLLDGFPRTVVQAEALDKALVDMN
FT                   ISLDKVINIQVDKERLIERAVGRRICRECGATFHVQYNPSTKGALCDQCGGELYQRDDD
FT                   NEETVTRRIEVYLSETTPLVEYYSSQNKLVTIDGDKKINEVFANIVTSLGSDL"
FT   gene            570521..571267
FT                   /locus_tag="Clos_0514"
FT   CDS_pept        570521..571267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0514"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: cdf:CD0092 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18076"
FT                   /db_xref="GOA:A8MLG2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLG2"
FT                   /protein_id="ABW18076.1"
FT                   /translation="MIYIKSRQEIELMREAGKIVAEAHELVREAIKPGITTMELDQIVE
FT                   THILKRGAIPAFKGYGGFPASTCTSVNHEVVHGIPGLKRLEEGDILSVDIGALYKGYYG
FT                   DSAKTHAIGKISPRAEELIEVTRQSFYEGIKFAKLGYRLSDISHAIQTYVESKGFSVVR
FT                   NYVGHGIGTSMHEEPQIPNYGPPGKGPRLKEGMVLAIEPMINIGTYEVKVLSDGWTVVT
FT                   LDGEYSAHYEHTVAITDDEPEILTLL"
FT   gene            571289..571567
FT                   /locus_tag="Clos_0515"
FT   CDS_pept        571289..571567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18077"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLG3"
FT                   /protein_id="ABW18077.1"
FT                   /translation="MELTDFNIGQIVQSKSGRDRGKYFIVFARLDEEHILIVDGSLRKV
FT                   DQPKKKKIKHVAKVNRVSEETREAILNNKVVNDAFVRRELKKLGFNS"
FT   gene            571594..571812
FT                   /locus_tag="Clos_0516"
FT   CDS_pept        571594..571812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0516"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   cth:Cthe_2927 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18078"
FT                   /db_xref="GOA:A8MLG4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG4"
FT                   /protein_id="ABW18078.1"
FT                   /translation="MSKQDVIELEGVVKEALPNAMFIVTLENGHEVLGHISGKLRMNFI
FT                   RILPGDKVTVELSPYDLSRGRITWRKK"
FT   gene            571829..571942
FT                   /locus_tag="Clos_0517"
FT   CDS_pept        571829..571942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0517"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: cpr:CPR_2374
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18079"
FT                   /db_xref="GOA:A8MLG5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG5"
FT                   /protein_id="ABW18079.1"
FT                   /translation="MKVRPSVKPICEKCKIIKRGGRVMVICENPKHKQKQG"
FT   gene            572166..572537
FT                   /locus_tag="Clos_0518"
FT   CDS_pept        572166..572537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0518"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: cdf:CD0095 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18080"
FT                   /db_xref="GOA:A8MLG6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG6"
FT                   /protein_id="ABW18080.1"
FT                   /translation="MARIAGVDLPRDKRVEVGLTYIFGIGRKTSNNILAAAGINPDTRI
FT                   KDLTEEEVNNLRRIIDADHHVEGDLRREIALNIKRLKEIRCYRGIRHIKGLPVRGQKTK
FT                   TNARTRKGPKKTVGRKKKK"
FT   gene            572560..572961
FT                   /locus_tag="Clos_0519"
FT   CDS_pept        572560..572961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0519"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: amt:Amet_4451
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18081"
FT                   /db_xref="GOA:A8MLG7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG7"
FT                   /protein_id="ABW18081.1"
FT                   /translation="MAKVAKKRTTRTRRRERKNIERGQAHIQSTFNNSIITLTDMQGNA
FT                   LSQASAGQLGFKGSRKSTPYAAQMAAETAAKAAMEHGLKTVEVYVKGPGAGREAAIRSL
FT                   QAAGLEVNLIKDVTPIPHNGCRPPKRRRV"
FT   gene            572984..573607
FT                   /locus_tag="Clos_0520"
FT   CDS_pept        572984..573607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0520"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: amt:Amet_4450 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18082"
FT                   /db_xref="GOA:A8MLG8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG8"
FT                   /protein_id="ABW18082.1"
FT                   /translation="MARYTEAVCRLCRREGMKLYLKGDRCYTDKCAISKRTYAPGQHGQ
FT                   SRKKLSNYGLQLREKQKAKRFYGVLESQFRKYFEIADKQAGITGENLLRLLETRLDNVA
FT                   YRLGFGSSRAEARQLVVHGHFTVNGKKVDIPSYLVSAGDTIAVAEKSKSSAKFKALAEN
FT                   AKGNTPNWLTVDVEKLEGKVVALPSREDIDLEIAENLIVELYSK"
FT   gene            573670..574623
FT                   /locus_tag="Clos_0521"
FT   CDS_pept        573670..574623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0521"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: amt:Amet_4449 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18083"
FT                   /db_xref="GOA:A8MLG9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLG9"
FT                   /protein_id="ABW18083.1"
FT                   /translation="MIEIEMEKPKVEVVEINAENTYGKFTVEPLERGYGTTLGNSLRRI
FT                   MLSSLPGAAVTSVKIDGVLHEFSTIPGVKEDVAEIIINLKGLSIRMHGNEPKTVRIEAK
FT                   GEGVITAGDIIADADVEILSPDTHIATLDTDAVLNMELTIAKGRGYVPAENNKTPGMPI
FT                   GVLPIDSIFTPVTKVSYHVENTRVGQVTDYDKLVIEVFTDGSIVPDEAISLAAKIMNEH
FT                   LNLFITLTDHVNDVEIMVQKEEDKKEKVLEMTIEELDLSVRSYNCLKRAGINTVDELAQ
FT                   KSEEDMMKVRNLGRKSLEEVQKKLEELGLGLRPSDE"
FT   gene            574646..574987
FT                   /locus_tag="Clos_0522"
FT   CDS_pept        574646..574987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0522"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: cdf:CD0099 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18084"
FT                   /db_xref="GOA:A8MLH0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLH0"
FT                   /protein_id="ABW18084.1"
FT                   /translation="MAHYRKLGRVSAHRNLMLRNLVTSLLKNGRIETTDTRAKETRRLA
FT                   EKMITLAKRGDLHARRQVLSFVTEETVVKNLFDEIAPKYQERNGGYTRIMKLGPRRGDA
FT                   AEMVIIELV"
FT   gene            575329..576168
FT                   /locus_tag="Clos_0523"
FT   CDS_pept        575329..576168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0523"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: amt:Amet_4447 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18085"
FT                   /db_xref="GOA:A8MLH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH1"
FT                   /protein_id="ABW18085.1"
FT                   /translation="MGKIIEAHNIQFQYKNNEDETMLALNDVTVSVEPGEFIVVIGHNG
FT                   SGKSTLAKHMNALLLPSEGDVFVKGLNTKDEEHIWDIRQTAGMVFQNPDNQLVATIVEE
FT                   DIAFGPENLGIPPVEIVKRVEEALSIVDMMEYRGKAPHLLSGGQKQRIAIAGVIAMRPD
FT                   CIIFDEPTAMLDPSGRREVIKTIHKLNKEENITIVHITHFMEEAVHADRVIVMEAGQIV
FT                   LEGKPKEVFSKVEELKALGLDVPQMTDLANELIKEGIDLPQDILTVDEMVMRLCQLK"
FT   gene            576153..577016
FT                   /locus_tag="Clos_0524"
FT   CDS_pept        576153..577016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0524"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: amt:Amet_4446 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18086"
FT                   /db_xref="GOA:A8MLH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH2"
FT                   /protein_id="ABW18086.1"
FT                   /translation="MSIKIENLTYIYNPGSPFETRALDHVNLEINTGEFIGLIGHTGSG
FT                   KSTLTQHLNGLIKPTSGKIMIGGIDITDESVKLRDIRKKVGLVFQYPEHQLFEETIYKD
FT                   IAFGPQNLGLSEQEIEERVREAMELVKLPFDELKDRSPFELSGGQRRRVAIAGVFAMKP
FT                   DVLILDEPTAGLDPRTRDELLAEIQTMHKKYKNTILLVSHSMEDISKLVDRVVVMHRGK
FT                   VALLGTPREVFKEVETLESIGLGVPQISYLIRALKEKGIEIREDIFTVEEAKVEILKWI
FT                   RSNKDA"
FT   gene            577009..577809
FT                   /locus_tag="Clos_0525"
FT   CDS_pept        577009..577809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0525"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: amt:Amet_4445
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18087"
FT                   /db_xref="GOA:A8MLH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH3"
FT                   /protein_id="ABW18087.1"
FT                   /translation="MLKDITIGQYYPTGSSIHKLDPRTKILVTFALIIGLFIINTFIPY
FT                   LYVVAFIAAAVYISKIPFKYIIKGLKPLKVIIIITFVINIFMTQGTPIFVMGPLKVTAE
FT                   GVYQAFFMAIRLMLLVMGTSLLTLTTSPISLTDGIENLLNPFKKIGVPAHELAMMMTIA
FT                   LRFIPTLLEETDKIMKAQMARGADFESGNIISRAKSLVPLLVPLFISAFRRADELAMAM
FT                   EARCYRGGDNRTRMKELKMTGKDTIALGATALLIGILIIHRVIL"
FT   gene            577835..578581
FT                   /locus_tag="Clos_0526"
FT   CDS_pept        577835..578581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0526"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: amt:Amet_4444 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18088"
FT                   /db_xref="GOA:A8MLH4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH4"
FT                   /protein_id="ABW18088.1"
FT                   /translation="MRNIMIEIEYDGSNYSGWQVQPNAITIQEEIMKALKKLEGKDVVI
FT                   HGSGRTDAGVHAYGQVATFLMERNIPVERLPLAMNSNLPKDITIIDAKEVPMDFHARYS
FT                   AIGKRYIYHIYESRYRSAILRNYSYHINYKLDRSKMMEASKLLIGTHDFRGFMSNGSSV
FT                   EDTVRTIKSLEFKSDGENIYMIIEGDGFLYNMVRIITGTLVQIGAGNKPLEQIEKILKT
FT                   KDRSLAGHTAPPQGLFLDKVFYPLTH"
FT   gene            578704..579135
FT                   /locus_tag="Clos_0527"
FT   CDS_pept        578704..579135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0527"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: amt:Amet_4443
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18089"
FT                   /db_xref="GOA:A8MLH5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLH5"
FT                   /protein_id="ABW18089.1"
FT                   /translation="MKSYMAKPNEVERKWYVVDAEGKTLGRLSSEIATILRGKNKPEFT
FT                   PHVDTGDFVIVVNAEKVALTGKKLDQSFYTYHTGHPGGLRQVSFRRLLAEKPESLVYNA
FT                   VKGMLPKTRLGRQMLTKLKVYAGPNHKHEAQQPEALELL"
FT   gene            579160..579552
FT                   /locus_tag="Clos_0528"
FT   CDS_pept        579160..579552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0528"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: amt:Amet_4442
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18090"
FT                   /db_xref="GOA:A8MLH6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLH6"
FT                   /protein_id="ABW18090.1"
FT                   /translation="MARVAYYGTGRRKQSIARVRLVPGEGNIKINNRDIEEYFKYETLK
FT                   RDVRMPLTITDTLSRFDVIATVAGGGYTGQAGALRHGISRALTKSDEELRGTLKRAGFL
FT                   TRDARMKERKKYGLKAARRSPQFSKR"
FT   gene            579634..579906
FT                   /locus_tag="Clos_0529"
FT   CDS_pept        579634..579906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18091"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH7"
FT                   /protein_id="ABW18091.1"
FT                   /translation="MDDNQLSLFKEDEYKAPKNTKALLWDGEGPKKVKAPKPPQGVTVP
FT                   KGYHWCPYCSMSVKLVKDKKLGIKRCPICSMSSRDYHMKNANFNL"
FT   gene            580304..581020
FT                   /locus_tag="Clos_0530"
FT   CDS_pept        580304..581020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0530"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: cdf:CD0106
FT                   germination-specific N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18092"
FT                   /db_xref="GOA:A8MLH8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH8"
FT                   /protein_id="ABW18092.1"
FT                   /translation="MVIRKYWLIRICIAVIAITVLILLLNYYKIIEVSMGVSTTDKVIV
FT                   IDPGHGGFDPGKLGSNGRKNEKDINLDISLYLKAYLEQNDFVVIMTREKDEDLYTEDGS
FT                   NRKMKTIDLTNRKKIVLDMKPDVFISIHANSFQESKYYGAQTFYPKNNEEGMKLANIIQ
FT                   QEFMNIVDPDNKRVPLENDTVYIIKGLDIPTVLIECGFLSNPEEERKLNDPQYQQKIAW
FT                   SIYVGLEKYFKTFVQE"
FT   gene            complement(580998..581378)
FT                   /locus_tag="Clos_0531"
FT   CDS_pept        complement(580998..581378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0531"
FT                   /product="membrane protein"
FT                   /note="KEGG: cbo:CBO1315 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18093"
FT                   /db_xref="GOA:A8MLH9"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLH9"
FT                   /protein_id="ABW18093.1"
FT                   /translation="MSEEHNNNNNSRVKQADGWGSLILRVILSAIVLSIAAFFTPGFTI
FT                   NGIWAVLLAAAVISIVDYLIQRFTPLHASPFGRGFTGFIVSAIVLYATQFLVPNMGVTM
FT                   WGALIGALVIGIIDMIIPGQTF"
FT   gene            581625..582458
FT                   /locus_tag="Clos_0532"
FT   CDS_pept        581625..582458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0532"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="KEGG: pth:PTH_0587 ATPase involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18094"
FT                   /db_xref="GOA:A8MLI0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI0"
FT                   /protein_id="ABW18094.1"
FT                   /translation="MSNKCDGCQHNVEGGCSSKSCIVLEKENQWSSIEKVIGIMSGKGG
FT                   VGKSSVTSLLAATLAKKGYAVGILDGDITGPSIPRLFGLKGQARQSEEGLLPTVAEDGV
FT                   KVMSMNLLLSEETEPVIWRGPVVSGVMKQFWTDVVWGELDYLLIDFPPGTGDVALTAMQ
FT                   SLPIDGIVMVTSPQGLVSMIVNKGIHMAEKMNVPVLGLVENMSYVQPPSCSEPYYLFGK
FT                   GKTEEVAKELGVDFLGSIPIEQEFAELSDQGKVFEYTNENFDKIANKVIKKLKAK"
FT   gene            582873..584330
FT                   /locus_tag="Clos_0533"
FT   CDS_pept        582873..584330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0533"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: csc:Csac_1713 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18095"
FT                   /db_xref="GOA:A8MLI1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI1"
FT                   /protein_id="ABW18095.1"
FT                   /translation="MEDKIVKEGITFDDVLLIPAKSEVLPHQVDVSTQLTKKIKLNIPL
FT                   MSAGMDTVTESKMAISLAREGGIGIIHKNMTIEEQALEVDKVKRSEHGVIVDPFFLSPD
FT                   HIVEDALAVMARYRISGVPIAEKGKLVGIITNRDIRFETNYKKKISEAMTKDNLVTARE
FT                   GISMDEAQKILMAHKIEKLPIVDDKGMLKGLITIKDIEKAIQYPNSAKDSNGRLLAGAA
FT                   VGVSSDIMERVEALYKAKVDVVVIDTAHGHSKGVIETIKKVKEKYPELQVIAGNVATGE
FT                   ATRELIEAGVDAVKVGIGPGSICTTRIVAGIGVPQITAVYDCAKVAKEYGIPVIADGGI
FT                   KYSGDIPKAIAAGASVIMIGSLFAGTEESPGETIIFNGRSFKSYRGMGSIASMEKGSKD
FT                   RYFQHDSKKLVPEGVEGKVPYKGYVKETIYQLIGGLRASMGYCGTATTKDLQENGKFIR
FT                   ITGAGLRESHPHDIIITKEAPNYSISE"
FT   gene            584346..585305
FT                   /locus_tag="Clos_0534"
FT   CDS_pept        584346..585305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0534"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; PFAM: GMP
FT                   synthase domain protein; KEGG: ctc:CTC02409 bifunctional
FT                   GMP synthase/glutamine amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18096"
FT                   /db_xref="GOA:A8MLI2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI2"
FT                   /protein_id="ABW18096.1"
FT                   /translation="MRDGKNIQTYIEQQISEIREKVGNKKAICALSGGVDSTVSAVLVH
FT                   KAIGDQLTCIFVDHGLMRKNEGDWVEDLFKNQFKMNFIRVNAKERFFGQLAGVEDPEQK
FT                   RKIIGEQFIRVFEEESKKLGQFDFLVQGTIYSDVIESGKDGNANVKSHHNVGGLPEDVD
FT                   FQLLEPLRSLYKDEVRMTGEELGLAHELVWRQPFPGPGLGVRVLGEITDEKVNIVREAD
FT                   AIVREEIKNAKLDGEIWQYFAILPNIKSVGVINGERTYVHTIAIRAISSTDAMTADWSK
FT                   IPHDVLNTMSKRIVNEVEGVNRVVYDITTKPPATVEWE"
FT   gene            585739..587091
FT                   /locus_tag="Clos_0535"
FT   CDS_pept        585739..587091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0535"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   cbo:CBO2901 purine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18097"
FT                   /db_xref="GOA:A8MLI3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI3"
FT                   /protein_id="ABW18097.1"
FT                   /translation="MSKENTQLSTVDKYFRLSEKKTDVKTEVIAGITTYITMAYILFVN
FT                   PDILSKAGMDYNAVFLATCLSAAIGTLIMGFYANIPFAQAPGMGLNAFFTYGVVMGLGY
FT                   TWQQALAAILISGILFIVLTITGAREAIIKAIPTSLKHAISGGIGLFIALLGFTNSGII
FT                   IADPNTFLAFSRFDNAPVILAVIGLVITGILMVKNVKGSILIGIIATTLIGIPMGVTNT
FT                   SINASFSFDLSPTFMQMDFAGLLKLGEASFIGAIASVATVIISFALVDMFDTIGTLIGT
FT                   ATKAGMLDQNGDLPNMDKALLADAVATSAGAVLGTSTVTTFVESAAGVAAGGKTGLTAV
FT                   TAGMLFLFSVFLAPLAGIVPAQATAPALIIVGVLMMGAVKQVNFDDFEEALPAFFTIAI
FT                   MPFTYSIANGIAAGLIFYPIMKISTGKAKEVHPTVYVLALLFILRFTILPH"
FT   gene            587166..588341
FT                   /locus_tag="Clos_0536"
FT   CDS_pept        587166..588341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0536"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: tma:TM0447 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18098"
FT                   /db_xref="GOA:A8MLI4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI4"
FT                   /protein_id="ABW18098.1"
FT                   /translation="MALDKKIKNSPNTVKIGIIGGGQLGKMIILEGKKLGIQFIVLDPD
FT                   ENCPAASIADEQILGGYYDSEKIEKLAACCHVLTYEVEHIHADILMALVEKGHSIQPAP
FT                   TTLKMIQNKYRQKTFLLEKGIATTEFEKITTVVDIENYIRREGLPAILKSCYGGYDGKG
FT                   NKVIRTVDEIEKAYQLLGGSTNELMIEKYITFTHEISVIAARGAYGEIRLFPIGENIHE
FT                   ENILRTTIVPARVEASVLQKAEKLALEVMEELEGTGVFCIEMFVDPEGNVLVNEIAPRV
FT                   HNSGHYTMEGCNISQFQQHLMAILEYPLATPYLIKPSLMMNLLGEEKEGRAMIEGLTEV
FT                   LQYDDTYVHFYGKEYTKPLRKMGHVTLLGHNPEALMDKAEKVKKVLKITGY"
FT   gene            588354..588860
FT                   /locus_tag="Clos_0537"
FT   CDS_pept        588354..588860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0537"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pfu:PF0427 phosphoribosylaminoimidazole
FT                   carboxylase catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18099"
FT                   /db_xref="GOA:A8MLI5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI5"
FT                   /protein_id="ABW18099.1"
FT                   /translation="MKSPVVSIIMGSDSDLPIMKEAAKLLSDFGITYECTIVSAHRTPE
FT                   RLFDFAKNAAERGIQVVIAGAGGAAHLPGMVAAITHLPVIGVPIQSKALGGVDSLYSIV
FT                   QMPLGVPVATVAINGGGNAGLLAAQIISLLDEEVKGKLIDYKEHLNRTVIEKAKRLEEI
FT                   GWENY"
FT   gene            588903..590309
FT                   /locus_tag="Clos_0538"
FT   CDS_pept        588903..590309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0538"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: cth:Cthe_1249
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18100"
FT                   /db_xref="GOA:A8MLI6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI6"
FT                   /protein_id="ABW18100.1"
FT                   /translation="MEKCIPVFNEGYQDKLKEECGVIGMFQWNETNAAASLFYGLYALQ
FT                   HRGQESAGIASNDGNRSYHYKKNGLVAEIFDDEILEQLEGHISMGHVRYGTSGGKSAAN
FT                   AQPFVVKTENKSIALAHNGSLVNGQELKHILKAEGYRFESAIDSEVIIKLLAKYSKESL
FT                   LIGIERTMDLIQGAYSLVIMTESELVGIRDPYGLRPLCLGELEEGGYVLASESCALDAI
FT                   GATLVRDVAPGEIITVNKEGIRSTYYSKRVKRASCVFEYVYFARPDSILDGANVYEARK
FT                   NAGKVLAKEHPIDADMVVAVPDSSIPIALGYAEELGLPFGEGLFKNRYVGRTFIEPDQP
FT                   SRERALRLKLSPLTRNIKGKKIVLVDDSIVRGTTSKKIVAELKRAGAKEVHLRISSPPV
FT                   AYSCYFGIDTPTRSELLGSTKSIEEIRELVGADTLGYISLEGLLASTGINAENFCTACF
FT                   NGNYPMKVEE"
FT   gene            590342..591367
FT                   /locus_tag="Clos_0539"
FT   CDS_pept        590342..591367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0539"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: cth:Cthe_1248
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18101"
FT                   /db_xref="GOA:A8MLI7"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLI7"
FT                   /protein_id="ABW18101.1"
FT                   /translation="MKITYKSAGVDVDEGQRAVQLMKNHVKSTFNSNVLADIGGFGGLF
FT                   SLNIKDYKEPVLVAGTDGVGTKLKIAFMMDKHDTIGQDCVAMCVNDILCQGGKPLFFLD
FT                   YVATGKLVGEKIAQIVGGIAEGCRKAGSALIGGETAEMPGLYAENEYDLAGFAVGIVDR
FT                   EQIITGANIKAGDIILGLPSNGIHSNGYSLVRKLFFEVLDMKITDYVEEFGTTLGEELL
FT                   KPTKIYVKEILSLIEAIPVKGISHITGGGFFENIPRILPENVDAKINVDAWQIPPIFKF
FT                   MAEKGNMSKDDIFGTFNMGIGMVVVVSKEDVNGAIAVLNKAGQEAHIIGEVVEGAKQVI
FT                   L"
FT   gene            591364..591993
FT                   /locus_tag="Clos_0540"
FT   CDS_pept        591364..591993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0540"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: cpr:CPR_0674 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18102"
FT                   /db_xref="GOA:A8MLI8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLI8"
FT                   /protein_id="ABW18102.1"
FT                   /translation="MKPLNIAVMISGSGSNLQALIDQIHKTNLGGNIALVLSNKEGVYG
FT                   LRRAEENRIPAMVIHRKQYESVAEYEKALMKVLEEKEIDLIVLAGYLSFIPVSLIQQYK
FT                   NRIMNIHPSLIPSFCGKGFYGEKVHEGVLQRGVKLTGATVHFVNEEMDGGPIIIQEAVA
FT                   VDFYDTVETVQKKVLEIEHRILPLAVTLFIEGRLRVEGSKVAVLNS"
FT   gene            592043..593581
FT                   /locus_tag="Clos_0541"
FT   CDS_pept        592043..593581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0541"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: cth:Cthe_1246
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18103"
FT                   /db_xref="GOA:A8MLI9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLI9"
FT                   /protein_id="ABW18103.1"
FT                   /translation="MVKRALLSVSDKEGIVQLAQNLSSFNIEILSTGGTAKLLRESGID
FT                   VRDVSEVTGFPECLDGRVKTLHPAVHGGILAIRDNANHMDTLKELEITPIDLVVINLYP
FT                   FKETILKSDVTLAEAIENIDIGGPTMLRAAAKNHRDVTVIIDPKDYHRVLEEIKENGDT
FT                   KLDTRYQLALKVFQHTAQYDALIADYLGKQISEEKIGANTITLTYEKVQDLRYGENPHQ
FT                   KAGFYKEIGANKGTLVDGVQLHGKELSFNNINDANGALELLKEFQEPTVVAVKHTNPCG
FT                   VASGTNIEEAWHKAYESDPLSIFGGIVAANRAVTKTMAAAMKEIFLEVIIAPNFTEEAL
FT                   EVFKEKKNLRLIKIEDICNGNHHSYQIKKVQGGILLQEDDHILFEQLDVVTEKEPTEEE
FT                   KEDLAFAFKIVKHVKSNGIVFVKNKQTLAIGPGQTSRIWALENAVKNTTHSLKGSVLAS
FT                   DAFFPFRDCVDTAFGAGVKAIIQPGGSINDGVSIKACNEHGISMVFTGFRHFKH"
FT   gene            593594..594844
FT                   /locus_tag="Clos_0542"
FT   CDS_pept        593594..594844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0542"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: cdf:CD0224 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp; protein
FT                   of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18104"
FT                   /db_xref="GOA:A8MLJ0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ0"
FT                   /protein_id="ABW18104.1"
FT                   /translation="MKVLIIGSGGREHTIAWKLQQSPLVTEIFCAPGNAGTTQIATNVE
FT                   INSNDMDQLVEFAERNAIDLTVVGPEEPLVNGIVDKFREKNLSIIGPDKNGAQLEGSKA
FT                   FAKAFMDKYHIPTAKYDEVHTLEEGIAALEKYSYPVVVKADGLAAGKGVFICESKEEAA
FT                   AAMKELLEDQILGDAGKDVVIEEFLSGIETSILCFVDGKTIVPMVSSQDHKRAFDGDQG
FT                   PNTGGMGTYSPNYVYTEDIEKRVEREILAPTLYGIQKEEMDYRGIVFIGLMITDHGPKV
FT                   LEYNVRFGDPETQVVLPRLETDLVQIFNSIIHGKLEDMNIQWTENGAVCVILASGGYPN
FT                   QYEKGLEITGLEEMEDLLIFHSGTTMSGGKMVTAGGRVLGVVAIDKNTEEARNKVYRNI
FT                   DKIKFEGSFYRRDIGTK"
FT   gene            595385..596176
FT                   /locus_tag="Clos_0543"
FT   CDS_pept        595385..596176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0543"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   tte:TTE0646 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18105"
FT                   /db_xref="GOA:A8MLJ1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ1"
FT                   /protein_id="ABW18105.1"
FT                   /translation="MQITIIGGGEGGSSILKTFMKMKDLEVVGIVDIDENAPGIQLAKE
FT                   IGINYGSSVREMLLKKTDLIVEVTGSNRVSDEIDMHNVHQAEVIHSAGAKLMTLLVKNE
FT                   EKLTKQLEIQMNEIRNISYVTGESVMKMHESITHTTSLSDTLNEFADRTIKHVKETDQI
FT                   IKFINKITQQTNILGLNASIEAARAGEHGRGFAIVAKEVQKLATNSEDFTKKIGEILGK
FT                   ISDEIFSVTKEIEQLNTITQNQHHMGAELQSAVAQLSESLK"
FT   gene            complement(596335..597186)
FT                   /locus_tag="Clos_0544"
FT   CDS_pept        complement(596335..597186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0544"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: dsy:DSY3920
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18106"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ2"
FT                   /protein_id="ABW18106.1"
FT                   /translation="MKNNKKNILFWLIGILTVSLVLTSCGKAPSENANTNSDAPTENKP
FT                   SVLTVGATPEPHAQILKVVEPLLKKEGVELKIIEFTDYILPNLALSGGEIDANFFQHAP
FT                   YMESFIASNKVKLESVAKIHVEPLGLYSKKINDFSELADGAKISIPNDPTNGGRALILL
FT                   EANGLIKLKENAGLEATEKDVVENPKKLTFVPLEAPQLPRSLEDVDASVINTNYALEAG
FT                   LNPLNDALILENEDSPYANILVVTPEHSKDENITKLIKALTSPEVKNFINDKYKGAIIP
FT                   AF"
FT   sig_peptide     complement(597106..597186)
FT                   /locus_tag="Clos_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.594 at
FT                   residue 27"
FT   gene            complement(597614..598846)
FT                   /locus_tag="Clos_0545"
FT   CDS_pept        complement(597614..598846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0545"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tte:TTE1382 Aspartokinases; TIGRFAM: aspartate
FT                   kinase; PFAM: aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18107"
FT                   /db_xref="GOA:A8MLJ3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ3"
FT                   /protein_id="ABW18107.1"
FT                   /translation="MKIIVQKFGGTSVSTRDRRKMVINKIVECKRSGKSVVVVLSAMGR
FT                   KGEPYATDTLKDLISTSYSGHSLKTMDLMMSCGEIISSALLGAGLESMGEKVVILTGSQ
FT                   AGILTDSVFGDADILAIEEERILSHLKAGAIVIVTGFQGATEYGEITTLGRGGSDTTAV
FT                   ALGVALCAESVEIYTDVDGIMTADPTIVSNAKIIDELSYDEVFQMAEKGAKVIHPRAVE
FT                   IAKKGSLLIKIKNTMSSHPGTRIHHCKYTGKDLYSTRHDANNLLTAITSKSRISQVCIL
FT                   TEEYLESENALFTALAEAGISIDMINFFINQKVFTVDDDKSDLVEEILQSFQVQYTLTR
FT                   ACSKVTAVGNRIAGIPGVMATIVTALSKEKIPILQSSDSHSTISLLVNSCDETSTLKLL
FT                   HQAFSLDKKNP"
FT   gene            599829..601046
FT                   /locus_tag="Clos_0546"
FT   CDS_pept        599829..601046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0546"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   ctc:CTC00822 proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18108"
FT                   /db_xref="GOA:A8MLJ4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ4"
FT                   /protein_id="ABW18108.1"
FT                   /translation="MKLTTKIFLGLIAGIIVGLFFTGNPEVIKTYVSPIGTLFLNLIKM
FT                   IIVPLVFSSLIVGAASTGDIKSLGRIGGKTMVYFLGTTAVAIVIGLVLGVVIKPGAGLI
FT                   IPAGIEAAQQAAPSLTDTLLNIVPANPLKGLVEGNMLQIITFALFLGIGLTSLPDDKGK
FT                   PFLNFFDSLAEIMYKITAFIMELAPFGVFGLIAPVVASNGPAVLLPLIKVIAAVYIGCV
FT                   LHALIVYAPAVRAFAKINPMAFFKGVAPAAITAYTTSSSSGTLPITIRSVKENFHVSDK
FT                   IASFVLPLGATVNMDGTALYQGVCALFIAQAYGITLTMPQLVTIILTATLGSIGTAGVP
FT                   GAGMIMLTVVLNSVGLPLEGIALIAGIDRVLDMARTCINVVGDTSAALVVAASENEIEI
FT                   PKAETV"
FT   gene            601148..601852
FT                   /locus_tag="Clos_0547"
FT   CDS_pept        601148..601852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0547"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: pho:PH0670 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18109"
FT                   /db_xref="GOA:A8MLJ5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ5"
FT                   /protein_id="ABW18109.1"
FT                   /translation="MNRTLGIIGGMGPLATANLFNKIVLKTEAKSDQDHIHILIDNNIA
FT                   IPDRTAYLVGDGDNPLEELVKSAKRLENMGADFLIMPCNTAHYFYQEIKDVINIAFLNM
FT                   IEETVMHIKEKYPTSKKVGLLATDGTVQSKIYDLYFNKENIEMINLDENSQKSIMNIIY
FT                   SVKAGKNQIPLEDIYSAIDELKGKGADVVILGCTELSVVNEKHDLKGNIVDALNIITET
FT                   AIQFAGKKVASK"
FT   gene            602213..602395
FT                   /locus_tag="Clos_0548"
FT   CDS_pept        602213..602395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0548"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: mta:Moth_1278 twin-arginine
FT                   translocation protein, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18110"
FT                   /db_xref="GOA:A8MLJ6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ6"
FT                   /protein_id="ABW18110.1"
FT                   /translation="MFGKIGTGELILILGIALVIFGPAKLPELGKALGRGINEFKSHAN
FT                   KVSEDVKEDPELKDK"
FT   gene            602569..604788
FT                   /locus_tag="Clos_0549"
FT   CDS_pept        602569..604788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0549"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM:
FT                   UvrD/REP helicase; KEGG: tte:TTE0604 Superfamily I DNA and
FT                   RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18111"
FT                   /db_xref="GOA:A8MLJ7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR021938"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ7"
FT                   /protein_id="ABW18111.1"
FT                   /translation="MEHHKENINSVHNEKESRYHTLNPMQKNAVLTTEGPVLVLAGAGS
FT                   GKTRVLTHRIAYLVEEKGVSPYHILAITFTNKAAKEMKERVEALLGDYHRDLWVSTFHS
FT                   SCVRILRMEIDKLGYEKNFVIYDTTDQQVLMKDCLKKFNLDEKLFQPRMILNEIGRAKD
FT                   LLIGPNEYLEEFGNDFRNQKIAEIYRLYQDRMKSNNALDFDDLIMKTVQLFQTHPTVLR
FT                   YYQNKFKYILVDEFQDTNMAQYTLISLLAKSHGNLCVVGDDDQSIYGWRGADIRNILGF
FT                   EKDFPNTQVVKLEQNYRSTKSILDAANMVVANNTDRKSKKLWTDNQDGEIIQYYRANNE
FT                   YDEASFISGTIEKLNEEENRPYSEFAILYRTNAQSRALEEMLMKRAIPYKIYSGTRFYD
FT                   RKEIKDILAYLRTIENPVDDVSVKRIINVPKRGIGIKSIDRFDEYAEGKNESFFGALLH
FT                   VDQMPDQSTRVKVQTNKFTELIQSLRDRQDEMSVTDIVKEIYEKTGYIDALMAEDKIEA
FT                   ESRIENLQEFLSVTKDFDENSEVKTLEEFLARTSLETTLDENDEENTVTLMTLHSAKGL
FT                   EFPVVFIPGMEESIFPSAMSLQENNLEEERRLCYVGITRAREKLYMSHAMTRTLYGRTN
FT                   ANPISRFLGEIPEELIQIDRPYNRKRDLKEMQTSPLFTGAMMHQKKGNANSINSDAIKA
FT                   GNKVKHPKFGVGTVVSVAGEMLTIAFPNSGIKKIASTFIQLEIMD"
FT   gene            604862..606847
FT                   /locus_tag="Clos_0550"
FT   CDS_pept        604862..606847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0550"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: cno:NT01CX_0434 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif; BRCT domain protein; zinc-finger
FT                   NAD-dependent DNA ligase C4-type; NAD-dependent DNA ligase
FT                   OB-fold; NAD-dependent DNA ligase adenylation; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; NAD-dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18112"
FT                   /db_xref="GOA:A8MLJ8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLJ8"
FT                   /protein_id="ABW18112.1"
FT                   /translation="MGSMERLRQLVDILNEYSYQYYVLDEPVVSDKEYDQLYDELVLLE
FT                   KELNTVLEDSPTIRVGGDVLKNFKAHNHLAPLWSLDKCKTPEELISWDLRVRRLLEGSG
FT                   VPIEYVMEYKFDGLTLNLTYNNGQLVQAATRGNGTTGEGILEQVKTIKTIPLTIPHKGR
FT                   IEVQGEGLMGLSVLAAYNKTALEPLKNPRNAAAGALRNLDPKVTAKRKLSAFCYNVGFY
FT                   EGIDFNTHMEILAFLKANKFPVSNYTKKFHTIHQVIEEIETIGEQVKSLDFLTDGLVIK
FT                   VNHMEARRLLGYTQKFPRWAMAFKFEAEEMTTELKDVIWQVGRTGKLTPAAVLEPIDIG
FT                   GVTVSRATLNNWEDIQRKKVKIGCRVWIRRSNDVIPEIMGSIEETLEGAMDIEKPQHCP
FT                   ACHSEVVERGAHIFCPNSLSCKPQLVSRIVHYASRDAMDIVGFSEKTAEQLFEELNLRD
FT                   LADLYEIKYEDLIKLPRFGDKKARNLLEAIENSKNCKLDSFVYALGIPNVGRKTATDLA
FT                   KHYKSFQAIQEAEFQELITLPDVGDIVAQSIIDFFEDEEIKKSVNRLINEGIRPLFKEV
FT                   EQQENIFLGKTVVVTGTLEKYGRKEIKELLEKLGAKVTGSVSKNTDFLLAGEAAGSKLE
FT                   KAMEIIASGVETSLRIISEAEFEAML"
FT   gene            607153..607902
FT                   /locus_tag="Clos_0551"
FT   CDS_pept        607153..607902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0551"
FT                   /product="integral membrane protein TIGR01906"
FT                   /note="TIGRFAM: integral membrane protein TIGR01906; PFAM:
FT                   Integral membrane protein 1906; KEGG: tte:TTE1993
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18113"
FT                   /db_xref="GOA:A8MLJ9"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLJ9"
FT                   /protein_id="ABW18113.1"
FT                   /translation="MLLFSKEFIVLHFKMGKEKGELSLKGIKKIGYVSIGILLSMVLLL
FT                   TSVELVAFHMDHYRASFEKYKITEATGMNMENLEHTMGDVLKYFKDDRVELDTRAVIHG
FT                   EEQPVFGEREISHMVDVKALFVQGRFIRNSGVPLILIIALILIKIDKDWRKGFAKTLLY
FT                   TSIANIGLLVMLLILMKIDFYKYFTYFHLIFFSNDLWILDPTTDVLIQMVPEEFFYSTA
FT                   VKIIVYFVGSLLVLGTAGGYYLKKRTK"
FT   gene            607983..609368
FT                   /locus_tag="Clos_0552"
FT   CDS_pept        607983..609368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD2720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18114"
FT                   /db_xref="GOA:A8MLK0"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK0"
FT                   /protein_id="ABW18114.1"
FT                   /translation="MIELTLVHWVYVIVVLVVLGTMILRRDTLIPCILGIFIMGLAANQ
FT                   GIVGAIGGIFNSFVVAGIELIGIIFIISVIVSMSKLLEDLGANQLMVKPITKLIKTPNQ
FT                   AFWFIGMVMLLVSWFFWPSPATALVGAVLLPVGLKVGLPAIGAAVAINLFGHGLALSSD
FT                   LVIQGALTITASTAGVAVTELSRKGLPLFAVMAVVTITTAYIMLKRDIKNGTLEVTNDL
FT                   MDREHKEDRKTSPVARIAAYIVPLAFGMDILAMFLFGLTGGDATALIGGTAVLMLIVLC
FT                   VLEYKSKALEHITNYIKSGFVFGIEIFGPIIPIAAFFYMGDLNSFVKVMGAGGLPATSQ
FT                   GILADLGTALASVAPMNRPTVAIMEMGISGLTGLDGSGFSGLSLSGAIAKVFGTAINGS
FT                   VAVLAALGQIGAIWVGGGTIVPWSLIPAAAICNVSPMELARRNFIPVIVGLICTTIVAM
FT                   FLI"
FT   gene            609794..610786
FT                   /locus_tag="Clos_0553"
FT   CDS_pept        609794..610786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0553"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   KEGG: cth:Cthe_1060 AIR synthase related protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18115"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK1"
FT                   /protein_id="ABW18115.1"
FT                   /translation="MEIGKVPTEVLKEVIFSNLKNRRPEVLVRPNIGEDCAVVDFGDYV
FT                   CVMSTDPITGAAKDIGSLAVHISCNDIASSGVEPLGIMLTIMAPPHTTKEDLSLVMSEA
FT                   NKAAASVNVEIIGGHTEITDAVNRMIISATAIGRQLKEKLVLSEGAKIDDAVFMTKYTG
FT                   LEGTAIIARDLEEKLKEKISDATIQTAQEFLKDISVVKEGITAGEVGVHSMHDVTEGGI
FT                   FGALWELGEASGIGIEIYEDQIPMRPETLEICHYLSIDPMRLISSGVMVMTIAQDKKEA
FT                   LMEAFKRENLILTEIGRMVEKDRIIISAAKGIRALDPPDVDELYKAFEN"
FT   gene            611015..613159
FT                   /locus_tag="Clos_0554"
FT   CDS_pept        611015..613159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0554"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; copper amine
FT                   oxidase domain protein; KEGG: cth:Cthe_0185 cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18116"
FT                   /db_xref="GOA:A8MLK2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK2"
FT                   /protein_id="ABW18116.1"
FT                   /translation="MRKLISSLLVAIIIISSFSISFANQSMDKISLKENGIGRNFQVVN
FT                   IKVDGKAVKSADVPPVIYPLNNQGRTLVPLRMIIDHFGDKLNADIEWDGTNNQVKIITK
FT                   DKEILLKIDSAVATVNGVAKNLPDNVPAKLLAIGSNGRTMVPIRFFAEELGLTVKWDDK
FT                   TWTASIDIPEQTGGKNPEEKPEEKPPVIGTVSVTDIKVETNGAIPKIRIKTSGKVSYKE
FT                   LKLVNPDRLVIDFENTIFDIGDRTALEPNGTLHIPTNNDLIKNVRMSQFNNNPFITRIV
FT                   MELGKTTAYQVTYDEQKGEIIIDFPNYIRSIKREVMNAKEVIVIDGDYLEDYSIMKLNN
FT                   PDRAVIDITGGILHDAFKSKTMNVDGRAAKTVRVSQHNVGNDLTGEKTVRIVVDLQDNL
FT                   DTEEIYAEVVNNRLYLHLEGEPLKAVKYEETGWTTSKLTFLGSRVTRYSIQRQQGNLIE
FT                   MSVPKADIELDAMNLQIGDHIVKSMDISENREGSEYHIRLELQDSVEYQLLSSEKTQDF
FT                   VLNLNNKAAKYREKLIVIDPGHGGSDPGTISPISGAYESIVVLDIALRLNQLLTEAGFR
FT                   TYMTRVDNLSPNIKLELQERVDVAEQLKADLFVSVHANSALASSASGLENYYHSTDPRG
FT                   KKLAEIFQSEMVKNANVNNRGAKVADFFVLRNTTMPSVLTETGFLSNPGDEAKLASSQH
FT                   RQQLAEGMFKGILRYFEENK"
FT   sig_peptide     611015..611086
FT                   /locus_tag="Clos_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 24"
FT   gene            613349..613867
FT                   /locus_tag="Clos_0555"
FT   CDS_pept        613349..613867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_2514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18117"
FT                   /db_xref="GOA:A8MLK3"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLK3"
FT                   /protein_id="ABW18117.1"
FT                   /translation="MEALLGYLLIFVARLTDVSMATIRMIMVVKGKRVIAACIGFVEVS
FT                   IYVVAIGKVLSGMDNPLNVLAYASGFATGNYVGIFLEEKMALGNIIAQVISDYEVEKLV
FT                   EKLRNVGFGVTVIEGYGREGIRYILNVSLQRKHLSRLYQTVEEHDKKAFVTVTDARAIR
FT                   GGYFAGMKK"
FT   gene            613965..614942
FT                   /locus_tag="Clos_0556"
FT   CDS_pept        613965..614942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18118"
FT                   /db_xref="GOA:A8MLK4"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK4"
FT                   /protein_id="ABW18118.1"
FT                   /translation="MRVLRYVAILLIVVSVVSLVGCSFFNREKETDVSLIIDTPTIQED
FT                   GLRETVLYYKDEIGLIVPVMRKIPWEEGIAKAAINQLVDEPAVRDNLSSIGLFPVLPTG
FT                   TEVLEMSINDGLAKVDFNENILSYDTDTDEKAIVQSLVYTLTEFEAIDKVQLLVNGKTL
FT                   NKLSFGTKVKNPMERENINLSLALESEELPVIVYYKTTTNGEDSFFIPVTKGVNALKTD
FT                   IKSALTALLEGAPEGTGLYSELPAGVVLNDVYVKEGVAYMDFSKEIENIPDNKTHQQSM
FT                   VYELGLTLREIEPTISQVRILSSGKEIQLNSDVSLNLPKHVNPY"
FT   gene            615348..616091
FT                   /locus_tag="Clos_0557"
FT   CDS_pept        615348..616091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0557"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: cdf:CD3308 ribonuclease Ph; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18119"
FT                   /db_xref="GOA:A8MLK5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK5"
FT                   /protein_id="ABW18119.1"
FT                   /translation="MSRIDGRKNNELRPVKFTRNFTRYAQGSVLVEMGETKVICTATIE
FT                   DKVPPFLKNTGKGWITAEYSMLPSSTQSRKVRESSRGKVEGRTQEIQRLIGRALRSVVD
FT                   LDALGERTLWIDCDVIQADGGTRTASITGSFVALVDALNKLKEEGAIESIPVRSFVSAI
FT                   SVGIINGEAMLDLCYEEDSTAKVDMNIVMTDRGEFVEVQGTGEESPFAKADLMNLLELG
FT                   EKGNLELIQLQKEALGAIADAIENK"
FT   gene            616106..616738
FT                   /locus_tag="Clos_0558"
FT   CDS_pept        616106..616738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0558"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   cdf:CD3308 ribonuclease Ph"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18120"
FT                   /db_xref="GOA:A8MLK6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK6"
FT                   /protein_id="ABW18120.1"
FT                   /translation="MKTTEEIKKIHQAVISTGNKHKLEEIGAILEDFNLEVLSMKDVNL
FT                   EGLEIIEDGNTFEENALIKAKAVMERTGKLTLADDSGLEVDVLDNQPGIYSARFSGENA
FT                   TDEKNNAKLLKMLEEVPFEKRTARFVCAMAAVFPNGDTIVLRGECPGVIGFEAKGKSGF
FT                   GYDPLFIVEEYNQTFAELGEEIKNKISHRARALEKLKKELILRLGSD"
FT   gene            616739..617203
FT                   /locus_tag="Clos_0559"
FT   CDS_pept        616739..617203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0559"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: cdf:CD3307 putative
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18121"
FT                   /db_xref="GOA:A8MLK7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLK7"
FT                   /protein_id="ABW18121.1"
FT                   /translation="MKIGIISDSHEGRYYIDLVMAQLKEVDLIIHAGDGYQDTKYIEHR
FT                   YGIKTLGVKGNCDLEGPEQRLETIENKRIFIAHGDRYGVVSNMDRIFYAAKEFEADIAI
FT                   FGHTHVPFYMVEEGIVLMNPGSITLPRGDSQRSYCILTLAKDIKVEFMKI"
FT   gene            617432..617505
FT                   /locus_tag="Clos_R0019"
FT                   /note="tRNA-Gly1"
FT   tRNA            617432..617505
FT                   /locus_tag="Clos_R0019"
FT                   /product="tRNA-Gly"
FT   gene            617511..617587
FT                   /locus_tag="Clos_R0020"
FT                   /note="tRNA-Arg2"
FT   tRNA            617511..617587
FT                   /locus_tag="Clos_R0020"
FT                   /product="tRNA-Arg"
FT   gene            617596..617671
FT                   /locus_tag="Clos_R0021"
FT                   /note="tRNA-His1"
FT   tRNA            617596..617671
FT                   /locus_tag="Clos_R0021"
FT                   /product="tRNA-His"
FT   gene            617677..617753
FT                   /locus_tag="Clos_R0022"
FT                   /note="tRNA-Gln1"
FT   tRNA            617677..617753
FT                   /locus_tag="Clos_R0022"
FT                   /product="tRNA-Gln"
FT   gene            617787..617869
FT                   /locus_tag="Clos_R0023"
FT                   /note="tRNA-Leu1"
FT   tRNA            617787..617869
FT                   /locus_tag="Clos_R0023"
FT                   /product="tRNA-Leu"
FT   gene            617874..617948
FT                   /locus_tag="Clos_R0024"
FT                   /note="tRNA-Gly2"
FT   tRNA            617874..617948
FT                   /locus_tag="Clos_R0024"
FT                   /product="tRNA-Gly"
FT   gene            617953..618029
FT                   /locus_tag="Clos_R0025"
FT                   /note="tRNA-Arg3"
FT   tRNA            617953..618029
FT                   /locus_tag="Clos_R0025"
FT                   /product="tRNA-Arg"
FT   gene            618086..618162
FT                   /locus_tag="Clos_R0026"
FT                   /note="tRNA-Arg4"
FT   tRNA            618086..618162
FT                   /locus_tag="Clos_R0026"
FT                   /product="tRNA-Arg"
FT   gene            618303..618548
FT                   /locus_tag="Clos_0560"
FT   CDS_pept        618303..618548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0560"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   mxa:MXAN_4946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18122"
FT                   /db_xref="GOA:A8MLV5"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV5"
FT                   /protein_id="ABW18122.1"
FT                   /translation="MGYIAWIILGALSGWIASIVMGKNSQMGAIANIVVGIVGAFIGGF
FT                   VFSLIGSVGVTGLNIWSIIVSVVGSCILLFVVNKIK"
FT   sig_peptide     618303..618371
FT                   /locus_tag="Clos_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.677 at
FT                   residue 23"
FT   gene            618718..619290
FT                   /locus_tag="Clos_0561"
FT   CDS_pept        618718..619290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18123"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV6"
FT                   /protein_id="ABW18123.1"
FT                   /translation="MDCTYKVKLMKRRDSMKKYALIILGLWMLISLIGCSTKILEEEYK
FT                   GFETEIQPTMQDEAPGTEKNLEKSLVLQVEEYIKENKVSYSWKDVQYDMANKLNEKFVV
FT                   AGEAELSDYYNYGFRGKEKDYFAVRITPYDGDYTNAWYLYLHRESFEKLYHSLKEGNRT
FT                   VIATCEIPRYIYKEGQGNMAFVNQAQW"
FT   gene            619326..619928
FT                   /locus_tag="Clos_0562"
FT   CDS_pept        619326..619928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0562"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   csc:Csac_0196 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18124"
FT                   /db_xref="GOA:A8MLV7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV7"
FT                   /protein_id="ABW18124.1"
FT                   /translation="MCGRYLLDMDTVEISNILHNIKWSCGETLKTGEIYPTNTVPMITS
FT                   RGVTFAKWGFPKWDNKGVVINARVEGLQERRMFKSLVKNKRCIIPANGYFEWKQIGGSK
FT                   VKEKYLIDNKGKILYMAGLYDTVEESSTQLSFLDHNTQTYLAFAIITKDANDSVSHVHH
FT                   RMPLIFNKEEMEMWLSGYDLSALLSQNNIALQYSMDH"
FT   gene            complement(619979..620626)
FT                   /locus_tag="Clos_0563"
FT   CDS_pept        complement(619979..620626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0563"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: cch:Cag_1936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18125"
FT                   /db_xref="GOA:A8MLV8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV8"
FT                   /protein_id="ABW18125.1"
FT                   /translation="MKILDLTHYISEDMPVYPGTEGPKFSPANSYEVDGFRETLVTLYT
FT                   HTGTHMDPPAHLFPNRTTLDQFPISQFVGRALVIHCSDLREGQSITMDYILPYKDKALQ
FT                   AEFLLFHTGWSQYWGTEQYFGEYPCIDHEVADFLINSRKKGIGLDTIGLDPIVDINLTL
FT                   HKKLFRDSEIVVIENLMNLHLLGDELFTFCALPLKHKDADGSPIRAIALLDE"
FT   gene            620944..621969
FT                   /locus_tag="Clos_0564"
FT   CDS_pept        620944..621969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0564"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: cdf:CD3228 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18126"
FT                   /db_xref="GOA:A8MLV9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLV9"
FT                   /protein_id="ABW18126.1"
FT                   /translation="MVEKIMKDEHLVTEERKAKSSNGMVILILNIVLMVASIFSIIIGA
FT                   NLISNTGNLFGILFIVIGVIYLMIVGPILFAGLKVLKPNEALVLTLFGKYTGTLKGEGF
FT                   FFVNPFSSAVSPASKNTSTGSLGTQDHIKVSANEINIPSQRSKKISLKAMTLNNDKQKI
FT                   NDQMGNPIIIGVVVIWKVVNTAKAVFNVDNYAEYLSIQTDSALRDITRLYPYDSVNDDN
FT                   EKSLRGSSLEVAEKLRHEIQKRVNIAGLEVVEARITHLAYAPEIASTMLQRQQASAIID
FT                   ARQMIVEGAVGMVEMALAKLSENDIVTLDEERKAAMVSNLLVVLCGNKEAQPIVNSGSL
FT                   Y"
FT   gene            621988..622158
FT                   /locus_tag="Clos_0565"
FT   CDS_pept        621988..622158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spr:spr1942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18127"
FT                   /db_xref="GOA:A8MLW0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW0"
FT                   /protein_id="ABW18127.1"
FT                   /translation="MEKKEKDNEKKQLLLRLSSSLWKDLAQWAEDDFRSINGQIEYLLT
FT                   ECVKQHKKGKM"
FT   gene            622227..622469
FT                   /locus_tag="Clos_0566"
FT   CDS_pept        622227..622469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18128"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW1"
FT                   /protein_id="ABW18128.1"
FT                   /translation="MVNQSLKYSLNNHKVITIMYMKDLEIIQRRIQVLKMESGLIKALD
FT                   IDKGQLRTFRIDRILSAIDTKLMGNEDSMAENYIF"
FT   gene            622771..624216
FT                   /locus_tag="Clos_0567"
FT   CDS_pept        622771..624216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0567"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="KEGG: fnu:FN1277 aminoacyl-histidine dipeptidase;
FT                   TIGRFAM: aminoacyl-histidine dipeptidase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18129"
FT                   /db_xref="GOA:A8MLW2"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW2"
FT                   /protein_id="ABW18129.1"
FT                   /translation="MGKLEGLKPERVFYYFEELTKIPRESYNEEQVSNYIKSVGEDLGL
FT                   ETIQDDLLNVIIRKPASPGYENAEGVIIQGHMDMVCEKESDSEHDFQKDPISLIVDGDY
FT                   ICADKTTLGADNGIAIAMGLAILEDNTLQHPAIEFLATSSEETEMDGALGLAEDALKGT
FT                   RFLNLDSEEEGVVIAGSAGGELIKIEIQSTYEELQDSMGFDIEIKGLMGGHSGMEINKP
FT                   RENANKILGNLLKELAERMEIRLISITGGTKDNAIPRSAGAKVALVQEDRVQFENIMEE
FT                   IKGRVIEKNKGKEPGIDISVERCETVTQGFSKNTLKSVVELLENLPTGVFTMLEGYDNI
FT                   VESSSNLAIIKTEDEKITVQISLRSSIERRLKEMEALIIKEADKINAVYTIGASYPEWE
FT                   YRPDSNLRKIAMAVYEHVFGVKMEAAVIHAGLECGAMAKKYPNMDLISFGPNIYDVHTP
FT                   KEKISISSTKRIYEYTVALLKSL"
FT   gene            624297..625175
FT                   /locus_tag="Clos_0568"
FT   CDS_pept        624297..625175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0568"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; Metal-dependent hydrolase HDOD; KEGG: gsu:GSU0294
FT                   HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18130"
FT                   /db_xref="GOA:A8MLW3"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW3"
FT                   /protein_id="ABW18130.1"
FT                   /translation="MQENQLLMLLDRSELIPKPSREISDIFKILNNPVELDIDLLVEKI
FT                   QDVENLHDLMIKNLNTGYFKANREIKTIKEAIVYFGMQTIQNLITLFITIQLFSEARDL
FT                   NKGEKPERVFYMDQYFKHVLGTSVASAMLSAMLNIGDRYKLFSYGLIHDIGIVVVDTCT
FT                   PELLDQVTKKLKSGVHQVVAERLAFSGITHAEIGAWLCRKWNIRQDIVDIVEFHHTPFL
FT                   AKETTDELKIIHIADVISTMYYEKLLGVNLHHGLSNKLMDSLGIKESHIKIIVEKLPEE
FT                   VERLNYFSIYG"
FT   gene            625221..626006
FT                   /locus_tag="Clos_0569"
FT   CDS_pept        625221..626006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0569"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: chy:CHY_0800 formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18131"
FT                   /db_xref="GOA:A8MLW4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW4"
FT                   /protein_id="ABW18131.1"
FT                   /translation="MERTNTIDMIRLKNGEMECIEDTVISEYPLTIFINGKELVTLLCS
FT                   PEGLEYLAVGFLVSEGMIKNIEQIEKVTIDQDKGYAHVELKNKSAFTEELFGKRTITTG
FT                   CGKGTVFYNVLDSLGTKKINHPIKIESEKILELSRKLNEESQLFKETGGVHSCALCDED
FT                   RIILFHEDVGRHNAVDKIIGEALLSGLNLNDKILITSGRISSEMIIKTIKNNIPVIVSR
FT                   SAPTDLSVKIAKQFHVTLIGFVRGNRMNIYNGTENLTIK"
FT   gene            626111..627073
FT                   /locus_tag="Clos_0570"
FT   CDS_pept        626111..627073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0570"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: dsy:DSY3488 hypothetical protein; TIGRFAM:
FT                   molybdenum cofactor biosynthesis protein A; PFAM: Radical
FT                   SAM domain protein; molybdenum cofactor synthesis domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18132"
FT                   /db_xref="GOA:A8MLW5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLW5"
FT                   /protein_id="ABW18132.1"
FT                   /translation="MKDLYSRRINYMRISITDLCNLRCQYCMPAEGICKKDHKEVLTLE
FT                   EITDIVKAGVGLGIDKVRITGGEPLVRNGIVEFIQMISNIDGIKDIAITTNGILLPRYA
FT                   EALKEAGLKRVNISIDSLNPDKYREITRGGDLSKVLEGINECIRLGLTPVKLNVVAIGG
FT                   YNDDEIEDFIQLTMDKPIDVRFIELMPIGEASQWGKDRFISNEEIVHRFKNLVPMETEK
FT                   SSPAKYYQLPGGMGRVGLINPISSHFCGDCNRVRLTSDGKLKPCLHSNHEIDILDAVRN
FT                   HPEKIQEVLASAILSKPEKHDLLTDSHEESNRGMSQIGG"
FT   gene            627076..627486
FT                   /locus_tag="Clos_0571"
FT   CDS_pept        627076..627486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD1715 putative molybdenum cofactor
FT                   sulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18133"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW6"
FT                   /protein_id="ABW18133.1"
FT                   /translation="MAKVKSISFKENNGWTECNHLYLDASKLKESKGRISFITQIGQER
FT                   LLKDEMKGFCHQRFKANFVVREMEIKDLVVDMQLRVGDTIVSIIQVGKACLLECPIIEA
FT                   SNPSCFVNRQVFFGAIIREGLVKKEDAIHILD"
FT   gene            627826..629184
FT                   /locus_tag="Clos_0572"
FT   CDS_pept        627826..629184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0572"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tte:TTE1917 sugar-binding periplasmic
FT                   proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18134"
FT                   /db_xref="GOA:A8MLW7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLW7"
FT                   /protein_id="ABW18134.1"
FT                   /translation="MKKREYKVFHIFLCLFLVVFIVLGPYYLINYRPNSVDYSKKNKAQ
FT                   EPGWQGIITLWDYPRLDKKTGTNFGWMYEKIRAFEKANPGVYIKFTPLSWEKGPIKINT
FT                   AAKLGGLPDIVPIGNDYGLMNRGVLEELNPYLTGDEIQDFRENALKAVTYQNKIYGIPW
FT                   MMTTYTMVLNLDLFNERGVEPPVDGQWTYEEFVSKMESLTFDSKGNNKIDRYGFNSFIE
FT                   PGYYNTWGILLSDGAKVFNEKMQYSFNDDKALSGLTKLMDLKLKYGITHPDFGTNNSNQ
FT                   SWTNFYKDQNIAVYPVGTWALNVLDNLQKEGTGLNYGIAGFPKGNLGKSITLNNTVGSY
FT                   GMVNQESEEKKQVIISFLKFLIKEEYQKDLIRLGVFPARKSIGNIYTDDTNMTMIYEEL
FT                   QNANIVFNHPYWKEIDEILQREIQQGVLGNKSPEQVLKDAEEKIHILLNRIEN"
FT   gene            629214..630182
FT                   /locus_tag="Clos_0573"
FT   CDS_pept        629214..630182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0573"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: cdf:CD3402 UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18135"
FT                   /db_xref="GOA:A8MLW8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLW8"
FT                   /protein_id="ABW18135.1"
FT                   /translation="MKVFGKNMTMDIDIGVNRVDKLKAYKALTKVIPQDLVLLDEPMKN
FT                   HTSFKIGGPADIMVIPETIDQLKSAIKLSKENQMPYFIIGNGSNLIVRDKGMRCIVIKI
FT                   AEQFSKVSFQGNTVIAEAGILLSKLSKKIMAESLKGFEFASGIPGTLGGAITMNAGAYG
FT                   GEMKDVVKGAHLLNDNGEVRYFTLEELELGYRTSIIQKQGYIALDVELALEKGDYQEIL
FT                   EITRDLTERRTTKQPLHLPSAGSVFKRPEGYFAGKLIQDSGLKGQRVGGAQVSELHSGF
FT                   IVNVGDATAKDVLDLIQLIKDRVYETFHVQLETEVRIVGEE"
FT   gene            630219..631091
FT                   /locus_tag="Clos_0574"
FT   CDS_pept        630219..631091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cbo:CBO3377 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18136"
FT                   /db_xref="GOA:A8MLW9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLW9"
FT                   /protein_id="ABW18136.1"
FT                   /translation="MKFVIITGLSGAGKSQAIKYMEDFGYYCVDNLPPTLLTKFAELCY
FT                   QSQGPMAKVALVIDIRGGMFFEDLFSSLERMTEAGYQYEILFLDASDKALIKRFKETRR
FT                   SHPLSVDGSIPEGIALEREKLKELKQKAKHIIDTTNLRSAQLKEELNNIYVEGNQSNNL
FT                   IISIVSFGFKHGIPLDADLVFDVRFLPNPFYIEDLKELTGNDKKVRDYVMNAPISVEFS
FT                   NKLNDMISFLIPQYIEEGKNQLVIAIGCTGGMHRSVTIAHVLYNYLKERGYRVLMNHRD
FT                   SNLSIGRKG"
FT   gene            631096..632427
FT                   /locus_tag="Clos_0575"
FT   CDS_pept        631096..632427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0575"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: ctc:CTC02494 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18137"
FT                   /db_xref="GOA:A8MLX0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX0"
FT                   /protein_id="ABW18137.1"
FT                   /translation="MRLIHWLKPGLKIKRWIICGLGGIVLVSIAISNYLNQLNLKLSFF
FT                   MSVFLGLIGLITVFLSLKSGIVSILEFVYYPVTLTGKTDNGKLDKKIYDKKILARGPRV
FT                   VVIGGGTGLSVLLRGLKLFTSNITAIVTVADDGGGSGKLREDLGMLPPGDIRNCILALA
FT                   DMEPTMEQLLQYRFKEGDLKGQSFGNLLIASMNDISGNFEEAIQKICDVLAVTGKVLPV
FT                   TLRNITLYAKLQNGTVVKGESNIPIRSKAEKSPIEKVFIKPKEAETIKDALCAIEDADI
FT                   VLLGPGSLYTSVVPNLLVKNIKESLNKTTAIKVYITNVMTQPGETDGYTVSSYVKGLLN
FT                   HWPEGRLDYVIANTGTISDIVSSKYETEGSEVTKLTEYDREILSHMGIQLITADLIDIK
FT                   KDYVRHDAIQLSKMIIDLVLQYKVASDKSRIIDYFYLRELLKKS"
FT   sig_peptide     631096..631206
FT                   /locus_tag="Clos_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.171 at
FT                   residue 37"
FT   gene            complement(632466..633731)
FT                   /locus_tag="Clos_0576"
FT   CDS_pept        complement(632466..633731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0576"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: sth:STH226 uracil
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18138"
FT                   /db_xref="GOA:A8MLX1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX1"
FT                   /protein_id="ABW18138.1"
FT                   /translation="MGKVKKVHNAPIEDISSLGAMKGLALGLQHVFTLFASTVLVPILT
FT                   GLDIGVALIMSGIGTLIFHFITQSKVPAYLGSSFSFIAPVILAGELYGLEYARGGIIVA
FT                   GFIYIIFALLISIYGSEKILKYFPPIVTGPIIIVISMTLAPNAINMASQDWLLSMLTLV
FT                   TIIAISVFGKGFLRIVPVIIGLGAGYLLASILGRVDYSPIAQAAWFGIPNFSLPKFNLG
FT                   ATMIVAPIALTTVVEHIGDVLAMSGVVKKDLAKDPGLTRTLIGDGVATSVSALFGGPAN
FT                   TTYSQNTGVVALTKVWDPKVMRIAAVITILIGLIPKLNAFTSTIPKPVIGGAVIVLFGM
FT                   IASIGARTLVDNRVDFSKSRNMIIIAVILVFGLGGATIPIKLSFVEIKLVGMALAAIVG
FT                   IILNIILPFEVDDEEESLMEEA"
FT   gene            634170..634592
FT                   /locus_tag="Clos_0577"
FT   CDS_pept        634170..634592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0577"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cdf:CD3398 putative DNA
FT                   repair protein (nucleotide pyrophosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18139"
FT                   /db_xref="GOA:A8MLX2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX2"
FT                   /protein_id="ABW18139.1"
FT                   /translation="MREEISAGGVVVFGNTILLLKKYNGDWVLPKGKVELDETFEQTAI
FT                   REVYEEASVKVEVIKYLGEIHYTYKNNWEDNNLINKTVHWFLMQSRTMDCIPLREEGFI
FT                   DAKFIHMNRSADLAKYHDEKEIITKAIAEYNKTSNA"
FT   gene            634634..635596
FT                   /locus_tag="Clos_0578"
FT   CDS_pept        634634..635596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0578"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199; KEGG:
FT                   tte:TTE1821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18140"
FT                   /db_xref="GOA:A8MLX3"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLX3"
FT                   /protein_id="ABW18140.1"
FT                   /translation="MSFSAVTKGELARIYSKDRCCQLAELAALIRMCGTLQLVGGAQKL
FT                   NIKLTTENPAIARKLFKLFKDLFGVHIEVMIRRNPRLRKNNHYLMVVTHGMGSTDILEK
FT                   VKILKKEANSFDISYGVPLMLLQNRCCRRAYLRGAFLGGGSVSDPEKTYHLEFVTHSHE
FT                   HSESLRDLINDFQLTSKIVERKGSYVVYLKEGDQIVDLLNIMEAHSALLELENVRIYKQ
FT                   MRNDVNRIVNCETANLSKTVDAAIRQIENIEYIKNTVGLGYLPENLREIAEIRLEYEDA
FT                   TLKELGEMLSPAIGKSGVNHRLRKIDEIATKLQEGKIKN"
FT   gene            635757..637787
FT                   /locus_tag="Clos_0579"
FT   CDS_pept        635757..637787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0579"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: ctc:CTC02321 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18141"
FT                   /db_xref="GOA:A8MLX4"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX4"
FT                   /protein_id="ABW18141.1"
FT                   /translation="MINNIDISNAMTIKLDNILPEMPPFVEGIRRAPDRGFKLTKEQTE
FT                   TALKNALRYIPEELHEALAPEFLEELMTMGRIYGYRFRPEGQIKGKPIQEYQGNCIEGK
FT                   AFQVMIDNNLDFDVALYPYELITYGETGSVFQNWMQYRLVKKYLEVMTDHQTLVLESGH
FT                   PLGLFRSKPDSPRVIITNALMIGMFDNLEDWEIAEQMGVANYGQMTAGGWMYIGPQGIV
FT                   HGTFNTLLNAGRLKFGMGPEEDLKGKLFISSGLGGMSGAQPKAIEIAGGVGIVAEVDYS
FT                   RIKTRYDQGWVKRYSADLKEVFDIAKEYIEKKEPMSIAYHGNIVDLLQYVVDHHIKLEL
FT                   LSDQTSCHAAYDGGYCPQGLTFEERTVMLKKDRGAFKKRVDETLRTHFNLIKTLVERGT
FT                   YFFDYGNSFMKAIYDAGVKEISKNGIDEKDGFIFPSYVEDIMGPELFDYGYGPFRWVCL
FT                   SGDHEDLIKTDKAAMDCIDPTRRGQDRDNYVWIRDAEKNQLVVGTQARILYQDAMGRTK
FT                   IALKFNEMVRNGEVGPIMLGRDHHDVSGTDSPFRETANIKDGSNVMADMATQCFAGNAA
FT                   RGMSLIALHNGGGVGIGKSINGGFGMVLDGSERVDKILNSAMPWDVMGGVARRAWARNE
FT                   NSISTSMEYNKNNEGTDHITIPYVPKAELVQGLVEAAFNKK"
FT   gene            637883..638788
FT                   /locus_tag="Clos_0580"
FT   CDS_pept        637883..638788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0580"
FT                   /product="glutamate formiminotransferase"
FT                   /EC_number="4.3.1.4"
FT                   /note="KEGG: bth:BT_2693
FT                   formiminotransferase-cyclodeaminase; TIGRFAM: glutamate
FT                   formiminotransferase; PFAM: Formiminotransferase domain
FT                   protein; Formiminotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18142"
FT                   /db_xref="GOA:A8MLX5"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX5"
FT                   /protein_id="ABW18142.1"
FT                   /translation="MSNVKKVVQCVPNFSEGRDLDKVERIINPFRGKEGVKLLDYSTDF
FT                   DHNRAVVTVVGEPEAVKHAVIEAMRIAIEEIDMTKHEGQHPRMGAIDVVPFIPIKNMTM
FT                   EEAVELAKEVGKEAWEKYNLPIFLYEKAASNPERENLATVRKGQFEGMAEKVKAPEWAP
FT                   DFGNGEIHPTAGITAVGARMPLVAFNVNLDSPTLEIANKIAKNVRHLSGGLRYCKGIGI
FT                   ELKERGIVQVSMNMTDYTKTALYRAFELIKIEARRYGVNVIGSEIIGLLPMEALIDTAV
FT                   YYLGVEDFSMDQVLEYRMME"
FT   gene            complement(638871..640970)
FT                   /locus_tag="Clos_0581"
FT   CDS_pept        complement(638871..640970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00329 aminopeptidase Y"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18143"
FT                   /db_xref="GOA:A8MLX6"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX6"
FT                   /protein_id="ABW18143.1"
FT                   /translation="MKKVCLKLAMPLLFFIVLTTVFSSGQPMKTSINESNIKSHLDSLT
FT                   SPEYEGRLIGTKGNEKVLAYIEDHFKDMGLRSFTSEGYRQEFKAVNFTWNGVPKFNVIE
FT                   SDGKFVDAYEEQKNFMFIMDNMSMGGSFKGRMNHITDPKEITQGDEQFKDQAVLIDYED
FT                   NPMKKLRLSDEEIDHRLYYLGKAKVIIYLDHNFTTKRKVHLGDKNTMIPANGLIKIGVP
FT                   KNTYKALLDYTNRGYHLDIHIPITFQEILSSNIYNVLPGKNYPNGDYLVIATSIDGLGL
FT                   NWDGKVYPGAADNGASISLILELARILSTTEKPLDSNLLFAGFNGKHTGSMGVEQYLRD
FT                   SMTFPEKAEIIYLDHLSSDGDTPLKIATFVKPRTERKTANKILHQLATTADGQNISYEL
FT                   DDGYLQGEYALFRNFGMIASTLTYDCNENIGTVLDTSDSINLSKVAEVGALLEAYITEY
FT                   GQFNLFSEISQVLKSIGWLIVVGIVLFILKYGLSDKKGFEKLNSWFDSNPVMSSYLLIL
FT                   FFISILTMQIQHSISETAGILLKDTIITWGSIVEMFAHNIFTTLPMLAYLGMVTVIPIG
FT                   LVFIVFMYLSKKLNKNVYVLLLSFSTYIVFMKFFNEFYDDRYTVIYPKLLSPYGSQYVI
FT                   IFLILLFSLLVTWMFSKETHKISHLRTTVLFLFLFIILTTFTYSPYVFAKEVVNARSVN
FT                   GRLKL"
FT   sig_peptide     complement(640893..640970)
FT                   /locus_tag="Clos_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.509 at
FT                   residue 26"
FT   gene            641717..643033
FT                   /locus_tag="Clos_0582"
FT   CDS_pept        641717..643033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0582"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: cth:Cthe_0942 MiaB-like tRNA modifying enzyme
FT                   YliG; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme YliG; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18144"
FT                   /db_xref="GOA:A8MLX7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLX7"
FT                   /protein_id="ABW18144.1"
FT                   /translation="MNVGFISLGCSKNLVVTEEIIGLFKSNHFNIVNKKEDAEIIVINT
FT                   CGFIESAKQEAINTILEMAKLKNNKCKYLIVAGCLVQRYKKELEKAIPEVDLFISISEY
FT                   KQIWKEIENLLDLETGKESNLDYHNRVLTTGSNMAYLKIGEGCDNHCTYCAIPNIQGPY
FT                   ISRTMEDILKEARNLAKQGIKELIVIAQDTTKYGLDIYGEARLPQLLEELCKIEDIEWV
FT                   RFLYVYPESITDELIKVVGENDKICNYFDIPIQHISDSVLKRMNRKSDGASVRNIIEKI
FT                   RREIPDVIIRTTLIVGFPGETEEDFKELYEFVEETKFDKLGVFAYSKEDNTPAAKLKEQ
FT                   IHHATKKSRLRKIMALQEKISRESLEQKVGNVYKVLIESRTKGGNYYIGRTYMDVPDMD
FT                   GVVYIVNNTKENLMNTFVDCRIQRAKDYDLFGELYTEGK"
FT   gene            643420..646914
FT                   /locus_tag="Clos_0583"
FT   CDS_pept        643420..646914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0583"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cdf:CD3396 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18145"
FT                   /db_xref="GOA:A8MLX8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX8"
FT                   /protein_id="ABW18145.1"
FT                   /translation="MSNQFVHLHVHTEYSLLDGFTVINKAMERVKEMGMNAIAITDHGS
FT                   MFGVVDFYKAAKKNGIKPIIGCEVYTAPRSMADKDPQKDKNQGHLVLLAKNEEGYQNII
FT                   KMVSNGFLEGFYYKPRIDYDELERHSKGIICLSACLAGDIQQLLLQDQYESAKALALRL
FT                   NAMFEENSFYLELQDHNMAEQKKVNLGLIKLSRETGIPLVATNDAHYINKEDAKAHDIL
FT                   LCIQTGKIVEDQERMRFPNDEFYLKSPEEMMKIFDFAPEAISNTVKIAEQCNFDFDFNT
FT                   IHLPEYHVPQDVNKEDYLRKLCFEGLNKRYTSVTEELESRLEGELSVIEKMGYVEYFLI
FT                   VWDFIKYAKDNGIPVGPGRGSAAGSIVAYTLGITDVDPIKYNLIFERFLNPERISMPDI
FT                   DIDFCYERREEVIDYVKQKYGEDKVAQIITFGTMAARAAIRDVGRVINMPYNEVDKIAK
FT                   QIPFAIGMTIEKALKMNPELKSIYEENEQGRYLIDMARRLEGMPRHASTHAAGVVIAKK
FT                   PLKEHVPLYVHDDNSTTQFTMGTLEELGLLKMDFLGLRTLTVIKDAIDLIEKNHGIKLD
FT                   LSDSKYDDEKVYDLISKGDTLGLFQLESAGMIQFLKELKPNCFEDIIAGISLYRPGPMD
FT                   SIPRYIENKNNPEKIKYIHESLEPILNVTYGCMVYQEQIMQIVRDLAGYSYGRSDLVRR
FT                   AMGKKKMDVMEQERKNFIYGIVNEKGEVEVAGCIRNGVPEDVANKIYDEMIDFANYGFN
FT                   KSHAAAYAVLAYETAYLKTYYKVEFMAALMTSVMGNTSKVVQYIQDCKKQNIKILPPSI
FT                   NRSFSKFTVEGESIRFALGAVKNVGIGMINNLVQIRETTGDFSTFLDFCQRVESKDINK
FT                   RAVESLIKCGAFDNMGGNRAQLMASFEGIMDNIQQEKRRKLEGQIDLFQMNEEMDASMN
FT                   TVNFPDIKDFSEKIRLSMEKEVVGFYISGHPLSEYEKELEQIVSANSAQLIEAMENLAE
FT                   SQLKDGQPIIVGGMIAEINSKITRNNQMMAFIVLEDLFGSLECIVFPRTLKQYNHLIEE
FT                   DGFIVIQGILSLKEDEEPKVLVNRMTPLVKVSEEHLKSLEKGNHKVFIKLKSKKDWHQI
FT                   EEIKPTLKKYSGSTPIVIYIEETNEKLKADRGLWISLNDEVILKLQDFFGEENIKIL"
FT   gene            647028..647219
FT                   /locus_tag="Clos_0584"
FT   CDS_pept        647028..647219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18146"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLX9"
FT                   /protein_id="ABW18146.1"
FT                   /translation="MWTVIYMANTRQDAEEIQNILVKEGFLVKVRPISKNNVDGTTEVL
FT                   VPRSEVEEVHSILIQLGL"
FT   gene            647384..648343
FT                   /locus_tag="Clos_0585"
FT   CDS_pept        647384..648343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0585"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: ctc:CTC02490 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18147"
FT                   /db_xref="GOA:A8MLY0"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8MLY0"
FT                   /protein_id="ABW18147.1"
FT                   /translation="MKKIAVLTSGGDAPGMNAAVRAVVRSGIYNEMKVMGVKQGYNGLI
FT                   NAQIEEMNLSSVADIIHRGGTILRTARSEEFMTEEGQRKALNVIKVLGIEGIVAIGGDG
FT                   SIRGAKTLNELGIPTIGVPGTIDNDLAYTDYTIGFDTSVNTVVDAISKIRDTSTSHGRA
FT                   NIIEVMGRHCGDIALMAGLAGGAESIIVPEVGVDVDEVCNKLLKGRYRGKLHSIIILAE
FT                   GAGSAIEMSKEIEEKTGIETRATILGHLQRGGSPTASDRILASKLGARAVELLLQDIGN
FT                   RVVGVHGKNVIDMDIDEALSMKSNFDIETYELTKILSI"
FT   gene            648367..650121
FT                   /locus_tag="Clos_0586"
FT   CDS_pept        648367..650121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0586"
FT                   /product="pyruvate kinase"
FT                   /note="TIGRFAM: pyruvate kinase; PFAM: PEP-utilising
FT                   protein mobile region; Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; KEGG: tte:TTE1815 pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18148"
FT                   /db_xref="GOA:A8MLY1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY1"
FT                   /protein_id="ABW18148.1"
FT                   /translation="MKRTKIVCTIGPASESKEVFRKLVMRGLNVARLNFSHGSHEEHGE
FT                   RIRVIKEVREELNEPVAILLDTKGPEIRTGKFKDTEVELLEGQEFTITTRDVLGDNTIC
FT                   NVSYEGLARDVKVGDSILIDDGLVGLKVQNIVGDTDIQCIVENAGIVKNNKGVNVPGVK
FT                   INLPAITEKDESDIKFGIEMDIDFIAASFVRKAADVLAIRKILEDNNGSHIQIISKIEN
FT                   QEGMDNLDEIIEVSDGLMVARGDLGVEIPTEEIPLAQKEMIRKCNRAGKPVITATQMLD
FT                   SMIRNPRPTRAEVTDVANAIFDGTDAIMLSGETAAGKYPAEAVEVMSNIAKRAEAAIDY
FT                   RGLLKTKAIEMETSVTDAISHATCTTAADLDASAIVTATSSGYTTRMVSKFRPSAPIIA
FT                   TTTSESVRRRLSLIWGVYSVITEQLHSTDDIIDISVSKALEAELIRNGDLIVITAGVPV
FT                   GVSGTTNLIKVHIVGEVILSGTGIGKKAATGKVVIVNSVEDGHKVEEGDILVAKATDRD
FT                   LMPFIEKAAAIITEEGGLTSHGAIVGLNLGKATLVGADMATIKLKEGEIVTVDALRGLV
FT                   YSGETKVL"
FT   gene            650384..651124
FT                   /locus_tag="Clos_0587"
FT   CDS_pept        650384..651124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0587"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mac:MA0368
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18149"
FT                   /db_xref="GOA:A8MLY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY2"
FT                   /protein_id="ABW18149.1"
FT                   /translation="MALNNISFSSKGIYISIKRCYNYIKFQQFTDGIFLMTINDRLVIN
FT                   FNGGIMARYTSLDPNKYILIRQAAIDLFYKQGINNTNMQEIAKEAGIAKGTIYLYYSSR
FT                   EDLIDHIFNYSLSLHIEASMKDVEIQSSNSEKLKKRVKNILFWNHEYPKEASIVSAYYK
FT                   PVNIVGTDDVSLKESYEINKVFLQEGIEQKEFKELPLEFLCKMFFSSVEGISTYIRKHP
FT                   SVLEDEKLLEAMVETTVAGLRKVK"
FT   gene            651169..652965
FT                   /locus_tag="Clos_0588"
FT   CDS_pept        651169..652965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0588"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FMN-binding domain protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ctc:CTC00811 fumarate reductase
FT                   flavoprotein subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18150"
FT                   /db_xref="GOA:A8MLY3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY3"
FT                   /protein_id="ABW18150.1"
FT                   /translation="MKKTKQILSVLLVFIMMLSFVGCSKPASNGGEGALFKAGTYTAKA
FT                   KGLGGDVEVEMILTETTIESVKVLSHSETPGISDPAIEQIPANIVAAQGLKIDAVSGAT
FT                   VTSEAILAAVIDCLTQAGANIEELKTKGLKAVVLEDETIETDVVVVGSGIAGLSAAVSA
FT                   AEEGAKVVLLEKMGSVGGASITCGGEILAGGSEMQAAQGIEDTAEGLKQYWLEVGKGKI
FT                   NEEIISFIADKSADTVKWLAERGVKFRNVTFSYYYPTQSVYRNHATETFSGADFILPLQ
FT                   EKAKSLGVEFRFETPAVSLINDKGTIKGVVAKNAGRTVTVNAKSTILATGGYANNKELV
FT                   EQYMPNVKGYGSALGEALNGDGLIMAREVGAEIVANGGGIVAPMDLGATRYVDAGGIFL
FT                   NVTPEGKRFANENEYWFKRAATLYHDLGFSNYFAITDSKLDNENLEKAVENGTAFKADT
FT                   IEELAKFIGAKPEILKATVTRYNGFAATGKDEDFGKPAVGPVGNREDNLKELQLLNAVD
FT                   QAPYYAIAFNTTGVTGTFGGPKIDMNAQVISTTGDVIPGLYAAGEVANGELFYEQYPCS
FT                   GSSIQMSTRMGIQAGKAAAAAK"
FT   sig_peptide     651169..651243
FT                   /locus_tag="Clos_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.665 at
FT                   residue 25"
FT   gene            complement(653367..654713)
FT                   /locus_tag="Clos_0589"
FT   CDS_pept        complement(653367..654713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18151"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY4"
FT                   /protein_id="ABW18151.1"
FT                   /translation="MLRTIRNILILILIGITATGMPIYASTMDFTALIPTITPKNQYIT
FT                   VTTEEEVVSNHQVKIKYGFSANSDYTRILFDEGNPFTFTLMNNGKVIEGLSLHDIAPNE
FT                   NYKALELYSESPAYITFDFDQSKLDLPDGSYKLTLHPNSQGKEFHLEQAEFHINFSSEG
FT                   TYVNAMASAPKGQMALTLYFPDKDLKYLSPITRFVPYTEYPLTTILRNLEQGPQAALGL
FT                   QKGSSIPPNGKAGKSGDTAYINLPNNLGPYDDGSSIATMAVGSLVNSMVSSKGISKVQF
FT                   QFNGTILKEAFHGMTMDQPYFGTAVDVIYTSYLSDTGRFLLVPIPFEQFTAVLGNDTNG
FT                   VKIPMFFDALKFNLSGIYNAQVHPIVPNEVELLDYSFHDGLLTLTFNEAFLKAYENNSS
FT                   LRNRMIDGIVFTFQSIENVTDVSFEVKHDSGQGFTKYDFQSPVYINPEN"
FT   sig_peptide     complement(654636..654713)
FT                   /locus_tag="Clos_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.767 at
FT                   residue 26"
FT   gene            654960..656318
FT                   /locus_tag="Clos_0590"
FT   CDS_pept        654960..656318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0590"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; protein of
FT                   unknown function Met10; (Uracil-5)-methyltransferase; KEGG:
FT                   cdf:CD3393 putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18152"
FT                   /db_xref="GOA:A8MLY5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY5"
FT                   /protein_id="ABW18152.1"
FT                   /translation="MLDKSKIYEMEISGLGHSGEGIGKIDDFTVFVENAIPGDVIRTKI
FT                   TVLKKNYGVGELLEILKPSANRVTPKCGIAGICGGCQIMHMDYEQQLRTKRNTVVEALK
FT                   RIGKIDAVVHPTLGMDNPYEYRNKAQFPVGILDGKSILGFYKKGSHEIVDTEYCHIQAP
FT                   INTKIVQVIKKYIDDFDVAVYDEKEHSGLIRHVVTKVGFATGEVMVIMVTNGKEFPYKD
FT                   KLIEMLKENVEGLKSVVQNINMKNTNVIFGDTTFTLYGEDQIVDYIGDLKFNISARSFY
FT                   QVNPAQTKVLYEKALEYADLTGNERVFDIYCGIGTISLFLAKKAKEVHGIEIIDAAIED
FT                   ARENARINHLTNTKFYVGKAEDVVPKLYKSGLVADVVVVDPPRKGCEESVLETIVNMAP
FT                   KRVVYVSCNPATLARDLAYLDEKGYKTVEVQPVDMFSHSSHVECCVSLERIKE"
FT   gene            656519..656803
FT                   /locus_tag="Clos_0591"
FT   CDS_pept        656519..656803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18153"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY6"
FT                   /protein_id="ABW18153.1"
FT                   /translation="MKFDVDKELIEVQIKYIQKEISMIEMVLRNKDYDTLDFIILQSNY
FT                   EVDLGDTATLEERLNVYKSWYEQVLYLLFEYEEENESLDDDILVVGIDY"
FT   gene            656949..657875
FT                   /locus_tag="Clos_0592"
FT   CDS_pept        656949..657875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0592"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region; KEGG:
FT                   cbo:CBO3059 GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18154"
FT                   /db_xref="GOA:A8MLY7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY7"
FT                   /protein_id="ABW18154.1"
FT                   /translation="MKNLELKTIIFNSLKYIETNINEPIMAEDIAKNAGYSLYHFSRMF
FT                   KKQMGLPIMEYVKERKLIRASEEIVNGKKIIDTALNYGYQSHSGFTKAFKNKFGFSPAL
FT                   LRAFSFQINCLGGNCNMSHVFMKSTAIHATKEELYELLITTINENMLEYDHEKIRKAYE
FT                   FACKAFDGKKRYSNDDYVTHPINVAILLSEMEASEDTVIAGLLHDILLEKSNISLKEVE
FT                   KMFSNSIVNIIKGVTEFNGNSDITDEDVIMVKLAERLHNMRTIEFMDEGRWKEKAKETL
FT                   DIFLPIAVKMNNEKILAELNDLSLKYI"
FT   gene            658143..658385
FT                   /locus_tag="Clos_0593"
FT   CDS_pept        658143..658385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18155"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY8"
FT                   /protein_id="ABW18155.1"
FT                   /translation="MMKRFLVVSDYSEYEQAMKASNGIEVIAVVSGERERKSLADVIRE
FT                   SKDVEEIEIDSIVNAFSSAIEVKEMDRLQLIGQII"
FT   gene            658428..658718
FT                   /locus_tag="Clos_0594"
FT   CDS_pept        658428..658718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0594"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bha:BH3445 transposase (05)"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18156"
FT                   /db_xref="GOA:A8MLY9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLY9"
FT                   /protein_id="ABW18156.1"
FT                   /translation="MSVEKRPRPTYTDEFKNQVVQLYKNGKRKCNITREYDIASSLLDK
FT                   WIKQADTSGSFKEKDNLTLEQKELIELRKRNKQLEMENDILKQAALIMGRK"
FT   gene            658721..659554
FT                   /locus_tag="Clos_0595"
FT   CDS_pept        658721..659554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0595"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bcz:pE33L466_0288 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18157"
FT                   /db_xref="GOA:A8MLZ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ0"
FT                   /protein_id="ABW18157.1"
FT                   /translation="MIRNNAHKYSVSAMCKVLEISRSSYYYESKPKQYESKLTSKIKKI
FT                   FQESRSNYGTRKIKAALRDNGYQVSRRRTGRIMKQEGLVSKYTVAQFRPYADKCNESQI
FT                   ENLVKRKFDDRSQYNVVVSDLTYVRVGNQWNYICVLVDLFNREIIGYSAGKNKDANLVS
FT                   KAFARVNTNLKNIQVFHTDRGNEFKNKLLDETLKIFDIKRSLSKRGCPYDNAVAEATFK
FT                   IIKTEFVKYKVFETLEELQYELADYVNWFHNHRLHSSLGYLTPATFRMNTLKKVV"
FT   gene            659653..659757
FT                   /pseudo
FT                   /locus_tag="Clos_0596"
FT   gene            659830..660168
FT                   /pseudo
FT                   /locus_tag="Clos_0597"
FT   gene            660225..660815
FT                   /locus_tag="Clos_0598"
FT   CDS_pept        660225..660815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0598"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: drm:Dred_3014
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18158"
FT                   /db_xref="GOA:A8MLZ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ1"
FT                   /protein_id="ABW18158.1"
FT                   /translation="MDKKHEILKAAFDIFCEKGYNLSVSELAGAVKIKTPSLYSHFGSK
FT                   DEIIELVIRDEIQRYYASLTEKMLEVKSLSCKEAMKSLFVYVIKYFSKDNRIKFWRAIP
FT                   FIQNQQLKSISTQLIVDNDRIFKQQMQICFSKGQSNGEIRLDASPGALRLYLCILQGVL
FT                   DGMLLGSEELVDRSNVDELFEAYWDGIRVIGTN"
FT   gene            660868..661842
FT                   /locus_tag="Clos_0599"
FT   CDS_pept        660868..661842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0599"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   tma:TM1284 oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18159"
FT                   /db_xref="GOA:A8MLZ2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ2"
FT                   /protein_id="ABW18159.1"
FT                   /translation="MISNQWYAILPSKKVKTDKIVGVKRMNLDLAIFRNSKGEIGCVVD
FT                   QCTHRGAALSLGKVKDDCIQCPFHGLEFNKIGKCMFIPANGKASTGDISRYNVKHYPVR
FT                   EENGIIYLWYGDEEKITDDLPFFDKEIDDSFVFSELEDHWNSHYSRCIENQLDVVHLPF
FT                   VHQSTIGRGNKTLVNGPKVVWEDGILTTSANNELDQGQKPKSPEECVIKDTHLSFRFPN
FT                   IWMNHISENIKVIIYFAPVDDENTVLYIRFYCKLTSLRPINSLIAYIGKFANKTVERQD
FT                   KRVVITQKPKASSLRSGEKLVPGDGPIIKYRKIREELINSTVK"
FT   gene            662135..663073
FT                   /locus_tag="Clos_0600"
FT   CDS_pept        662135..663073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18160"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ3"
FT                   /protein_id="ABW18160.1"
FT                   /translation="MKKIKMLILYFLMFLLVFSACSNQSSPNPLDNDSNGSLGVIDGKW
FT                   VEQKEDTLIFDKEPDFPVINSYLDLTMNDYRALAEQKNVHLIWATGKSISPSKYYGLFN
FT                   SNRNCLESEVSVSIFVKNMKTGEEVSVLTGDDTSSYHILNWWLDDTRFVFQRDDRDGKR
FT                   TYGVCTVNGEVTLLESLKDSTIILQHSSSYFISCEYGDEKTISFSKIGTDNHIENIGEF
FT                   SSDHYIMEAVISSDFRFIALKTRENYETYDRMLEILDSTNGLFYKIEPPITQNASSVSL
FT                   NTLNWQSTYLRARYHVIYNNEQESVLYEYQF"
FT   sig_peptide     662135..662209
FT                   /locus_tag="Clos_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.369 at
FT                   residue 25"
FT   gene            663331..663918
FT                   /locus_tag="Clos_0601"
FT   CDS_pept        663331..663918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0601"
FT                   /product="ATP-binding membrane protein"
FT                   /note="KEGG: gtn:GTNG_1582 ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18161"
FT                   /db_xref="GOA:A8MLZ4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ4"
FT                   /protein_id="ABW18161.1"
FT                   /translation="MIIWINGAFGSGKTTCTYELNKRLSNSFVYDPENIGYFIRKNIPK
FT                   ELYESDFQNHDQWRVFNYEMLKYLNSTYEGIILVPMTLVNRQYYDEIIGRLIKENIKVK
FT                   HYILYAEKKTIEKRLNKRFEWSNSWAKSQIDRCIYAFNHHITEEKIITDHKTIDDIVEE
FT                   IAEKSGLTLRSDKRGHFKKLMDRWATLIKHIR"
FT   gene            complement(664410..665348)
FT                   /locus_tag="Clos_0602"
FT   CDS_pept        complement(664410..665348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clos_0602"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein MerR; Prophage CP4-57 regulatory;
FT                   KEGG: cac:CAC0252 molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clos_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABW18162"
FT                   /db_xref="GOA:A8MLZ5"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8MLZ5"
FT                   /protein_id="ABW18162.1"
FT                   /translation="MSTKAALSTQEVADLLQVSKSTIYDLIRRGEINSYKVGRKVRFTE
FT                   EDVKEYISKSKESQNAKKTSVLDGTFSLMGNEKKPDGFIICGQDLILDVLSNYMRLHNI
FT                   PALRAYIGSYDGLISLYRNKVNVTASHMWDSDTDTYNVPYVRRLIPGIPAVIIHLTCRM
FT                   QGLYVAKGNPKNISGWDDFKRDDIIMVNREQGAGSRVLLDENLKLLGIFGSTIKGYNRE
FT                   ISSHLAVASAVSRGEADVAVGNEKIACQVDNIDFIAMKKERYDLVLRKEDMNTFEIQTL
FT                   LKIIRSDAFRNEFGNIGGYDTKDMGRIIAET"
FT   gene            665513..666577
FT