(data stored in ACNUC7421 zone)

EMBL: CP000854

ID   CP000854; SV 1; circular; genomic DNA; STD; PRO; 6636827 BP.
XX
AC   CP000854;
XX
PR   Project:PRJNA16725;
XX
DT   20-APR-2008 (Rel. 95, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Mycobacterium marinum M, complete genome.
XX
KW   .
XX
OS   Mycobacterium marinum M
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium.
XX
RN   [1]
RP   1-6636827
RX   DOI; 10.1101/gr.075069.107.
RX   PUBMED; 18403782.
RA   Stinear T.P., Seemann T., Harrison P.F., Jenkin G.A., Davies J.K.,
RA   Johnson P.D., Abdellah Z., Arrowsmith C., Chillingworth T., Churcher C.,
RA   Clarke K., Cronin A., Davis P., Goodhead I., Holroyd N., Jagels K.,
RA   Lord A., Moule S., Mungall K., Norbertczak H., Quail M.A.,
RA   Rabbinowitsch E., Walker D., White B., Whitehead S., Small P.L., Brosch R.,
RA   Ramakrishnan L., Fischbach M.A., Parkhill J., Cole S.T.;
RT   "Insights from the complete genome sequence of Mycobacterium marinum on the
RT   evolution of Mycobacterium tuberculosis";
RL   Genome Res. 18(5):729-741(2008).
XX
RN   [2]
RP   1-6636827
RA   Stinear T.P., Seemann T., Harrison P.F., Jenkin G.A., Pidot S.J.,
RA   Davies J.K., Small P.L.C., Johnson P.D.R., Brosch R., Cole S.T.,
RA   Ramakrishnan L., Parkhill J.;
RT   ;
RL   Submitted (09-AUG-2007) to the INSDC.
RL   Pathogen Sequencing Unit, Wellcome Trust Sanger Institute, Wellcome Trust
RL   Genome Campus, Hinxton, Cambridge CB10 1SA, United Kingdom
XX
DR   MD5; 32319d9baf1e139356c1365270a529b5.
DR   BioSample; SAMN02604327.
DR   EnsemblGenomes-Gn; EBG00001236387.
DR   EnsemblGenomes-Gn; EBG00001236388.
DR   EnsemblGenomes-Gn; EBG00001236390.
DR   EnsemblGenomes-Gn; EBG00001236392.
DR   EnsemblGenomes-Gn; EBG00001236394.
DR   EnsemblGenomes-Gn; EBG00001236396.
DR   EnsemblGenomes-Gn; EBG00001236398.
DR   EnsemblGenomes-Gn; EBG00001236400.
DR   EnsemblGenomes-Gn; EBG00001236402.
DR   EnsemblGenomes-Gn; EBG00001236404.
DR   EnsemblGenomes-Gn; EBG00001236406.
DR   EnsemblGenomes-Gn; EBG00001236408.
DR   EnsemblGenomes-Gn; EBG00001236410.
DR   EnsemblGenomes-Gn; EBG00001236412.
DR   EnsemblGenomes-Gn; EBG00001236414.
DR   EnsemblGenomes-Gn; EBG00001236416.
DR   EnsemblGenomes-Gn; EBG00001236418.
DR   EnsemblGenomes-Gn; EBG00001236420.
DR   EnsemblGenomes-Gn; EBG00001236422.
DR   EnsemblGenomes-Gn; EBG00001236424.
DR   EnsemblGenomes-Gn; EBG00001236426.
DR   EnsemblGenomes-Gn; EBG00001236428.
DR   EnsemblGenomes-Gn; EBG00001236430.
DR   EnsemblGenomes-Gn; EBG00001236432.
DR   EnsemblGenomes-Gn; EBG00001236434.
DR   EnsemblGenomes-Gn; EBG00001236436.
DR   EnsemblGenomes-Gn; EBG00001236438.
DR   EnsemblGenomes-Gn; EBG00001236440.
DR   EnsemblGenomes-Gn; EBG00001236442.
DR   EnsemblGenomes-Gn; EBG00001236444.
DR   EnsemblGenomes-Gn; EBG00001236446.
DR   EnsemblGenomes-Gn; EBG00001236448.
DR   EnsemblGenomes-Gn; EBG00001236450.
DR   EnsemblGenomes-Gn; EBG00001236452.
DR   EnsemblGenomes-Gn; EBG00001236454.
DR   EnsemblGenomes-Gn; EBG00001236456.
DR   EnsemblGenomes-Gn; EBG00001236458.
DR   EnsemblGenomes-Gn; EBG00001236460.
DR   EnsemblGenomes-Gn; EBG00001236462.
DR   EnsemblGenomes-Gn; EBG00001236464.
DR   EnsemblGenomes-Gn; EBG00001236466.
DR   EnsemblGenomes-Gn; EBG00001236468.
DR   EnsemblGenomes-Gn; EBG00001236470.
DR   EnsemblGenomes-Gn; EBG00001236471.
DR   EnsemblGenomes-Gn; EBG00001236473.
DR   EnsemblGenomes-Gn; EBG00001236475.
DR   EnsemblGenomes-Gn; EBG00001236477.
DR   EnsemblGenomes-Gn; EBG00001236480.
DR   EnsemblGenomes-Gn; EBG00001236482.
DR   EnsemblGenomes-Gn; EBG00001236483.
DR   EnsemblGenomes-Gn; EBG00001236484.
DR   EnsemblGenomes-Gn; EBG00001236486.
DR   EnsemblGenomes-Gn; EBG00001236488.
DR   EnsemblGenomes-Gn; EBG00001236490.
DR   EnsemblGenomes-Gn; EBG00001236493.
DR   EnsemblGenomes-Gn; EBG00001236498.
DR   EnsemblGenomes-Gn; EBG00001236500.
DR   EnsemblGenomes-Gn; EBG00001236502.
DR   EnsemblGenomes-Gn; EBG00001236504.
DR   EnsemblGenomes-Gn; EBG00001236506.
DR   EnsemblGenomes-Gn; EBG00001236508.
DR   EnsemblGenomes-Gn; EBG00001236510.
DR   EnsemblGenomes-Gn; EBG00001236512.
DR   EnsemblGenomes-Gn; EBG00001236514.
DR   EnsemblGenomes-Gn; EBG00001236516.
DR   EnsemblGenomes-Gn; EBG00001236518.
DR   EnsemblGenomes-Gn; EBG00001236520.
DR   EnsemblGenomes-Gn; EBG00001236522.
DR   EnsemblGenomes-Gn; EBG00001236524.
DR   EnsemblGenomes-Gn; EBG00001236526.
DR   EnsemblGenomes-Gn; EBG00001236529.
DR   EnsemblGenomes-Gn; EBG00001236531.
DR   EnsemblGenomes-Gn; EBG00001236533.
DR   EnsemblGenomes-Gn; EBG00001236535.
DR   EnsemblGenomes-Gn; EBG00001236537.
DR   EnsemblGenomes-Gn; EBG00001236539.
DR   EnsemblGenomes-Gn; EBG00001236542.
DR   EnsemblGenomes-Gn; EBG00001236544.
DR   EnsemblGenomes-Gn; MMAR_5487.
DR   EnsemblGenomes-Gn; MMAR_5488.
DR   EnsemblGenomes-Gn; MMAR_5489.
DR   EnsemblGenomes-Gn; MMAR_5490.
DR   EnsemblGenomes-Gn; MMAR_5491.
DR   EnsemblGenomes-Gn; MMAR_5492.
DR   EnsemblGenomes-Gn; MMAR_5493.
DR   EnsemblGenomes-Gn; MMAR_5494.
DR   EnsemblGenomes-Gn; MMAR_5495.
DR   EnsemblGenomes-Gn; MMAR_5496.
DR   EnsemblGenomes-Gn; MMAR_5497.
DR   EnsemblGenomes-Gn; MMAR_5498.
DR   EnsemblGenomes-Gn; MMAR_5499.
DR   EnsemblGenomes-Gn; MMAR_5500.
DR   EnsemblGenomes-Gn; MMAR_5501.
DR   EnsemblGenomes-Gn; MMAR_5502.
DR   EnsemblGenomes-Gn; MMAR_5503.
DR   EnsemblGenomes-Gn; MMAR_5504.
DR   EnsemblGenomes-Gn; MMAR_5505.
DR   EnsemblGenomes-Gn; MMAR_5506.
DR   EnsemblGenomes-Gn; MMAR_5507.
DR   EnsemblGenomes-Gn; MMAR_5508.
DR   EnsemblGenomes-Gn; MMAR_5509.
DR   EnsemblGenomes-Gn; MMAR_5510.
DR   EnsemblGenomes-Gn; MMAR_5511.
DR   EnsemblGenomes-Gn; MMAR_5512.
DR   EnsemblGenomes-Gn; MMAR_5513.
DR   EnsemblGenomes-Gn; MMAR_5514.
DR   EnsemblGenomes-Gn; MMAR_5515.
DR   EnsemblGenomes-Gn; MMAR_5516.
DR   EnsemblGenomes-Gn; MMAR_5517.
DR   EnsemblGenomes-Gn; MMAR_5518.
DR   EnsemblGenomes-Gn; MMAR_5519.
DR   EnsemblGenomes-Gn; MMAR_5520.
DR   EnsemblGenomes-Gn; MMAR_5522.
DR   EnsemblGenomes-Gn; MMAR_5523.
DR   EnsemblGenomes-Gn; MMAR_5524.
DR   EnsemblGenomes-Gn; MMAR_5525.
DR   EnsemblGenomes-Gn; MMAR_5526.
DR   EnsemblGenomes-Gn; MMAR_5527.
DR   EnsemblGenomes-Gn; MMAR_5528.
DR   EnsemblGenomes-Gn; MMAR_5529.
DR   EnsemblGenomes-Gn; MMAR_5530.
DR   EnsemblGenomes-Gn; MMAR_5531.
DR   EnsemblGenomes-Gn; MMAR_5532.
DR   EnsemblGenomes-Gn; MMAR_5533.
DR   EnsemblGenomes-Gn; MMAR_5534.
DR   EnsemblGenomes-Gn; MMAR_5535.
DR   EnsemblGenomes-Gn; MMAR_5536.
DR   EnsemblGenomes-Gn; MMAR_5537.
DR   EnsemblGenomes-Gn; MMAR_5538.
DR   EnsemblGenomes-Tr; EBT00001581906.
DR   EnsemblGenomes-Tr; EBT00001581907.
DR   EnsemblGenomes-Tr; EBT00001581908.
DR   EnsemblGenomes-Tr; EBT00001581909.
DR   EnsemblGenomes-Tr; EBT00001581910.
DR   EnsemblGenomes-Tr; EBT00001581911.
DR   EnsemblGenomes-Tr; EBT00001581912.
DR   EnsemblGenomes-Tr; EBT00001581913.
DR   EnsemblGenomes-Tr; EBT00001581914.
DR   EnsemblGenomes-Tr; EBT00001581915.
DR   EnsemblGenomes-Tr; EBT00001581916.
DR   EnsemblGenomes-Tr; EBT00001581917.
DR   EnsemblGenomes-Tr; EBT00001581918.
DR   EnsemblGenomes-Tr; EBT00001581919.
DR   EnsemblGenomes-Tr; EBT00001581920.
DR   EnsemblGenomes-Tr; EBT00001581921.
DR   EnsemblGenomes-Tr; EBT00001581922.
DR   EnsemblGenomes-Tr; EBT00001581923.
DR   EnsemblGenomes-Tr; EBT00001581924.
DR   EnsemblGenomes-Tr; EBT00001581925.
DR   EnsemblGenomes-Tr; EBT00001581926.
DR   EnsemblGenomes-Tr; EBT00001581927.
DR   EnsemblGenomes-Tr; EBT00001581928.
DR   EnsemblGenomes-Tr; EBT00001581929.
DR   EnsemblGenomes-Tr; EBT00001581930.
DR   EnsemblGenomes-Tr; EBT00001581931.
DR   EnsemblGenomes-Tr; EBT00001581932.
DR   EnsemblGenomes-Tr; EBT00001581933.
DR   EnsemblGenomes-Tr; EBT00001581934.
DR   EnsemblGenomes-Tr; EBT00001581935.
DR   EnsemblGenomes-Tr; EBT00001581936.
DR   EnsemblGenomes-Tr; EBT00001581937.
DR   EnsemblGenomes-Tr; EBT00001581938.
DR   EnsemblGenomes-Tr; EBT00001581939.
DR   EnsemblGenomes-Tr; EBT00001581940.
DR   EnsemblGenomes-Tr; EBT00001581941.
DR   EnsemblGenomes-Tr; EBT00001581942.
DR   EnsemblGenomes-Tr; EBT00001581943.
DR   EnsemblGenomes-Tr; EBT00001581944.
DR   EnsemblGenomes-Tr; EBT00001581945.
DR   EnsemblGenomes-Tr; EBT00001581946.
DR   EnsemblGenomes-Tr; EBT00001581947.
DR   EnsemblGenomes-Tr; EBT00001581948.
DR   EnsemblGenomes-Tr; EBT00001581949.
DR   EnsemblGenomes-Tr; EBT00001581950.
DR   EnsemblGenomes-Tr; EBT00001581951.
DR   EnsemblGenomes-Tr; EBT00001581952.
DR   EnsemblGenomes-Tr; EBT00001581953.
DR   EnsemblGenomes-Tr; EBT00001581954.
DR   EnsemblGenomes-Tr; EBT00001581955.
DR   EnsemblGenomes-Tr; EBT00001581956.
DR   EnsemblGenomes-Tr; EBT00001581957.
DR   EnsemblGenomes-Tr; EBT00001581958.
DR   EnsemblGenomes-Tr; EBT00001581959.
DR   EnsemblGenomes-Tr; EBT00001581960.
DR   EnsemblGenomes-Tr; EBT00001581961.
DR   EnsemblGenomes-Tr; EBT00001581962.
DR   EnsemblGenomes-Tr; EBT00001581963.
DR   EnsemblGenomes-Tr; EBT00001581964.
DR   EnsemblGenomes-Tr; EBT00001581965.
DR   EnsemblGenomes-Tr; EBT00001581966.
DR   EnsemblGenomes-Tr; EBT00001581967.
DR   EnsemblGenomes-Tr; EBT00001581968.
DR   EnsemblGenomes-Tr; EBT00001581969.
DR   EnsemblGenomes-Tr; EBT00001581970.
DR   EnsemblGenomes-Tr; EBT00001581971.
DR   EnsemblGenomes-Tr; EBT00001581972.
DR   EnsemblGenomes-Tr; EBT00001581973.
DR   EnsemblGenomes-Tr; EBT00001581974.
DR   EnsemblGenomes-Tr; EBT00001581975.
DR   EnsemblGenomes-Tr; EBT00001581976.
DR   EnsemblGenomes-Tr; EBT00001581977.
DR   EnsemblGenomes-Tr; EBT00001581978.
DR   EnsemblGenomes-Tr; EBT00001581979.
DR   EnsemblGenomes-Tr; EBT00001581980.
DR   EnsemblGenomes-Tr; EBT00001581981.
DR   EnsemblGenomes-Tr; EBT00001581982.
DR   EnsemblGenomes-Tr; EBT00001581983.
DR   EnsemblGenomes-Tr; MMAR_5487-1.
DR   EnsemblGenomes-Tr; MMAR_5488-1.
DR   EnsemblGenomes-Tr; MMAR_5489-1.
DR   EnsemblGenomes-Tr; MMAR_5490-1.
DR   EnsemblGenomes-Tr; MMAR_5491-1.
DR   EnsemblGenomes-Tr; MMAR_5492-1.
DR   EnsemblGenomes-Tr; MMAR_5493-1.
DR   EnsemblGenomes-Tr; MMAR_5494-1.
DR   EnsemblGenomes-Tr; MMAR_5495-1.
DR   EnsemblGenomes-Tr; MMAR_5496-1.
DR   EnsemblGenomes-Tr; MMAR_5497-1.
DR   EnsemblGenomes-Tr; MMAR_5498-1.
DR   EnsemblGenomes-Tr; MMAR_5499-1.
DR   EnsemblGenomes-Tr; MMAR_5500-1.
DR   EnsemblGenomes-Tr; MMAR_5501-1.
DR   EnsemblGenomes-Tr; MMAR_5502-1.
DR   EnsemblGenomes-Tr; MMAR_5503-1.
DR   EnsemblGenomes-Tr; MMAR_5504-1.
DR   EnsemblGenomes-Tr; MMAR_5505-1.
DR   EnsemblGenomes-Tr; MMAR_5506-1.
DR   EnsemblGenomes-Tr; MMAR_5507-1.
DR   EnsemblGenomes-Tr; MMAR_5508-1.
DR   EnsemblGenomes-Tr; MMAR_5509-1.
DR   EnsemblGenomes-Tr; MMAR_5510-1.
DR   EnsemblGenomes-Tr; MMAR_5511-1.
DR   EnsemblGenomes-Tr; MMAR_5512-1.
DR   EnsemblGenomes-Tr; MMAR_5513-1.
DR   EnsemblGenomes-Tr; MMAR_5514-1.
DR   EnsemblGenomes-Tr; MMAR_5515-1.
DR   EnsemblGenomes-Tr; MMAR_5516-1.
DR   EnsemblGenomes-Tr; MMAR_5517-1.
DR   EnsemblGenomes-Tr; MMAR_5518-1.
DR   EnsemblGenomes-Tr; MMAR_5519-1.
DR   EnsemblGenomes-Tr; MMAR_5520-1.
DR   EnsemblGenomes-Tr; MMAR_5522-1.
DR   EnsemblGenomes-Tr; MMAR_5523-1.
DR   EnsemblGenomes-Tr; MMAR_5524-1.
DR   EnsemblGenomes-Tr; MMAR_5525-1.
DR   EnsemblGenomes-Tr; MMAR_5526-1.
DR   EnsemblGenomes-Tr; MMAR_5527-1.
DR   EnsemblGenomes-Tr; MMAR_5528-1.
DR   EnsemblGenomes-Tr; MMAR_5529-1.
DR   EnsemblGenomes-Tr; MMAR_5530-1.
DR   EnsemblGenomes-Tr; MMAR_5531-1.
DR   EnsemblGenomes-Tr; MMAR_5532-1.
DR   EnsemblGenomes-Tr; MMAR_5533-1.
DR   EnsemblGenomes-Tr; MMAR_5534-1.
DR   EnsemblGenomes-Tr; MMAR_5535-1.
DR   EnsemblGenomes-Tr; MMAR_5536-1.
DR   EnsemblGenomes-Tr; MMAR_5537-1.
DR   EnsemblGenomes-Tr; MMAR_5538-1.
DR   EuropePMC; PMC2336800; 18403782.
DR   EuropePMC; PMC2600814; 19104652.
DR   EuropePMC; PMC2689228; 19442300.
DR   EuropePMC; PMC2737907; 19592526.
DR   EuropePMC; PMC3209108; 21880973.
DR   EuropePMC; PMC3434033; 22712622.
DR   EuropePMC; PMC3884719; 24520560.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4303273; 25612300.
DR   EuropePMC; PMC4703794; 26779131.
DR   EuropePMC; PMC5040422; 27721649.
DR   EuropePMC; PMC5989629; 27613236.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000854.
DR   SILVA-SSU; CP000854.
DR   StrainInfo; 352440; 0.
XX
CC   DNA and bacteria are available from Dr Lalita Ramakrishnan,
CC   lalitar@u.washington.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6636827
FT                   /organism="Mycobacterium marinum M"
FT                   /strain="M"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216594"
FT   gene            1..1533
FT                   /gene="dnaA"
FT                   /locus_tag="MMAR_0001"
FT   CDS_pept        1..1533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MMAR_0001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /note="plays a critical role in the initiation and
FT                   regulation of chromosomal replication. binds to the origin
FT                   of replication; it binds specifically double-stranded DNA
FT                   at a 9 bp consensus (DnaA box): 5'-TTATC(C/A)a(C/A)A-3'.
FT                   DnaA binds to ATP and to acidic phospholipids. DnaA protein
FT                   binds the origin of replication (oriC), ATP and ADP, and
FT                   exhibits weak ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38472"
FT                   /db_xref="GOA:B2HI46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HI46"
FT                   /protein_id="ACC38472.1"
FT                   /translation="MTNDPGSGFAAVWNAVVAELNGEPNTDGDAGTGTTLTSPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRTPITAALSRRLGQQIQLGVRIAPPP
FT                   ADDDDDSVAAAVEDPGLEASPETSQEVSDEIDDFGENAPNSRQSWPTHFKKRSTDADTS
FT                   ASAGGTSLNRRYTFDTFVIGASNRFAHAATLAIAEAPARAYNPLFIWGESGLGKTHLLH
FT                   AAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEG
FT                   KEGIQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELET
FT                   RIAILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAE
FT                   IVLRDLIADAGTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELT
FT                   DLSLPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   gene            2074..3282
FT                   /gene="dnaN"
FT                   /locus_tag="MMAR_0002"
FT   CDS_pept        2074..3282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MMAR_0002"
FT                   /product="DNA polymerase III (beta chain) DnaN"
FT                   /note="DNA polymerase III is a complex, multichain enzyme
FT                   responsible for most of the replicative synthesis in
FT                   bacteria. this DNA polymerase also exhibits 3' to 5'
FT                   exonuclease activity. the beta chain is required for
FT                   initiation of replication once it is clamped onto DNA, it
FT                   slides freely (bidirectional and ATP-independent) along
FT                   duplex DNA [catalytic activity: N deoxynucleoside
FT                   triphosphate = N diphosphate + {DNA}n]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38473"
FT                   /db_xref="GOA:B2HI47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:6D47"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI47"
FT                   /protein_id="ACC38473.1"
FT                   /translation="MDAATTRAGLTDLKFRLVRESFADAVSWVAKNLPTRPAVPVLSGV
FT                   LLTGSDEGLTISGFDYEVSAEVRVPAEIASPGTVLVSGRLLSDITRALPNKPVDFYVDG
FT                   NRVALTCGNARFSLPTMAVEDYPTLPTLPEDTGTLPAELFSEAIGQVAIAAGRDDTLPM
FT                   LTGIRVEISGEKVVLAATDRFRLAVRELTWNALSPDIEAAVLVPAKTLGEAAKANTDGS
FT                   EVRLSLGAGMGVGKDGLLGISGDGKRSTTRLLDAEFPKFRQLLPAEHTAVASADVAELT
FT                   EAIKLVALVADRGAQVRMEFADGMLRLSAGADDVGRAEEDIAVEFAGQPLTIAFNPTYL
FT                   IDGLASLHSERVSFGFTTPGKPALLRPASAEDRIVSGPGDQGPFAAVPTDYVYLLMPVR
FT                   LPG"
FT   gene            3303..4460
FT                   /gene="recF"
FT                   /locus_tag="MMAR_0003"
FT   CDS_pept        3303..4460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MMAR_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="the RecF protein is involved in DNA metabolism and
FT                   recombination; it is required for DNA replication and
FT                   normal SOS inducibility. RecF binds preferentially to
FT                   single-stranded, linear DNA. it also seems to bind ATP"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38474"
FT                   /db_xref="GOA:B2HI48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HI48"
FT                   /protein_id="ACC38474.1"
FT                   /translation="MYVRHLGLRDFRSWAHADLELGPGRTVFVGPNGFGKTNIIEALWY
FT                   SATLGSHRVGTDAPLIRAGADRAVISTIVVNDGRECAVDLEIAAGRANKARLNRSPVRS
FT                   TREVIGVLRAVLFAPEDLALVRGDPADRRRYLDDLATLRRPTIAGVRADYDKVLRQRTA
FT                   LLKSVSGARFRGDRGALDTLDVWDSRLAQHGAELMAARIDLVRLLAPEVEKAYQLLAPE
FT                   SRSAAIAYRASMDAFVAADDAAPDRVTLEEGLLAALAARRDAELERGVCLVGPHRDDLE
FT                   LRLGDQPAKGFASHGESWSMAVALRLAAFALLRADGSEPVLLLDDVFAELDAARRTALA
FT                   RVAESAEQVLVTAAVLEDIPSGWDARKVHIDLRDSADGRVSVVQS"
FT   gene            4457..5020
FT                   /locus_tag="MMAR_0004"
FT   CDS_pept        4457..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0004"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38475"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HI49"
FT                   /protein_id="ACC38475.1"
FT                   /translation="MSDDGEQPGPGDGAARDELSGMDLVRRTLAEARAAARARGQDPGR
FT                   GFAAGPAPRRVAGRRRSWSGPGPDTRDPQPLGKLTRDLAKKRGWSGHVAEGTVLGQWSR
FT                   VVGAQIADHATPTALNEGVLSVTAESTAWATQLRIMQSQLLAKIAAAVGNGVVTSLKIT
FT                   GPASPSWRKGPRHIAGRGPRDTYG"
FT   gene            5230..7308
FT                   /gene="gyrB"
FT                   /locus_tag="MMAR_0005"
FT   CDS_pept        5230..7308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MMAR_0005"
FT                   /product="DNA gyrase (subunit B) GyrB"
FT                   /note="DNA gyrase negatively supercoils closed circular
FT                   double-stranded DNA in an ATP-dependent manner and also
FT                   catalyzes the interconversion of other topological isomers
FT                   of double-stranded DNA rings, including catenanes and
FT                   knotted rings [catalytic activity: ATP-dependent breakage,
FT                   passage and rejoining of double-stranded DNA]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38476"
FT                   /db_xref="GOA:B2HI50"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI50"
FT                   /protein_id="ACC38476.1"
FT                   /translation="MTGPRASNPEENIRTVAAQKKKAQDEYGASAITVLEGLEAVRKRP
FT                   GMYIGSTGERGLHHLVWEVVDNSVDEAMAGYATQVNVRLLDDGSVEVADNGRGIPVAMH
FT                   ATGAPTVDVVMTQLHAGGKFGGENSGYNVSGGLHGVGVSVVNALSTRLEVDIKRDGYEW
FT                   SQFYDRAQPGTLKQGEATKKTGTTIRFWADPDIFETTEYDFETVARRLQEMAFLNKGLT
FT                   INLTDERVTPDEVVDDVVSDTAEAPKSAQEKAAESTAPHKVKSRTFHYPGGLVDFVKHI
FT                   NRTKSPIQQSIVDFEGKGSGHEVEIAMQWNGGYSESVHTFANTINTHEGGTHEEGFRSA
FT                   LTSVVNKYAKDKKLLKDKDPNLTGDDIREGLAAVISVRVAEPQFEGQTKTKLGNTEVKS
FT                   FVQKVCNEQLTHWFEANPSEAKTIVNKAVSSAQARLAARKARELVRRKSATDLGGLPGK
FT                   LADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNT
FT                   EVQAIITALGTGIHDEFDLSKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENG
FT                   HVFLAQPPLYKLKWQRTEPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDA
FT                   KELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV"
FT   gene            7348..9867
FT                   /gene="gyrA"
FT                   /locus_tag="MMAR_0006"
FT   CDS_pept        7348..9867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MMAR_0006"
FT                   /product="DNA gyrase (subunit A) GyrA"
FT                   /note="DNA gyrase negatively supercoils closed circular
FT                   double-stranded DNA in an ATP-dependent manner and also
FT                   catalyzes the interconversion of other topological isomers
FT                   of double-stranded DNA rings, including catenanes and
FT                   knotted rings [catalytic activity: ATP-dependent breakage,
FT                   passage and rejoining of double-stranded DNA]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38477"
FT                   /db_xref="GOA:B2HI51"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI51"
FT                   /protein_id="ACC38477.1"
FT                   /translation="MTDTTLPPGGEASDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMYDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQE
FT                   PTVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELAEAVFWCLENHDADEEATLAAVTE
FT                   RVKGPDFPTSGLIVGTQGISDAYKTGRGSIRMRGVVEIEEDSRGRTSLVITELPYQVNH
FT                   DNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVEIKRDAVAKVVLNNLYKHTQLQT
FT                   SFGANMLSIVDGVPRTLRLDQMIRYYVEHQLDVIIRRTTYRLRKANERAHILRGLVKAL
FT                   DALDEVIALIRASQTVDIARVGLIELLDIDEIQAQAILDMQLRRLAALERQRIVDDLAK
FT                   IEAEIADLEDILAKPERQRAIVRDELAEIVDKHGDDRRTRIIAADGEVSDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVRHFFVCSTHDWILFFTTQGR
FT                   VYRAKAYELPEALRTARGQHVANLLAFQPEERIAQVIQIKSYEDAPYLVLATQNGLVKK
FT                   SKLTDFDSNRSGGIVAINLRGEDELVGAVLCSSEEDLLLVSANGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNADDRLLSLNVVREGTYLLVATAGGYAKRTGIEEYPVQGRGGKGVLT
FT                   IMYDRRRGRLVGALIVDDDSELYAITSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDT
FT                   LLAIARNAEENADEAVAEATDTDESSN"
FT   gene            9951..10853
FT                   /locus_tag="MMAR_0007"
FT   CDS_pept        9951..10853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0007"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38478"
FT                   /db_xref="GOA:B2HI52"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI52"
FT                   /protein_id="ACC38478.1"
FT                   /translation="MTSPNDPGAPNMGDNFNGDAAVDRSGVHRAGTGPGRLPDPADSPP
FT                   WQRGAARPGNPGPRPPEQSGEGRVPGPTSAADARLSRFISGTSAPAGAPAPVKAPPPEA
FT                   EAPPVRGENLPAEAYASELPDLSGPAPRPVQRKPAPDRGADNSGAHPVAGAARSAAAEA
FT                   RESRESRFQVSSRRAARGPVRASMQIRRIDPWSTLKVSALLSVALFFIWMIAVAFLYLV
FT                   LGGMGVWAKLNSNVGDLLNNTSGSSAELVSSGTIFGGAVLIGLVNIVLMTAMATIAAFI
FT                   YNLATDLIGGIEVTLADRD"
FT   gene            10914..10990
FT                   /gene="ileT"
FT                   /locus_tag="MMAR_5487"
FT   tRNA            10914..10990
FT                   /gene="ileT"
FT                   /locus_tag="MMAR_5487"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            11151..11226
FT                   /gene="alaT"
FT                   /locus_tag="MMAR_5488"
FT   tRNA            11151..11226
FT                   /gene="alaT"
FT                   /locus_tag="MMAR_5488"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            11363..12199
FT                   /locus_tag="MMAR_0008"
FT   CDS_pept        11363..12199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38479"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI53"
FT                   /protein_id="ACC38479.1"
FT                   /translation="MDVNRPDYVLGHSDYELGRLGRQAMLLDATTREYLATAGLEPGMR
FT                   VLDVGSGPGDVAFLASELTMPGGEVVGTDRAAGAVSAASAAAAARGLSETVRFRLGDPA
FT                   DSSFERPFDAIVGRYVLTFQADPAAMLHRLSQHLVPGGIVAFHEPDWSAVRSSPPAPTH
FT                   DRCCHWIREALDRTHTSWDMADRLHNAFTGAGLPAPTLTMRTFIGAGRAAAVWLQALAD
FT                   LVETLLPTIQAQGVATATEVGIETLTQRLLEEVSDLGATVIGRSEVGAWTRTPRSG"
FT   gene            complement(12227..12988)
FT                   /locus_tag="MMAR_0009"
FT   CDS_pept        complement(12227..12988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0009"
FT                   /product="transcriptional regulator"
FT                   /note="transcription"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38480"
FT                   /db_xref="GOA:B2HI54"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI54"
FT                   /protein_id="ACC38480.1"
FT                   /translation="MDGLTVGQVAERFGITVRTLHHYDEIGLLIPSRRAASGYRVYTSA
FT                   DLTRLSQVIVYRRLELPLDEIARLLDEGNAVSHLVRQRERVMARLDEMKDLVEAIDQAL
FT                   EKAMTNTPMTDDDMRELFGDGFDDYRAETEQKWGETTEWKESQRRTRSYGKDEWVRIKA
FT                   EGQAVEKTLSDAFRAGLPADSEEAMNAAEQHRRHVNRWFYDCPPAFHRSLGDMYVSDPR
FT                   YIATYDESFGLPGLAAYCREAIHANANRTGG"
FT   gene            complement(13099..13527)
FT                   /locus_tag="MMAR_0010"
FT   CDS_pept        complement(13099..13527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38481"
FT                   /db_xref="GOA:B2HI55"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI55"
FT                   /protein_id="ACC38481.1"
FT                   /translation="MSEQAEARLTPRERLTRGLTHTAVGPVDVTRGVVGLGVHSAQSTA
FT                   SELRRRYRQGRLAREVAAAQEAIAQELAAAQEVVANLPQVIQEARRKQGRSKRPWVIAG
FT                   AVTVVVVAGGAVAFTVVRRSSQPEPSPRPPSVDVQPRP"
FT   gene            13692..14240
FT                   /gene="ppiA"
FT                   /locus_tag="MMAR_0011"
FT   CDS_pept        13692..14240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="MMAR_0011"
FT                   /product="peptidyl-prolyl cis-trans isomerase A, PpiA"
FT                   /note="ppiases accelerate the folding of proteins
FT                   [catalytic activity: cis-trans isomerization of proline
FT                   imidic peptide bonds in oligopeptides]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38482"
FT                   /db_xref="GOA:B2HI56"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI56"
FT                   /protein_id="ACC38482.1"
FT                   /translation="MADCDSVTNSPIQTATATLHTNRGDIKVALFGNHAPKTVANFVGL
FT                   AQGTKEYSTQNASGSTSGPFYDGAVFHRVIRGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGPTPHLNRRHTIFGEVSDPDSQRVVETIATTS
FT                   TDGSDRPTEPVVIESITIS"
FT   gene            complement(14251..14676)
FT                   /locus_tag="MMAR_0012"
FT   CDS_pept        complement(14251..14676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0012"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38483"
FT                   /db_xref="GOA:B2HI57"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI57"
FT                   /protein_id="ACC38483.1"
FT                   /translation="MQQTQWSPRTAGVAGCALAGVLMATAAVTVVTDPPGRILAGVAAL
FT                   GLILFAGGSWRARPKLAITREGLAIRGWLRTQLLRPASIKIIRINEFRRHARTVRLLEI
FT                   EADNDAMFVLSRWDLGTDPLDVLDALTAAGYAGRGKR"
FT   gene            complement(14832..15113)
FT                   /locus_tag="MMAR_0013"
FT   CDS_pept        complement(14832..15113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0013"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38484"
FT                   /db_xref="GOA:B2HI58"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HI58"
FT                   /protein_id="ACC38484.1"
FT                   /translation="MPKSKVRKKNDFTVKPVSRTPVKVKVGPSSVWFVALFIGLMLIGL
FT                   VWLMVFQLAAVGSQAPAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   gene            15242..15985
FT                   /locus_tag="MMAR_0014"
FT   CDS_pept        15242..15985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0014"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38485"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI59"
FT                   /protein_id="ACC38485.1"
FT                   /translation="MTDERRSPWRFGVPLVCLLAGLLLAATHGVSGGAEIRRSDAPRLV
FT                   DLVRQSQSSVNRLSAERDALTARIDANHLRSSDAALTAMLRRARELASEADMDPAHGPG
FT                   LVVTLNDAQRDANGRFPRDASPDDLVVHQQDIDAVLNAMWSAGAEAIQMQDQRIIANSV
FT                   VRCVGNTLLLNGRTYSPPYIITAIGDPAAMQAALEAAPLVVLYKQYVVRFGLGYREEAK
FT                   SDVNVAGYSEPVRMHYAQPLGPVGY"
FT   gene            16023..16709
FT                   /gene="trpG"
FT                   /locus_tag="MMAR_0015"
FT   CDS_pept        16023..16709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="MMAR_0015"
FT                   /product="anthranilate synthase component II TrpG"
FT                   /note="involved in biosynthesis of tryptophan (at the first
FT                   step). supposed tetramer of two-components I and
FT                   two-components II: component I TrpE) catalyzes the
FT                   formation of anthranilate using ammonia rather than
FT                   glutamine"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38486"
FT                   /db_xref="GOA:B2HI60"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI60"
FT                   /protein_id="ACC38486.1"
FT                   /translation="MPILVVDNYDSFVFNLVQYLGQLGVRAEVWRNDDPRLSDEAAIAA
FT                   QFDGVLLSPGPGTPERAGASVSLVRACAAARTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVYHTNVGVLQGLPDPFTATRYHSLTILPDSLPAELEATAHTRSGVIMGVRHTE
FT                   LPIHGVQFHPESILTEGGHRMLANWLAYCGWARDDTLVRRLENEVASAIRPHLPVEAGT
FT                   TDRTSA"
FT   gene            complement(16687..18567)
FT                   /gene="pknB"
FT                   /locus_tag="MMAR_0016"
FT   CDS_pept        complement(16687..18567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="MMAR_0016"
FT                   /product="serine/threonine-protein kinase B PknB"
FT                   /note="involved in signal transduction (via
FT                   phosphorylation). thought to regulate cell
FT                   division/differentiation. can phosphorylate the peptide
FT                   substrate myelin basic protein (MBP) [catalytic activity:
FT                   ATP + a protein = ADP + a phosphoprotein]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38487"
FT                   /db_xref="GOA:B2HI61"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI61"
FT                   /protein_id="ACC38487.1"
FT                   /translation="MTTPQHLSDRYELGDILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPSGPLPYIVMEYVNGVTLRDIV
FT                   HTDGPMAPTRAIEIIADACQALNFSHQNGIIHRDVKPANIMISTTNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEILTGEPPFTGDSPV
FT                   AVAYQHVREDPIPPSERHEGISAELDAVVLKALAKNPDNRYQTAAEMRADLVRVHNGES
FT                   PEAPKVLTGAERRSLTASSPSSPAAPRTDPLPRQTLDDTDRDRSTPSVGRWVAVVAVLA
FT                   VLTIVVTIAINTFGGNTRNVQVPNVRGQASADAIAALQNRGFKTRTLLKPDSTIPPDHV
FT                   IGTDPAANASVSAGDQITINVSTGPEQRELPDVSSMTYAEAVKKLTAAGFGRFKEAKSP
FT                   STPELMGKVIGTNPPANQTSAITNVITIIVGSGPATKQIPDVAGQSVEEAEQNLNVYGF
FT                   TKFSQASVDSPKPAGSVIATNPPAGTTVPIDSVIELQVSKGNQFVMPDLSGMFWTDAEP
FT                   RLRALGWTGSLDKGPDVDAGGSQHNRVVYQNPPAGAGVNRDGIVTLKFGQ"
FT   gene            complement(18564..19922)
FT                   /gene="pknA"
FT                   /locus_tag="MMAR_0017"
FT   CDS_pept        complement(18564..19922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="MMAR_0017"
FT                   /product="serine/threonine-protein kinase a PknA"
FT                   /note="involved in signal transduction (via
FT                   phosphorylation). thought to regulate morphological changes
FT                   associated with cell division/differentiation process.
FT                   phosphorylates at serine and threonine residues [catalytic
FT                   activity: ATP + a protein = ADP + a phosphoprotein]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38488"
FT                   /db_xref="GOA:B2HI62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI62"
FT                   /protein_id="ACC38488.1"
FT                   /translation="MSPRVGMTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLK
FT                   QEFSSDPEFIERFRAEARTTAMLNHPGIAAVHDYGESQMNGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGQDASPSSDVYSLGVVGYEAVSGKRPFTGDGA
FT                   LTVAMKHIKEPPPPLPAELPPNVRELIEITLVKNPGLRYRSGGPFADAVAAVRAGRRPP
FT                   RPSQSPPAGRAAPAAIPSSAPARIAPAPTTRTTTPRRTRPATGGHRPPPARRTFSSGQR
FT                   ALLWAAGVLGALAIIIAVLIVINSRADSQQQPPPPTVTQTTTAHQTPTGQGPRLNWTEG
FT                   KAIGNPGLQSNQPDLVDDAGRNRPIGNRGSATSWNVTVTPQHLAALARFEMQR"
FT   gene            complement(19919..21394)
FT                   /gene="pbpA"
FT                   /locus_tag="MMAR_0018"
FT   CDS_pept        complement(19919..21394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="MMAR_0018"
FT                   /product="penicillin-binding protein PbpA"
FT                   /note="involved in peptidoglycan synthesis (at the final
FT                   stages). cell wall formation; PbpA is supposed to be
FT                   responsible for the determination of the rod shape of the
FT                   cell. its synthesizes cross-linked peptidoglycan from lipid
FT                   intermediates"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38489"
FT                   /db_xref="GOA:B2HI63"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI63"
FT                   /protein_id="ACC38489.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDSRFRFLRVYPNPEVYAPVTGFYSLRYSSTGLERAE
FT                   DPLLNGSDQRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCGGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHDPEAQAEAWKDLRDDPSSPLTNRAISETYPPGS
FT                   TFKVITTAAALQAGATENDQLTAAANIPLPDSTATLENYGGAPCDSGQTVSLREAFAKS
FT                   CNTAFVQLGISTGAAALRSMAHAFGLDTPPSAIPLQVAESTVGPIPDAAALGMSSIGQK
FT                   DVALTPLQNAQIAATIANGGVVMRPYLVDSLKGPDLANISTTTPHQQRRAVSPQVAAKL
FT                   TELMVGAEQVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
FT   gene            complement(21391..22800)
FT                   /gene="rodA"
FT                   /locus_tag="MMAR_0019"
FT   CDS_pept        complement(21391..22800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="MMAR_0019"
FT                   /product="cell division protein RodA"
FT                   /note="this is a septum-peptidoglycan biosynthetic protein,
FT                   involved in cell wall formation. plays a role in the
FT                   stabilization of the FtsZ ring during cell division"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38490"
FT                   /db_xref="GOA:B2HI64"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI64"
FT                   /protein_id="ACC38490.1"
FT                   /translation="MTTQLQPPVTVTPPLPTRRNAELLLLCFAAVITIAALFIVEANQD
FT                   RAIHWDLASYGLAFLTLFGFAHLAIRRFAPFTDPLLLPVVALLNGLGLVMIHRLDLVDK
FT                   QIGHRAHPSANQQMLWTLVGVASFALVVTFLKDHRQLARYGYTCGLAGLVLLAIPAVLP
FT                   AALSEENGSKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLMGMTLPR
FT                   PRDLAPLLAAWVASVGVMVFEKDLGTSLLLYASFLVVLYLATQRFSWVIIGLTLFTAGS
FT                   VVAYFVFHHVRVRVQNWLDPFADPDGTGYQMVQALFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLAAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLASTLAIQL
FT                   FIVVGGVTKLIPLTGLTTPWMSYGGSSLLANYVLLAILARISHGARRPLRTRPRNTSSI
FT                   AAAGTEVIERV"
FT   gene            complement(22797..24356)
FT                   /gene="pstP"
FT                   /locus_tag="MMAR_0020"
FT   CDS_pept        complement(22797..24356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstP"
FT                   /locus_tag="MMAR_0020"
FT                   /product="serine/threonine phosphatase PstP"
FT                   /note="involved in regulation (using dephosphorylation of a
FT                   specific phosphorylated substrate)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38491"
FT                   /db_xref="GOA:B2HI65"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI65"
FT                   /protein_id="ACC38491.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLAKLDAAVRSGNSAIAAQVEMEPELEGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETIHEALQIPDVAESAYRLIELALRG
FT                   GGPDNVTVVVADVVDYEYGQTQPILAGAVSGDDDQLTLPNTAAGRASAITARKEAVKRV
FT                   PPQVETVHRPRWSWRRMALVATLVVLLVVAGLFISRAVIRNNYYVAEFNGTVSIMRGIQ
FT                   GSFLGMSLHEPYLMGCLNARNELSQISYQQSGEHLDCNLMKLDDLRPPERAQVQAGLPA
FT                   GSLDNAIGQLRELAANSLLPPCPAPRATSPPESSAPSTASETPGQPSVTSSPASTTPPT
FT                   PSASTTPTTTSGSTAATSTPPTGTSPAAPTSPTPTLTTSSPNVTALPPPPPQPGIDCRA
FT                   VA"
FT   gene            complement(24353..24820)
FT                   /locus_tag="MMAR_0021"
FT   CDS_pept        complement(24353..24820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0021"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38492"
FT                   /db_xref="GOA:B2HI66"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI66"
FT                   /protein_id="ACC38492.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWLFIWSVLRILRTDIYAPTGAVMVRRGL
FT                   ALRGTLLPSRQRGQSARYLVVTEGALTGARITLSGQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSQRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPMGTPVRIGKTAIELRP"
FT   gene            complement(24954..26594)
FT                   /locus_tag="MMAR_0022"
FT   CDS_pept        complement(24954..26594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0022"
FT                   /product="conserved protein"
FT                   /note="function unknown, contains FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38493"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI67"
FT                   /protein_id="ACC38493.1"
FT                   /translation="MGSQKGLVQRIERKLESTVGDAFARMFGGSIVPQEVEALLRREAA
FT                   DGVRSLPGNRLLAPNEYIITLSVHDAEELGADPHLTSSEFARYLADYIHEQGWQTYGDV
FT                   VVRFEQSSSLHTGQFRARGAVNPDVEPRPTVNDSAQPQSNDAFGAEPGVPPMTDNSSYR
FT                   GGQGQGRPDEYYDERYARPQEDPRGGPHGGPDPRGGYPPEAGGYPPQPGYPPPRPQDQG
FT                   GYPEQGGYPEQGGYPDQRGYQDQRGYQDQRGYPDQGGYPDQRGYPEQGGYPPSYEQRPP
FT                   APGGYGAQGYDQGYRQAGGYGQPPGGQPGYGGYGEYGREPARQDEGAYSAPAAPSAPPE
FT                   AQRPGYPDQGGGYDQGYQQGGAGYGRPEYGQGDYTQYADTSSPGGYPPQGAGYADPAGR
FT                   DYEYCQAAAPDYGQAPPDYGQAPSDYGQAPPEYGQPAGGGYGGYGQSGYGAAGSSVILQ
FT                   LDDGSGRTYQLRDGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTT
FT                   VNNAPVQEWQLADGDVIRLGHSEIIVRIH"
FT   gene            26889..26971
FT                   /gene="leuT"
FT                   /locus_tag="MMAR_5489"
FT   tRNA            26889..26971
FT                   /gene="leuT"
FT                   /locus_tag="MMAR_5489"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   misc_feature    27047..33095
FT                   /note="bacteriophage phiMmar01; MURD1; may be remnant
FT                   prophage or integrated plasmid locus"
FT   gene            27392..27772
FT                   /locus_tag="MMAR_0023"
FT   CDS_pept        27392..27772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0023"
FT                   /product="killer suppression protein"
FT                   /note="some domain conservation with a putative killer
FT                   suppression protein HigA, from Methylococcus capsulatus
FT                   str. Bath"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38494"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI68"
FT                   /protein_id="ACC38494.1"
FT                   /translation="MVGRDYLRGGSEQRGRFGGILIIVSFATPELRLLCEEPKVAKAKL
FT                   GDDVARLLRARLADLRSADGLLDLPTGNPRIDGDSYLLDLGSSATMRWEPYGRSAKPAE
FT                   NGLLDWGRVNRVKLVQIDRNTR"
FT   gene            27769..28845
FT                   /locus_tag="MMAR_0024"
FT   CDS_pept        27769..28845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0024"
FT                   /product="plasmid maintenance system antidote protein"
FT                   /note="antidote for potential plasmid segregant killing
FT                   system. maybe the partner for the toxin encoded by the
FT                   upstream gene"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38495"
FT                   /db_xref="GOA:B2HI69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI69"
FT                   /protein_id="ACC38495.1"
FT                   /translation="MNATGLSPRWASPPGETIAQAAADRGISHSELATRLGLAKQQLAE
FT                   LLVGSLPITLGLAETLSATVGASREFWISRDAQYHDDLRRVEADQWAQQFPISQMVEFG
FT                   WISQPADWHEQIDACLEYFQVEEPAGWETRYGQALCTARYRKSPTFDVDAAATSAWFRA
FT                   CEAQAEGQFTSGFFDADRFAKMVADLVSLTRIKDPARFIPQLTARCAEAGVVVVVVRPP
FT                   KGCPVSGVARTYRGRPLIQLSARNLSDDHFWFSFFHEAGHIVLHPHEEMYIDNFDEGLN
FT                   DDVEAEANAFAERQLFPAGVDVQGRLTSRAIVRAAQANGVSTGVVVGQLQYRGAIRQNQ
FT                   FNTLKRRYVWDGPNLGMK"
FT   gene            complement(28826..29764)
FT                   /locus_tag="MMAR_0025"
FT   CDS_pept        complement(28826..29764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38496"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI70"
FT                   /protein_id="ACC38496.1"
FT                   /translation="MPRPAVSPRDRVLAHRLRESLDDYAATVRPLPGIASSATKDTFIA
FT                   QLVDSDRRRRFTLHVATSDPHPKVLGEPLSAFDPHYAAVRCVRDGDFDEACWLVFLATH
FT                   FGFHRHNRWALSGNFYRRLDAGQPWTWETVSAQPAALRAWLDSNRTALRSAGGPFGNHR
FT                   KYESLAGNTQTGTGEAIESYVEWVGSSHRAHFDDLCAARSAQKSFAAAYASMADVARFG
FT                   RTARFDYLTMLGKLGIVDLLPDKLYLQGSTGPLNAARLLVSGSTGAKTSAAELEDYLYD
FT                   LGDHLGVTFDILEDGLCNWQKSPSRFISFRG"
FT   gene            complement(29745..30536)
FT                   /locus_tag="MMAR_0026"
FT   CDS_pept        complement(29745..30536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38497"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI71"
FT                   /protein_id="ACC38497.1"
FT                   /translation="MYSPLVRLIDQATMFAPSDYILDWASPVPFFGDVDQAQVATVGIN
FT                   PSNREFVDVAGQELRGSERRLSTLASLGLPRWSQVTGRHLSEIRRSCARYFKINPYRRW
FT                   FDVLDRTLRAGQFSYYDGSACHLDLVALATRDKWGTIDMRTRQNLINDGKSVLAQIIRD
FT                   SSVTTLILNGRSVVTEFAALASVQLAAQPIDSWALPRKNGGDVNGYLFTGTICALGDVD
FT                   LGRQVSVYGYNHNLQSSFGVTSTVIDRIGLRLGDLVAASSR"
FT   gene            complement(30550..31500)
FT                   /gene="thyA_1"
FT                   /locus_tag="MMAR_0027"
FT   CDS_pept        complement(30550..31500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA_1"
FT                   /locus_tag="MMAR_0027"
FT                   /product="thymidylate synthase, ThyA_1"
FT                   /note="involved in deoxyribonucleotide biosynthesis.
FT                   provides the sole de novo source of dTMP for dana
FT                   biosynthesis [catalytic activity: 5,10-
FT                   methylenetetrahydrofolate + dump = dihydrofolate + dTMP]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38498"
FT                   /db_xref="GOA:B2HI72"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI72"
FT                   /protein_id="ACC38498.1"
FT                   /translation="MALAFSAGTVDDLLREAYTAIREQGQPVLPTRAPTRELIGVSLEL
FT                   TEPRCRLSRTEARRLSRTGIAQLAWYLSGTTNPEMILHWVPNHRNELEADGTIHGAYGP
FT                   RMFGTGDNAQFCTVLELLKTSSSSRRAVIQLFDATDLTGPGRYKDVPCTNTLQFFVRDS
FT                   RLHLMVTMRSNDAYIGLPLDVFAFTMLQELMAGELGIGIGRYIHSVGSLHIYEYNKEAI
FT                   IDFLAEGWQSTDTPMPAMPAQSLTRHVPQFLASELQIRSGTPFADLTLPSDPYWADLAR
FT                   MLALDSARGRKAHDEVAAVKESIAAPFFSEFLRRD"
FT   gene            complement(31578..31934)
FT                   /locus_tag="MMAR_0028"
FT   CDS_pept        complement(31578..31934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38499"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI73"
FT                   /protein_id="ACC38499.1"
FT                   /translation="MTVYVDDMRMLATVGRFYARWSHLTADTEEELHEFAARLGLPRRT
FT                   AQFPGTWKSHYDVTDFTRDRAMELGAVAIGYKSTEAVALLRRKRALQPPSIQLGLPLDI
FT                   SPQRPDPQPGTAGM"
FT   gene            complement(31934..32410)
FT                   /locus_tag="MMAR_0029"
FT   CDS_pept        complement(31934..32410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38500"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI74"
FT                   /protein_id="ACC38500.1"
FT                   /translation="MEAGILKREITPNGPQAGRPTTSVPAAARLLGIDVRTVRARIARG
FT                   ELAGGAVAKNRRLRWFVYSDALLTDVGYNDDQRADAGQSSIKKAASLLLQAHAELQAGL
FT                   GRDSKGIDHLGRARAELIAHKKAVTKSFDHLQAALALIDDWPSDQGHNGENGTP"
FT   gene            complement(33374..34174)
FT                   /locus_tag="MMAR_0030"
FT   CDS_pept        complement(33374..34174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0030"
FT                   /product="shortchain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38501"
FT                   /db_xref="GOA:B2HI75"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI75"
FT                   /protein_id="ACC38501.1"
FT                   /translation="MAVIGKRRAYRVRVESATFLIVGGSSGIGRSVAERAARRGATVAV
FT                   TARRTDRLASLAATIAEMGGSCSIHPADATDPVAAQSVVADVLERHGKIDVVLLNAGGA
FT                   PALDLTRLDAADITSVMDANYDVAVNYLVPVLRHMTERGTGVIAHTNSLAGWYAVPLQG
FT                   PYSAAKAALRVLFDAYRIEYAGSGVRFVSIYPGFVATEATEGDGMPAPGEISEQEAADH
FT                   VLRALSSGRESYSFPRAMSTLVGLGRLLPTTLRRKVIKKVVTSA"
FT   gene            34328..35080
FT                   /locus_tag="MMAR_0031"
FT   CDS_pept        34328..35080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38502"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI76"
FT                   /protein_id="ACC38502.1"
FT                   /translation="MIVLLPPSETKRGGGDGPPLRLEELANPGLGALRAALVGELVDLA
FT                   ADPPACRSALGVSPSQDAEIERNAALRTAPTLPALRRYTGVLYDALDVDSLRGAEAKRA
FT                   RARLAIGSALFGLLRADDQVPAYRLSATSKLPAKPTLAARWKPLLEPLLAELAAQDLIV
FT                   DLRSGSYVALGPTSGAIHVKVLAEHPDGRRTVVTHFNKAYKGRLARILASTRAEPADAA
FT                   AVAAVARRAGMQVERSGNELTLVVAAGG"
FT   gene            complement(35105..36100)
FT                   /locus_tag="MMAR_0032"
FT   CDS_pept        complement(35105..36100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38503"
FT                   /db_xref="GOA:B2HI77"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI77"
FT                   /protein_id="ACC38503.1"
FT                   /translation="MLAAVHRWSKCRRARRLAFAALAVLCVGLVASCGLRSATGAVLEA
FT                   KPGLIRHYQSLEGVPITVAAKDFTEQLILGNMLSIVLHAAGARVTNLSNTPGSFGVRRA
FT                   LLTGEANIAPEYTGTGWINYLGHENPIKGAKQQWEAVNAADQVNGLTWLPPAPMNNTYT
FT                   LAIRESEAERLGVTKLSDLKRLPRSALTFCIESEFASRNDGFVPMLHAYGLDLEDLAKI
FT                   TTLDTGVVYSATAQGECNFGEVFTTDGRIPALHLRLLEDDKHFFPLYNLTEVVDTSLIN
FT                   DHPELREIFAQLNPRLTNDTMRELNAQVDNNGRDPAIVAKDWLLQQKLLT"
FT   gene            complement(36106..36915)
FT                   /locus_tag="MMAR_0033"
FT   CDS_pept        complement(36106..36915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0033"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38504"
FT                   /db_xref="GOA:B2HI78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI78"
FT                   /protein_id="ACC38504.1"
FT                   /translation="MSVAGNDINVEGAVKGGAEGPPTAPTTPGRPSVGRWALQPLTCAF
FT                   AVAGALAYVTVADVSESERRSLSVSHLLQLLREHLVISLSATVLTCVVAIPVGIALTRG
FT                   SMRRYSKPIITVAGFGQAAPAIGLIALGAVVFGIGQLGAIVALTVYGAMPIIANTVTGL
FT                   DGVDRRIVEAARGMGLSAFSTLRRVELPLSLPVIVAGVRTALVLIVGTAALASFTGGGG
FT                   LGQLITTGIKLQQPVTLIVGAILVAALALFIDWLARLIEMVAAPRGL"
FT   gene            complement(36912..38111)
FT                   /gene="proV_1"
FT                   /locus_tag="MMAR_0034"
FT   CDS_pept        complement(36912..38111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proV_1"
FT                   /locus_tag="MMAR_0034"
FT                   /product="osmoprotectant (glycine
FT                   betaine/carnitine/choline/L-proline) transport ATP-binding
FT                   protein ABC transporter ProV_1"
FT                   /note="thought to be involved in active transport of
FT                   osmoprotectant (glycine betaine/carnitine/choline/L-
FT                   proline) across the membrane (import). responsible for
FT                   energy coupling to the transport system"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38505"
FT                   /db_xref="GOA:B2HI79"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI79"
FT                   /protein_id="ACC38505.1"
FT                   /translation="MPEAASADQPTTSDAPQSSGLRILLDGVTKRYGVRSTPAVDNVTL
FT                   EIGAGEIVMLVGPSGCGKTTTMKMINRLIEPTSGRIFIGDDDVTRRNPDELRRHIGYVV
FT                   QGAGLFPHLTVGDNIGIVPRLLKWDKNRVAARIDELLDLVNLDPAQYRDRFPRELSGGQ
FT                   QQRVGVARALAADPPVLLMDEPFGAVDPITRQRLQDELLRLQEELHKTIVFVTHDFGEA
FT                   VKLGDRIAILTTGSKVVQYDTPERILAEPANDFVRGFVGAGATLMQLSLTRVRDIDLHE
FT                   AVVAQAGGDPAEAVELAGSLDREHAIVLDRQNRPLRWLPLEELAKPQALAQVTRDDDLE
FT                   CVNLASTLNDALDEMLTSSHGVVVVTGRRNTYQGVIRVETIMEAIADIRGAANSEEPDT
FT                   "
FT   gene            complement(38104..38772)
FT                   /locus_tag="MMAR_0035"
FT   CDS_pept        complement(38104..38772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0035"
FT                   /product="ABC transporter permease"
FT                   /note="maybe involved in active transport of osmoprotectant
FT                   (glycine betaine/carnitine/choline/L- proline) across the
FT                   membrane (import). responsible for the translocation of the
FT                   substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38506"
FT                   /db_xref="GOA:B2HI80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI80"
FT                   /protein_id="ACC38506.1"
FT                   /translation="MEAATEFMGLYDFVVDRWSVLWFLAYQHISLVGQTLILATAIALI
FT                   LGVLIYNSPLGVAAGNAVTAVGLTIPSYALLGVLVGIVGLGVLPSVIMLTFFGVFPILR
FT                   NVVVGLTGVDKGLVESARGMGMSRLTTLVRLELPLAWPVIMTGVRVSAQMLMGIAAIVA
FT                   FALGPGLGGYIFSGISRMGGANATNSIVAATIGILILAVILDTVLNLIARLTTPRGIRA
FT                   "
FT   gene            39071..39478
FT                   /locus_tag="MMAR_0036"
FT   CDS_pept        39071..39478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0036"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38507"
FT                   /db_xref="GOA:B2HI81"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI81"
FT                   /protein_id="ACC38507.1"
FT                   /translation="MRGTGRIVRFDDVRGYGFIAPDSGGEDVFLHANDLDFDRLLAKRG
FT                   TRVSFDIEDGPRGKFATAVLITSEGSGRAGAGSKAAASDTDEYFDVFSAQEFKEAATEI
FT                   LLEATPSITGEQIVRIRAAFEGFARKHGWIE"
FT   gene            complement(39580..40539)
FT                   /locus_tag="MMAR_0037"
FT   CDS_pept        complement(39580..40539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38508"
FT                   /db_xref="GOA:B2HI82"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR028536"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI82"
FT                   /protein_id="ACC38508.1"
FT                   /translation="MTSFLWDQHTCLPLQTDTSVEPLIRYHGQDMAVLVSVNAGYSPHS
FT                   FRDTTALLDHYRAAISAHPDLELAAGVGDVATITRGGRIAVVFDLEDSRPLDDDLDNLA
FT                   TLADLGVRTLLPTYNHANRAGSGCLDSTDAGLTGWGRAIVAEMNDVGIVPDGSHCSTRT
FT                   GLDMCEVSTGPVVYSHSCMRAVWDHPRNITDDQARACAATGGVIGITGVGIFLGPNTPT
FT                   LDAMTRHLEYAVDLVGIDHVGISSDFSFDLADFYDELARNPDLFDESYTRWGPIQWMAP
FT                   ETLLTLGAHLADRGWAGDHINAVLGANFYRVAQRVWPT"
FT   gene            40669..41982
FT                   /gene="amt_1"
FT                   /locus_tag="MMAR_0038"
FT   CDS_pept        40669..41982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt_1"
FT                   /locus_tag="MMAR_0038"
FT                   /product="ammonium-transport integral membrane protein,
FT                   Amt_1"
FT                   /note="thought to be involved in transport of ammonium
FT                   across the membrane (export). responsible for the
FT                   translocation of the substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38509"
FT                   /db_xref="GOA:B2HI83"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI83"
FT                   /protein_id="ACC38509.1"
FT                   /translation="MDIDPAATAWLLASTALVLLMTPGLAIFYGGMVRTTGVLNMIMMS
FT                   FISIPLVTVAWLLAGYSLAFSDGAAPGFPGGLVGGLTHAGMRGIGPATVHGSVPELLFA
FT                   TFQLSFAIITAALVSGAIADRAKFAAWMVFVPVWSIAVYSVVAHWVWSPSGWLAKMGVL
FT                   DYAGGLVVEIVSGSSALALALVLGPRIGFKVDPMRPHNLPFVLLGVGLLWFGWFGFNAG
FT                   SALAANGLASAIFLNTLVAGCLGMLGWLSVEQIRDGKPTTFGAASGVVAGLVAITPSCG
FT                   TVNTLGAALVGLAAGIVCAFAITVKFKLNYDDSLDVVGVHFIGGVVGVLLIGLLATAVM
FT                   TDGARGLFYGGGLGQLGKQALAMVVVALYAFTVSYLLAALIERLMGFRVSREEEVSGVD
FT                   LSQHAETAYTEGVYGHQQLHRPFSGGDAIRPRPNIEDA"
FT   gene            complement(41992..42291)
FT                   /locus_tag="MMAR_0039"
FT   CDS_pept        complement(41992..42291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38510"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI84"
FT                   /protein_id="ACC38510.1"
FT                   /translation="MTADRTGAQTTITAEAGKYTIAVEGKTVGLATYIDRGNQRVFDHT
FT                   EVDPAFGGRGLATILVEEALQDARAAGKRIVPVCSMVVTVLDKHPEYDEITDPV"
FT   gene            complement(42288..43256)
FT                   /locus_tag="MMAR_0040"
FT   CDS_pept        complement(42288..43256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-term truncated by frame-shift mutation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38511"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI85"
FT                   /protein_id="ACC38511.1"
FT                   /translation="MSNLETAPAEVACCAAQGAGIEVLHPREVPLGGPRAIRVQRTLPQ
FT                   RQRSLIGAWCFVDHYGPVSAHMDVAPHPHTGLQTVSWLFGGEVEHRDSAGVHARIRPGE
FT                   LNLMTAGAGICHSEVSVGSGVLHGAQLWVALPDSARDTGRDFAHYAPAPAVLPGARARV
FT                   FIGELAGLRSPVHTFTPLLGAQLDLDAHAELDIEVDPTFEHGVLCDAGDLELAGTALAA
FT                   GDLGYQGPGNTTLHVRNIGAQPARLLLLGGTPFAEELVMWWNFVGRNHDEIVSYRQLWQ
FT                   DADARFGEVVGYQGSVTRLPAPPLPTTRLLPRPLPNREDHR"
FT   gene            complement(43370..43786)
FT                   /gene="whiB5"
FT                   /locus_tag="MMAR_0041"
FT   CDS_pept        complement(43370..43786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB5"
FT                   /locus_tag="MMAR_0041"
FT                   /product="transcriptional regulatory protein (Whib-like),
FT                   WhiB5"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38512"
FT                   /db_xref="GOA:B2HI86"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI86"
FT                   /protein_id="ACC38512.1"
FT                   /translation="MSNPCATNPELWFGYPDDDSGDGAAKARAYERSATEARIQCLRRC
FT                   PLAQQRLCAERAVKHREEYGVWAGVKLPGGQYRKRGQLAEAHDVLRRIAAGEINARQLP
FT                   ENTALLARNERDAVPVTAVVWHLPVTQVGPQTAA"
FT   gene            43930..44721
FT                   /locus_tag="MMAR_0042"
FT   CDS_pept        43930..44721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0042"
FT                   /product="transcriptional regulatory protein"
FT                   /note="maybe involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38513"
FT                   /db_xref="GOA:B2HI87"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI87"
FT                   /protein_id="ACC38513.1"
FT                   /translation="MSRESAGAAIRALRESHDWSLADLAAATGVSIMGLSYLERGARKP
FT                   HKGTVQKVENGLGLPPGTYSRLLVAADPEAELARLLAARPTETASPRRPGVVVVDRHSD
FT                   TDVLEGYAEAQLDALRSVIDRLPASTSNEYETYILSVVAQCVKAEMLAASSWRVAVNAG
FT                   SESSARLMEHLQALEATRTALLERMPASLSARFDRACAQSQLPDAVIAALIGVDSDELW
FT                   DIRNRGVIPPGALPRIRAFVDGSTESSQQQDPGCDDGEGQR"
FT   gene            44718..45545
FT                   /locus_tag="MMAR_0043"
FT   CDS_pept        44718..45545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0043"
FT                   /product="secreted protein P60-related protein"
FT                   /note="function unknown. the P60 protein is a major
FT                   extracellular protein may be involved in the invasion of
FT                   host cells"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38514"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI88"
FT                   /protein_id="ACC38514.1"
FT                   /translation="MIPTEVDALLRAHQMFVGTGDHRMPDVRPQPGAEPLRRATLPNPA
FT                   TDQPRYGFRAARGREVLAAATRTDAAVAAVIADAHRDREQARELTGNVVNQARADGVAP
FT                   PVTPLAQREAIRRRVGRLRAQRAHVLWAHRRARRRLAALRLLRYRMLHHHGSRQRLSPI
FT                   SGRAGIAVRAALSRLGRPYVWGATGPDRFDCSGLVQWAYAQAGVHLDRTTYQQINDGIV
FT                   VSRSHIRPGDLVFPHPGHVQLAIGNNLVVEAPHAGASVRISPLGNHVQIRRPL"
FT   gene            45542..45922
FT                   /locus_tag="MMAR_0044"
FT   CDS_pept        45542..45922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38515"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI89"
FT                   /protein_id="ACC38515.1"
FT                   /translation="MNGGEPRAEQAGSALAAIRARQAELARQHDVLGEADRALAEALTR
FT                   AHTVMRDSVRRLDAIGAEIDGAVAGQDSLALDTPLGAREFQNFLLAKQREIATIVATAH
FT                   ELDRTKSAVLASLRAHYGESAG"
FT   gene            45997..47250
FT                   /locus_tag="MMAR_0045"
FT   CDS_pept        45997..47250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38516"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI90"
FT                   /protein_id="ACC38516.1"
FT                   /translation="MGGSEQRAQSGAARGAAADAIAGAEVALAHQNSMSSQLDLQVIAA
FT                   ILNAHLTAVDGSEALDELQQETEAAVRTRSDLDTPAGARDFQRFLIGKLRDIREVVATA
FT                   SLDDTSKATLMAAWTSLYNASKQEASSPGDVPTATEPAAGTGADAVRAAGLTSGDPLLD
FT                   SLLFDDPGLVAEAPLPQGAAPSGAATAPALPSMPSLGDGSGAATPSGAGSVPNLPAGPA
FT                   LSAIPRAIASRLDELDDPSLDSLALDPDDSDDEPADLDEDTDGGGEDTEQPASSGEPQP
FT                   LPTGPTTVTLPNGDTITAASPELAAAINATAGGAAIADAFQQQGIAIPPPGTPVSDPID
FT                   PARLAAGDIGMFTDRHALALGDGNAFLDGQMQQVSSIGGPNFLGWQHPPTSTTVTAPAQ
FT                   TGAPTPTRPATTPVAPRY"
FT   gene            47293..47610
FT                   /locus_tag="MMAR_0046"
FT   CDS_pept        47293..47610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38517"
FT                   /db_xref="GOA:B2HI91"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI91"
FT                   /protein_id="ACC38517.1"
FT                   /translation="MADRIHVEPAHLREAAAHHEQTSEYLRSVPSSHAAIQESLNSLGP
FT                   IFSELRDAGRDLLELRRQCYEQQADDHADIAQNLRTSAAVWDQHEQDAAHDFGGIVDNG
FT                   R"
FT   gene            47607..47912
FT                   /locus_tag="MMAR_0047"
FT   CDS_pept        47607..47912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38518"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI92"
FT                   /protein_id="ACC38518.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVALSEGAMETDAVALA
FT                   EGILLTADVSCLKALLEVREEIVAAGHTPSAEVPTNRDLDVAIERLLAHQLRPRRR"
FT   gene            48140..49246
FT                   /locus_tag="MMAR_0048"
FT   CDS_pept        48140..49246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38519"
FT                   /db_xref="InterPro:IPR040604"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI93"
FT                   /protein_id="ACC38519.1"
FT                   /translation="MAIFGRRTARQRLRKAAQESLAIPAFSSPPDCTPWVIGGLWPTEL
FT                   SRDAPETATLAEYLEADLQRIADSANEELASLRHAVMLDSDRRAAEARVIDDARARAVQ
FT                   RVESARNQLREGASTEPPVAPPDVADPNAAEPGSQPQPPTAGRPDAVDAARAAARAPAP
FT                   AVPESDDQRLRRLLMFVARQEPRLNWAIGQRPEGTVLVTDVAHGWIPPGIALPQGVRLL
FT                   PPKRRSGRLAALVDAATGLLSYSPGDPLPWADEDTATRSSVRPRELPMADNVARELCDA
FT                   TRSRVGLPRRAHVLAKAADAGTAVVEDEIDLLRVHLDTARHEVVAHYPSIDGEVLLNCM
FT                   LLAATASSVSGDAVTANYHLAWFRELNA"
FT   gene            49334..49654
FT                   /locus_tag="MMAR_0049"
FT   CDS_pept        49334..49654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38520"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI94"
FT                   /protein_id="ACC38520.1"
FT                   /translation="MVSGPGGRAELSDKDLVESVLRELSEAADKWEALVAQAENVTYSV
FT                   DLGDVHAVANSDGRLLKLTLHPGVMTGYSHGELADRLNVALAALRAEAEAENEARYGGP
FT                   LQ"
FT   gene            49704..50027
FT                   /locus_tag="MMAR_0050"
FT   CDS_pept        49704..50027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0050"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38521"
FT                   /db_xref="GOA:B2HI95"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI95"
FT                   /protein_id="ACC38521.1"
FT                   /translation="MARLDFLHHSLFRIIGAASGLDWWTMTWLTIAKVALVGFLVMGSG
FT                   VLLFTFVRKARRGVRPPTSDPNASSYLNAVFGGAPPTPLPQWAHHDEAFDEDPEGGDSR
FT                   HGA"
FT   gene            complement(50055..50828)
FT                   /locus_tag="MMAR_0051"
FT   CDS_pept        complement(50055..50828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38522"
FT                   /db_xref="GOA:B2HI96"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI96"
FT                   /protein_id="ACC38522.1"
FT                   /translation="MAGPGPIVADLEAESDDLDALVAPLPPQRWSELTPAPGWSIAHQI
FT                   AHLLWTDRVALTAVTDEAGFADVLTAAAANPAGFVDEGAEELAALPPAELLSDWRLTRG
FT                   RLHEALLNVADGRKLPWFGPPMSAASMATARLMETWAHGLDVADALGVTRPATDRLRSI
FT                   AHLGVRTRDYAYFVNNLAPPTEQFLVELRGPGGDIWSWGPADAAQRVTGPAEDFCFLVT
FT                   QRRPLSSLHLTATGEDARQWLQIAQAFAGPPGEGR"
FT   gene            complement(50831..52123)
FT                   /locus_tag="MMAR_0052"
FT   CDS_pept        complement(50831..52123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0052"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38523"
FT                   /db_xref="GOA:B2HI97"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI97"
FT                   /protein_id="ACC38523.1"
FT                   /translation="MHASAPVELWRSVRSLPDFWRLLQVRIASQFGDGLFQAGLAGALL
FT                   FNPDRAADPMAIARAFAVLFLPYSLLGPFAGALMDRWDRRLVIVGANIGRLILIAGIGT
FT                   ILAFEAGDLLLLFVALLANGLARFVASGLSASLPHVVPREQVVTMNSVATASGAVAAFV
FT                   GANFMLLPRWLAGGGDHGAAAVIFTAMIPVAISLLLALRFAPRVLGPDDTKRAIHGSAV
FT                   YAVITGWMHGVRTVVQLPTVAAALSGLAAHRMVVGVNSLLILLLVHHMRDVDVEGLGTA
FT                   LLFFAATGLGAFLANVLTPGLIRRWGRYATTNGALAAAAVIQLAGAGLLLPVMVVCGFL
FT                   LGVAGQVVKLCADSAMQIDVDDALRGHVFAVQDALFWVSYIVSVTVAAALIPDDGRAPV
FT                   FVLVGSVIYLIGLCVHSIVGRRSSAANVEGG"
FT   gene            52283..52888
FT                   /locus_tag="MMAR_0053"
FT   CDS_pept        52283..52888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38524"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HI98"
FT                   /protein_id="ACC38524.1"
FT                   /translation="MAPQEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEH
FT                   NDGGTLGVVLNRPSETAVHNVLPQWAKLAAKPKTMFIGGPVKRDAALCLATLRVGADPG
FT                   GVSGLRHVAGRIVMVDLDADPDLIAPLVEGVRIFAGYSGWTIGQLEGEIERDDWIVLSA
FT                   LPSDVLVPPRADLWGRTLRRQPWPLSLLATHPIDVSRN"
FT   gene            complement(52875..53882)
FT                   /locus_tag="MMAR_0054"
FT   CDS_pept        complement(52875..53882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0054"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38525"
FT                   /db_xref="GOA:B2HI99"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2HI99"
FT                   /protein_id="ACC38525.1"
FT                   /translation="MLLMVLGGVLAAVLLPARGAASDAVIVAARVAVSVLFFLYGGKLS
FT                   LEQAWHGLRQWRLHALVLITTFLIFPILGLAIRALVRSWMDEELHSGLLFMCLVSSTMQ
FT                   SAILFTSIARGHVSAAIVSASLSNILGVLLAPILVLFLMDIGGGSQAEESALADFVLQL
FT                   FVPFVLGQLARRWIGALNARHPGLMRWIDRAAILLLVYAAYSLGVATGGWTKVEAWHLV
FT                   AVVALDALLLALALGITTALGRAAHLNRDNSVVLMFCGSQKSLVSGLPMAMVMFPEAIS
FT                   GVVMLPLMIYHQLQLVVGAVIASKLGRKVVDQADSAALPAVAEPDERGESLSSG"
FT   gene            complement(53923..54273)
FT                   /locus_tag="MMAR_0055"
FT   CDS_pept        complement(53923..54273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0055"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38526"
FT                   /db_xref="GOA:B2HIA0"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA0"
FT                   /protein_id="ACC38526.1"
FT                   /translation="MMIAGVLCMCAAAASALFGAWSLARADVTDSTQLALRAMAPTQLA
FT                   AAVMLSAGGVVALAASPHTALVVLIVCVAGALGTLAAGSWQSARFALSRVDTIPDEASC
FT                   SGSCAGCTLSCH"
FT   gene            complement(54358..55491)
FT                   /gene="mtc28"
FT                   /locus_tag="MMAR_0056"
FT   CDS_pept        complement(54358..55491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtc28"
FT                   /locus_tag="MMAR_0056"
FT                   /product="secreted proline rich protein Mtc28"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38527"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA1"
FT                   /protein_id="ACC38527.1"
FT                   /translation="MIHIARTWRGFAGCMAAGFVGVTLIASGTASADPLYPQPPSPAPA
FT                   PAQAAVPPVQNLNASPGSITNRFAPVPAQVPAPMQVPAATAAPVPAAIPATGQMPAAGQ
FT                   VPAAGQLPVAAPVAPAITPAVTGTVRDYLNGKGVKLEAQRPQGFNALEITLPMPPRWTP
FT                   VPDPNVPDAFAVIADRVGGNSVYTSNAQVVVYKLVGDLDPAEAISHGFVDSQNLLAWRT
FT                   TNASMAEFGGFPSSVIEGTYRENDMTLNTSRRHVIAASGSENYLVSLSVTTAQSQAVAD
FT                   APATDAIINGFRVAAPTAAGHTPARAGAPAAVAPQTPARAASPAAPAQAPVSIPHHPAA
FT                   ATAPAQAPVPNLTPALQAVPGQVAAAPPVAAAPAPSR"
FT   gene            55690..58620
FT                   /gene="leuS"
FT                   /locus_tag="MMAR_0057"
FT   CDS_pept        55690..58620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MMAR_0057"
FT                   /product="leucyl-tRNA synthetase LeuS"
FT                   /note="involved in translation mechanism [catalytic
FT                   activity: ATP + L-leucine + tRNA(leu) = AMP + diphosphate +
FT                   L-leucyl-tRNA(leu)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38528"
FT                   /db_xref="GOA:B2HIA2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HIA2"
FT                   /protein_id="ACC38528.1"
FT                   /translation="MTESPTTTPGSTSGAPSGVPSGVNDAESDAPRHRYTAELAAGVER
FT                   TWQQNWARLGTFNVPNPVGSLAPSDGSPVPEDKLFVQDMFPYPSGEGLHVGHPLGYIAT
FT                   DVFARYHRMKGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEANVVNFRRQLGRLGLG
FT                   HDSRRSFSTTDVEFYKWTQWIFLQIYNAWFDAAANKARPISELVAEFDSGARSLVDGRD
FT                   WSTLSAGERADVIDDHRLVYRADSMVNWCPGLGTVLANEEVTSDGRSDRGNFPVFRKRL
FT                   RQWMMRITAYSDRLLDDLDVLDWPDQVKTMQRNWIGRSTGASALFTATRSNGETVGLEV
FT                   FTTRPDTLFGATYLVLAPEHDLVDDLVGAGWPAGVDPLWTGGGATPAEAVAAYRRAIAA
FT                   KSDLERQESKEKTGVFLGSHAINPATGQPVPIFIADYVLAGYGTGAIMAVPGHDQRDWD
FT                   FARALGLPVVEVIAGGDISQAAYTGDGVLVNSGFLDGMSVGEAKQAITARLESDGHGQA
FT                   RIEFKLRDWLFARQRYWGEPFPIVYDADGRPHALDESALPVELPDVPDYSPVLFDPDDA
FT                   NSEPSPPLGKATEWVHVELDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNADRFCA
FT                   KENETYWMGPRPAEHGPDDPGGVDLYVGGAEHAVLHLLYARFWHKVLYDLGHVSSREPY
FT                   RKLINQGYIQAFAYTDARGSYVPAEEVIERDGGFVYPGADGEIEVFQEFGKIGKSLKNS
FT                   ISPDEICDDYGADTLRVYEMSMGPIEASRPWATKDVIGAYRFLQRVWRLVIDENTGEIL
FT                   VADTPAELDTDTLRALHRAIAGVAEDYAALRNNTAVAKLIEYTNFLTKRHRDAVPRAAI
FT                   EPLVLMVAPLAPHLAEELWQRLGHTTSLAHGPFPAADPAYLIDDTVEYPVQVNGKVRGR
FT                   VVVAADADDDAVKAAALADEKVQAFLAGASPRKVIVVAGRLVNLVV"
FT   gene            complement(58650..59315)
FT                   /locus_tag="MMAR_0058"
FT   CDS_pept        complement(58650..59315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0058"
FT                   /product="short-chain type oxidoreductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38529"
FT                   /db_xref="GOA:B2HIA3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA3"
FT                   /protein_id="ACC38529.1"
FT                   /translation="MPTALITGASRGIGAAIAAALAPTHTLLLAGRPSSQLDAVADQFG
FT                   ATTFPLDLTDDESIETSCEIVDELDVLIHNAGLSIPGHFGDSHVDEWRATFNVNLFGAV
FT                   ALTLALLPALRSARGQVVFINSGAGRNVSAGMASYSASKFALRAFADSLRTDEPTLRVT
FT                   TVYPGRTDTDMQRELVDFEGGTYDPARFMRADTVAAVVANVVATPPDGHVHEVVIRPR"
FT   gene            complement(59356..59859)
FT                   /locus_tag="MMAR_0059"
FT   CDS_pept        complement(59356..59859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0059"
FT                   /product="transcriptional regulatory protein"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38530"
FT                   /db_xref="GOA:B2HIA4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA4"
FT                   /protein_id="ACC38530.1"
FT                   /translation="MADSESTAPEVTELAEGLHRALSKLFSILRRGDPNGVVAGELTLA
FT                   QLSILVTLLDRGPIRMTDLAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDI
FT                   TPQGRSVHAESLANRHAALAAMLDQLPHSDLETLMTALTPLERLACGEPANAPEDDAAT
FT                   PGRG"
FT   gene            complement(59916..60665)
FT                   /locus_tag="MMAR_0060"
FT   CDS_pept        complement(59916..60665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0060"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /note="involved in amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38531"
FT                   /db_xref="GOA:B2HIA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA5"
FT                   /protein_id="ACC38531.1"
FT                   /translation="MTRQDAGRQPVCLAARSIHQTLGGSVVLRGVDLEVPAGTTAAVIG
FT                   PSGSGKSTLLRTLNRLHEPDSGDILLDGRSVLRDNPNDLRQRIGMVFQHFNLFPHRNVV
FT                   DNVTLAPRKLRGLSNEEARMLALDQLDRVGLKHKANARPDMLSGGQQQRVAIARALAMA
FT                   PQVMFFDEATSALDPEMVKGILALIADLGADGMTMVVVTHEMGFARSTSDAVVFMDHGT
FT                   VVEAGPPEQLFEAARTERLQRFLAQVL"
FT   gene            complement(60662..62431)
FT                   /gene="glnQ"
FT                   /locus_tag="MMAR_0061"
FT   CDS_pept        complement(60662..62431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="MMAR_0061"
FT                   /product="ABC transporter permease protein GlnQ"
FT                   /note="amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38532"
FT                   /db_xref="GOA:B2HIA6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA6"
FT                   /protein_id="ACC38532.1"
FT                   /translation="MLAVSATILIVLGLALAAPALADHNQCAPAGVDSAMVLPADLSSA
FT                   TTAGSDEDVQTTAGVVPLSSVNIGDLGLGTPGVLTAGTLSDAPPNTCINSTGQFTGFDN
FT                   ELLRAIAAKLGLQVRFVGTDFSGLLAQVAARRFDVGSASVKLTEARRRTVAFTNGYDFG
FT                   YYSLVVPPGSAITKFSDLAPGQRIGVVQGTVEESYVVNSLHLQPVKYPDFATVYGNLKT
FT                   HQIDAWVAPGNQAEAAIRPGDPAVLVANTFGAGDFVAYVVARDNRPLLDALNSGLDAVI
FT                   ADGTWSQLYSKWVPRTLPPGWKPGSRAVAAPTLPDFAAIAAAHRHKPVGPAAPKSALTQ
FT                   LRDSFFDWDMYRQAIPTLFKTGLPNTLILTLSASIIGLALGMALAIAGISHQRWLRWPA
FT                   RVYTDIFRGLPEVVIILIIGLGVGPIVGGLTNNNPYPLGIAALGLMAGAYVGEILRSGI
FT                   QSVDPGQLEASRALGFSYSAAMRLVVVPQGVRRVLPALVNQFIALLKASALVYFLGLIA
FT                   QQRELFQVGRDLNAQTGNLSPLVAAGIFYLMLTVPLTHLVNYIDARLRRGRRRLDPEDP
FT                   PGVVSSTIGEEMT"
FT   gene            complement(62513..63277)
FT                   /locus_tag="MMAR_0062"
FT   CDS_pept        complement(62513..63277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0062"
FT                   /product="transcriptional regulatory protein (probably
FT                   GntR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38533"
FT                   /db_xref="GOA:B2HIA7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA7"
FT                   /protein_id="ACC38533.1"
FT                   /translation="MPKKYGVKEKDQVVAHLLNLILTGKLRSGDRVDRNEIAGSLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFVERFDQSTVLEHYELEGVLNGMASARTAANPTPR
FT                   ILGELDGLMRTLRAAKDARIFAELTSEYRRTINEEYAGPRLQALIRASQNLIPGAFWAS
FT                   YQYRREDMLPFYEDEHSAIHRRDPQAARAACSGRSELMAQSMLAELFRRQVFTPHEQAC
FT                   RHNGHATAAPVAPLPARPKIVVETPEATRLAF"
FT   gene            complement(63388..64185)
FT                   /locus_tag="MMAR_0063"
FT   CDS_pept        complement(63388..64185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0063"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38534"
FT                   /db_xref="GOA:B2HIA8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA8"
FT                   /protein_id="ACC38534.1"
FT                   /translation="MTSPVHPDRPLRIGVQLQPQHASHYGDIRDAVRRCEDIGVDIAFN
FT                   WDHFFPLFGDPDGAHFECWTMLAAWAEQTSRIQIGALVTCNSYRNPELLADMARTVDHI
FT                   CDGRLILGIGSGWKQKDYDEYGYEFGTAGSRLDDLAGALPRIKTRLAKLNPAPTRDIPV
FT                   LIGGGGERKTLRLVAEHADIWHSFTGVDEFPAKSAVLARHCADVGRDPATIERSAALQD
FT                   SGRLSADADALAGLGVTLLTVGCDGPDYDLAAAEALCRWRDSR"
FT   gene            complement(64217..65131)
FT                   /locus_tag="MMAR_0064"
FT   CDS_pept        complement(64217..65131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0064"
FT                   /product="hydrolase"
FT                   /note="function unknown, probably involved in lipid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38535"
FT                   /db_xref="GOA:B2HIA9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIA9"
FT                   /protein_id="ACC38535.1"
FT                   /translation="MTDSFPDDLTGLTEFDLLAENAEQAGVTGPLPEVERIEVGAAETR
FT                   ISALRWGGRAPRVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWRQDGDYSPQ
FT                   HNADALVPALRELASEAEFVVGMSLGGLTAIRLGALAPELVDELVLIDVTPSALQRHAE
FT                   MTAEQRGTVALMHGEREFPSFQAMLDLTVAAAPHREVKALRRGVFHNSRRLENGNWAWR
FT                   YDAIRAFPDFAVLWDDVDALAAPVTLVRGGKSGFVSDEDIAELRGRAKGFRGAQTVENS
FT                   GHSVQSDQPRVLVEILRGVLGGR"
FT   gene            complement(65222..66340)
FT                   /gene="ino1"
FT                   /locus_tag="MMAR_0065"
FT   CDS_pept        complement(65222..66340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ino1"
FT                   /locus_tag="MMAR_0065"
FT                   /product="myo-inositol-1-phosphate synthase Ino1"
FT                   /note="involved in phosphatidylinositol (pi) biosynthetic
FT                   pathway [catalytic activity: d-glucose 6-phosphate = 1L-
FT                   myo-inositol 1-phosphate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38536"
FT                   /db_xref="GOA:B2HIB0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB0"
FT                   /protein_id="ACC38536.1"
FT                   /translation="MSEKKPLGAPGAQPEVRVAIVGVGNCASSLVQGVEYYQNADDNSM
FT                   VPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNAVVQ
FT                   RGPTLDGIGKYYADTIELSDDEPVDVVKVLKDNKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPAWAKKFKDAGVPIIGDDIKSQVGATITHRVMAKLFEDRGVTL
FT                   DRTYQLNVGGNMDFKNMLERERLESKKVSKTQAVTSNLTGSLAGKVEDKNVHIGPSDHV
FT                   AWLDDRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGIIIDAVRAAKIAKDRGIGGP
FT                   VIPASAYLMKSPPKQLADDVARTQLEEFIIEG"
FT   gene            complement(66402..66944)
FT                   /locus_tag="MMAR_0066"
FT   CDS_pept        complement(66402..66944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38537"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB1"
FT                   /protein_id="ACC38537.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQAEGLIAENAAPTGMPVRRARRVYQLTDAGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLRDAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNHAEQT"
FT   gene            complement(67100..67969)
FT                   /locus_tag="MMAR_0067"
FT   CDS_pept        complement(67100..67969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0067"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38538"
FT                   /db_xref="GOA:B2HIB2"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB2"
FT                   /protein_id="ACC38538.1"
FT                   /translation="MAKWLGASLARGGSAATRAKDTDRQDACQILDSALSDGQLSMEEH
FT                   RQRVATATQAVTLGDLQHLVADLQSESAPAEVPALKSRGQRNSLGLLAAALGVSILLGV
FT                   AIGWGLYGNTRSPLDFTTDPGAKPDGVAAVVLTPPKQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRMVIYPEYAVLDRKDPADERRILSYTYRGGWGDPTGSARSGADTALVDLGKFDVKTA
FT                   VGIMRGAAETLGMKPKDVTNMYLSINPASDPTTPGAISLQLYVSSDYGSGYIAFAGDGT
FT                   IKQVNYPS"
FT   gene            68082..68516
FT                   /locus_tag="MMAR_0068"
FT   CDS_pept        68082..68516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38539"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB3"
FT                   /protein_id="ACC38539.1"
FT                   /translation="MRLQRQVVDYALRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFH
FT                   GKQSQVICPICRKEQLTLVSWVFGDHLGPVSGSARTAEELIMLTTRFSEFAVHVVEVCR
FT                   TCSWNHLVKSYVLGAARPARPPRGTGGKRTARNGARTASE"
FT   gene            68974..71046
FT                   /gene="ponA1"
FT                   /locus_tag="MMAR_0069"
FT   CDS_pept        68974..71046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ponA1"
FT                   /locus_tag="MMAR_0069"
FT                   /product="bifunctional penicillin-binding protein 1A/1B
FT                   PonA1"
FT                   /note="involved in peptidoglycan synthesis (at the final
FT                   stages), cell wall formation. synthesis of cross-linked
FT                   peptidoglycan from the lipid intermediates. the enzyme has
FT                   a penicillin-insensitive transglycosylase N-terminal domain
FT                   (formation of linear glycan strands) and a
FT                   penicillin-sensitive transpeptidase C-terminal domain
FT                   (cross-linking of the peptide subunits)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38540"
FT                   /db_xref="GOA:B2HIB4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB4"
FT                   /protein_id="ACC38540.1"
FT                   /translation="MRRSAYLAAAVVILLPIVTFTMAYFIVDVPRPGDIRTNQVSTILA
FT                   SDGSEIAKIVPPEGNRVDVNLSQVPEHVRAAVIAAEDRGFYSNPGFSFSGFARAIKNNL
FT                   FGGDLQGGSTITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMSGEWSKDDVLQAYLN
FT                   IIYFGRGAYGISAASKAYFDKPVEQLTVSEGALLAALIRRPSTLDPAVDPDGALARWNW
FT                   VLDGMVDTKALSAKDRAEQVFPRTVPPDQARAANQTTGPNGLIERQVTKELLELFNIDE
FT                   QTLNTQGLQVTTTIDAQAQQAAEKAVAKYLDGQDPEMRAAVVSIDPHNGAVRAYYGGDN
FT                   ANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYDVDSSPLTVDGIKITNVEGESCGTC
FT                   NIAQALKMSLNTSYYRLMLKLKGGPEAVADAAHQAGIATSFPGVPHTLSEDGKGGPPNN
FT                   GIVLGQYQTRVIDMASAYATLAASGIYHRPHFVQKVVNADGRVLFDASTEDNTGDQRIP
FT                   KAVADNVTAAMEPIAGYSRGHNLAGGRPSASKTGTVQLGDTSANRDAWMVGYTPSLSTA
FT                   VWVGTVKGDEPLVTASGAPIYGSGLPSDIWKATMDGALKGTEVESFPKPTEIGGYAGVP
FT                   APPPPPPEAPPPSETVIQPTVEIAPGITIPVGPPTTITLAPPPPPGAPPADNPPP"
FT   gene            71043..72683
FT                   /locus_tag="MMAR_0070"
FT   CDS_pept        71043..72683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0070"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38541"
FT                   /db_xref="GOA:B2HIB5"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB5"
FT                   /protein_id="ACC38541.1"
FT                   /translation="MTDARTQRCATSPEPLARDLRSADYRDFPSRTDVLGSALAGVIGG
FT                   PVGRHALIGRARFMTPVRVMFLMALVFLALGWSTKAACLQSTGTGPGDERVANWDNQRA
FT                   YYELCYSDTVPLYGAELLNQGKFPYKSSWIETNGEGTPQIQYDGRIAVRYMEYPVLTGV
FT                   YQYLSMALAKTYTALSKVAPLPVIAEVVMFFNAAALGLALAWLATVWATAGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATAFAMGGLLAWARRKPWLSGVLIGLGAAAKLYPLLFL
FT                   GVLAVLGIRSGRLGGVLRAALATAATWLMVNLPVMVLYPRGWSEFFRLNTRRGEDMDSL
FT                   YNVIKSFTGWRGFDPSLGFWEPPVVLNTVVTVLFGLACAAIVYIALTAPRRPRLAQVAF
FT                   LVVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMYYLYGNASR
FT                   SLPEQWFTTTVLLRDIAVMALCALVIRQIYRPEEDLVRWDGRIDDPAGGTFDRAADAPP
FT                   GWLPGWLRPVHSRRVTVAAAPEPVPVGGR"
FT   gene            72683..73321
FT                   /locus_tag="MMAR_0071"
FT   CDS_pept        72683..73321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0071"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38542"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB6"
FT                   /protein_id="ACC38542.1"
FT                   /translation="MQVAIPVFPRFTALDAVGPYEVLQRIPSIDVVFIGHQRGEVRTEN
FT                   GMLGVTCDATFAEVDAPDVVVFPGGIGTRGLLEDETIRGWLQAVHPHTRFTTSVCTGAL
FT                   LLAAAGLLDGLTATTHWRAAELLNGLGARYVPQRVVEHLPQRIITAAGVSSGIDMGLRL
FT                   VELLVDREAAQAAQLLIEYDPEPPFDAGSLAKADEGVRARAIEFLDSRK"
FT   gene            73445..73735
FT                   /gene="rpsF"
FT                   /locus_tag="MMAR_0072"
FT   CDS_pept        73445..73735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="MMAR_0072"
FT                   /product="30S ribosomal protein S6 RpsF"
FT                   /note="binds together with S18 to 16S ribosomal RNA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38543"
FT                   /db_xref="GOA:B2HIB7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB7"
FT                   /protein_id="ACC38543.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGR
FT                   RRLAYEIAKHAEGIYAVIDVKAAPATVSELDRQLSLNESVLRTKVMRADKR"
FT   gene            73827..74354
FT                   /gene="ssb"
FT                   /locus_tag="MMAR_0073"
FT   CDS_pept        73827..74354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="MMAR_0073"
FT                   /product="single-strand binding protein Ssb"
FT                   /note="this protein is essential for replication of the
FT                   chromosome. it is also involved in DNA recombination and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38544"
FT                   /db_xref="GOA:B2HIB8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIB8"
FT                   /protein_id="ACC38544.1"
FT                   /translation="MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQSG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVVEVEVE
FT                   EIGPSLRYATAKVNKASRGGGGGGFGGGGGGGGGGGARQAPAQASSPAGGDDPWGSAPA
FT                   SGSFGGDDEPPF"
FT   gene            74400..74654
FT                   /gene="rpsR1"
FT                   /locus_tag="MMAR_0074"
FT   CDS_pept        74400..74654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR1"
FT                   /locus_tag="MMAR_0074"
FT                   /product="30S ribosomal protein S18-1 RpsR1"
FT                   /note="this protein has been implicated in aminoacyl-
FT                   transfer RNA binding. it appears to be situated at the
FT                   decoding site of messenger RNA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38545"
FT                   /db_xref="GOA:B2HIB9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HIB9"
FT                   /protein_id="ACC38545.1"
FT                   /translation="MAKSNKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSAR"
FT   gene            74697..75155
FT                   /gene="rplI"
FT                   /locus_tag="MMAR_0075"
FT   CDS_pept        74697..75155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="MMAR_0075"
FT                   /product="50S ribosomal protein L9 RplI"
FT                   /note="binds to the 23S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38546"
FT                   /db_xref="GOA:B2HIC0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HIC0"
FT                   /protein_id="ACC38546.1"
FT                   /translation="MKLILTADVDHLGSVGDTVEVKDGYGRNFLLPRGMAIVASRGAQK
FT                   QADEIRRSRETKAVRDREHANEIKTAIQALGSVALPVKTAADSGKLFGSVTAGDVVAAI
FT                   KKAGGPNLDKRIVRLPKAHIKAVGTHPVVMHLHPEIEVELSVDVVAES"
FT   gene            75689..77071
FT                   /gene="dnaB"
FT                   /locus_tag="MMAR_0076"
FT   CDS_pept        75689..77071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="MMAR_0076"
FT                   /product="replicative DNA helicase DnaB"
FT                   /note="participates in initiation and elongation during
FT                   chromosome replication; it exhibits DNA-dependent ATPase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38547"
FT                   /db_xref="GOA:B2HIC1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC1"
FT                   /protein_id="ACC38547.1"
FT                   /translation="MAVVDDLAHSDNMDAPPPSEDFGRQPPQDLAAEQSVLGGMLLSKD
FT                   AVADVLERLRPGDFYRPAHQNIYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPY
FT                   LHTLISTVPTAANAGYYAGIVGEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQA
FT                   EIYDVADRRLSEDFVPLEDLLQPTMDEIDAIASNGGISRGVPTGFTELDEVTNGLHPGQ
FT                   MIIVAARPGVGKSTLGLDFMRSCSIKHQMASVIFSLEMSKTEIVMRLLSAEAKIKLADM
FT                   RSGRMTDDDWTRLARRMSEISEAPLYIDDSPNLTMMEIRAKARRLRQKANLKLVVVDYL
FT                   QLMTSGKKHESRQVEVSEFSRHLKLLAKEIEVPVVAISQLNRGPEQRTDKKPMLSDLRE
FT                   SGSLEQDADMVILLNRPDAFERDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFANM
FT                   AR"
FT   misc_feature    77080..88055
FT                   /note="MURD2; function unknown; contains two clusters of
FT                   dehydrogenases and membrane putative membrane proteins. One
FT                   group may be involved in carbon monoxide metabolism (CoxS,M
FT                   & L)"
FT   gene            77176..77604
FT                   /locus_tag="MMAR_0077"
FT   CDS_pept        77176..77604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38548"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC2"
FT                   /protein_id="ACC38548.1"
FT                   /translation="MSQNMKPGISTANDLASWVEALAGGRVLDGQIQQQRMASIQSTDP
FT                   SNRAAAGYGWGMAKFGPMYGHTGELPPSSSGRISRQASTGTPRRQPSLGASSRRCTPGR
FT                   GSQRPGVRRPTIGSPATSLVGDREAPNEPKAGNGMVGR"
FT   gene            77847..78095
FT                   /locus_tag="MMAR_0078"
FT   CDS_pept        77847..78095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38549"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC3"
FT                   /protein_id="ACC38549.1"
FT                   /translation="MSDDQNTDAPPNHLSIDPRSAFYSEEVLRRDVGIRFNGVEKTNVH
FT                   EYNVAEGWVRVEVPTAKDRRGNPMVVKLSGTVEPYFR"
FT   gene            78147..78350
FT                   /locus_tag="MMAR_0079"
FT   CDS_pept        78147..78350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38550"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC4"
FT                   /protein_id="ACC38550.1"
FT                   /translation="MVGLWLDHGANLSCGPALPGQARRGGGYVMAEPAGNRLISDLENE
FT                   SGRPVRGGHFVFHSARHVPHIP"
FT   gene            complement(78908..81016)
FT                   /gene="coxL_2"
FT                   /locus_tag="MMAR_0080"
FT   CDS_pept        complement(78908..81016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL_2"
FT                   /locus_tag="MMAR_0080"
FT                   /product="carbon monoxyde dehydrogenase (large chain),
FT                   CoxL_2"
FT                   /note="involved in cellular metabolism [catalytic activity:
FT                   CO + H(2)O + acceptor = CO(2) + reduced acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38551"
FT                   /db_xref="GOA:B2HIC5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC5"
FT                   /protein_id="ACC38551.1"
FT                   /translation="MTTAPATRGAMRFARVEAYSKITGTARYAADHRPEGLLYAVLVGA
FT                   PVAAGRLKAVDADAALGSPGVVAVLIADDLPDFPLLSPPSAVRRMPLMNNEIHYEGQAV
FT                   AIVIAESIEAAEAARALVVVDCERTNAVVLGSGTREPADGEYSDPFDKGDFDTAWSNAA
FT                   IRVERTYLQPPRHHHAMETSGTVAQWDEDQLTLWDAVQASATVPPVIATALGIDAHRIR
FT                   IVAPHIGGGFGSKSFVWPHQTLAAAAARVTGRPVKLHLRRADQFSSVGYQPWMEQTMRL
FT                   AADRTGRLIGIEHVAVNNTGMVDNYVEPATTATKGLYAADAIRTRQFVERVNLNVPTPM
FT                   RAPLEGPGMWALESAMNELADEAGMDPLDLRLANYAENSPADGRPWSSNRLREAYAEGA
FT                   RRYRWRERYERPRAEGPWAIGHGMATCTMGSFRFPSQARVRLRDDGTAVVEANVHDIGT
FT                   GVQTILCQIAAAELGISSDRVEILWGDTDLPTAGPAYGSSTTMSVGSAVAAAARHVVNQ
FT                   LAALGIDDPAATGIAEVVGEGRFSTPGGGTNLDGEGTPFAIRAWGAVFVEVGVDRDLGL
FT                   IRLRHAVGVYSAGRILNPVTARAQMIGGIIWGWGKATLEASTQEPTYGRWLAKNLSNVA
FT                   LPVNADIPAAIDVSFIDEFDSAASLIGARGIGELGATGVDAAVAAAVYDAVGVRVRELP
FT                   ILPWQVLS"
FT   gene            complement(81013..82017)
FT                   /gene="coxM_2"
FT                   /locus_tag="MMAR_0081"
FT   CDS_pept        complement(81013..82017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxM_2"
FT                   /locus_tag="MMAR_0081"
FT                   /product="carbon monoxyde dehydrogenase (medium chain),
FT                   CoxM_2"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism [catalytic activity: CO + H(2)O + acceptor =
FT                   CO(2) + reduced acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38552"
FT                   /db_xref="GOA:B2HIC6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC6"
FT                   /protein_id="ACC38552.1"
FT                   /translation="MKDFRYARATDIASALATLHHDDTTVIAGGTELLNWYRLGIATEG
FT                   NVLDIGGVQGLRDITREGDELVIGALATLNDVAAHPTVNGGAGVLSSACRQAASAQLRN
FT                   RATMGGNVLQRTRCPYFRAEEPLPWGCNKRTPGTGCSSLTGQHERQAIFGWTDDCVAVH
FT                   PSDPAVALAALDAQIEVASAAELRSIPMTQFHLSQQEAAATGDPRRESRLEPGELITGY
FT                   RLRLRPDEAQAYVKVRERASYEYAIVSAAAVVRISHGVIAAARLALGSVAQRPWRLYEA
FT                   ESQLVGLPLHRNAVLPVVERALSASDPLPDNGFKAMLAARAAVRALLTAGGAA"
FT   gene            complement(82014..82523)
FT                   /gene="coxS_2"
FT                   /locus_tag="MMAR_0082"
FT   CDS_pept        complement(82014..82523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxS_2"
FT                   /locus_tag="MMAR_0082"
FT                   /product="carbon monoxyde dehydrogenase (small chain),
FT                   CoxS_2"
FT                   /note="involved in cellular metabolism [catalytic activity:
FT                   CO + H(2)O + acceptor = CO(2) + reduced acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38553"
FT                   /db_xref="GOA:B2HIC7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC7"
FT                   /protein_id="ACC38553.1"
FT                   /translation="MSNVADTAPTFSRRLPIRVRINGEEVEAEVEARTTLLDWLRETLG
FT                   LTGAKKGCNEGACGACTVLVDGTHMNSCLTLAVQCSGRDVTTVEGLVGPDGELHPVQQA
FT                   FAEHDAFQCGYCTPGQIVSAVACIAEGYATDEISVREWMSGNICRCSSYPQITSAVLAA
FT                   ANSSVR"
FT   gene            complement(82520..83431)
FT                   /locus_tag="MMAR_0083"
FT   CDS_pept        complement(82520..83431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0083"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38554"
FT                   /db_xref="GOA:B2HIC8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC8"
FT                   /protein_id="ACC38554.1"
FT                   /translation="MTFVDVHFHLAPASFIRQKPNRVFDIYPQLGDGALGRQELAAAGG
FT                   RAFVSLPWPVPPGADVEATATATSSCNDELLAAAAEHVEYAGAMIAVDLTDPARAVTEV
FT                   RRTADAQAMAGVMIYVSPTSRLDEEGLHEFYAELSARRLPLFLHPALEPPIGGATDWSL
FT                   DASLSPPVVTSTAAARLMLSGRLDEHPGLTLIIPHLGGVLPYLAQRLIDQSGRGAALHD
FT                   IPTYLRTRTYVDTCSFHPPALRCALDTIGPSRLVLGSDYPFRGPVARAIADIADSGVDE
FT                   TFKESALIGNATAAIRTAAGAV"
FT   gene            84174..84782
FT                   /locus_tag="MMAR_0084"
FT   CDS_pept        84174..84782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0084"
FT                   /product="conserved hypothetical short-chain dehydrogenase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38555"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HIC9"
FT                   /protein_id="ACC38555.1"
FT                   /translation="MKAVVVGSGAVGAAVARTLRAHDHEVVSVGRTSGDYLADLTDIGS
FT                   LRRLFEAIGEFAAVACAAGDVFPAQLEMSTDKQWTDSIAAKGRGQIDLVRAALPHIADR
FT                   GSFTLISGVLGEEITAACTIGATVNAMVEGFVVAAATELPRGIRINCVSPTVLAESPHF
FT                   QPYFPGYPPVSAEDVATAYLRAISNPFTGRILKLHKTNC"
FT   gene            84893..87637
FT                   /locus_tag="MMAR_0085"
FT   CDS_pept        84893..87637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0085"
FT                   /product="transcriptional regulatory protein"
FT                   /note="contains N-term ATPase domain and C-term DNA-
FT                   binding domain; may be involved in regulation of
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38556"
FT                   /db_xref="GOA:B2HJ87"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ87"
FT                   /protein_id="ACC38556.1"
FT                   /translation="MPTVTLVGRHREQQQLQQLLDAARRGESGVLVLRGDAGIGKTTLL
FT                   TDLVDNAPDLRVLRVRGAEMEMELTYSGVQQLCGPLMSLIGQLPEPQLDALEIALGRKR
FT                   GRAPDRLLLGLAVLTLVGEASRASPILCVVDDAQWVDSASVQALAFVARRIHVDPVAMV
FT                   FATRDRGPDALTGHCELSLQGLEDHDARLVLSTAIPGRLNDSVAETVLAEANGNPLALL
FT                   ELHNALIRGELAGGYGLANATRTETQIERTFVSRLRALPSETKTFLLVAAAESTARPEW
FT                   LWAAAHRLGIGPEAAAPAEAAGLIAAQGSVRFRHPLIRAAVYHSSSAAERRRVHAALAA
FT                   SIAGPDDDDHRVWHRAHAAEAPDAQTADDLERSAERARARGGLSAAASFLEHATKLTPD
FT                   PFVRASRALDAAMTSLEAGMPDSATRLVASAAAAADDELIAARCELIRAKIAFAASRGS
FT                   DAPPLLLAAAQRMQRLDPSESRKAYLGAVLASILVGRMATDQHNSSPSVAKAASNAPAA
FT                   PHPPRALDVLLDGLVIRLTEGYVAAAPRLRSAIREYLRERDIGVAEPGWHDLTARVCLD
FT                   LFDQDAYNFLAARQVEDLRAAGALTMLPVALVTFAGVCVSAGNFGQADALLDESAAIIA
FT                   ATGAPPRPAIKTYLAAYRGQEQICREGVQQTVDSAASRGEGYDVSVAMYAAAILHNGLG
FT                   QYQEAFNAAASGARYDDVGMCGYLLGELIEAAVRCKEHNAATEALGRLLKRTKASGTPT
FT                   ALGIGASATALVSDGSIADAAYREAITHLRRSPVAVHLARTHLTYGEWLRRERRRSEAR
FT                   SQLRIAYDMFAQMGAAGFAERARRELSATGEAVYVQPTGITVDLTTQESHIARLARDGY
FT                   TNAEIAGLLFISARTVEWHLSKIFAKLGVTSRRELRAILMESP"
FT   gene            complement(88106..88885)
FT                   /locus_tag="MMAR_0086"
FT   CDS_pept        complement(88106..88885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0086"
FT                   /product="hydrolase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38557"
FT                   /db_xref="GOA:B2HJ88"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ88"
FT                   /protein_id="ACC38557.1"
FT                   /translation="MSTFVVPGAELAVELSDEGGHPVVQLHGLTSSRARDRVLNLDLGR
FT                   GLSGTRLLRYDARGHGKSTGRKVPQDYRWERLAEDLLRLLDKWFPGEQVHGVGPSMGTG
FT                   TLLHAAAREPDRFAGLTLMVPATAWHTRPAQAANYRVAAEIIETEGVGAFIAWGRAATP
FT                   PPATVGAPETVPDVADALLPSLFRGAALSDLPTSEALARIDVPTTILAWINDPAHPLST
FT                   AESLAALLPQSTLTVAHTPADVETWPKILSQDVARRG"
FT   gene            88976..90742
FT                   /locus_tag="MMAR_0087"
FT   CDS_pept        88976..90742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains a non-ribosomal peptide synthetase-like
FT                   condensation domain"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38558"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ89"
FT                   /protein_id="ACC38558.1"
FT                   /translation="MRLTNVAHLRLPFGRLWGYDVSVSDLGRQLPVSFDQRIHVAAGAR
FT                   PGSWMALSIRLPAGVSRQSLADAWLGVIARHGTLRTAFTLGADGDPQLHEIDVQPGKWV
FT                   EHEIAAGQEVNDALRVVLNAACSPDQRPSHRLCVLETAAGLTVVIAADHAHVDMWSMLV
FT                   IARDLLSMLADARTGRTSSLQPRPAFVVHTQALLDRPPAPDRVRARWAQIINDSGGVMP
FT                   RFPLPLGKSGPHPERVEVRDVFDVDDGAAFAAQARNDGVSTLALAVVAMTAVTRELAGA
FT                   PLRAVFPVHSRFEEKWHDSVGWFITNSVLESAVVEPNAAAAAVKEAVQLGSWPLADVLA
FT                   PWGGMPMAPGMFAISWLDQLRLPVRIDSVGLDAQYVSARIHTDGVMLWFIQDESGLHLR
FT                   CRYPDTAEARTNVGSWLDLLVARLQALAQSSVRGLLRVAGRTFRVQRATREHVGVIAEL
FT                   LSDDEFGQDREGAELERYEAAYDILVRNRSNYLGVVLNGSDMVVATVQLTIIPGLSRGG
FT                   ATRLQIEGLRVAKAERAQGLGTALVEWAHNYGRAHGAQLAQVTTDEARERARAFYRRLG
FT                   YHAAHVGLKRTI"
FT   gene            complement(90890..91492)
FT                   /locus_tag="MMAR_0088"
FT   CDS_pept        complement(90890..91492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0088"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38559"
FT                   /db_xref="GOA:B2HJ90"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ90"
FT                   /protein_id="ACC38559.1"
FT                   /translation="MTIGEQVPEGPVESVPSTERKGQRTRRRILDAARAVFAEVGYERA
FT                   TIRGIAAAAGVDKSSIIKYFGTKQALFHEAVHWDIPVAELTTDDAGQTTENYARAMLTA
FT                   WAADPNSPMAVLLRTSMTSEDAADILRRHITAQGVDAVAATIDASDARLRAAVAGAILM
FT                   GIASQRFILRMPDLVDADIDDILRLVTPLLRSLIDPE"
FT   gene            91634..92122
FT                   /locus_tag="MMAR_0089"
FT   CDS_pept        91634..92122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown; contains thiopurine S-
FT                   methyltransferase domain. this is a cytosolic enzyme that
FT                   catalyses S-methylation of aromatic and heterocyclic
FT                   sulfhydryl compounds"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38560"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ91"
FT                   /protein_id="ACC38560.1"
FT                   /translation="MTEPRMDWDSAYRQDVRPPWSIGAPQPELAALIEGGKVRSEVLDA
FT                   GCGEAELSLALAAQGYSVVGLDASATAIATASAAAAERGLTTASFAAADVTAFDGYDGR
FT                   FNTVMDSGLLHVAGPRELVRGERESFIGGYRRQHSGQAVGSPAMNAADDGCTRASSRR"
FT   mobile_element  complement(91980..93219)
FT                   /mobile_element_type="insertion sequence:ISMyma01"
FT   gene            complement(92022..92816)
FT                   /locus_tag="MMAR_0090"
FT   CDS_pept        complement(92022..92816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0090"
FT                   /product="transposase, ISMyma01_aa2"
FT                   /note="transposition of the insertion sequence, ISMyma01"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38561"
FT                   /db_xref="GOA:B2HEH7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2HEH7"
FT                   /protein_id="ACC38561.1"
FT                   /translation="MLGVSERFACRVTGQHRATQRHEPVAGTPADPDAALREWLRDYAN
FT                   KHPRRGFRPAYHDARGEGWEVNHKKVQRLWREEGLRVPQRRKRKRHGTSTAPPEVVADA
FT                   PDRVWAVDFQFDVTTDGRPIKIVSIIDEHTRECLGGMVERSITGDHLTEELGRIAAGRG
FT                   ALPAVLRCDNGPELACSAMADWAEGQVGLHFIPPGEPWRNGYVESFNSRIRDECLNINS
FT                   FWSLAQARVVIGDWKHEYNHHRRHSSLGYLPPARYAAACTHR"
FT   gene            complement(92858..93139)
FT                   /locus_tag="MMAR_0091"
FT   CDS_pept        complement(92858..93139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0091"
FT                   /product="transposase, ISMyma01_aa1"
FT                   /note="transposition of the insertion sequence, ISMyma01"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38562"
FT                   /db_xref="GOA:B2HEH6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2HEH6"
FT                   /protein_id="ACC38562.1"
FT                   /translation="MATRKRHSPEQIVRKLMTADRLLAEGKDTAAVCRELGVSEATYHR
FT                   WRNQFGGLKAEDAKRLKDLERENAALKRLLADAELEKDALREIARGNF"
FT   gene            93232..93537
FT                   /locus_tag="MMAR_0092"
FT   CDS_pept        93232..93537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38563"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ94"
FT                   /protein_id="ACC38563.1"
FT                   /translation="MQRRQAYVQAIHRAAAPGAGLFILAFAQRQFGDGMPGPNGFTAEE
FT                   LRDTVATQWTVDEVRSATLYANDVQLAAGSAPGVEAQRDDKGRLMFPGFLLLAHKG"
FT   gene            complement(93566..95239)
FT                   /gene="ermB"
FT                   /locus_tag="MMAR_0093"
FT   CDS_pept        complement(93566..95239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ermB"
FT                   /locus_tag="MMAR_0093"
FT                   /product="integral membrane efflux protein ErmB"
FT                   /note="translocase that confers resistance to substances of
FT                   high hydrophobicity. involved in transport of multidrug
FT                   across the membrane (export): multidrug resistance by an
FT                   export mechanism. responsible for the translocation of the
FT                   substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38564"
FT                   /db_xref="GOA:B2HJ95"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ95"
FT                   /protein_id="ACC38564.1"
FT                   /translation="MNTTPAKATALQQNLPGRPDGSTGSSVAAGERHVDRLDGSLLRIA
FT                   GICVFASVAVNLANTAVSVAQRSLIVTFGSNQAVVAWTVTAYTLTEAAAIPLSGWAADR
FT                   IGTKRLFMISVLGFTLGSVLCAVAPNIACLIIFRAVQGGGGGILMPLVITILAREAGPN
FT                   RLARLMSVMGIPLLLGPMAGPILGGWLIDDYGWQWIFWINVPIGLITVALAAIAFPGDH
FT                   TAPSETLDIIGMLLLSPGLATFLYGLSTVPARGTVADRHVLIPATAGLVLMGAFVFHAL
FT                   YRADRPLIDLRLFRNRVVTVANATIVFVAAGFSGAVLLVPSYFQQLLRETPLQVGIHMI
FT                   PLGLGAAVTIPTSSVLMDRHGAGKVVLGGVTLISVGMGTLAFGAAEHAAYVPTLLIGLT
FT                   IVGMGIGSIMLQLTTVAVQTLAPHQIARGSTLVSVNQQLSASASTALMSVILTSQFNRS
FT                   ANIAAANRLEALNESATRRGIPLDPSQIPPRTLNPDFGANLLHDLSQAYTVVFVYASVV
FT                   MLVTFLPAVFLPMRAAITSAPLREPIDPEFPEMAARGRPG"
FT   gene            complement(95329..98193)
FT                   /gene="mmpL5_3"
FT                   /locus_tag="MMAR_0094"
FT   CDS_pept        complement(95329..98193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL5_3"
FT                   /locus_tag="MMAR_0094"
FT                   /product="conserved transmembrane transport protein,
FT                   MmpL5_3"
FT                   /note="thought to be involved in fatty acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38565"
FT                   /db_xref="GOA:B2HJ96"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ96"
FT                   /protein_id="ACC38565.1"
FT                   /translation="MTIKRPVRQSLSCAIRRLSIPIVIGWIALSAYLTVGLPPLEVVGQ
FT                   LHSVSMNPRDAPSAVAMRRIGELFKESDSDNTAMILLEGDQPLGDNAHYYYNNLVRQLS
FT                   SDTTHVQHIQNFWGDPLTAEGAQSTDGKAAYVQLNLAGNMGGPLANQSIEAVRQILART
FT                   PPPPGIKVYVTGPSALTADMSRTGDKSLVIVTMISVLVIFTMLLLVYRSIVTVTLLLIT
FT                   VGIELTAARGVVAFLAWHGVIGLSTYAINLLTTMAIAAGTDYSIFIIGRYQEARQAGED
FT                   AETAFYTMYRGVAHVILGSGLTIAGAMYCLTFTRMPYFQSMGIPCAAGMLVAVVAALTM
FT                   GPAVLALGSRFGLFDPKRKIKTRGWRRIGTAVVRWPAPILTATCAVSLVGLIALPGYQT
FT                   NYDDQTYVPENIPANAGYAAANRHFPPSRMKPDVLLIVADHDMRNSADFLVLDKLAKGI
FT                   FHVPGISRVQAITRPKGTPIEHTSIPFQISMQNAGQLQNMKYQRDRMNDMLTQADQLTS
FT                   TIALMKRTYDLMLQMSKTTHRMVGDTLEMKSVTDELRDHIADFEDTWRPIRSYFYWEKH
FT                   CADIPICWSLRSIFDALDGVDQVSEQLTTLTGDLTDMDRILPQVVATFPQMIQNMEGMR
FT                   TLILTMHSTMSGIYDQMDELSKNSTAMGQAFDAAKNDDSFYLPPEVFNNPDFKRGMKMF
FT                   LSQDGKAARLFIFHRGNAAGYEGISSISAINIAAAEALKGTPLEDAQIYLTGTAAVYKD
FT                   IADGSKYDLIIAGLSSLCLIFIIMLLITRGFVAALVIVGTVALSLGVSFGLSVLLWQHL
FT                   LRIELHWLVLAMSVIVLLAVGSDYNLLLVSRLKEEVGAGIKTGIIRAMGGTGKVVTSAG
FT                   LVFALTMASMAVSDLIVIGQIGTTIGLGLLFDTLIVRSLMTPSIAALLGRWFWWPLNIR
FT                   SRPPRLTRQRPLPSVSQEPAAARV"
FT   misc_feature    95649..163719
FT                   /note="MURD3; This locus harbours a 34 kbp three-gene
FT                   cluster encoding a 3-module NRP and two single module PKS
FT                   for production of an unknown metabolite. The region also
FT                   contains FAAL and MmpL family genes, their products playing
FT                   poteintial roles in transferring other metabolites to this
FT                   system for elongation and export respectively. Other genes
FT                   in this region encode oxygenases, P450 hydroxlase,
FT                   dehydrogenases and putative regulatory genes"
FT   gene            complement(98190..98627)
FT                   /gene="mmpS5_3"
FT                   /locus_tag="MMAR_0095"
FT   CDS_pept        complement(98190..98627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpS5_3"
FT                   /locus_tag="MMAR_0095"
FT                   /product="conserved membrane protein MmpS5_3"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38566"
FT                   /db_xref="GOA:B2HJ97"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ97"
FT                   /protein_id="ACC38566.1"
FT                   /translation="MTALKILGKLWIPLVIVTVVGVTAFSVSRVHGFFGSQKPELYTDG
FT                   SSDDATPFNPKQLTYEIFGPAGTVADIDYFDVNAQPRRVDGAHLPWSLEIKSTSASLTG
FT                   NIVAQGDSNRLGCRIIVDGVIKAERISQEVNAYTFCIVKSA"
FT   gene            99141..99527
FT                   /locus_tag="MMAR_0096"
FT   CDS_pept        99141..99527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38567"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ98"
FT                   /protein_id="ACC38567.1"
FT                   /translation="MCDRNNRPMLGKRRPSVARSDRAPRVVQLRICEYLPVGNWSRPPA
FT                   AARIQLTCKAKSHNDSGALPTAGGGDEMSGRPVELRRQRPRAGLITRPALADSCEFTGR
FT                   GCESTWAGVKYALGADVKTSTRKL"
FT   gene            99527..99763
FT                   /locus_tag="MMAR_0097"
FT   CDS_pept        99527..99763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0097"
FT                   /product="conserved hypothetical MbtH-like protein"
FT                   /note="function unknown; many of the members of this family
FT                   are found in known antibiotic synthesis gene clusters"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38568"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJ99"
FT                   /protein_id="ACC38568.1"
FT                   /translation="MLMTISPFDDDNGAFFVLVNHEEQHSLWPTFAEIPAGWQVVYGEE
FT                   ERTKCLAYIDENWPDIRPKSLREKLARGSHGHT"
FT   gene            99926..103084
FT                   /locus_tag="MMAR_0098"
FT   CDS_pept        99926..103084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0098"
FT                   /product="polyketide synthase"
FT                   /note="polyketide synthase possibly involved in lipid
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38569"
FT                   /db_xref="GOA:B2HJA0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036299"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA0"
FT                   /protein_id="ACC38569.1"
FT                   /translation="MASQEKLHTYLKQVVLELEKTRRRLREVEMGAREPIAIVGMACRY
FT                   PGGLESPADLWSAVAEGRDLISEWPSDRGWYGEPYFDGESQTSRLGAPIGGFLADVSAF
FT                   DAEFFGLSSSEALAMHPHQRLALECAWEAFERGGIDPSSVRGSDIGVFLGVTSIPYETL
FT                   GEGVDGDSPLMLAGHMTSMAAGRISYLFGLEGPAMALDTACSSSLVAIHQAVGSLRSGE
FT                   CSMALAGGAAIMMSPPSFFALAQGMASASDARCKSFSASADGAGWGEGLGLLLLERLSD
FT                   ARRNQHPVWAVVRGSAVKHDGASNAPQAPNGLAQQRIIRRALQNAGLAAAEVDVVEAHS
FT                   PGTPVGDLVEAEALMATYGQHRPEGRPLWLGSLKSNTGHTLAAAGVGSVIKMVEAMRHR
FT                   TIPLTLHVNEPTPYVDWASGRIQLATETQEWPRPDNARRAAISGVGMGGVNAHIIIEEA
FT                   VEEPMPVGETALSDSGWDAASPAVPWIITAKSPEALLAQAARTVAHLEDDPDLRAIDIG
FT                   YSLASTRAQFAHRAVVVGRDRNELLNGVRSLVAGESVPAVVRGVAEPSAKTAAFFHGEG
FT                   AHWLGMGRQLYSIFPVYAKAIDETCEILSSLMGTPVRDLLFASADSEKGSLLRRPSYAQ
FT                   PALFAVETALYRLAQSWGFQPDFVMGCSAGEIAAGHAAGLWSLQDACALVVESGRLRQS
FT                   MGDADTTAVSPAAELYAIPPLGASECSANGASGNHTGPQPSDGQEATSTGQPQASSAAA
FT                   LRTGLFKLCGRLDYRLPDTPIVSAHTGTVVDPSLVRTPEYWVEQLISPVHLKKAIRRAR
FT                   SKEDITTFLQIGPGIHHAAMIHGIFEDADGTSAGVVIPPLLQPGTDEDVSFVSGLATAY
FT                   ANGAPVDWAGVYRGAGARRVPLPTYAFQRTRLWLDAQGGAGLAGEVDARASAGPVHDGE
FT                   PVCTEIERTVAAAIGQVLGIAQVSRDDGFLALGGDSVSAMRLAARVRAEGLPLTPELLF
FT                   EHATVRQIAAALQEAANQATDWGAPGRLAADRQFEAMSVSGLSSAELAALPGLLAMLDQ
FT                   PRSA"
FT   gene            103081..114750
FT                   /locus_tag="MMAR_0099"
FT   CDS_pept        103081..114750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0099"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /note="function unknown but the gene encodes a Nrp of three
FT                   functional domains with the predicted sequential
FT                   condensation of the amino acids threonine, threonine and
FT                   alanine. the second domain contains an epimerization domain
FT                   and the third domains contains a terminal te"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38570"
FT                   /db_xref="GOA:B2HJA1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA1"
FT                   /protein_id="ACC38570.1"
FT                   /translation="MTQPTKPVVDIEDVMTLSPLQLGLFALAMASGAASDDPYTVALGI
FT                   DVHGSLDVGLLRSCALAMLKRHPNLRARFLGRGLPHPVQVVPSEVQLEWARVEATAETA
FT                   GALEAQERNRGFDLEMGPAIRFLLIELPGDRWRFLITAHHIVIGGWSIALFVDELLTLY
FT                   EADCNIDTLPAQPRPYRDYIGWLERCDVEQGQRQWREHLAGLAAPTLLAAPLGSSGVQP
FT                   DSLPKRAELTLDEGATTSLVDGARSRGVTVNTLTQLAWALMLSMLTDRRDVVFGVTVSS
FT                   RPAELARVESMVGLFVNTVPLRVRLDPKTTVAQQCALIQRDAARLREHAYLSHSQIRAL
FT                   AGMGELFDTLLVFQNFPSLGLADGKARAVGAARFDSLTVQSPTHFPVCITAELTDARLS
FT                   LSIATNANAFGDITESALGDRLVAVLQRLLPMWDRPLRDVSMLLDGQTDGDTAVSEHAR
FT                   LDVVGNRAVLAEPLVEPVSVPGLFAAQVASRAEVTALVCGDRSLTYRELDRAANRLAHL
FT                   LVDQGVGPGDVVGLLLERSVEAVIAILAVLKSGAAYLAIDVNHPDGRIGFMIEDAAPVA
FT                   VITTAGLAQRLAGYPVAVIDIDDPAIATCYPGYGLPFPSADNIAYLIYTSGTTGKPKGV
FT                   GITHHNITQLFTSVAATGFTPAPGQIWTQCHSYAFDYSVWEMWGALLHGGRLVVVPELV
FT                   TRSAAELLALLVTEGVGVLSQTPSAFYALQAEDAAQPQLGRQLCLDAVVFGGEALEPAR
FT                   LGPWLANHGRRPRLINMYGITETTVHASFREIVRHDLGFAVSPVGVPLANLAFFVLDGW
FT                   LRPVPVGVAGELYVAGAGVGCGYWRRSGLTASRFVACPFGALGARMYRTGDVVRWGPDG
FT                   QLQYVGRADEQVKIRGYRIELGEVAAALSQLDGVDQAVVIAREDRPGDKRLVGYLVGSV
FT                   DAGQARAALAQALPAYMVPAAVVVVDSLPLTVNGKLDIRALPAPQYGATGSYRAPASPV
FT                   EEVLAGIYAQVLGLDRVAVDQSFFDLGGDSLSAMRVVAAINKSLGGDLSVRALFDAPTV
FT                   AELAPGIGQGSGQWTPLVAGERPAVVPLSFAQQRLWFIDQLQGPSAVYNMAWSARLSGE
FT                   LDAAALGAAFADVVGRHESLRTVFRAVAGVAEQLVLGVEQVDVRWQIIDAQGWSSRRLA
FT                   AALEQQARHCFDLTVEIPLRASLFRVTDDEHVLVVVAHHIAADGWSLRPLVTDLGVAYA
FT                   SRCAGRAPGWAGLAVQYVDYTLWQRTNLGELTDSHSGIAGQLRYWEKALEGMAERLQLP
FT                   TDRAYPRVADHRGSGVDVQWPAQLQQQVARVAREHHATSFMVIQTALAVLLAKLSGSSD
FT                   VAVGVPVAGRGDPALDELVGVFVNTVVLRVQVAGDPTFAQLLAQVRTRSLAAFEHQDVP
FT                   FEVLVERLNPVRSLTHHPLVQVVLAWQNDMSAELVLDGLDVEFAPVHTQTARMDLVFSL
FT                   GERFTDTGAPAGIGGGVEFRTDVFDAASIAALIQRLQRVVVAMVADPDRRLSSVDLLDA
FT                   AEHARLDVVGNRAVLAEPLVEPVSVPGLFAAQVASRAEVTALVCEDRSLTYRELDRAAN
FT                   RLAHLLVDQGVGPGDVVGLLLERSVEAVIAILAVLKSGAAYLAIDVNHPDGRIGFMIED
FT                   AAPVAVITTAGLAQRLAGYPVAVIDIDDPAIATCYPGHGLPFPSADNIAYLIYTSGTTG
FT                   KPKGVGITHHNITQLFTSVAATGFTPAPGQIWTQCHSYAFDYSVWEMWGALLHGGRLVV
FT                   VPELVTRSAAELLALLVTEGVGVLSQTPSAFYALQAEDAAQPQLGRQLCLDAVVFGGEA
FT                   LEPARLGPWLANHGRRPRLINMYGITETTVHASFREIVRHDLGFAVSPVGVPLANLAFF
FT                   VLDGWLRPVPVGVAGELYVAGAGVGCGYWRRSGLTASRFVACPFGALGARMYRTGDVVR
FT                   WGPDGQLQYVGRADEQVKIRGYRIELGEVAAALSQLDGVDQAVVIAREDRPGDKRLVGY
FT                   LVGSVDAGQARAALAQALPAYMVPAAVVVVDSLPLTVNGKLDIRALPAPQYGATGSYRA
FT                   PASPVEEVLAGIYAQVLGLDRVAVDQSFFDLGGDSILAIQVVARARAAGVVCRPRDVFT
FT                   EQTVAGLATVAAVFDDANDDGGHAEDSVGEVVATPIMLWLQSLDGPLKEFNQTALLQAP
FT                   AAMSYGDVIVSLQAVLDRHAMLRLQVDTDATGRWLLHVPAPGCVDARKCVRAVTALSDD
FT                   ELVQARSRLDPSAGVMVSALWVTSSAQLALVIHHLAIDGVSWRILLDDLNSVWEQHRSG
FT                   EMAALPAGGTSFRRWAALLAEQAYSATAVDHAAAWRQVLATPSVLPAVKPAVDTYATAQ
FT                   RLLVSLDIETTRTLLAAAPAAFHAGVQDILLIAFALAWSEFSSGGGSRIAIDVEGHGRH
FT                   EELAFGVDLSHTLGWFTTKYPVAVSVGALRWAQVVAGDAALGAVVKDAKEQLRGLPDGL
FT                   LYGLIRYLNREVELAGAEPTIGFNYLGRLSTRTTAGDDHWQIARWGSLFTDECASAELP
FT                   IQLFHTVELDAVTFDTEAGPQLHAQWTWATSALDRAQLNRISRLWFEALTGICAHVRAG
FT                   GGGMTPSDIGLTRLSQHQIDQLEQRYCVADVLPLTPLQQGLLFHADAARGGADLYVVQF
FT                   DITLSGALDPRRLRTAAQEVLRRHPNLAAQFVWGEPLDEPVQIILNDLVLEWRTVEFDP
FT                   AGDPDAHVEQHIDEVCADERVAVADLGGGSPFRIALIRTAPCEHRLVLTAHHIVCDGWS
FT                   MPIVMQEILAAYAGQPLAAPGSYRNFLTWLAERDKSAARTAWRELFADFRHPTLVGLPD
FT                   HLGLGSRGVESYLLPIGITEALTELARSCRVTVNIVLQAAFAQLLSWLTGQHDVAFGTT
FT                   VSGRPAEVAGVHSMVGLFINTVPTRARMASTTTTRELLDQLQSVHYETLEHHHLALSDI
FT                   HRVSGHDQLFDTLFVYENYPIDKTAAQGTGELAISGIGCREYSHYPLVVQAMPGDQLGL
FT                   RVEFRTDVFDAASIAALIQRLQRVVVAMVADPDRRLSSVDLLDAAEHARLDVVGNRAVL
FT                   AEPLVEPVSVPGLFAAQVASRAEVTALVCGDRSLTYRELDRAANRLAHLLVDQGVGPGD
FT                   VVGLLLERSVEAVIAILAVLKSGAAYLAIDVNHPDGRIGFMIEDAAPVAVITTAGLAQR
FT                   LAGYPVAVIDIDDPAIATCYPGHGLPFPSADNIAYLIYTSGTTGKPKGVGITHHNITQL
FT                   FTSVAATGFTPAPGQIWTQCHSYAFDLSVFEMWGALLHGGRLVVVPESVTGSPADLHAL
FT                   LVAEQVDVLAQTPSAVAMLSTQGLESTTLVVGGEACPAEVVDNWAPGRMMVNQYGPSET
FT                   TMYVSMSAPLVPGSGPAPIGVPVPRAALFVLDGWLRPVPAGVAGELYVAGAGVGCGYWR
FT                   RSGLTASRFVACPFGALGARMYRTGDVVRWGPDGQLQYVGRADEQVKIRGYRIELGEVA
FT                   AALSQLDGVDQAVVIAREDRPGDKRLVGYLVGSVDAGQARAALAQALPAYMVPAAVVVV
FT                   DSLPLTVNGKLDIRALPAPQYGATGSYRAPASPVEEVLAGIYAQVLGLDRVAVDQSFFD
FT                   LGGNSILAMRVSSAIEKFLGVDLPVRLMFEAPTVESLSRQVESPYSSVELAPVELLKQG
FT                   AGTPLFCLPPGGGLSWIYRNLGAYLDCPIIGIQQVPSDQEVEPGSVGDMARRYVDMIQA
FT                   HHPDGPYNLLGWSMGGVVAHEIAVELRRRGCEVGRLIVLDAAGEVDSADSVAEPASESD
FT                   VLELILVAAGIDIAEHPRPLTYHEAEALLNQRTPVEFSLPPRRIVEIMLDNMNANQSMR
FT                   LKHVPDVFDGDMIVFSAKRDSGGRSLADSWRQYVAGDITEYPIDCTHEAMLNIESLQLF
FT                   ADRIAIYLR"
FT   gene            114798..115397
FT                   /locus_tag="MMAR_0100"
FT   CDS_pept        114798..115397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0100"
FT                   /product="4-hydroxybenzoate synthetase (chorismate lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38571"
FT                   /db_xref="GOA:B2HJA2"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA2"
FT                   /protein_id="ACC38571.1"
FT                   /translation="MNRRYLSDEEIQGLNRDLRILVTTNGTLTRILNIVTADEIVIENI
FT                   DQEILPDAPTPPDRAQLPKGGTLLRNVVLKGRHSGSSFVAAETSIVVDRVPPELIESLM
FT                   NTDRPIGELLVASRIEFFKEAPEVWIGELPEWIVAPEYGISQHQALARRYTIIISGQPA
FT                   IVITEHFLPEIFICCLNNDIAINKDIRPISAPRPKQ"
FT   gene            115545..122879
FT                   /locus_tag="MMAR_0101"
FT   CDS_pept        115545..122879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0101"
FT                   /product="polyketide synthase PKS"
FT                   /note="function unknown but contains a single extension
FT                   module with domain structure (KS, Ata, DH, KR, ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38572"
FT                   /db_xref="GOA:B2HJA3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA3"
FT                   /protein_id="ACC38572.1"
FT                   /translation="MRNNNLAWLLANQALASEWSASPAYYAPNIVTHAQIHEGAARLGN
FT                   VFGSRGLRTGDRVLLCLPDSTDLVQLLLACLARGIVAFISNPELRPDDHTFQEQDTQPA
FT                   LVVTTDALRDRFARSGIVDPGELWAEANQAKPAAYEPLTGDALAYGTYTSGTTGAPKAA
FT                   LHRHGDVWAFIDAMCRNALRLTPDDVGLSIARMYFAYGLGNSVWFPLATGSSAVISRSP
FT                   LGAESAANLSERFSPSVLYGVPTFLARVADTCAADAFRSLRCVVSAGEALELGLAQRLM
FT                   KFFGGIPLLDGIGSTEVGQTFISSTVDEWRLGTLGKVLSPYEIRVVAPDGTTAAPGVEG
FT                   DLWVRGPSLTAGYWNRPTQPPSISDSWLDTRDRVCVDAHGWVTYRCRADDIEIVGGINI
FT                   NPREIEQLIVEDHLVAETAVVAVREATGESALQAFLVPESGASLGESAIKELHRRLLGS
FT                   LSPHKVPHRFEIAERLPRTASGKLQRGQLRTQPAAQPVWERRCTVGTSDSDGQRDPQTQ
FT                   TNYKVGPRVGPVTLDERLAVLQQEGHRLIADTVSAEVAQILGDPAAERIDRDVAFAELG
FT                   FDSRMTVELRNRLAAVTGLRLPETVGWDYGSISRLAAHLETELAGSGGRGKPGPSVAGG
FT                   APVAIVGVGCRYPGGVESAGGLWDVVVGGRDVISGFPVDRGWDVEGVFDPDPDALGKTY
FT                   CRLGGFLDGADRFDAGFFGIGPSEALAMDPQQRLLLECSWEALEDAGIDPVSLRGSVTG
FT                   VFTGLMSSDYGAGRVSGDLEGYGLTSAAASVASGRVAYLLGLEGPAVSVDTACSSSLVA
FT                   LHLAASSLRSGECDVALAGGVTVMATPATFVGFSRQRGLAADGRCKAFAGAADGTGFSE
FT                   GAGVVVLMRLSEARRRGLAVLGVIAGSAVNQDGASNGLTAPNGPAQQRVIEAALANAGL
FT                   TAADVDVVEGHGTGTTLGDPIEAQALLATYGQARPADQPLWLGSIKSNMGHTQAAAGIA
FT                   GVIKMVQAMRHELMPATLHVDVPSPHVDWSSGAVSLLTQPRPWPAVDGRPRRAGVSSFG
FT                   ISGTNAHVIVEQVCPEVVAEAVDVSPDSLPWVVSGKSEAAVAAQAKRLLAAVQADEGLD
FT                   RLDVGFSLARRTAFEYRAVVLGEDRQQLISGLTELAAGQPGPTVLNGRAATVSKTVMVF
FT                   PGQGSQRLGMGQQLHGQFPVFAQAFDAVVEQLDRYLRLPLRDALWGGDEHLLESTEFAQ
FT                   PSLFAVEVALFALLRDWGVSPDVVMGHSVGELSAAHVAGVLTLDDAAKLVAARGRLMQA
FT                   LPEGGAMFAIAASEHEVSPLLGEAVGIAAINAPDAVVISGERAAVGVLAEELIDRGRRV
FT                   HRLAVSHAFHSPLMEPMLADFALAAGDITAHPPRIALVSNLTGELAGPDYGSAQYWVEH
FT                   VRRPVRFADSVRNLEELGASHFIEVGPGGGLSSAIAQSLRSPEAVTVPVLGKDRPEVNS
FT                   LISAVGQLFSTGVGVDWSAVFAGSGGRQVGLPTYAFARRRFWLDGSASAADVGEAGLVA
FT                   AGHALLGAVVEQPDTGAVVLTGRLSLARQPWLADHLVGGAVLFPGTGFVELAIRAGDEV
FT                   GCGVVEELTLATPLVLNAGTAVQVQVVVGSAGQSGQRLVSMYSRADQPDQHWVLHAQGS
FT                   VAPAAVQPAAAASAELSTWPPAGAEAVDIGGLYERLARRGYGYGPAFQGLRAVWRRGRD
FT                   VFAEVGLPNDEGLDLTDVGIHPALLDAVLHATMAAAGADVAEMRLPFSWRGVSLHAAGA
FT                   AGLRARIAALDGGDGAAVSVELADAAGLPVLSVDSLVTRPVTANQLNAAIAAAAGAPDD
FT                   KLLEVAWSPIALNDRTIGGRDDVPVMLWDDHRDDDGHGAGTVVIWESCCAADDDVVRSA
FT                   YAATHAALAVLQSWLSGDRPGTLVIVTHGGVALTDEGVKDLAAAAVWGLVRSAQSEHPG
FT                   RIVLIDTDSAPTDPEVLMDLANLAGRGEPQLLVSGGAVYGARLAPIPPALSATDGDCPT
FT                   SDGPAELASVLDPAGTVLITGGTGMAGGVLARHVVGAGGVRHVVLASRQGEQAPGVAEL
FT                   VSELSAAGAEVLVLACDVADRDAVAQMMEQVRRRCPPLTGVIHAAGVLDDTVIASLTPD
FT                   RMNPVLRAKVDGAWHLHQLTRGLGLSMFVLCSSIAGVMGSPGQGNYAAANTFLDALAAH
FT                   RRATGLAGLSVQWGLWEQTSAMTGHLGERDLARIRRSGLAPMSVGQAVELFDAAVLLDR
FT                   STVVAACLDRNALASPAVSAELPMLFHSLLPRPSRRVINKDATTHESGLAQRLQALSPH
FT                   QQHQLLVETVRNQAAVVLGRPSGQDIDPECTFQDLGLDSLTAVELRNRLKAASGLSLSP
FT                   TLIFDYPTPATLARHLAQQLIGTGTTGSAQIESQLETLQQTLLAIEDGDKQRVAAQLRK
FT                   FLTRLLAPAESGRPLDDRIKDATSPSEILQLIDAGSIES"
FT   gene            122876..129469
FT                   /locus_tag="MMAR_0102"
FT   CDS_pept        122876..129469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0102"
FT                   /product="polyketide synthase PKS"
FT                   /note="function unknown but contains a single extension
FT                   module with domain structure (KS, ATP, DH, ER, ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38573"
FT                   /db_xref="GOA:B2HJA4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA4"
FT                   /protein_id="ACC38573.1"
FT                   /translation="MKGAKTMNPECMDPEHNNLFEALKRVAVELNQTRAQLREHEERAD
FT                   VPVAIVGVGCRYPGGVESAGGLWDVVVGGRDVISGFPVDRGWDVEGVFDPDPDALGKTY
FT                   CRLGGFLDGADRFDAGFFGIGPSEALVMDPQQRLLLECSWEALEDAGIDPVSLRGSVTG
FT                   VFTGLMSSDYGAGRVSGDLEGYGLTSAAASVASGRVAYLLGLEGPAVSVDTACSSSLVA
FT                   LHLAASSLRSGECDVALAGGVTVMATPATFVGFSRQRGLAADGRCKAFAGAADGTGFSE
FT                   GAGVVVLMRLSEARRRGLAVLGVIAGSAVNQDGASNGLTAPNGPAQQRVIEAALANAGL
FT                   TAADVDVVEGHGTGTTLGDPIEAQALLATYGQARPADRPLWLGSIKSNMGHTQAAAGIA
FT                   GVIKMVQAMRHELMPATLHVDVPSPHVDWSSGAVSLLTQPRPWPAVDGRPRRAGVSSFG
FT                   ISGTNAHVIVEQVCPEVVAEAVDVSPDSLPWVVSGKSEAAVAAQAKRLLAAVQADEGLD
FT                   RLDVGFSLARRTAFEYRAVVLGEDRQQLISGLTELAAGQPGPTVLNGRAATVSKTVMVF
FT                   PGQGSQWPGMGRELLAASPVFAEHMRLCAEALGEFVDWSLLDVVNGVAGAPTLDRVDVV
FT                   QPVLWAMMVSLAQLWRSVGVVPDAVIGHSQGEIAAACVAGALSLRDGAAVVALRSRALV
FT                   DLAGTGGMVAIACGVERVRELLADYGDRLSLAAVNGVAAVVVSGEAKALRGLTGRCEAE
FT                   GMRARRIEVDYASHSAQVESIGSSLVEALAGVRPRSSDIEFVSTVTGASVDGASLGADY
FT                   WYRNIRQTVRFDRAVRYCHEQGCRTFVEASPHPVLLAGIEESLAEGIGRPDSAGVIVIP
FT                   TLGRNEGGVERFWMSLSQAWLAGVGVDWSAVFAGSGGRQVGLPTYAFARRRFWLDGSAS
FT                   AADVGEAGLVAAGHALLGAVVEQPDTGAVVLTGRLSLARQPWLADHLVGGAVLFPGTGF
FT                   VELAIRAGDEVGCGVVEELTLATPLVLNAGTAVQVQVVVGSAGQSGQRLVSMYSRADQP
FT                   DQHWVLHAQGSVAPAAVQPAAAASAELSTWPPAGAEAVDIGGLYERLARRGYGYGPAFQ
FT                   GLRAVWRRGRDVFAEVGLPNDDGLDLTDVGIHPALLDAALHAWLCVGGFGGDGEATVLP
FT                   FSWQHLSLHGSGASRLRVRIAPAGPSAVSVELADGAGLPVLSVGSLTTRPVGAAQLQAA
FT                   MSAGGDGTGRELLNVVWTPITFERDSVQRDGERRVVSWDDFLAGRCAAARDLDRDVAVV
FT                   WQWESGGAESVVNTVYTATHRVLEVLQRWLADDLPAVLVVCTRGAMGLAGEAITDLAGA
FT                   AVWGLVRSAQTEHPGRIVLIDTDTSMALPTVIGVGEPQLVVRAGDVYAARLARGRAALR
FT                   TPDAGQGWQLAATGGGTFDDVVLEPCPRSDEPLAVGQVRVALAALGVNFRDVLVVLGLY
FT                   PGNKPTLGGEGAGVVVEVGPGVSGLEPGDRVLGLMSGRSECVVDQRLLVPIPAGWSFAE
FT                   AASAPIVFLTAFYGLSDLAGLRRGESVLVHAATGGVGMAAIQLARLWGARVFVTASRGK
FT                   WDTLRAMGFDDDQIADSRTLEFEEKFSAATGGRGIDVVLNALAGEFTDASLRLLAERGR
FT                   FIEMGKTDIRDAQEVAQEHPGVSYRAFDLANEVAPQRLGQMLAELMTLFAAGKLHRLPV
FT                   KTWDVRCAPQAYQFVSQARHIGKVVLSAPTELRDALAAGTVLITGGTGLVGSVLARHLV
FT                   SAYGVRNLVLVSRMGEQGAGVAELVDELSDAGARVLVAACDVADQSAVEKLIAGWGREY
FT                   PALTGVIHAAGVLDDAVITSMTPDQVDSVLRAKVDGAWNLHHATRGLGLSMFVLCSSIA
FT                   GVVGAPGQGNYAAANAFLDALVTDRRAHGLAGVSLGWGLWEQASGMTKHLRGSDVSRLS
FT                   RGGFAAISAQQALDLFDAALIVDQPTVLAARLDRRALENPALNADLPTLFSDLITRPMR
FT                   RNVDNDGTPTELALVNRLNMMNPDEQHDLLTEVVCTQAVMVLGRLNAADIDPNATFSDL
FT                   GFDSLTAIELRNRLKTVTGLTLPPTLIFDHRAPSALAQHLGQQLCVTHQHESHNAMAPA
FT                   DSEDEKLRSILSAISVADLRDAGLLDKLLRLRKDPDRNLRVDRVDRVDNVGTKQQELEG
FT                   MINSLSPEELVAMALAEPSGGNRMDSGG"
FT   gene            129487..130578
FT                   /locus_tag="MMAR_0103"
FT   CDS_pept        129487..130578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38574"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA5"
FT                   /protein_id="ACC38574.1"
FT                   /translation="MQQLGPKCARGQLSQPDRAWLDAARSSRSQPSTDRLSALKLSGSQ
FT                   LSATDARAIGQSTQIFPRHVSKISLWSTSSGCNPGLKYTFALGAMPSKKWDTGQHDRAA
FT                   QRFDGMEPGPRSAAEPYTCRVNISKAIVGAATAPIRAGVAVADAGLSVAAVALGAVKQS
FT                   LGEESPKTVDPITDLFPLRGAIVGANRVAELTENDRAMGRALVRGGAADKLMRPGGIVD
FT                   LLTAPGGLLDRVSAADSSSLERILAPGGLADRLLAEDGPLERMFAEDGIIERMFAEDGV
FT                   IDKLLVKNGPLEQFTEAAEILSQLAPAVDKLTPTTDTLESAVVTLNKMVNSLSGITDRI
FT                   PRRRSTRPAVRAKRTTDQAGVDE"
FT   gene            130639..132027
FT                   /locus_tag="MMAR_0104"
FT   CDS_pept        130639..132027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown but probable role in the production
FT                   of unknown PKS/NRP metabolite from this locus. amino acid
FT                   homology suggests this gene product may have fatty acid
FT                   ligase activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38575"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA6"
FT                   /protein_id="ACC38575.1"
FT                   /translation="MMAVGECTTLIAWEAWRFRRGDGAAISRRQRARLQTLVRHARTAS
FT                   PYYRRLYRDIPSGQVPLASLPVVSKRDLMAHFDDWVTDPDITIESLRRDFLSDHSLLGA
FT                   RYLGRYHVATTSGTSGEPAILIHDDASWAVFQFVGRRGESRFIARRELLSGVLRRGLRA
FT                   AALFVADGHIGASAALAAARRRSAFLASRARVFSVLRPVPDLVREINEFEPTIVEGYPS
FT                   ALALLAGEQRAGRLAIEPLLAITAGEQLTPALRADIESTFGCPIQNRYASAEFPGLSME
FT                   CRYGSLHVNTDWYLFEPVDENYQPVAAGAVSHTVLVTNLANRVQPLIRYDLGDRVKPTG
FT                   TPCACGNRLPAITVEGRAADLLSFEAPDGTAITVLPLALVTVIEETPGVHRCQAIRTGP
FT                   RALTVRLEISPGTDPGQVWRAVDERLHAFFAAQQTAPIAVEHAVEPPAVDPRSGKFRQV
FT                   WSAH"
FT   gene            complement(132134..132397)
FT                   /locus_tag="MMAR_0105"
FT   CDS_pept        complement(132134..132397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38576"
FT                   /db_xref="GOA:B2HJA7"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA7"
FT                   /protein_id="ACC38576.1"
FT                   /translation="MTDEQRRQALARIHAKRSFWWHLGAYILGNAALVAIWFFTSGGYF
FT                   WPIWPALGWGIGLVFHGLGVFLGMRPITEEQIQREIDRGHLS"
FT   gene            complement(132604..133635)
FT                   /locus_tag="MMAR_0106"
FT   CDS_pept        complement(132604..133635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains two MaoC acyl dehydratase domains"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38577"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA8"
FT                   /protein_id="ACC38577.1"
FT                   /translation="MTAAAEASAMESRVGHYYRLDETYRVGREKVREYARAVQDYHPAH
FT                   WDMAAAEKLGYSGLVTPLTFTSIPAMAANRYLFESVVVGYDTYMQTEEVFEQHRPIVAD
FT                   DELHVDVELSSVRRIAGRDLITVTNTFTDTAGERVHTLHTTVVGITAEDVDPAIKSAVQ
FT                   NTIMHDVNILEIAAADAAYQKTVRPEGEIRIADSGTTRTPGTPSFEDVQVGDELPVRHA
FT                   RLSRGDLVNYSGVAGDANPIHWDENIAKLAGLPDVIAHGMLTMGLGAGFLSAWSGDPGA
FT                   VTRYAVRLSQPAIVSAAEGADIEYSGRIKSLDPATRTGVVIVAAKSGGRKIFGLATLNV
FT                   RFS"
FT   gene            133857..134909
FT                   /gene="celA"
FT                   /locus_tag="MMAR_0107"
FT   CDS_pept        133857..134909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA"
FT                   /locus_tag="MMAR_0107"
FT                   /product="cellobiohydrolase a (1,4-beta-cellobiosidase a)
FT                   CelA"
FT                   /note="hydrolysis of cellobiose"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38578"
FT                   /db_xref="GOA:B2HJA9"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJA9"
FT                   /protein_id="ACC38578.1"
FT                   /translation="MAFVELWHYFAGVMSSAFGALARRIAPFLAVSAAAYLAFFAAPAP
FT                   VVPAPPITLVDGANPLAGQPFYVDPGSAAMVAARNATPPSPELNAIANTPQSYWLDQAF
FT                   PASTVGGTVARQTGAAQAAGAMPILTLYGIPHRDCGSYASGGFATGADYRAWIDAISSG
FT                   LGSAPAAIIVEPDALAMADCLSADQRQERFDLVRYAVNTLTRDPAAAVYVDGGHSRWVS
FT                   AEEMAARLNQVDVGHARGFSLNISNFYTTDEEIGYGEAISGMTNGSHYVIDTGRNGVGP
FT                   APESPLNWCNPDGRALGVAPTTATAGAHADAYLWIKRPGESDGSCGRGEPQAGHFVSQY
FT                   AIDLAHNAGQ"
FT   gene            135051..135656
FT                   /locus_tag="MMAR_0108"
FT   CDS_pept        135051..135656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0108"
FT                   /product="transcriptional regulatory protein"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38579"
FT                   /db_xref="GOA:B2HJB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB0"
FT                   /protein_id="ACC38579.1"
FT                   /translation="MISTSGTERRADGRQLRYQHRRGEIFDAVMAHVLEHGITGLSFRT
FT                   LAAAVGVSHVTLRHHFGTKDQLLVEILGAIGTRIVIPEQLGADDVEALWRRWNEPGAQR
FT                   RSQLLFEAYAQAVRHPDEYRGFLDRIVTDWIETIRQHAVQAGCPSDEAENFATLLIAQL
FT                   RGLQFDLLASNDRARVAAALGTVVDGVRAKRAEWDASR"
FT   gene            135771..136856
FT                   /locus_tag="MMAR_0109"
FT   CDS_pept        135771..136856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38580"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB1"
FT                   /protein_id="ACC38580.1"
FT                   /translation="MPNMDIPFQPLRNSLYTSLELMGGFDPERPLSAAETLDFQTYRYF
FT                   TANGGACPNDPYAGMMQALHDHSIMRAISKFFTSVDVPTVAIMGGHDVPRSAARYLDVV
FT                   HVARTLTRCGCLVASGGGPGTMEATHLGALLATASDQDVTDAVQHLRSRPTLPDTTSVV
FT                   SQTGEVDTAIVRQLHSWAKPAFEIAQTFTETGGRSLAVPTWHYGCEPLTPLATHVAKYF
FT                   QNSLREDMLLSLAANGIIYTPGASGTLQEVFQNAAQNYYPRSGQEFSPMIFYGREFWTE
FT                   KLPVLPVLEGLFVGNAKLTPEEFGRLIRVVDTAEEAVNALLEHRPSTTKMIHRMQAEGF
FT                   GPILAAAAGSAEAATSVLGAR"
FT   gene            137017..138456
FT                   /locus_tag="MMAR_0110"
FT   CDS_pept        137017..138456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0110"
FT                   /product="oxidoreductase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38581"
FT                   /db_xref="GOA:B2HJB2"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB2"
FT                   /protein_id="ACC38581.1"
FT                   /translation="MAREISRQAFLRGAAGALAAGAVFGSVRAAAEPNPSGWEGLSSAL
FT                   GGKVLRPDDGPQFATAKQVFNTNYNDFTPAAVVTPTSAADVQKAMAFATAHNLKVAPRS
FT                   GGHSYIGASTANGAMVLDLRQLPGDINYDAATGQVTVTPSTGLYEMHQVLAGAGRGIPT
FT                   GTCPSVGAAGHALGGGLGAHSRHAGLLCDALTSAAVVLPSGQAVTASAASNPDLFWALR
FT                   GGGGGNFGVTTSLTFATFATKDLDAVNLDFPPESFAQVLLGWQQWLRTADRNNWALADA
FT                   TVDQMGTHCRILATCPVGSGGSVASAITSAVGVQPIGTDHHTFNYLDLVRYLAVGNLNP
FT                   APLGYVGGSDVLPTINAGAAKGIASAIDAFPRGAGRALAIMHALDGALATVAPGATAFP
FT                   WRRQSALVQWYVETPGSPAAASGWLNTAHQAVQPYSAGGYVNYLEANQPASRYFGPNLS
FT                   RLSAVRQKYDPGRVMFSGLNL"
FT   gene            complement(138493..139467)
FT                   /locus_tag="MMAR_0111"
FT   CDS_pept        complement(138493..139467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0111"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38582"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB3"
FT                   /protein_id="ACC38582.1"
FT                   /translation="MSFVLATPELMTTAAQDLAAIRSTLGEASATAAAPTTALAAAAED
FT                   EISTGIAALFGAFGSDYQAISAQAQAFHEQLINLLTASGGAYLSAETAATATVTTGGFP
FT                   SLVANTTANLQTIADTWTNQTVPILTHAVTGYPQLISTSLASGNVLPLLAIPANLAQGS
FT                   ATLYQAFSSPVSLSLTSLTPSGISLGVGLGLPQLLALNALGAPVNAGLAAGASGTAIFG
FT                   ALQAGDTMGAISTLADTPANIANGFLNGSQTLSMQLSLPGLSVAADIPFSGLLSPLQPL
FT                   SLTATTPVLPLLNSLTITGPPVGGLVPSLVQYVPELLATSLGP"
FT   gene            139721..140698
FT                   /gene="dhaA_1"
FT                   /locus_tag="MMAR_0112"
FT   CDS_pept        139721..140698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaA_1"
FT                   /locus_tag="MMAR_0112"
FT                   /product="haloalkane dehalogenase DhaA_1"
FT                   /note="generates a primary alcohol and halide from 1-
FT                   haloalkane and H2O [catalytic activity: 1-haloalkane + H2O
FT                   = a primary alcohol + halide]. thought to be regulated by
FT                   Rv2720|LexA in M. tuberculosis"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38583"
FT                   /db_xref="GOA:B2HJB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023594"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB4"
FT                   /protein_id="ACC38583.1"
FT                   /translation="MPAGAPPIDCRYGLPGHYARVQAFSPTHLEAPMTEIDPTPLTKRR
FT                   LAVDGKQMAYHESGEGRSVVFLHGNPTSSYLWRNIIPHVSDRARCIAPDLIGQGDSDKL
FT                   DDTGPGSYRFVEHRHYLDGLLDQLDLGDDVVLVIHDWGSALGFDWANRHRERIGGIAFM
FT                   EAIVRPVTWAEWPESAAGIFRGFRSDAGEQMVIDKNLFVEAVLPGSILRGLTPAEHDEY
FT                   RRPFVEPRHRRPTLSWPREIPIEGEPADVHQIASDYAQWLPTADFPKLFINAEPGAILT
FT                   GPQREFCRSWTNLTEVTVPGSHFIQEDSPHEIGQAIADWLSSLG"
FT   gene            complement(140862..141167)
FT                   /locus_tag="MMAR_0113"
FT   CDS_pept        complement(140862..141167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38584"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB5"
FT                   /protein_id="ACC38584.1"
FT                   /translation="MLMHASQPPSKHPEWQRRLCMDRLLPELVTMDVGQAIVESRGLKD
FT                   DQKDHRTVDNLRRKRALGGRLHLDHVGGPTEPMLWIPDACCGAVTQHRCGDSETTP"
FT   gene            complement(141538..141798)
FT                   /locus_tag="MMAR_0115"
FT   CDS_pept        complement(141538..141798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0115"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38585"
FT                   /db_xref="GOA:B2HJB6"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB6"
FT                   /protein_id="ACC38585.1"
FT                   /translation="MTDLLVAAILAGAFGLALWGAGAFGLARRPHYPLASYLAAGGVVV
FT                   ALIVVLLTTGRTDWVIVSAGALALFIPLIVIRERRAERKRR"
FT   gene            complement(141795..142814)
FT                   /locus_tag="MMAR_0116"
FT   CDS_pept        complement(141795..142814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0116"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38586"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB7"
FT                   /protein_id="ACC38586.1"
FT                   /translation="MPATLSQVRAWSTEHLIDTAGYWTKTADQWENAFFQMRNQSYALG
FT                   WSGAGGDALRERTSADLPIVGAKADMLRQAAGIAGNGASDISAAQRRVLYAVEDAHNAG
FT                   FTVGEDLSVTDTHRSGTPAEQAARQAQAQAFAGDIRLHARQLDGADAKVAGQLTAATAD
FT                   LSSVGFAQNPIPATQAPTTHRNGVQLVDFKQNGGEPPPFAPWDTPDGTPPPGAPGLSPE
FT                   LQQMILGGDPANLTGQGLLDNLQQLVQSLPENDPRTAWLRGQVADLQAHMSDIDYARTH
FT                   CTTSDWFDRTTLFASGLVSTGILTLTAETGVGGVAAVASGFGTLVAGKNLLGCLVGSK"
FT   gene            complement(142815..143285)
FT                   /locus_tag="MMAR_0117"
FT   CDS_pept        complement(142815..143285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38587"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB8"
FT                   /protein_id="ACC38587.1"
FT                   /translation="MHRSPRPPRRHKPTTTEKPRQVRPNLVNTRTTSLVTNPTSAHEAK
FT                   WCPRGPGFRLARVGSDELHVKLGQLGVTASQWQDLRAQLAAGATPPAPGQPFQATAAAV
FT                   SGIGAAIGGTGVALATRTQATAAAVTAAAASYANQEATAAGEMAAVTQVRVV"
FT   gene            complement(143631..144206)
FT                   /locus_tag="MMAR_0118"
FT   CDS_pept        complement(143631..144206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0118"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38588"
FT                   /db_xref="GOA:B2HJB9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJB9"
FT                   /protein_id="ACC38588.1"
FT                   /translation="MPRYIDVDGLFDITVTVFAECGYRATTTQEIARRAGVNEVTLFRR
FT                   YGNKATLINSALTHALANSPFARVVATDDIRGDLLALVTAYAETVQKYGGAVVTLAVEV
FT                   PRNPELGTAMAALMPNLHNAAQVIETHQTQGQLAPGDPYQKLVMLLGPLMAAGLWSRTG
FT                   AEALASQLDFGALVAAFLDGHRAPEDRR"
FT   gene            144293..145480
FT                   /locus_tag="MMAR_0119"
FT   CDS_pept        144293..145480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0119"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="function unknown but some domain identity with
FT                   nitroreductase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38589"
FT                   /db_xref="GOA:B2HJC0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC0"
FT                   /protein_id="ACC38589.1"
FT                   /translation="MERSAMNDAQQLPQDHDTYPTQRSRRSILWRTKVRLQFTGWLQYL
FT                   ITAVVAAVFLAVAGLGWLIGVWQPLLLWTPLGIGLLLLVISILDVITVKWGLRPAESLP
FT                   RRSDHPNAFDMMRARRSCHSFQKRDLTERDRAGLIRAAAACTDRDRLIGTSPIRFEYIR
FT                   ATRLAWTVEGAHEFLVAIAPRNYDRLALLDVGRSLQKVVLHATRTGVATCWIGPGANQT
FT                   RVVEHLGDRFDPSQDHVVCICALGYRSRFLPLFIRLIERIQNRRLPLASLFFADPNLRV
FT                   PLAVDTAPFAAFGRCYEICQWSPSSYNAQTTRCVAVTESRNGSTRVARLDFFATTTSRF
FT                   YAPVAVGIWCANWETGCAALGIPGHFAVLPADAPGIRGYPDVPHYDVSWIADPKS"
FT   gene            145613..147001
FT                   /locus_tag="MMAR_0120"
FT   CDS_pept        145613..147001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown but contains C-term predicted
FT                   ATPase domain (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38590"
FT                   /db_xref="GOA:B2HJC1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC1"
FT                   /protein_id="ACC38590.1"
FT                   /translation="MTLTNDELTDLTTGLTGGDEARRQPITDVNAWLDGLEYGVRPALR
FT                   ALGELLIGVAEREGCENADRFIARCLGVPDSGHLLDEERDLNPVSRLTTALALAEWIEQ
FT                   HAHACEVGPGEHAYPPKWTQTEIGGRRYRHPLCLCVHFPAGTLLAETGCVIHIEARETV
FT                   MHSAEVSAYVTPDNQAHARAVLDRLAERANELNPYRGEAVRATNNHGLNFSVIDLPSTA
FT                   TRDTVIVPDAVWTEVDLGVASVRDRHDLLNAHGLGARRGVLLCGPPGTGKSAVSAVVAA
FT                   EVVGEFTVIYVEAKAGADLLTAVVEEAQRLGGPVLIVLEDVDLWCRDRRAGDGGLSELL
FT                   AAMDIRPEARILTLASTNDAETLDKAAVRTGRFDSIVEVGHPNRADAARILAALIRDIP
FT                   GGAAVDTAAVVAALPERTSGSDIREVVRRAVLAGDRGSVSTAALLAELGSGRYRATVPH
FT                   GMYL"
FT   gene            147163..149505
FT                   /locus_tag="MMAR_0121"
FT   CDS_pept        147163..149505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0121"
FT                   /product="formate dehydrogenase H"
FT                   /note="decomposes formic acid to hydrogen and carbon
FT                   dioxide under anaerobic conditions in the absence of
FT                   exogenous electron acceptors [catalytic activity: formate +
FT                   NAD(+) = CO(2) + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38591"
FT                   /db_xref="GOA:B2HJC2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC2"
FT                   /protein_id="ACC38591.1"
FT                   /translation="MAFQRSAASGDVPAEYDEDSITVTSPKREAAGVRAVLVSLQRGLE
FT                   QMGAFRTAAALARLNQRNGFDCPGCAWPEEPGGRKLAEFCENGAKAVAEEATRRTVTPE
FT                   FFARHSVTELLAKPEYWLSQQGRLSHPMVLRPGDDHYRPIGWDEAYRLIAEHLKALGSP
FT                   DEALFYTSGRTSNEAAFCYQLLVRSFGTNNLPDCSNMCHESSGSALSESIGIGKGSVTV
FT                   EDVEHADLIIIAGQNPGTNHPRMLTVLEKAKANGAKIIAINPLPEAGLIRFKDPQKMNG
FT                   VVGHGVPIADEFVQIRIGGDMALFAGLGRLLLEAEERAPGTVVDQAFVDQHCAGFDEYR
FT                   RRTLQIEMDTVLAATGVGAPQLERIAAMVMASQRTIICWAMGLTQHSHAVATIGEATNL
FT                   LFLRGMIGKPGAGVCPVRGHSNVQGDRTMGIWEQMPEQFLAALDREFGIDSPRKHGYDT
FT                   VAAIRAMRDGQAAVFMAMGGNFASATPDTAVTEAALRSCALTVQISTKLNRSHLVHGST
FT                   ALILPTLGRTDRDLRDGRKQVVSVEDSMSMVHLSRGSLHPPSDQVRSEVQIVCQLARTL
FT                   LGAQHPVPWERFASDYDTIRDAIASVVPGCADYNLRVRQPDGFQLPHPPRDAREFPTST
FT                   GKANFSVSPLQWVPVPPGRLILQTLRSHDQYNTTVYGLDDRYRGVKGGRRVVFMHPSDI
FT                   EALGLTAGERVDLVSEYHDAGGNLQERRAKDFLVIGYSTPVGNAAAYYPETNPLVPLDH
FT                   TAEKSNTPVSKAIVVRVEPASGGDDRR"
FT   gene            complement(149522..150760)
FT                   /gene="cyp279A2"
FT                   /locus_tag="MMAR_0122"
FT   CDS_pept        complement(149522..150760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp279A2"
FT                   /locus_tag="MMAR_0122"
FT                   /product="cytochrome P450 279A2 Cyp279A2"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38592"
FT                   /db_xref="GOA:B2HJC3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC3"
FT                   /protein_id="ACC38592.1"
FT                   /translation="MTSTVDRQVAPNVFAAGLPNIDYQNAQSPDEAHQILAEARCRSPI
FT                   ALGPHGPELLTYDLVHTVLRDPRFRMPPGMFLAAQGITSGPLWDRLAANLISLDGPAHH
FT                   RLRRLVSQAFTPRATGRLNTTITEVITDLVDRCADRGRCDVVADIARRYPIPIICALLG
FT                   APAGDWKLFSGWTDDILKAFSWDAAAQQPAILAAWDELDAYIDDMVAARRGSLTEDLIS
FT                   ALIRAEDDGDCLSSDELRMLVAGLLIGGTDTTRNQLAASAQALCDHPDQWVLLAQHPDL
FT                   AANAAEETMRHSPITFSTLRIALDDVELAGVMIPTGTLVIANTGAANRDPALYRDPDRL
FT                   DISRPIAGPIQTFGAGMHYCLGANLARRELTEALRIITQRMPGARRTGAAPWKSLTGLS
FT                   GPTTLPIEFDAGH"
FT   gene            150923..154276
FT                   /locus_tag="MMAR_0123"
FT   CDS_pept        150923..154276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0123"
FT                   /product="transcriptional regulatory protein (LuxR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38593"
FT                   /db_xref="GOA:B2HJC4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC4"
FT                   /protein_id="ACC38593.1"
FT                   /translation="MLASMSEIDPRAEAPLVDWSDVDMGELLPTGTVTLLLADVEGSTR
FT                   LWQNQPEPMTAAVAHLDSVLATTVATHHGVRPVEQGEGDSFVVAFASAREAIACALDLQ
FT                   RSPLGPIRLRIGVHTGDIQLRDPNDPTNYIGPTINRTARIRELAHGGQTVISGATQLLV
FT                   VDQLPDGAWLADLGLHPLRDLPRPERVMQLCHSGLQNDFPPLRTTKSIAVHRMPARLTR
FT                   FVGRIAQMADVRSLLADNRLVTLTGAGGAGKTRLAVEIAASAVDEFGDGLWYVDLAPVS
FT                   HAEAVPVTVARALGLSDQPGRSTVDALARFIGEHQVLVVLDNCEHLLDATAALLLELTG
FT                   RCPAVRLLATSREPLGVPGEVTFLVPSLSVTEATELFTDRARRVRPDFAVTDDNTTAVT
FT                   EICNRLDCMPLAIELAAARVRALSIDEIRTGLHDRFRLLTGGARTVVRRQQTLRASVDW
FT                   SHALLTEPERVLFRRIAVFLGGFDLDAAQAVAGDSQVQRYQVVDELALLVDKSLVIAES
FT                   GGGPTRYRLLETVRQYAQEKLAESGEVEAVRSRHVTYYKSVAKLLDAPTGTDHERRLAQ
FT                   AEDELDNLRSAFGWSLETRDFDSALELATSLHPVWMTRGQGREGLAWLEAGLGNEAGLG
FT                   NEAGLGNEDVQVSPSTLARALADKVTLLAWTGSMAGFDDAERALTIARELADPALLIRA
FT                   LVARGVITAYDADVARPYFDEAAQLARELGDSWRLSQILSLQTRAAMAAGDPIALEAAG
FT                   EEGLRIAEAIGDRTTSRECRGALGWVRAWRGDPIGALHQLGEAIAEASAAHDLLLLMIS
FT                   QVVQGFTYAYVGDADGACACADAVFTSSAELVGANEGLGYATAAIACQAAGDATAAWKA
FT                   YQKARELVGMDPQMAGVFPFGALAPLVSGDLSAARRWADDVVSTSYGCYLSVALTARAR
FT                   VALAQGELGQADRDSHAALSCSAANGTTLGVADTLECLAELAATEGDRREAARLLASAE
FT                   AIRHRTGEVRLKILDAHCEVVLAELRNELGEQDFAAVWGQGAVISTDEVISYVRRGRGT
FT                   RRRPSSGWGSLTPTEHDVVRLVQEGLSNKDIAARMFISPRTVQTHLTHVYTKLGLTSRI
FT                   QLVHEVARHA"
FT   gene            complement(154332..155273)
FT                   /locus_tag="MMAR_0124"
FT   CDS_pept        complement(154332..155273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0124"
FT                   /product="quinone oxidoreductase"
FT                   /note="possibly binds NADP and acts through a one-electron
FT                   transfer process. quinones are supposed to be the best
FT                   substrates. may act in the detoxification of xenobiotics
FT                   [catalytic activity: NADPH + quinone = NADP+ +
FT                   semiquinone]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38594"
FT                   /db_xref="GOA:B2HJC5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC5"
FT                   /protein_id="ACC38594.1"
FT                   /translation="MDTMKAAIVRTFDEPPHFGDFPDPTSSKPGELIVDVVATALHPRV
FT                   RAQADGSHYTSTGELPFVPGIDAVVRDAEGTLYYAHLADTTLGTMAQRTIIDQQWAVAL
FT                   PDDADPVTVAAAVNPVLSSWVALRNRINFKPGSRVLILGATGSSGGMAIQVAKRFGAAE
FT                   VIAAGRNRQRLSELTSLGADRTLTLDQLGAAGDVDVVLDYVWGPPTAKGMVDLVTNRRD
FT                   PHEELIWIQIGSTGGPSADIVSAALRSTRLQIVGSGIGSVSERDIRNDIPGIAQAVAAG
FT                   EFEVRTQAMPLSDVTSAWTRPLGADRRVVFLP"
FT   gene            155386..155832
FT                   /locus_tag="MMAR_0125"
FT   CDS_pept        155386..155832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0125"
FT                   /product="transcriptional regulatory protein (MarR family)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38595"
FT                   /db_xref="GOA:B2HJC6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC6"
FT                   /protein_id="ACC38595.1"
FT                   /translation="MVVAMSGGGSPGKQLADDLRDALVQTSFALMAVLTEVAAEHDLSL
FT                   TQLRVLGIMRDREPTMGELASYTGLERSTVSGLIERAAARGLVVKTADENDGRAVRVNL
FT                   TTGARRLERETTKAIEQRIAPMLGRLSTREQQRLAALLSKTLER"
FT   gene            complement(155864..156622)
FT                   /locus_tag="MMAR_0126"
FT   CDS_pept        complement(155864..156622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38596"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC7"
FT                   /protein_id="ACC38596.1"
FT                   /translation="MSDSDMFDAARAAGSPIEQAVAVFMLHPDTFAESIEAGYEHPFAG
FT                   YVAGRAGVLGETTGVTVHSVFAVFEPSFIHGMWETGIAVRGAIGAAELYWDQVAGFARK
FT                   YLAAATGLDRIAALGEKIIAATPDAGLPLYAGWRTMALADDAAARALQVMFVLRELRAG
FT                   VHFNALSISGITPVEAHMLNKGHEYTTMFGWPEPFADGTDKKDRYAAVEEATNRRMAEI
FT                   FGAALDGGEADELARLSTAALATLKASAAS"
FT   gene            complement(156692..157801)
FT                   /gene="adhD_1"
FT                   /locus_tag="MMAR_0127"
FT   CDS_pept        complement(156692..157801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhD_1"
FT                   /locus_tag="MMAR_0127"
FT                   /product="zinc-containing alcohol dehydrogenase
FT                   NAD-dependent, AdhD_1"
FT                   /note="thought to catalyze the reversible oxidation of
FT                   ethanol to acetaldehyde with the concomitant reduction of
FT                   NAD. probably acts on primary or secondary alcohols or
FT                   hemiacetals [catalytic activity: an alcohol + NAD+ = an
FT                   aldehyde or ketone + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38597"
FT                   /db_xref="GOA:B2HJC8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC8"
FT                   /protein_id="ACC38597.1"
FT                   /translation="MKTTAAVLLEAGKPFEIMELELDGPRVGEVLIKYTAAGLCHSDLH
FT                   LTDGDLPPRYPIVGGHEGSGVIEEVGPGVSKVKPGDHVVCSFIPNCGTCRYCSTGRQNL
FT                   CDMGATILEGCMSDGSFRFHRKGVDFGAMCMLGTFSERATISQHSVVKIDDWLPLTTAV
FT                   LVGCGVPTGWGTSVYAGGVRPGDTTVIYGAGGLGINAVQGAVSAGAKHVVVVDPVAFKR
FT                   DTALKFGATHAFPDAASAAAKVNEITWGQGADQALILVGTVDTEVVSAAAAVIGKGGTV
FT                   VITGLANPEKLTVQLSGLDLTLNEKTIKGTLFGSANPQYDIVRLLRLYDAGQLKLDELI
FT                   TTQYRLEDVNQGYQDLRDGKNIRGVIVHD"
FT   gene            complement(157936..158958)
FT                   /locus_tag="MMAR_0128"
FT   CDS_pept        complement(157936..158958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0128"
FT                   /product="oxidoreductase"
FT                   /note="function unknown; may be involved in electron
FT                   transfer"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38598"
FT                   /db_xref="GOA:B2HJC9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJC9"
FT                   /protein_id="ACC38598.1"
FT                   /translation="MARVTLEPGAEEFLVGPDEDILSAALRSGINLQYGCRHGNCSSCK
FT                   HWLIDGDVDDSAASVYAIPRDERENGAILLCCTFARSDLVIEIHQNDGAEALPPMTPPS
FT                   RRRAKVLGLRTRTSNLIELRVELDDPLSFRAGQYAEFTLDSGERRSYSLVNPPSSAREL
FT                   TFCIKRVPNGLFNKVLDRIEPGSTLHLEAPFGTMFLRDTEHPVIAVATGSGIAPILSML
FT                   TDAAEQHPDVPFRFYYGARFVRDLVYLDEIAALSTRLKDFRFIPCLSQQAPDPVPNGRS
FT                   GRVTRAIATDIRDASPYAAYLCGAPEMCNDVGRLLEAKGLPEARIHADRFYPAVESISV
FT                   "
FT   gene            complement(158967..159284)
FT                   /locus_tag="MMAR_0129"
FT   CDS_pept        complement(158967..159284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0129"
FT                   /product="monooxygenase effector, MmoB/DmpM family protein"
FT                   /note="function unknown, but the MmoB/DmpM family consists
FT                   of monooxygenase components such as MmoB methane
FT                   monooxygenase regulatory protein B. When MmoB is present at
FT                   low concentration it converts methane monooxygenase from an
FT                   oxidase to a hydroxylase and stabilises intermediates
FT                   required for the activation of dioxygen"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38599"
FT                   /db_xref="GOA:B2HJD0"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD0"
FT                   /protein_id="ACC38599.1"
FT                   /translation="MSASEQHASTTVGIVLMKSEEADATVAYFTAECPQVRIQDRHTFY
FT                   LCETEGMIRIPLAEVEEFLGKPLTMSRFLVVMSSYYGRARVEDDAFVITSEMSQLEPAS
FT                   S"
FT   gene            complement(159281..160372)
FT                   /locus_tag="MMAR_0130"
FT   CDS_pept        complement(159281..160372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0130"
FT                   /product="monooxygenase hydroxylase, subunit B (AamH_B)"
FT                   /note="function unknown, but enzymes in this family are
FT                   involved in hydroxylation of hydrocarbons"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38600"
FT                   /db_xref="GOA:B2HJD1"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD1"
FT                   /protein_id="ACC38600.1"
FT                   /translation="MTTGAISEGATPEAIGEGFYSERELTYIQPQKRRLSEYEAVICNA
FT                   QPDMGQFDSGGWYLLRPDGLGCQDARTTALVHPNWFDYRDPSGLWQRSYINMAAQQERS
FT                   IAGASSSAKANGALGEIAPDWLHLVARYYEAYGSFEWGMFKAHAFVTREALSDTLSMTY
FT                   TFSAMDRLRHQQDIALYSLGLYEQAPGYTEGAGREAWLNDPACQGARRLVERLLSLRDW
FT                   GEMVTMTNLVVEPLIATVIGSEFFRRLAPLHGDPVTAVIEMTVEADRRRNRAATQALVK
FT                   MLTADTDRAGRPVPAAENRDLMQRWVDSWYPDALAAVDAFLPVFDAAPVGSGGGEQAKR
FT                   RVVSATADILELAGLRAPVEVTS"
FT   gene            complement(160372..161910)
FT                   /locus_tag="MMAR_0131"
FT   CDS_pept        complement(160372..161910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0131"
FT                   /product="monooxygenase hydroxylase, subunit A (AamH_A)"
FT                   /note="Enzymes in this family are involved in hydroxylation
FT                   of hydrocarbons"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38601"
FT                   /db_xref="GOA:B2HJD2"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD2"
FT                   /protein_id="ACC38601.1"
FT                   /translation="MTASITTQHEKIKSFDWEPSYFHRDALYPTKYKIPPRTKDPFRTL
FT                   VREYVGMEEEKDSRQYGALEDALSRMNNSAQVEPRFMEVLKPVLAFVDFGEYAAMKCTA
FT                   MLIDTVENPELRQGYLAQMIDEVRHTNQEAYLMRYFAKHAPDPAGFNSGFEMRANDPIG
FT                   RPARAVFEAFMNDDPITNSLNLQVVAETAYTNPLFVSLTEVAAANGDQATPSVFLSVQS
FT                   DEARHMANGYATLAAVLSEPDNLPMLQEDFDTAFWRQHAFIDNFLGGVNDYFSKARVKS
FT                   YKEFWQQWIWEDWAGSYIERLEPFGLHVPRWMDDAKRHVEWGGHTAAMVSAALWPVHAW
FT                   RSDYMTDEDFTFFEDKYPGWEKYYGDFWRAYRQMADPRNGQLALGLFPAMPPICRVCQM
FT                   PAVFPRIDVNEIRLSVDKAGQRHAFCSQACQHIFRQAPHRHTGKTWWEVNDGIELWRYI
FT                   EINHLLRSDGKTLMGQPHVHTDERWLWTIDDIRRTGVAIQDPLKALPAEAFTEI"
FT   gene            162067..162729
FT                   /locus_tag="MMAR_0132"
FT   CDS_pept        162067..162729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0132"
FT                   /product="two-component transcriptional regulatory protein"
FT                   /note="response regulator of a two-component regulatory
FT                   system involved in transcriptional regulatory mechanism.
FT                   has domain homology to CitB, a response regulator
FT                   containing a CheY-like receiver domain and an HTH DNA-
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38602"
FT                   /db_xref="GOA:B2HJD3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD3"
FT                   /protein_id="ACC38602.1"
FT                   /translation="MHPHGGSQDGSLVHSAAANTAPEAVRVLVVDDHPIVHLGVERLVQ
FT                   GNPRVQMCTGARNVKSGVAVAAAERPHVVLLDLHLPDMALPEAAAALRGACLGVKLILF
FT                   TGDSKPTVSQVAGLVGMDAVVHKDNACAVLVTAIEEVAAGRRFCDPVISTGNPLELSRR
FT                   EYQVLERLAIGETNAQIAQKLQLAPNTVKSYVQSLLAHLDARNRLDAVIKAQQAGML"
FT   gene            complement(162701..163795)
FT                   /locus_tag="MMAR_0133"
FT   CDS_pept        complement(162701..163795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0133"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="sensor part of the two-component regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38603"
FT                   /db_xref="GOA:B2HJD4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD4"
FT                   /protein_id="ACC38603.1"
FT                   /translation="MLALLDRTAALRHGADVVHRRLGADLAAGANRIAEDDTMEVVAVV
FT                   GGRTEELNGLVIGPQEGLGGQAAVLRRTVAVHDYCMSRDITHDFDHAVRAEGLRAAMVA
FT                   PIVRAHRLYGLLYAARRSPVAWTDRDRAELLSLARQAAVAMEVADSAREMAEVAAFGER
FT                   QRLAIRLHDSVGATLFSLRVALMSAQEETEPGRREELLSDALVLTERATSELRAQTLSL
FT                   HDLPEDKALAVTLEGDCRDFATRTGTAAELVVLGDLPLLDSARTDALRRTAREALLNVE
FT                   KHAGAHSVVVSLYRAEDGVGLTVADDGTAPDIASEHRRGLGLRATVERIERVGGWLSCT
FT                   ANEEGGGTVQAWVPAARAFRPVGP"
FT   gene            164203..164562
FT                   /locus_tag="MMAR_0134"
FT   CDS_pept        164203..164562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38604"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD5"
FT                   /protein_id="ACC38604.1"
FT                   /translation="MQSHAEMPSIDTAQLCGVREVRITKAAAYLHFDDVDITIKVVAPP
FT                   RAGAAVLETVWDVTAREPGPGLGTWWGSWRRFLPAGQDQPERRVAEEIRDAVDRIRQML
FT                   DAHAQQVSHRGGGRA"
FT   gene            164572..165291
FT                   /locus_tag="MMAR_0135"
FT   CDS_pept        164572..165291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38605"
FT                   /db_xref="GOA:B2HJD6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD6"
FT                   /protein_id="ACC38605.1"
FT                   /translation="MTITYDEALRLRIRARLTSHERRAVTDPTKRHAAVAVVLVDSEVG
FT                   EDRVDPAPVDEWIGGRPMPEPGLDGRMVDVSGGAAFFLCRRASRLRAHAAQWALPGGRV
FT                   DPGETAIEAALRELDEEIGIRLPDSAVLGLLDDYPTRSGYVITPVVIWGGGRLDPHPVP
FT                   DEVVAVYRVGLHQLQRQDSPRFVAIPESPRPVVQVPLGNDLIHAPTGAVLLQVRWLCLE
FT                   GRDDPVDELEQPVFAWK"
FT   gene            165450..166634
FT                   /locus_tag="MMAR_0136"
FT   CDS_pept        165450..166634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0136"
FT                   /product="conserved hypothetical intergral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38606"
FT                   /db_xref="GOA:B2HJD7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD7"
FT                   /protein_id="ACC38606.1"
FT                   /translation="MTSGSAPQWLTRNLRVLSLVSLLQDAASELLYPLLPIYLTTVLGA
FT                   PPSVVGAVEGAAEGAASLTKVVSGPLGDRFARRPLIASGYGMAALGKLIVAAAGAWPGV
FT                   LAGRVVDRLGKGLRGAPRDALLVDGVEPAQRGRAFGFHRTMDTLGAVIGPLLGLAGYEL
FT                   FDHQIGPVLYLAVIPAVLSVLLITWVREPPRNLAKAKPASILDGTRRLSRRYWAVVSFL
FT                   VLFSIANFPDALLLLRLKQIGFSVVGVIMAYVGYNAVYALASFPAGALADRLGRPVVYA
FT                   FGLVFFAVGYLGLGITTDTATAWALIAAYGLFTACYDGVGKAWISAIVSAELQSSAQGV
FT                   FQGLSGFAVLAAGLWAGFLWGVDGRLPLLISGGAGAVFALALLAAAAGTRRRAR"
FT   gene            166686..166952
FT                   /locus_tag="MMAR_0137"
FT   CDS_pept        166686..166952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38607"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD8"
FT                   /protein_id="ACC38607.1"
FT                   /translation="MSSKQVPGGVVHALPPDLREALVTNSTALAAWNDITPLARNEFIC
FT                   WVEDAKQQKTRERRIRRTREELEEGQRRPCCWPGCKHRERTGK"
FT   gene            complement(166992..168185)
FT                   /locus_tag="MMAR_0138"
FT   CDS_pept        complement(166992..168185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38608"
FT                   /db_xref="GOA:B2HJD9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJD9"
FT                   /protein_id="ACC38608.1"
FT                   /translation="MKTELGFTFFDCDNHYYEAVDAFTRHIEREYKKRAIQWAQLDGRA
FT                   RLIVGGRVNRFIPNPTFDPVGKPGALDEYFRGRNPRGADLNALFGDLEPIRPEYRDRDA
FT                   RLAAMDEQGMQGCIMLPTLGVGMEQALLPDLEATAATFRAFNRWMQEDWGFAYQERIFA
FT                   APYITLCIPDNAVRELEWALRHGARFIVMVPGPVTTEVGMRAPGDPLFDPFWQLANDSG
FT                   ITVCYHSGETYYSKFMPAWGEADYMMSFQALLGFRSLFSGDPLQDTFANHLHKGLFHRF
FT                   PNLRMACIESGSAWVFHLFEKLAKSYGQIPFIYQEDPRETFKRHVWVSPFYEDELADLL
FT                   KLLGADRIIMGSDYPHVEGLAEPASYIKDLQNFDYTPDQCRAVMRDNGLELALRRPV"
FT   gene            complement(168341..170566)
FT                   /gene="fadE6_1"
FT                   /locus_tag="MMAR_0139"
FT   CDS_pept        complement(168341..170566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE6_1"
FT                   /locus_tag="MMAR_0139"
FT                   /product="acyl-CoA dehydrogenase FadE6_1"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38609"
FT                   /db_xref="GOA:B2HJE0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE0"
FT                   /protein_id="ACC38609.1"
FT                   /translation="MALAITAEQEQLAQAVAQFAARHAPIDKTRAAWDSIAAGELPPWW
FT                   EEFTAHGFHAVHLSEDAGGQGGTLADMACVLEAAAAALLPGPLLSTATASAVAGLADTS
FT                   AAALIAELAGGATAAVVLPEHCDVRAARVAAGWRLDGSSQTTLGICAAQRVLLAARSED
FT                   GAQLWFVLDPRSPGSGLSVQPQRGTDLCTDVGVLTLADHVVAAESLVSGIATERARCLV
FT                   VALAACAAAGTVRRGAEAAVDYIRTREQFGKPVGAFQALQHKAAVLLVNAELAAAAAWD
FT                   AVRAADEPLEQHRLAAASAALVAVGPAPDLTLDALLMFGAIGYTWEHDMHLYWRRAISL
FT                   AASLGPTTRFSRAAGELARTLSRSTAVNLGNVESEFRARVAATLDRAQALANEHPTDDS
FT                   RNPGLAHGSQRDLLAEAGLAAPHLAKPWGLAATPVQQVIIAEEFSKRPGVTKPSLGIAE
FT                   WIFPTILDRGSDLQRDRFGWPILRGTQRWCQLFSEPGAGSDLASLRTRAVKVDGGWLVN
FT                   GHKIWTSHADRAQFGALLARTDPDAAKHRGISYFLVDMASPGIEVSPIKQASGRFDFNE
FT                   VFFTDVFVADDMLVGNPGDGWDLAVATMAVERTAIGNYVNIDRTQVLRHVAMADGLDQD
FT                   AALRAVGDVESHTTAIKAMVLRETLRQIQGQVAGPTSSIAKYAMVLLLRRVWTATLGLA
FT                   GRVAMLEDSDPAVLGPYFDMPSELIGGGTAEIQLTVIASMILGLPRK"
FT   gene            complement(170574..171440)
FT                   /locus_tag="MMAR_0140"
FT   CDS_pept        complement(170574..171440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38610"
FT                   /db_xref="GOA:B2HJE1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE1"
FT                   /protein_id="ACC38610.1"
FT                   /translation="MAGPVGLPVIDTMIGFPHEGSAQYDFIRKQTKDRESKENFEFPVE
FT                   YMFKDVPKGLPTDDPVSLVLQQMDRFNIEKAMIGVREDSAQLALKTFPDRFIPSGAIAD
FT                   PNDVMGSVAAIRREYEQFGIRATSVFPAGTFPQVPIDDPKMYPIYATCVELGIPIFVCA
FT                   GIPGPRLPFRPQEVSRIDIVMFDFPDLVFVTRHGCEPWEELAVKLMLKWPNLYYSTSAF
FT                   APKYYPKAIIDYANSRGADKVLYAGYFPMGLSLERIFSELPKVGLKDEVWPKFLYGNAA
FT                   RILGLTG"
FT   gene            171755..172330
FT                   /locus_tag="MMAR_0141"
FT   CDS_pept        171755..172330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0141"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38611"
FT                   /db_xref="GOA:B2HJE2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE2"
FT                   /protein_id="ACC38611.1"
FT                   /translation="MTASQLFRRAKVIEEVIDLIADVGADAVQMRDVAQRSGVALATVY
FT                   RYFSSKEHLLAAALQDWQMRLTRRILSASGSPDQDPLPGILDYLRRALRAFHRNPEMTA
FT                   LMLQMMTSTDRDAKATIDQMDRTNVEMFNRLLHGVAPADISNVSFALNAALSGALTGLL
FT                   TSRLTLEEALGHVEWVARALLDEGRPHP"
FT   gene            complement(172339..173550)
FT                   /gene="ltp1_1"
FT                   /locus_tag="MMAR_0142"
FT   CDS_pept        complement(172339..173550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltp1_1"
FT                   /locus_tag="MMAR_0142"
FT                   /product="lipid-transfer protein Ltp1_1"
FT                   /note="possibly catalyzes the transfer of a great variety
FT                   of lipids between membranes"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38612"
FT                   /db_xref="GOA:B2HJE3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE3"
FT                   /protein_id="ACC38612.1"
FT                   /translation="MSASDEIWILGIRMTKFGKHPDLDTVDLAAQAAMSALDDAGVSMA
FT                   DIGVLAAGNLMAANAGIGQQLQKQIGQTGIPVYNVANACATGATALRTAIMAVKAGEVD
FT                   YGMAVGVEKLSGAGLLGGGGKKKSDADVWTPAGRYGAVAPVDGRIGTETMPGVFAQIGT
FT                   EYGHKYGGTSFELFAKISEKNHAHSTLNPLAAYQKRFTLEQIMNDVMIAYPNTRPMCSA
FT                   NCDGAAAAIVCNGETLKSLSARQRRRAVKVSASVLTTDPYEPGCQVLPNVNTLTRNAAK
FT                   TAYEQAGVGPSDLDLVELHDCFATAELVHYDNLMLCEQGGAADFFESGAPWRDGSTPVN
FT                   VSGGLQSKGHPIAATGIANVWEICHHLRGEAGDRQIDNAKVGLAHVIGLGSACGVHILE
FT                   RSAA"
FT   gene            complement(173581..173979)
FT                   /locus_tag="MMAR_0143"
FT   CDS_pept        complement(173581..173979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38613"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE4"
FT                   /protein_id="ACC38613.1"
FT                   /translation="MTKQIPLVDYLVLDDGDPHLMARECTHCGARFFDRRNACANCFAT
FT                   EFTTVPVPTEGTVRTFTIVTFAAPGIPTPFIASVVDCDGTQVRANLINIDPDPEHVHDG
FT                   MKVRLATYAIGTDAQGTEAIGFGFEPAT"
FT   gene            complement(174075..174491)
FT                   /locus_tag="MMAR_0144"
FT   CDS_pept        complement(174075..174491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0144"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38614"
FT                   /db_xref="GOA:B2HJE5"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE5"
FT                   /protein_id="ACC38614.1"
FT                   /translation="MAADKPNFWQYIAYSYGKCLPDSMRSWVANDLAGKGAIRRHMIRW
FT                   ALPPILILAPLWLLPASLYVHSEMTVPLYIWSLLISLALNKVWRRHRLAQHGLDPNLVD
FT                   VLKQKKQARMHEDYARRYGPRPEEAHWQSNSSPF"
FT   gene            complement(174522..175013)
FT                   /locus_tag="MMAR_0145"
FT   CDS_pept        complement(174522..175013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0145"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38615"
FT                   /db_xref="GOA:B2HJE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE6"
FT                   /protein_id="ACC38615.1"
FT                   /translation="MAAPTTPQADPLALEQQVCFALAITNRAVLAVYRPLLEPLGLTHP
FT                   QYLVMLALWDNQRTSSGQGSALAVKQIAATLQLDSATLSPMLKRLEALGLVTRTRNATD
FT                   ERSTDVKLTRFGIALRERAAEVPAAVIARLGVDPTELEQLHRVLTRINVAALAADAPQS
FT                   "
FT   gene            175147..176310
FT                   /locus_tag="MMAR_0146"
FT   CDS_pept        175147..176310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0146"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38616"
FT                   /db_xref="GOA:B2HJE7"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE7"
FT                   /protein_id="ACC38616.1"
FT                   /translation="MLVTVAVENYRSLRQLVVPLHQLNVVTGANGSGKSNLYRALRLMA
FT                   DSARNGAVAALAREGGLSSTMWAGPAVIGKSVRQGRHQVQGTVRTDSVSLKLGFAGSDF
FT                   GYAMDLGLPQASISKFKLDPEVKVEALWVGPVWRSATAIAERGGPVARLRDGDDNWHLI
FT                   TDALRPFDSMLSELADPVRAPELIEMRERIRNWRFYDHLRTDADAPARQARIGTRTTVL
FT                   GHDGADLAAALETIREIGDEAALDEAIDRAFEGSRIDVASDNGRFELALKQPGMLRPLG
FT                   AAELSDGTLRYLLWSAALLSPRPPQLLVLNEPETSLHPELLPALASLIATAAQRSQIIV
FT                   VTHSEPLVAGLQQAAEVHTIRLTKELGETRIVGQGMLDQPSWHWPPR"
FT   gene            complement(176332..177075)
FT                   /locus_tag="MMAR_0147"
FT   CDS_pept        complement(176332..177075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0147"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38617"
FT                   /db_xref="GOA:B2HJE8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE8"
FT                   /protein_id="ACC38617.1"
FT                   /translation="MLPTSSSTPDAPALRPTAAPAHRWGLGAFVLVELVYLLSSTLLAL
FT                   VVASAGPRSAALISLAVAAPTVIAAGLAVFITMRRGNGPRTDLRLGGTWRDVRLGLVFG
FT                   LGGLVVSVPASMLYASITGPDANSALYKVFGDVRASWPWAVAVFIVVVFVGPLCEEILY
FT                   RGLLWGALERRWGQWVALVVSTAVFALAHFEFTRAPLLLVIAVPIALARLYSGGLWASI
FT                   VAHQVTNSLPGLVLMLILTGTMPAS"
FT   gene            complement(177130..178338)
FT                   /locus_tag="MMAR_0148"
FT   CDS_pept        complement(177130..178338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0148"
FT                   /product="glycosyltransferase"
FT                   /note="function unknown, glycosyltransferases, related to
FT                   UDP-glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38618"
FT                   /db_xref="GOA:B2HJE9"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJE9"
FT                   /protein_id="ACC38618.1"
FT                   /translation="MKAVVASYGSRGDVEPCAAAARELLRRGHEVRVAAPPNLVGFLES
FT                   AGLTTVAYGPDSHQQMGPAANLVGDFAATAQHPITMVPKLIEHLTRVNAAKSETLTALA
FT                   DGADLLVVGFNEQAVAANVAEYFGIPLAGLHFFPAPALPAGMLSTLATKAADDAQRQAL
FT                   GLPPALESVPQRVAEQGSLEIQAYDQIVLPGPPGRWVQADGRHPFVGALTLQSPTDDDD
FT                   AILAWIAEGAPPIYFGFGSTPLTSPAEQFAMISAACAQLGERALICAGPNDFGQMPHSH
FT                   QVMVAPAVNHAAVFPACRAIVHHGGAGTTAAGLRAGIPMLIRWLWLDQPIWAAGIEELG
FT                   VGVGQPFSATTSESLAAGLGSILAAQYIARARTVAAQMTPPAHSIAMAADLLEHTAHVD
FT                   RRS"
FT   gene            complement(178407..179618)
FT                   /gene="fadE25_2"
FT                   /locus_tag="MMAR_0149"
FT   CDS_pept        complement(178407..179618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE25_2"
FT                   /locus_tag="MMAR_0149"
FT                   /product="acyl-CoA dehydrogenase FadE25_2"
FT                   /note="function unknown, but involved in lipid degradation
FT                   [catalytic activity: acyl-CoA + ETF = 2,3-dehydroacyl-CoA +
FT                   reduced ETF]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38619"
FT                   /db_xref="GOA:B2HJF0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF0"
FT                   /protein_id="ACC38619.1"
FT                   /translation="MTFSLELSDDVIEVRDWVHKFSAEVIRPAAAEWDEREETPWPVIQ
FT                   EAAKVGLYSPDFFAQQSVEPSGVGILAAFEEMFWGDAGIAISIMGTGLAAAALAANGTP
FT                   EQLGRWLPEMFGTPGDPKLGAFCSSEPDAGSDVGAIRTRAHFDEAAGEWVLNGTKTWAT
FT                   NGGIANVHIVVVSVHPELGTRGQATFVIPPGTKGLTQGQKFKKHGIRASHTAEVVLDNV
FT                   RLPEDAILGGREKFEARIARVKSGASARGQAAMKTFERTRPTVGAMAVGVARAAYEYAL
FT                   EYACQREQFGRKIGEFQAVAFKLADMKARIDAARLLVWRAGWMARNNHNFDSAEGSMAK
FT                   LVASETAVYVTDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVISRALTG
FT                   LPIR"
FT   gene            complement(179647..180291)
FT                   /locus_tag="MMAR_0150"
FT   CDS_pept        complement(179647..180291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0150"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR/AcrR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38620"
FT                   /db_xref="GOA:B2HJF1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF1"
FT                   /protein_id="ACC38620.1"
FT                   /translation="MVSEYSLTMSTSGRDRLLSAALKLFAAKGYAATSVADIQRCSGLA
FT                   PGSGALYKHFGSKHELLEAAVEHRIDSIVAAREQYDAGEPGGVEQAVRTAGHLIWTNLK
FT                   QSEDLLKVMLREPGALGDLDEKTWQIITDNAYQRFADELAASNRSGRTRIPDPEAAASV
FT                   AIASLSYAATLQALTGRSPGNIDDSRYFEAWVNQTVSMLSQYTNPAPSRKP"
FT   gene            complement(180345..181562)
FT                   /gene="eis1"
FT                   /locus_tag="MMAR_0151"
FT   CDS_pept        complement(180345..181562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eis1"
FT                   /locus_tag="MMAR_0151"
FT                   /product="enhanced intracellular survival protein Eis1"
FT                   /note="supposed involved in intracellular survival.
FT                   possibly associated with the cell surface and secreted"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38621"
FT                   /db_xref="GOA:B2HJF2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022902"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF2"
FT                   /protein_id="ACC38621.1"
FT                   /translation="MSTNIRVLDTEQDLMAAGKVFRVAMVGLPPMPNLSPGQITTLLEP
FT                   GRTVGTFIDEQLVGTADAATSDLTLPGGAIVRHAAVTRIGVLPTFRRQGIATELMSHQL
FT                   RDFAARGETVATLRASEATIYERFGYGVASSAQSVEIQTARATLRPGVGTGGPVRLLDT
FT                   ADSWDVLAGIYARNRPSRPGTIDRPGVWWQFQRLRAETSPGPSYIAVHGEPGRETGFVR
FT                   YRPIDTEKWFVADQRTIVVEDFFAPTGAAYLGLLRFLFGLDLIDRVVFWMLPLDDPLPW
FT                   LLVDRRAMKVTAVHDETWLRVIDVRAALAARRYYGDGTVTIAIDDPLLAGNSGHFTISG
FT                   DGAEPTSRRPALHLDVAGLAAVLLGGARWRDLAMAGLARCEDPTALAVADQLFAAPEAP
FT                   HAGFFF"
FT   gene            complement(181702..182268)
FT                   /locus_tag="MMAR_0152"
FT   CDS_pept        complement(181702..182268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0152"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38622"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF3"
FT                   /protein_id="ACC38622.1"
FT                   /translation="MSLRDAVLAALLEGESSGYDLAKEFDASMANFWMATPQQLYRELE
FT                   RLTEQGLIQARVVHQERRPNKRMHSLTESGRAAILQFTSKPPKPAVIRDELLIKIQACD
FT                   AGNIDAVREFVVELLQWATAKLERYERARRRMLDGRTEQEYLTQAERIGPYLTLLRGIS
FT                   FEQANIQWAEQTLKILDFRLATQTG"
FT   gene            182396..182827
FT                   /locus_tag="MMAR_0153"
FT   CDS_pept        182396..182827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38623"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF4"
FT                   /protein_id="ACC38623.1"
FT                   /translation="MHPFRKAVEERDVTAVEAMLADTVVFTSPVVFKPYVGKAITAALL
FT                   RGVLRVFEDFRYIREIADGNGRDHAFVFEATIAGASGASGKKVMGCDFLHFNEDGLIDD
FT                   FMVMVRPMSGAMALSEAMGAQFDRIQQEALELAQQFAGA"
FT   gene            182886..183926
FT                   /locus_tag="MMAR_0154"
FT   CDS_pept        182886..183926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0154"
FT                   /product="coenzyme F420-dependent oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38624"
FT                   /db_xref="GOA:B2HJF5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF5"
FT                   /protein_id="ACC38624.1"
FT                   /translation="MRIGLAINYAGGFKEVAAEVADLERAGLDIVFVPEAYSFDAVSAL
FT                   GYLAACTDRVQLASGILQLYTRTPTLTAMTAAGLDYVSDGRFTLGLGASGPQVIEGFHG
FT                   VPYDAPIARTREIIEICRQVWRRERLEYQGKHYTIPLPAGQGTGLGKPLKIINQPVRER
FT                   IPILLAALGPKNVELAAEVAEGWQPIFYLPEKAHDVWGQALAAGRAKRDPALGELDVYA
FT                   GPVLAIGDNVESLREFVKPHLALYIGGMGAKGKNFYHMLATRYGYGAEADRIQQLYLAG
FT                   DKDGAAKVVPDELVRDVNLIGTPGFVRDRLAAFRESGVTTLNVAPIAETAAERVKLIDT
FT                   LRQLVD"
FT   gene            complement(183948..185015)
FT                   /gene="fadE36_1"
FT                   /locus_tag="MMAR_0155"
FT   CDS_pept        complement(183948..185015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE36_1"
FT                   /locus_tag="MMAR_0155"
FT                   /product="acyl-CoA dehydrogenase FadE36_1"
FT                   /note="function unknown, but possibly involvement in lipid
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38625"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF6"
FT                   /protein_id="ACC38625.1"
FT                   /translation="MPGPMSEDIPGVHAEAVSRWLVTLGHQVAAPLRFQRIGLGQSNLT
FT                   YRVTDAAGRAWVLRRPPLGHLLASAHDVVREARIMAALAETDVPVPRILGVTTDSEFSE
FT                   APLVLMEFVDGLVVDTMEVAEALTPRQRRQIALSLPRTLAKIHAVDLAKVGLDDLASHK
FT                   PYAQRQLKRWAGQWELSKTRELPELDDLTRRLVAAAPEQREISLVHGDFHLRNLITSPE
FT                   TGAVVATLDWELSTLGDPLADMGSLLTYWMEPGESGVGDFAPSTLDGFPDRAEMTRLYL
FT                   EETGRDPAALQYWHVLGLWKLAIIAEGVMRRAMDEPQNKASEGTPTVAWIDARVHMARE
FT                   IADAAGMNQVSDSAS"
FT   gene            complement(185034..186257)
FT                   /gene="fadE2_1"
FT                   /locus_tag="MMAR_0156"
FT   CDS_pept        complement(185034..186257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE2_1"
FT                   /locus_tag="MMAR_0156"
FT                   /product="acyl-CoA dehydrogenase FadE2_1"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38626"
FT                   /db_xref="GOA:B2HJF7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF7"
FT                   /protein_id="ACC38626.1"
FT                   /translation="MSLFDISDRAKQYQSDLLEFMDSQVYPAEAIYDEQMRAAGDPHFH
FT                   PPILEELKAAARNRGLWNLFHPHPEWGPGLTNLEYAPLAEILGRSHIASEACNCSAPDT
FT                   GNMEVLTLFGTDEHQQRYLKPLLEGKIRSAFAMTEPAVASSDATNVEMSMVRDGDSYIL
FT                   NGRKWFASNGMHRNCKVLIVMGKTDPTAPVHRQQSMMVVPIDAPGLTVRRNLPVFGYQD
FT                   REGHAEIDFVDVRVPVKDVLKGEGEGFAISQARLGPGRIHHCMRAIGMAERALELMCKR
FT                   AQSRVTFGKPISENANVRDWIAEARIEIEMIRLLTLKAAYLMDTVGNKQARTEIAAIKV
FT                   AAPNIALKIVDRAIQVHGGGGVTDDFPLAMAWAHLRTLRLADGPDEVHKRAIATQELRK
FT                   YRNGAHGS"
FT   gene            complement(186380..187504)
FT                   /gene="cyaA"
FT                   /locus_tag="MMAR_0157"
FT   CDS_pept        complement(186380..187504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="MMAR_0157"
FT                   /product="adenylate cyclase, CyaA"
FT                   /note="possibly involved in camp synthesis [catalytic
FT                   activity: ATP = 3',5'-cyclic AMP + diphosphate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38627"
FT                   /db_xref="GOA:B2HJF8"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032026"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF8"
FT                   /protein_id="ACC38627.1"
FT                   /translation="MAADVDIEASGLLDGLEGTARQDRAELIAWLLERGFSLEHIQASA
FT                   AAPVMLPAYRVLGDDGTLVSAREICAATGIELDVLQRLQRAVGLPRIDDPDEAVLPRAD
FT                   AEAVRHAKVFLDIGYDLEDAVAVMRVLVESLGHAAAMMREAALKTLLRPGFSEIELAEA
FT                   SEQLAQAAIPLLPPMMDDLMRLELRHSVETEAVNAAERAAGTLPGARPVTVAFADMAGF
FT                   TRLGEVMPAEDLERVAARLADLAHDAATMPVRFVKSIGDAVMLVCPEPAPLLRAALDLA
FT                   AAAANNLPPLRIGVASGAAVTRAGDWFGSPVNLASRVTSIAYPGTVVVAESTRDAVGNA
FT                   GDFEWFSIGAQRIRGMRAEVKLFRVEPARPAARG"
FT   gene            complement(187618..189855)
FT                   /gene="icd2"
FT                   /locus_tag="MMAR_0158"
FT   CDS_pept        complement(187618..189855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd2"
FT                   /locus_tag="MMAR_0158"
FT                   /product="isocitrate dehydrogenase [NADP] Icd2"
FT                   /note="involved in the krebs cycle [catalytic activity:
FT                   isocitrate + NADP+ = 2-oxoglutarate + CO(2) + NADPH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38628"
FT                   /db_xref="GOA:B2HJF9"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJF9"
FT                   /protein_id="ACC38628.1"
FT                   /translation="MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIQIKTSDIS
FT                   VAARILAEFPDYLTDEQRVPDNLAELGELTQDPDTNIIKLPNISASVPQLKAAIKELQD
FT                   KGYAIPDYPADPKTDEEKALKERYARCLGSAVNPVLRQGNSDRRAPNAVKEYARKHPHS
FT                   MGEWSMASRTHVAHMRHGDFYAGEKSITLDRAHKVKMELVTKGGQTLVLKPEVSLDDGD
FT                   IIDSMFMSKKALCEFYEEQIEDAYKTGVMFSLHVKATMMKVSHPIVFGHAVKTFYRDAF
FT                   AKHQKLFDELGVNVNNGLSDLYSKIETLPASQHDEIIDDLHRCHEHRPELAMVDSARGI
FT                   TNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNG
FT                   QFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEVPEDGVANIVDLDTGEVLLTQDVEAGDI
FT                   WRMCVVKDAPIRDWVKLAVTRARNSGMPVLFWLDPYRPHENELIKKVKTYLKDHHTEGL
FT                   DIQIMSQVRSMRYTLERLIRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSIVPLMA
FT                   GGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGASLEDMGIKIGNDRAKILART
FT                   LDDAIGKLLGNNKSPSRKTGELDNRGSQFYLALYWAQELAEQTDDAELAEHFAKLAKAL
FT                   ADGEEAIVAELAEAQGEAVDIGGYYAPDNEKTTAVMRPSKTLNAALEAAQG"
FT   gene            complement(190532..191368)
FT                   /locus_tag="MMAR_0159"
FT   CDS_pept        complement(190532..191368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0159"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38629"
FT                   /db_xref="GOA:B2HJG0"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG0"
FT                   /protein_id="ACC38629.1"
FT                   /translation="MEGKDDGCISPQEGGTTRKPRRVGPDAKAKAGRTSATTDAAAQPG
FT                   PDPTRDPVSDSPETCGGGHGGNTIGRAPGTAEPSSQETELEVDHDDLDPGIQACAAAGD
FT                   GPDPALEPGHDVTPQRRARSWTKVAAALAAAAVLAGTAALGWLWKEQRDTEIAGRQALS
FT                   AALRFTENLTTIDSANIDENFRETIDGSTGEFKEMYLKSSAALQQALRENKASAHGVVV
FT                   ESAIKSTSPDTVVVVLFVDQSVSNARAPEPRLDRSRVEVTMKKVDGRWLAAKVELP"
FT   gene            complement(191358..192149)
FT                   /locus_tag="MMAR_0160"
FT   CDS_pept        complement(191358..192149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0160"
FT                   /product="conserved secreted protein"
FT                   /note="function unknown. possibly secreted"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38630"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR021992"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG1"
FT                   /protein_id="ACC38630.1"
FT                   /translation="MSGWKAALAAGVLVAGCAVSTAPSAWGSAQSFCGELGGDFDGRYC
FT                   HTTVTSVRKADRDIRMAIPGDLVDNAVSGPVVRDYLRTLYNNWREKGADMVQDSWGEEN
FT                   YQQFGHQSAVSVVFHEDYHADGPKINNAYRTFTFDTALGRQLQLTDIVKAGLDPLAVIP
FT                   PLAEPFVAAALDRAAPPHQPGTYPFTVDRWTPDKVYSGGYKAWALTPSELILYLPDYPV
FT                   AHDNPINYEPGMPVWSMDGGAVEAHIPIDVLAPVLRSGYGG"
FT   gene            complement(192161..192886)
FT                   /locus_tag="MMAR_0161"
FT   CDS_pept        complement(192161..192886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0161"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38631"
FT                   /db_xref="GOA:B2HJG2"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG2"
FT                   /protein_id="ACC38631.1"
FT                   /translation="MVAITGDDVENSNITQLTDTTDTTERGQPAIATDELESPSTAAGP
FT                   CADVESGNADDVDCTDTDAHAPRAPRRWRSRWSRMRVKRVRVGFNQAILAVILASLSVS
FT                   AVLGWHLFAAHHANVAAELAQQTAIGYAQTLTSIDSNNVDANFNQVLDGATGEFKDMYT
FT                   RSSVQLRQLLIDNKATAHGVVVDSAIQSKSKSRVVVLLMIDQTVTNAARPDPRVDRSRM
FT                   KITMEKTDGRWLASKVELS"
FT   gene            193261..194349
FT                   /locus_tag="MMAR_0162"
FT   CDS_pept        193261..194349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0162"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38632"
FT                   /db_xref="GOA:B2HJG3"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG3"
FT                   /protein_id="ACC38632.1"
FT                   /translation="MEGLASGRTEAAKPLSRDGAQQPGWFVGQRVDILLVFGLGAFLSA
FT                   VLFAAGSHKGLFLVGAVGFSLLSDLPHVFTTSVRIWLDPRERSRYRAHYLMSLAVIGTL
FT                   VAILWFGGWLIPLLAIWAYWQVFHVLKQHFGMINIYAAKNGYKGPRKKIQYALYSTCLA
FT                   PVVFRAAHGLHFSEYEVFGKRLPFSNLSVPVPPVPKLIVIAGFIVAAVCLALAVIEQLQ
FT                   LKRDGQRTLPAMAVATFVVAALSYNLSYLLVSDLFALILIATTTHSLQYHLINWTRNNT
FT                   RFAHSNNSEEKKLLLARLSTRKALPLYIAFLAGLGVLAGQLDTIIFAVPLTFVLHHFYM
FT                   DGALWKSKKNPELAYDLGIIRA"
FT   gene            194342..195523
FT                   /locus_tag="MMAR_0163"
FT   CDS_pept        194342..195523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0163"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38633"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG4"
FT                   /protein_id="ACC38633.1"
FT                   /translation="MLDEEVGAHRWTEALAHPPAPTVRPVRTNAEIKDFIGVPWQIYRG
FT                   DDAWRPTLRRVMRAKMDPRKNPLHSEVQIANFVAYRQGRPVGRISACIDSHYVQRYGDY
FT                   AFFGFFESEPDQAIASTLLTTAENWARGRGMNAIIGPFSYTSREDVGLLISGYDTPPTI
FT                   MQPHNPPYYPRLVEAAGYSKKFDTACFRWSVDENPSVQQRLLSRADAVLGAQGASVRPV
FT                   RLSDYEQELELLRKLYNDSFAKHPENVPLSRPVFASMAAEMRPLIDPNIVRIVEANNTP
FT                   VGFLFMLPDVNEITGQSGRLTPSALLRIAAKRGGRIRGVRTAVVVLIGAVQTQFGAGLG
FT                   RILAGEIVRTITGAGYSAVATTWMHEDNMWSNSLAAQMKKAPEKRHRVYQKEL"
FT   gene            195523..196503
FT                   /locus_tag="MMAR_0164"
FT   CDS_pept        195523..196503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0164"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38634"
FT                   /db_xref="GOA:B2HJG5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG5"
FT                   /protein_id="ACC38634.1"
FT                   /translation="MAPRILVTGATGYLGSTILEALVRAGERATILVQPGDPHVMSPEL
FT                   RSNVDVVRGDITDAQSVDEAMRGIARVYHLAGIASPNSRLANQIWRTNVLGAYHVAQSA
FT                   WRHGVQRLVHVSSTAAIGYPPNGVIADEDFDPRDSVLDNVYSATKRAGEQLVLDFVDRG
FT                   LDVVVVNPAAVFAPGFGPPRSWQGLLVAARKGLLRVVPPGGTAVCSARDFAAGVTAAMN
FT                   KGQPGRRYILSTDNLSYRQIAELLVRAVGRSHQVRVAPMRPFRALGRGKRIASDFSSRA
FT                   HFDDPLVPENIDLMARKVYYDPTRAVRELGIPKVSVAELITEFVG"
FT   gene            196500..197597
FT                   /locus_tag="MMAR_0165"
FT   CDS_pept        196500..197597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0165"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38635"
FT                   /db_xref="GOA:B2HJG6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG6"
FT                   /protein_id="ACC38635.1"
FT                   /translation="MSTQTRQALAEGAGSKDVLGISMAQARSLVADLAVRRQWIYWVDL
FT                   TVCVAVGYTAFLLCPARQPLSPAAVGCVVVAALALYRAVLFVHEIVHAGAELRSFALYW
FT                   HAVCGIPLMVPQFTYEFHQEHHASRTYGTAADGEYVAYATEPRWRVVALPFTALLGPVF
FT                   FVVRFLVLAPLSWLVPPLRRYVLTRASALMIDADFCRTLPPGGAPRSWLIQEFACFAYL
FT                   VGVAVLFGLGVFAPYRLLEAYAVVSLILFVNWIRVLVAHRYESENQRMTFPEQVLDSID
FT                   HPSLPVLGELWAPLGLRLHAVHHLFPKLPYHQLAEARRRLAEAVPRDRGYWVTEDPSVV
FT                   SSFRRLLSRRAESSKPIRQLTDEAV"
FT   gene            197597..198946
FT                   /gene="gabT_2"
FT                   /locus_tag="MMAR_0166"
FT   CDS_pept        197597..198946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT_2"
FT                   /locus_tag="MMAR_0166"
FT                   /product="4-aminobutyrate aminotransferase, GabT_2"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38636"
FT                   /db_xref="GOA:B2HJG7"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG7"
FT                   /protein_id="ACC38636.1"
FT                   /translation="MLAKNPPPMRESNAATYSRRLPIRLVEARGTRVRDSSGRWYIDCL
FT                   AAAGAMSLGWNHPVVSEAVIRTVDSGEPWLSLDFHTPAREQFVEDLLSILPPGLAADGR
FT                   VHLCSPSGASAVEAALTLAEIATGGREHVGVQGGFHGCTRAARAASSGGGLRQQPVVMA
FT                   PRTTFLPFPQNYRCPFGVGGERGVDLAVTAVEQLAAPHAGISAPASIISEFVLGEGGVL
FT                   PAHPRWAKALRNLANRFEVPLIADEVQAGMFRTGRAWGFEHCDIEPDMVVMSKGLGSGV
FT                   PIAVIVVREGYDVWEPGAFTGTFRGNAMAFAAASAVIRYAREAALAEHVTRMGEYFRTG
FT                   LQRILEECEIVGDVRGRGLMLAAEIVDPQLPWPSGVAPAPELARQIQRASLSNGLIIES
FT                   GGQYGNVIRFLPPLTIEEADISAALTAFEAAVKQVERHRTKAVDLRADQR"
FT   gene            198943..200451
FT                   /locus_tag="MMAR_0167"
FT   CDS_pept        198943..200451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0167"
FT                   /product="glutamate decarboxylase"
FT                   /note="catalyzes the production of GabA [catalytic
FT                   activity: L-glutamate = 4-aminobutanoate + CO(2)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38637"
FT                   /db_xref="GOA:B2HJG8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG8"
FT                   /protein_id="ACC38637.1"
FT                   /translation="MSRDVSDFAGEFVSGSGTAAYRDAITLASGLVANALEAADAPGLV
FT                   DGYSLLKELADKPRLDTVAGVGLPAALEEAVGLMAGHSAVVTHPAYLAHLHCPPTVASL
FT                   SAEVLISAFNQSLDSFDQAPAATAIEQRVVEHLCARIGYGTDADGTFTSGGTQSNLHAL
FT                   LMARDVFAQRTLGLDVGTAGLPAAARSWRLLCTRQAHFSARQALRILGLGADAVIEVPT
FT                   DDAGRLCVEALAGCIAESQARGTPVFGLFLTAGTTDYGAIDPLEPAIKIARQHGVWAHV
FT                   DACVGGCLAFSAQHRHLLRGIELADSVAVDFHKLLFQAISCSALLVRDAESFRVSAGHA
FT                   DYLNPADDVEHDVVNLVGKSLQTTRRFDALKIFLTLRALGERRIGAMIDATCAAAAAAG
FT                   RAVSDHPHLTLCAPVAVNTVVLRWRHPELTEQKCDAVNSAIRSSLARCGLALVGRSRAA
FT                   GHQAIKLTFVNPLITADLATGVIADVSRRGNEIACLPDDLAAQA"
FT   gene            200448..201191
FT                   /locus_tag="MMAR_0168"
FT   CDS_pept        200448..201191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0168"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38638"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJG9"
FT                   /protein_id="ACC38638.1"
FT                   /translation="MTERLCRIERVAASDPRFGWAKQVEYTVFGLENNFASDADIAAAE
FT                   MVHYRDWERSSEIFVSLDTAAPHQPVGVLRALRHDPELGLDSFSTLRDARNYPVDERTR
FT                   RNFLYPRWSDFFDGIDPRRIAELATQGVLRSARRSGMIEQIWRAFFSSLAADGVDLVTV
FT                   ALVVPLFEWYRQLLPDRLHQIGEILPNYIGADSVPAVVDIGGSFISDSIRDMDADSASL
FT                   LALTVQAPHPASAVPGPSGEEEREQ"
FT   gene            201188..201694
FT                   /locus_tag="MMAR_0169"
FT   CDS_pept        201188..201694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0169"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38639"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH0"
FT                   /protein_id="ACC38639.1"
FT                   /translation="MRSIHTDEHVFRKVSEIDCPVERVWQTVTTQEGINHEMGPYMKMT
FT                   MPKQFIGRSIADVEPGTRIGKSFLLLFGFLPFGFDDITITRIEPGRMFREESTMTGMRV
FT                   WVHHRTLEPKGDKTVVSDEITLAPQAPMGLIPGWGKLMSKILSAFFTHRHRRLCKSLAK
FT                   TGVAQ"
FT   gene            201706..202434
FT                   /locus_tag="MMAR_0170"
FT   CDS_pept        201706..202434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0170"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38640"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH1"
FT                   /protein_id="ACC38640.1"
FT                   /translation="MAASVLVAAAALTGGCTAVNKAAGEPVGHAFQLLEYPQPVSQPVA
FT                   EPAEGSPYGGYSVEVAGSVTYLKETTVLPKSGLLTIGPGPRAGELQVQHYYQGDRFPYE
FT                   TGVLSKDGTASTLNAITIVNPLDSRVSLQCAVAGGIALENLNEPRDLHGECGGGAKLSG
FT                   TVRADGTRQATWRGKPVELARTVVDLTITGMTSGKVHQINDVPKGGSFPLYTAIDVNMT
FT                   AQGINLTEELERYVLPRVQD"
FT   gene            202409..203383
FT                   /locus_tag="MMAR_0171"
FT   CDS_pept        202409..203383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0171"
FT                   /product="ATP-binding protein ABC transporter"
FT                   /note="probably involved in active transport of substrate
FT                   across the membrane (export). responsible for energy
FT                   coupling to the transport system"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38641"
FT                   /db_xref="GOA:B2HJH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH2"
FT                   /protein_id="ACC38641.1"
FT                   /translation="MSSPESKTDNETGDSQPGTSALEAVDLVKSYPGSDANAVDGLNLV
FT                   IPRGVVYCLLGRNGAGKTTTIRMATTLLTPTSGQLEVLGVPVDNTTQLRPLIGVALQEV
FT                   ALDLWMSPVEQIRMSLAMAGWPKSDRKRREGELVEQFGLGKYLNRKVGALSGGMRRRVD
FT                   VALAVAHNPQMLFLDEPSSGLDIEGKQEVWNAIRLLRSEGRTVVLTTHDMDEAVSLADE
FT                   VGIIKDGVLVAAGSTQEFTRSHGFAVDISAPQEITDDAVRQLAGAGYPMQRKGSSAVTG
FT                   SLDSASASEIGSLATVLDRLGLAGANIEIRSTSLRDAFLEATQ"
FT   gene            203380..204156
FT                   /locus_tag="MMAR_0172"
FT   CDS_pept        203380..204156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0172"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38642"
FT                   /db_xref="GOA:B2HJH3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH3"
FT                   /protein_id="ACC38642.1"
FT                   /translation="MTRSALANTARLFRRYVVVGLRQPVFGFIFPIVFPVVLVVFVRSM
FT                   FQRVADLPGFPLTSYTAYIAPGLIMLIPMLGAGYGAGTLIEEISSGFTDRLRLYGVSTG
FT                   QIMAAKIGFEMFRILPAAVIVIGLLALLDAPLRAGILTAALLILLMFLWSAAYSSLFYL
FT                   VALRTLNPQAPVAMLPLALPVLFVSQALMPSVFLSDWLRISINVNPFSHIVSAASTIMY
FT                   GDFDTMTVLRGCLVGLGMFLILQIPIHFVIRRKIGK"
FT   gene            204172..204453
FT                   /locus_tag="MMAR_0173"
FT   CDS_pept        204172..204453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0173"
FT                   /product="acyl carrier protein"
FT                   /note="thought to be involved in de novo fatty acid
FT                   biosynthesis; this protein is the carrier of the growing
FT                   fatty acid chain in fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38643"
FT                   /db_xref="GOA:B2HJH4"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH4"
FT                   /protein_id="ACC38643.1"
FT                   /translation="MSEVRVFLVEFIADELEIATTEVRDSSELIRDLGFDSLAFASTVS
FT                   EIASRFGVRLSKDDVFESKTVGALVELVESRKSAPDAVNAAVNASGNP"
FT   gene            204462..206102
FT                   /gene="pks16_1"
FT                   /locus_tag="MMAR_0174"
FT   CDS_pept        204462..206102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks16_1"
FT                   /locus_tag="MMAR_0174"
FT                   /product="polyketide synthase Pks16_1"
FT                   /note="involved in some intermediate steps for the
FT                   synthesis of a polyketide. probably not a PKS but more
FT                   likely an acyl-CoA synthetase or fatty acyl AMP ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38644"
FT                   /db_xref="GOA:B2HJH5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH5"
FT                   /protein_id="ACC38644.1"
FT                   /translation="MRRLCDSQGATQHGLTTAPVGADGRSHLDQLTNTPWSDIHHLGRR
FT                   AAGALQRDGVTPGDVVAVLAGAPGEIAPLVQGAWMCGAAVTMLHQPTHRSDLQAWAADT
FT                   KKTLSMVGASTVVVGSPFQSAAQEFAKVGLRGLELSELLTADEGRIVVAEEDSPAFLQL
FT                   TSGSTGHPKAVSITYRNIEANGRALMAAASADVASDVVVSWLPLFHDMGMMGLLIIPMY
FT                   EGMDAVHITPADFLNDPLLWAELITKHRGSITAAPNFAYSLLARRLRRAQDHAFDLSSL
FT                   RFALNGAEGIDVATLERLATEGARFGLRRDAIVPAYGMAEATLAISVVRPGEGFRVCPP
FT                   HPDLVAAQGEAAAPRVMLGPPVPGCDVRVVSEDRTVLAPSEIGELEIRGDNVTAGYRTE
FT                   AGFEPAVDAGGWLATGDVGYLTENGQPVICGRKKDILIISGRNVHPEDIERSVVGIAGI
FT                   RSGGVAAVRLATASASEGFVMVAESALHADDAESNRIRTEVADRVFVNLGVSPRAVHVV
FT                   PAGWLPKTSSGKLRRRQTSERLRLFDDAL"
FT   gene            206112..206957
FT                   /gene="yrbE6A"
FT                   /locus_tag="MMAR_0175"
FT   CDS_pept        206112..206957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE6A"
FT                   /locus_tag="MMAR_0175"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE6A"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38645"
FT                   /db_xref="GOA:B2HJH6"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH6"
FT                   /protein_id="ACC38645.1"
FT                   /translation="MATTFVNDRLIGLRRLSVTYLRQHPAASLATAGEQIVLGVAALRY
FT                   LAIDLVTGRFPWTECIRQASFMAATAIMPTILVALPIGATLSIQFAMLAGQVGATSLAG
FT                   AASGLTVVRQAASLVAAILLAAAVGSAITADLGVRTMREETDAMEVMGVSVVRNLVVPR
FT                   LLAAMVIGVALCGVVCFVGFLASYLFNVYVQGGSAGSFLATFSAFATTGDMILALLKAA
FT                   VYGFIVTVVACQKGLSTRGGPAGVANSVNAAVVEAVLLLMIVNVVVSELYTVLFPRTGL
FT                   "
FT   gene            206959..207825
FT                   /gene="yrbE6B"
FT                   /locus_tag="MMAR_0176"
FT   CDS_pept        206959..207825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE6B"
FT                   /locus_tag="MMAR_0176"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE6B"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38646"
FT                   /db_xref="GOA:B2HJH7"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH7"
FT                   /protein_id="ACC38646.1"
FT                   /translation="MTSFVAMRRMSIRQIVFAGAGAGAGQPLARFGHMIAFYLHTVLAI
FT                   PVALRRYRREFMRLLSDITWGNGSIVVGGGTVGVVLVLGITAGALVAIEGYNFLNMMGI
FT                   GPAIGVVSSLVTTRELAPIMAALGFAVQAGCRFTTQIGAMRVAEEIDALNAMAIRPIPY
FT                   LVTTRLLASAVAIIPLYIACLTISYLSCQLMVTFTTHGSVGPYLHYFTMLIDARDVGYS
FT                   VIKAVVFVALASVVQCYYGFCAEGGPEGVGVAAGHAMRASITVVIIVNMVLTMALWSVD
FT                   AGVRFGG"
FT   gene            207828..209318
FT                   /gene="mce6A"
FT                   /locus_tag="MMAR_0177"
FT   CDS_pept        207828..209318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6A"
FT                   /locus_tag="MMAR_0177"
FT                   /product="MCE-family protein Mce6A"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38647"
FT                   /db_xref="GOA:B2HJH8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH8"
FT                   /protein_id="ACC38647.1"
FT                   /translation="MTNHIDLDGIYFSKRQLLARGGIALVVVLLVTSWLLAKSMGYLDR
FT                   GVQVVADLRNIGDGLPAGSDVKYRGIQVGTVESLDPSIGNQPNQVRIRLKPEYAASIPV
FT                   TVTARVVPSNVFAVSSIQLVEHGPGAPISDGERISEDTDLPTVLFQTALTKLRDILAAA
FT                   GRNRDDHTLGVLAAVGAATNNRNGALQLSTHQLIRIIDELNGVVATDQGPSTVAALVDA
FT                   ARGLSQSAPELLDAFHDAVAPMRTLVDKQQALHDFLGAGQYTTGLAVNSLQNHSDQLVQ
FT                   ITTDLTPVVGVFADNAQHFVPITERITRFSDKFFEEVWDPASTVAHGRVNVSFTPSYTY
FT                   TRADCPRYGELRAPSCFTAPLVQARPDLPEVLLPQNYQPPPNLAPPPGTVVGPDGNLVA
FT                   VGPPLINPTPNLEDPNPPLPAGVTPAPPVPGTANPDLLPAAPSSFGGNVGPVGSVQERA
FT                   ALSLITGEQATVATQLLLGPVARGAIASRTQQTPTESK"
FT   gene            209337..210410
FT                   /gene="mce6B"
FT                   /locus_tag="MMAR_0178"
FT   CDS_pept        209337..210410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6B"
FT                   /locus_tag="MMAR_0178"
FT                   /product="MCE-family protein Mce6B"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38648"
FT                   /db_xref="GOA:B2HJH9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJH9"
FT                   /protein_id="ACC38648.1"
FT                   /translation="MTSPRTRTRRGALLWVAFFLVVATALTWMVYVTLRRDVKGPTARY
FT                   GALFTDVFGLREGDDVRVAGVRVGRVQKVELDQTLARVSFIVQQGQPILTDTIASITYQ
FT                   NIVGQRYLALAPGRTGRGIPIPPGSVIPVERTEPSFDIGTLLNGYEPLFAVLDPDQVNN
FT                   FTKAVIASLQGDTSALATLVDQTSTLTATFAGNDDALGNVIGSLDRVAGSLASQSAEFE
FT                   HTIAQTRQMVSQFNSRRSELVESTGNMAAVVRQLGGILADVNPQIHQILDRQPGYTKHL
FT                   LDIEPQAAFVGMNTPLLLKGLARVFGQGTYMNVYGCDVNFYGYFPGLNDMVPIIVAAAT
FT                   PGGKPMYTPKCRNVTDG"
FT   gene            210403..211449
FT                   /gene="mce6C"
FT                   /locus_tag="MMAR_0179"
FT   CDS_pept        210403..211449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6C"
FT                   /locus_tag="MMAR_0179"
FT                   /product="MCE-family protein Mce6C"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38649"
FT                   /db_xref="GOA:B2HJI0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI0"
FT                   /protein_id="ACC38649.1"
FT                   /translation="MAERIKHLRPRLRPLASYNKTWLGFVGLSLAVVLIGALLLVKQAG
FT                   IGYRRYTAEFLQAASLQPDNVVSVAGVPVGNVISVRLAGDHVEARLRVKDNIALGRDTR
FT                   AAIKITTIFGSRYIDLHPTGAGVPPGQTIDLAHTEVPYDLQAALADSTRTFEQVDGDRI
FT                   ASSLTVLGQALNGLPDVFPQALENVRALSSVISQRRDQLGTLLKSTQNVTDILRRQQSD
FT                   LGSMIRQGQDLIGEFVAHSAAFHAMMQALTQVVGSLRTIVVDDRAALEDVVQTMEQLSA
FT                   KLAEQDALFRNLLEIAPVPVRELANASGYGNALELNAAAGPLVDSWMCAISGRAKQFGL
FT                   IQYFKDCA"
FT   gene            211446..212558
FT                   /gene="mce6D"
FT                   /locus_tag="MMAR_0180"
FT   CDS_pept        211446..212558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6D"
FT                   /locus_tag="MMAR_0180"
FT                   /product="MCE-family protein Mce6D"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38650"
FT                   /db_xref="GOA:B2HJI1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI1"
FT                   /protein_id="ACC38650.1"
FT                   /translation="MTHRHNLIRVGVGLVVVAALACAGWYGLARDRGPIVVTAQFDSAA
FT                   GLYEGNAVAVLGIPVGHITKIVAKSGYAEVEFTVDRAVQVPADVQAVTISTSILTDRQI
FT                   ELTPAYRGGPTLRNHDTIGLTRTRAPVEFDRVLGMLDRLASSLQGDGRGGGPVAGVLDA
FT                   GYDVVNGNGQHLKEAFDELSKALRLSADRGVHTREQMTAIIENLSSLLDAAAKNDSTLR
FT                   QFGSTVRQLSQIMANEGFGSGTSGQQLNALIQRTGDILNANREAIARGIANGNTTIQSV
FT                   VDRQREVTEFFDVLPLMADNLYNAVDQRNGSIRAHQLTDRMIFDSQFGKEVCNLMGLRQ
FT                   LGCSTGTLQDYGPDFGLTYVLDGLAAMGQK"
FT   gene            212555..213682
FT                   /gene="mce6E"
FT                   /locus_tag="MMAR_0181"
FT   CDS_pept        212555..213682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6E"
FT                   /locus_tag="MMAR_0181"
FT                   /product="MCE-family lipoprotein Mce6E"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38651"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI2"
FT                   /protein_id="ACC38651.1"
FT                   /translation="MIRRLSGRPRWRLGILATVLATTACSTNGLADLPLPAPGLGSGGY
FT                   RITAIFANALNLNEHAKVKLGGADIGLVESMTARDFNAVTTLRIRSDVRVPVGSGAELR
FT                   TATPLGDVFVSIVPPSQRAADTPTLQDGDTIALNKTATAATVESVLSSAAILINGGVAH
FT                   NLTNVINGLGKAAGNDGEVYGELIRKSNELLGKLDARTGQLEDAMSQTEHLAAELDRKR
FT                   EVIAELLQATDPATSVLAADASQISDLLLLMGGAATELKKFPSIAGTDSSGRSVIKDAN
FT                   AVAAAWNDVALDPDARLSALSNLYAPFVKLTAGTSISGSAGIDRLVLGSIPDIGFGGDP
FT                   GLHGPKRYDWRKFIGSLKFTLWRLQERVVGQGPPQ"
FT   gene            213679..214917
FT                   /gene="mce6F"
FT                   /locus_tag="MMAR_0182"
FT   CDS_pept        213679..214917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce6F"
FT                   /locus_tag="MMAR_0182"
FT                   /product="MCE-family protein Mce6F"
FT                   /note="function unknown, but thought involved in host cell
FT                   invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38652"
FT                   /db_xref="GOA:B2HJI3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI3"
FT                   /protein_id="ACC38652.1"
FT                   /translation="MTDVAPSLTNMRGGRHTWLSCVGLLLTLVVSVAYLLIGVLHVRPL
FT                   ASNYALTVELGQSGGLLPNQDVALHGVQIGKVESLEISRTGVTAILRINAGVRIPVAST
FT                   VRVSALSPAGEQYVDFNATSGEGPFLKNGDAISQDRTTTPVTPAELLQHADGVLAQIDP
FT                   AKLAGIRRELNLSKAAPEKLTAIVDGGVFLISTLDSVLPQTVSLLRNSRVVLSAAIDVN
FT                   DGIDATARNVHQLLTGISSMDDGYRRMVDQTPGVLKAADNLFSDNSDTMVQLLGNLTTV
FT                   AKLSYLRVPALKALFPDYRGSALEAFMSTMHDGGLWATADLYPRYTCDYGTPSHPPSAA
FT                   DYPEPFLYTYCRDDDPAVLIRGARNAPRPPGDDTAGPPPGADLGATTGPTPQGRFTIPT
FT                   PYGGPRLPIEPPH"
FT   gene            215603..218155
FT                   /locus_tag="MMAR_0183"
FT   CDS_pept        215603..218155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0183"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38653"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI4"
FT                   /protein_id="ACC38653.1"
FT                   /translation="MTFLNVLPEMVAAAAADLTNIGSSMTAANAMAAASTTTVLAPGAD
FT                   EVSVAIAGLLRLHGQQYQQFGAHLSEFHARFTQMLSAGANEYSLAEAANATFTASSLQT
FT                   LPLDVLNAVNAPFQAFTDRPLIGNGVAGAPGTGQNGGAGGWLIGNGGAGGSGTPPGLGS
FT                   AGGTGGTGGAAGLIGNGGAAGAGGASTSGVGGAGGAGGAGGWLFGAGGTGGAGGLTVGT
FT                   TGGQGGAGGAGGLFGPGGTGGAGGTSFVDAGGAGGAGGDSGLLSGLFGTGGGHGGLGGA
FT                   GVTAGGDGGAGGDGGPLIGRGGDGGAGGLSNSVDAVGGAGGAGGDGSRLVGSGGAGGTG
FT                   GTSLAGDGGAGGAGGTAGLLGSGGSGGSGGTSGFLGTGSGGAGGDGGNASLFGFGGAGG
FT                   VGGISGNDTGGVGGMGGTAGLLAGNGGMGGAGGEGFLTGGAGGKGGNAMFFGTAGNGGN
FT                   GGYGPTFGIGGADGATGPLQGVFDLGNAPVQALTGRPLIANGANAATGSGQDGGAGGWL
FT                   LGDGGAGGSGEAGQAGGSGGAAGLLFGVGGAGGVGGSAGLVGDAGAGGSGGSGGLLWGN
FT                   GGAGGAGGLSIANTNGTGGVGGAGGDSGLLGAGGAGGSGGTALLGTGGTGGAGGAGGIL
FT                   GGTGGQGGIGGFGETGAGDGGSGGIAGLFGSGNAGGAGGYANTSDGGQGGQGGDGGVIF
FT                   GYGGAGGTGGVTPGGTGGIGGAGGNGGLLFSGGGVGGAGGLGPSGGSGGTGGHGGWFGA
FT                   AGTGGSGGFGFSIAGGAGGAGGDSTSGVGGGGGAGGDSTVTGGAGGDGGGALLLGNGGN
FT                   GGNGGAVVTGGTPGGGGNGGTGGLLLGADGLNGLTQTM"
FT   misc_feature    218100..230400
FT                   /note="ESX-6"
FT   misc_feature    218302..230285
FT                   /note="MURD4; Spans two Esat6-like loci. This region
FT                   includes PE and PPE genes, other genes encoding predicted
FT                   membrane proteins and two distinct clusters of esx genes.
FT                   These regions are similar but are not identical to the ESX1
FT                   (RD1) region of MTB"
FT   gene            218996..220441
FT                   /locus_tag="MMAR_0184"
FT   CDS_pept        218996..220441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0184"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38654"
FT                   /db_xref="GOA:B2HJI5"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI5"
FT                   /protein_id="ACC38654.1"
FT                   /translation="MASLRLTTKVQVSGRRFLVRRLEHAIVRRDTQMFDDPLQFYSRSA
FT                   SLGIVVAVLILAGAVMLAYVKPQGQLGDTNLVADRASDQLYVTVSGQLHPVYNLTSARL
FT                   VLGNPAAPTSMRSSELNKLPKGQTIGIPGAPYATPVSADSASTWSLCDTVAYAGTANPV
FT                   TRTALIAMPLQIDAAIAPLRANEALLVSYRHSTWIVTAQGRHAIDLSDRALTTAMGIGE
FT                   TATPTPISEGMFNALPDSGPWRLPSIDAAGAPNTLGLPAALVIGSVFRVETTAGTKHFV
FT                   VLRDGVAPVNDDTAGALRDMESYGLIDPPPVPPDLVVDLPQRVYQSPLPDEPLKIISRV
FT                   QDPTLCWSWQRSAGDQAPTTSVLSGRHLPLPPSVVSAGISQIRGTATIYIDGGKFLVLQ
FT                   SPDPRYAESMYYVDPQGVRYGVPDAAVANALGLGSPQDAPWQVVRLLVDGPVLSKDAAL
FT                   LEHETLPPDPNPAKIDAAAAGAP"
FT   gene            220525..220821
FT                   /locus_tag="MMAR_0185"
FT   CDS_pept        220525..220821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0185"
FT                   /product="PE family protein, PE35"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38655"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI6"
FT                   /protein_id="ACC38655.1"
FT                   /translation="MRSMSFDPAAASVAAAISAHASRGLDAGTAAASSVTGLAPAGADE
FT                   ISAQFAAAFAAEGAQVLALNTAAQDELARAGQALRQIAGMYSAVDNSWSDTLA"
FT   gene            220878..221984
FT                   /locus_tag="MMAR_0186"
FT   CDS_pept        220878..221984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0186"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38656"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI7"
FT                   /protein_id="ACC38656.1"
FT                   /translation="MLWNALPPELNTARLMAGAGAAPALQAASGWEALGAALEAQADGV
FT                   AASLVSLGEMWSGAGSDRALAAAAPMVIWLRGAAQVAHTRAAQATAQAGAYLQALAMTP
FT                   SLPEIAANHVTHAVLAATNFLGINTVPIGANEADYFIRMWNQAASAMDVYQAETMLNTA
FT                   FEKLEPMTAILDQNVGQLANDVAEEVAQASSQVPLFPVANLPIQPAMSGSVLQLLQPLQ
FT                   AVTSLFSLGSSMGGAVSPLGGAAGAESAAQVGLVGASPLSSHPLAGGSGPRTGAGLLRA
FT                   VSMPGAGGTLVRTPLIGGLLDKPADPAVAPVAAAGSSATSGAAPVGGTGLGRAAGAGES
FT                   SRPGPAVSATLTREPDEVDDDWDDDDDW"
FT   gene            222089..222391
FT                   /gene="esxB_1"
FT                   /locus_tag="MMAR_0187"
FT   CDS_pept        222089..222391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxB_1"
FT                   /locus_tag="MMAR_0187"
FT                   /product="10 kDa culture filtrate antigen EsxB_1"
FT                   /note="a culture filtrate antigen that forms part of a
FT                   novel secretion apparatus"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38657"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI8"
FT                   /protein_id="ACC38657.1"
FT                   /translation="MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQAQWRG
FT                   AAGTAAQAAVVRFQEAANKQKAELDEISTNIRQAGVQYSRADDEQQQALSSQMGF"
FT   gene            222428..222715
FT                   /gene="esxA_1"
FT                   /locus_tag="MMAR_0188"
FT   CDS_pept        222428..222715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxA_1"
FT                   /locus_tag="MMAR_0188"
FT                   /product="6 kDa culture filtrate antigen EsxA_1 (early
FT                   secreted antigenic target-Esat6)"
FT                   /note="6kDA, culture filtrate antigen forms part of a novel
FT                   secretion apparatus"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38658"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJI9"
FT                   /protein_id="ACC38658.1"
FT                   /translation="MTEQQWNFAGIEAASSSIGGNVGSIHSLLDEGKQSLHKLAAAWGG
FT                   SGSEAYQGVQQKWDSTAQELNNALQNLARTISEAGQAMSSTEGNVAGMFG"
FT   gene            222948..223235
FT                   /gene="esxA_3"
FT                   /locus_tag="MMAR_0189"
FT   CDS_pept        222948..223235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxA_3"
FT                   /locus_tag="MMAR_0189"
FT                   /product="conserved hypothetical EsxA-like protein, EsxA_3"
FT                   /note="function unknown but identity with other Esx
FT                   proteins, including EsxA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38659"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJJ0"
FT                   /protein_id="ACC38659.1"
FT                   /translation="MAVLHYNFAAIEIGVAEIQAEVIKTQKHLHDANQVLSTLTEVWGG
FT                   SGSEAYQQVQQQWDSASADLNAALQALAHAIHQSNQEMLTTETGLATLFS"
FT   gene            223485..223664
FT                   /locus_tag="MMAR_0190"
FT   CDS_pept        223485..223664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38660"
FT                   /db_xref="UniProtKB/TrEMBL:B2HJJ1"
FT                   /protein_id="ACC38660.1"
FT                   /translation="MDLPARKAATPAQHCDSPLDNAHHNMFPVPLGSPGRNGALVAVTV
FT                   TNPDTPGESRPQHR"
FT   gene            223778..224923
FT                   /locus_tag="MMAR_0191"
FT   CDS_pept        223778..224923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0191"
FT                   /product="PPE family protein, PPE51_2"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38661"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKF6"
FT                   /protein_id="ACC38661.1"
FT                   /translation="MDFAMLPPEVNSGLMYTGPGAGSLLAAANSWDELAIELGTTAQTY
FT                   ESVLSGLTSMYWAGPASESMAAKAAPYVWWLHSTAEQTQQTATQCRAAAMAFEQAYAMT
FT                   VPPPVILANRMQLMSLVATNFFGQNTAAIAALEAQYAEMWEQDAAAMYGYATSAAMAAQ
FT                   LVPFSSPQQTTNPAGLSAQSAAVNQADATAAAANPLSDLIALVQKGLAALAGAFPNLLP
FT                   DDFSILDGIFAGYATVGVSQDCESIIAGIIGAESNLGMLGAASENPAELAPGDIGIGSV
FT                   LSSAPSVGGAVSGPGAVLVSVGRAGSIGQLSVPASWAAPATRQVAALSSAGLTTIPGTE
FT                   EAAHGIPGMPGMPVGSSSRASSVVPRYGVRLTVMAHPPAAG"
FT   gene            225330..225551
FT                   /locus_tag="MMAR_0193"
FT   CDS_pept        225330..225551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38662"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKF7"
FT                   /protein_id="ACC38662.1"
FT                   /translation="MRRIMIFVIPNRRRDPEQCNRDRRAIAQAPDSSVCASPLDHARGS
FT                   GRQRTNKKILGITNVVAAEHESTVRRAT"
FT   gene            225548..225676
FT                   /locus_tag="MMAR_0194"
FT   CDS_pept        225548..225676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38663"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKF8"
FT                   /protein_id="ACC38663.1"
FT                   /translation="MNQMNQLIAAATGCVQPSVPGTPGARPATPDPNPASTPGVIE"
FT   gene            225736..226038
FT                   /gene="esxB_2"
FT                   /locus_tag="MMAR_0195"
FT   CDS_pept        225736..226038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxB_2"
FT                   /locus_tag="MMAR_0195"
FT                   /product="conserved hypothetical EsxB-like protein, EsxB_2"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38664"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKF9"
FT                   /protein_id="ACC38664.1"
FT                   /translation="MAEMKTDAATLTGQAHQFERIADDLKASIRRVETTAAGLLLAWRG
FT                   DAGHAAQAAIALFHQAATQQVKKLNEISTKIWTAAQDYTDTDDHETGLLSNQMNF"
FT   gene            226072..226359
FT                   /gene="esxA_2"
FT                   /locus_tag="MMAR_0196"
FT   CDS_pept        226072..226359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxA_2"
FT                   /locus_tag="MMAR_0196"
FT                   /product="conserved hypothetical EsxA-like protein, EsxA_2"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38665"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG0"
FT                   /protein_id="ACC38665.1"
FT                   /translation="MAVLHYNFAAIEIGVAEIQAEVIKTQKHLHDANQVLSTLTEVWGG
FT                   SGSEAYQQVQQQWDGASADLNAALQALAHAIHQSNQEMLTTETGLATLFA"
FT   gene            226403..226750
FT                   /locus_tag="MMAR_0197"
FT   CDS_pept        226403..226750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0197"
FT                   /product="conserved hypothetical alanine and proline rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38666"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG1"
FT                   /protein_id="ACC38666.1"
FT                   /translation="MTTSKNPVTVDAPVLAAAGDALRGLSFPSPPKPPIGLEMDYAVIA
FT                   ANEVLPHIYFAVKDVLNTAQSTLHQLGANIVTAANTYTNTDKTLGEQLSQYKFQPPAAA
FT                   NPAPAGTGVED"
FT   gene            226758..227129
FT                   /locus_tag="MMAR_0198"
FT   CDS_pept        226758..227129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38667"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG2"
FT                   /protein_id="ACC38667.1"
FT                   /translation="MTRRPDVQVVPKDLTPTGAELEVLRAAEVLTLSGDTWRSSCARGS
FT                   QAPQQLAQGFERAAKNYRGTDRVALVWRAYLQEVLESADPQMPAELDERLARALPHLHG
FT                   ILSALADVIDEDFQIVRGG"
FT   gene            227133..229202
FT                   /locus_tag="MMAR_0199"
FT   CDS_pept        227133..229202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0199"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38668"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG3"
FT                   /protein_id="ACC38668.1"
FT                   /translation="MPQIVKKPDTPNSEAMLEPNGWPNVYELDLINQARDYFMAHKQLS
FT                   EVHSACLKQMSEMFTKDVWSGDAAEAAHAKLSDFSSRLETVVKQLLGVYIWYGDMAALL
FT                   MTVKKRICMLVIETEAEVDELEASAEENPAAPLQIMALLAEANASNTAMVVTVATALQT
FT                   GLGLIPEDMFPAIDMNSPADYLPDLDPPLPPLPAPISNNIPKPIKPLLGQKEQASDSTS
FT                   SDTVQPTSGSTPAATSVPTSGATAALSPLSSLSSLASMASMASMASMSSAGMAGSSAAD
FT                   PQGPPSSEPNTAAAEPAAAPVPTGGGGAHPGGQGIRPQFLGPQVGASSPVPQADPAAAA
FT                   SGASSAPAAPTTSFASGGAAAGPGVRSSAPVAGTRSGRTPTTPAADKSAGKAPVHARST
FT                   ADGDFAGTAETMDADALVAIPVAAALAERDAIAAASTPRTSEAPDPLALARRIAAALNA
FT                   PDVGGTDDFGFFWVTAVTADGEIVVANSYGLAYIPDGVHLPAAVHMASSDRGIAASERA
FT                   RWATYPVMAVQGWAAHHNATLRAIIATEEQLANCDPGVPKILLQPDEIPDTGQMGGRTR
FT                   LEVVDPRAAKRLAATVDARLIDLLPAAPADANAPVDRRHRLWFEVLKPMSSECAGREIA
FT                   HVAEFYNYAAHSQEILLWRAHNAVDADAQRAAVTDWLYWLYITAQLDSAQAIAA"
FT   gene            229316..229807
FT                   /locus_tag="MMAR_0200"
FT   CDS_pept        229316..229807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38669"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG4"
FT                   /protein_id="ACC38669.1"
FT                   /translation="MPIPRPTTADAPAMLEPDGWPGIEEDLVSDLAVTLRRTCAQLEDV
FT                   GEACWEAGALFEDGRWQGPAGAAAAVRFEEILEQMRSVLAALALVTDWHFDVCEFVTEV
FT                   KEDIFTGVLSTQALIEATREAQPEAVPPLIAAQHVSNILKVSGLGLHIGADGTVLLAEI
FT                   "
FT   gene            complement(229926..230201)
FT                   /locus_tag="MMAR_0201"
FT   CDS_pept        complement(229926..230201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38670"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG5"
FT                   /protein_id="ACC38670.1"
FT                   /translation="MTSPLTVSIPSLRTAAGELFAISTAADFPRIPPGVLAIGTDPASV
FT                   HFNRLSPAMLGTLNARLLAIQKALFQLSNDMAAAARAYQEADAAGR"
FT   gene            complement(230276..231814)
FT                   /locus_tag="MMAR_0202"
FT   CDS_pept        complement(230276..231814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0202"
FT                   /product="conserved hypothetical alanine and glycine rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38671"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG6"
FT                   /protein_id="ACC38671.1"
FT                   /translation="MTKPINVQVVPEELMGRASELESLIAAPTASLEALCALPMVVNAT
FT                   ADLVFSANAMLTYIDAGNKARQQLADALREAAKSYVGTDEQVEQALNAGGGAVSAVAPR
FT                   GVLGAHAPGAGAGLGGVRSGLLAAPSAVPPAPPYYPVRTAAAQIAEPDQGTSFNAFAAA
FT                   WTAYQQPLLDSTEAFRPFQNWQGEAATAVEANFEQFRQWVYQIADLCKQLVAQVQGISS
FT                   AHSWAVTQHPTVAQLNKLDKTWEQVQREKIAAEHDSAWIRNMELAILKGEEKALLKKYT
FT                   DYQNQSESVLTEYTKKANLPLSPLNPPVPPTAYSPPAPTPTPTPDPTPTPGSTSGSGTG
FT                   TGGLPMMPMMGGIPSMGGMGSASKAGLAAASGVPGGPALKPAALGGGAGAGAAMPLQSP
FT                   SGAGAPASAAAAGGVAAGGGAARGTGAAAGRGGMGMAPVGHGGHGASSPKDKRDQTGQE
FT                   SLYTEDRAWTEALIGGHEPDETADHAPVTASPPEIDQQLAAALRAAALREALDY"
FT   gene            232431..233972
FT                   /locus_tag="MMAR_0203"
FT   CDS_pept        232431..233972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0203"
FT                   /product="conserved hypothetical alanine and glycine rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38672"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG7"
FT                   /protein_id="ACC38672.1"
FT                   /translation="MTKPINVQVVPEELMGRASELESLIAAPTASLEALCALPMVVNAT
FT                   ADLVFSANAMLTYIDAGNKARQQLADALREAAKSYVGTDEQVEQALNAGGGAVSAVAPR
FT                   GVLGAHAPGAGAGLGGVRSGLLAAPSAVPPAPPYYPVRTAAAQIAEPDQGTSFNAFAAA
FT                   WTAYQQPLLDSTEAFRPFQNWQGEAATAVEANFEQFRQWVYQIADLCKQLVAQVQGISS
FT                   AHSWAVTQHPTVAQLNKLDKQWEQAEECKIRAEHESKLWIRKMEMAIANKELDVTLKQY
FT                   TDYQNRSESVLTEYTKKANLPLSPLNPPVPPTAYSPPAPTPTPAPTPTPTPGSTSGSGT
FT                   GTGGLPMMPMMGGIPSMGGMGSASKAGLAAASGVPGGPALKPAALGGGAGAGAAMPLQS
FT                   PSGAGAPASAAAAGGVAAGGGAARGTGAAAGRGGMGMAPVGHGGHGASSPKDKRDQTGQ
FT                   ESLYTEDRAWTEALIGGHEPDETADHAPVTASPPEIDQQLAAALRAAALREALGY"
FT   gene            234056..234607
FT                   /locus_tag="MMAR_0204"
FT   CDS_pept        234056..234607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38673"
FT                   /db_xref="GOA:B2HKG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG8"
FT                   /protein_id="ACC38673.1"
FT                   /translation="MKTRDATATRSAILDAAQSQFGENGFERTTIRSVAKAAGVDPALV
FT                   MHYFGSKAGLFTAATRFDIKFPDLSGIPMDRIADALLPNFLRVWGPRGAFLPLLRAAAS
FT                   NRDAADALVEVFVDRVGPALSAIVPDRGPERAALVAAQMVGVATARYVIGLPPLLHMDD
FT                   EELIRWLRPVIVHYLTDPAP"
FT   gene            complement(234666..236270)
FT                   /locus_tag="MMAR_0205"
FT   CDS_pept        complement(234666..236270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0205"
FT                   /product="flavoprotein"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38674"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKG9"
FT                   /protein_id="ACC38674.1"
FT                   /translation="MADDTPEHIVESTDVVVIGFGAAGVSAAITAREQGVQVVALDRAN
FT                   GGGATAISGGIIYAGGGTAVQQQAGVRDSFEQMLTYLRLEVADAVSESTLESFVRGSPG
FT                   MIDWLSHYGVPFDSTVCPYKTSFPNNHYYLYHSGSENSGAFRSHTPPVQRGHRVKGKGT
FT                   SGKQLYAPLAKAALSLGVQFYPHTKVTKLLQDSTGRVTGVEAMTMHDAPPRIRRTYAAL
FT                   AAVSTKPGIYYPPLRNLMERRLRALERRYARAVQIRARRGVIVCAGGFIANSEWIKRYA
FT                   PRYVTGLQLGTSGDDGSGIALAQSVGAVTERMDNVSAWRFITPPSAFISTVMVDQQGQR
FT                   VIDESRYGAAVGKALVQDHNARAWLVADADLMNEARRQMLKQPLWFQRAQAAALMVADS
FT                   VRAETLARVARKAGVDPDGLQATVDAHNSAIDAAATDPAGKPAEFVRRVARAPFTLLNI
FT                   SVRPSLLNPTPMLTLGGIKVDEQTGAVLDASGAAIPGLFGAGRTATGICSNSYVSGLSI
FT                   ADCVFSGRRAGNHAAIE"
FT   gene            complement(236388..237773)
FT                   /gene="sdaA"
FT                   /locus_tag="MMAR_0207"
FT   CDS_pept        complement(236388..237773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="MMAR_0207"
FT                   /product="L-serine dehydratase SdaA"
FT                   /note="involved in gluconeogenesis from serine [catalytic
FT                   activity: L-serine + H2O = pyruvate + NH3 + H2O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38675"
FT                   /db_xref="GOA:B2HKH0"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH0"
FT                   /protein_id="ACC38675.1"
FT                   /translation="MTISVFELFTVGIGPSSSHTVGPMRAANEFIAALRSAGQRDAVAA
FT                   VQIDLFGSLAATGAGHGTMSAVLLGLEGFQPEAISSEAKERRLAEIAESGVTRIDGTVA
FT                   VPLTEGDVKLHPDVVLPTHPNGMTLTATDSGGRVLATETYFSVGGGFIVTAGSDHSDDR
FT                   HSCRTPLPYSSGQELLDICDQFGISISEVALRNESCCRSAQDVRSGLLHLRDVMVECEQ
FT                   QSISRDGLLPGSLQVRRRAKSWYERLNAEDPNRKPEFAEDWVNLVALAVNEENASGGRV
FT                   VTAPTNGAAGIVPAVLHYAAHYTRAGTADSEDATVRFLLTAGAIGSLFKERASISGAEV
FT                   GCQGEVGSAAAMAAAGLAEVLGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERN
FT                   AISAGKAINAARMALRGDGFHRVTLDQVIDTMRATGADMHAKYKETSAGGLAINVAVNI
FT                   VEC"
FT   gene            complement(237770..239047)
FT                   /gene="glyA2"
FT                   /locus_tag="MMAR_0208"
FT   CDS_pept        complement(237770..239047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA2"
FT                   /locus_tag="MMAR_0208"
FT                   /product="serine hydroxymethyltransferase GlyA2"
FT                   /note="key enzyme in the biosynthesis of purines, lipids,
FT                   other components. interconversion of serine and glycine
FT                   [catalytic activity: 5,10-methylenetetrahydrofolate +
FT                   glycine + H2O = tetrahydrofolate + L-serine]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38676"
FT                   /db_xref="GOA:B2HKH1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH1"
FT                   /protein_id="ACC38676.1"
FT                   /translation="MTILNESLSTFDPDIAALIDSELNRQETGLEMIASENYAPLAVMQ
FT                   AQGSVLTNKYAEGYPGRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAS
FT                   AMHALLNPGDTILGLSLAHGGHLTHGMRINFSGKLYNVAAYEVSKDDYLIDMDAVAQAA
FT                   RDHQPKMIIAGWSAYPRQLDFARFREIADEVGAVLMVDMAHFAGLVATGLHPSPVPHAH
FT                   VVTSTTHKTLGGPRGGIILSNDAAIAKKINSAVFPGQQGGPLEHVIAAKATAFKMAAQP
FT                   EFVQRQQRCLDGARILADRLNQPDVAERGITVLTGGTDVHLVLVDLRNADLDGQQAEDR
FT                   LAAVDITVNRNAVPFDPRPPMVTSGLRIGTPALASRGFSHDDFGAVADIVAAALTAADD
FT                   DQLGELRKQVQELAARYPLYPELHKP"
FT   gene            complement(239044..239448)
FT                   /gene="gcvH_1"
FT                   /locus_tag="MMAR_0209"
FT   CDS_pept        complement(239044..239448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH_1"
FT                   /locus_tag="MMAR_0209"
FT                   /product="glycine cleavage system H protein GcvH_1"
FT                   /note="the glycine cleavage system catalyses the
FT                   degradation of glycine. the H protein shuttles the
FT                   methylamine group of glycine from the P protein to the T
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38677"
FT                   /db_xref="GOA:B2HKH2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="PDB:3TZU"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH2"
FT                   /protein_id="ACC38677.1"
FT                   /translation="MTDRKIPGDRSYTADHEWIDIAPGAATPDGPVRVGITSVAVEALG
FT                   DLVFVQLPEVGETVSAGESCGEVESTKTVSDLIAPASGQIVEVNTAAVDDPATIATDPY
FT                   GAGWLYSVQPTAVGELLTASEYAGQNGLSL"
FT   gene            complement(239495..240622)
FT                   /gene="gcvT_1"
FT                   /locus_tag="MMAR_0210"
FT   CDS_pept        complement(239495..240622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT_1"
FT                   /locus_tag="MMAR_0210"
FT                   /product="aminomethyltransferase GcvT_1ne"
FT                   /note="the glycine cleavage system catalyzes the
FT                   degradation of glycine [catalytic activity: (6S)-
FT                   tetrahydrofolate + s-aminomethyldihydrolipoylprotein =
FT                   (6R)-5,10-methylenetetrahydrofolate + NH3 +
FT                   dihydrolipoylprotein]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38678"
FT                   /db_xref="GOA:B2HKH3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH3"
FT                   /protein_id="ACC38678.1"
FT                   /translation="MTTSRTTPATPLLQQHHELGARFTDFAGWQMPVRYGSELTEHHTV
FT                   RSAAGLFDLSHMGEIEVLGPGAAAALDYALVGAFSGLKVGKAKYSLLCREDGGVIDDLV
FT                   AYRLAEDNFLVVANAANAAAVYEALVQRAAGFDATVTDRSQDTALIALQGPVAERVLCK
FT                   VVAEADRATVTELKYYAATQIQLGEIPVLLARTGYTGEDGFELYVDNAHAAPVWHLLLD
FT                   AGRADGVIPAGLACRDTLRLEAGMALYGHELSLETSPYDAGLGRTVRLEKYFVGRDALA
FT                   ELAAQGPRRTLIGLQGLGKRAARAGYAVYTEDGQRQIGTVTSGALSPTLGYPIAISYVE
FT                   AGTVDTDSIVAVDIRGSMEHFRVVATPFYVRPRPA"
FT   gene            complement(240640..243525)
FT                   /gene="gcvB_1"
FT                   /locus_tag="MMAR_0211"
FT   CDS_pept        complement(240640..243525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvB_1"
FT                   /locus_tag="MMAR_0211"
FT                   /product="glycine dehydrogenase GcvB_1"
FT                   /note="this family consists of glycine cleavage system P-
FT                   proteins from bacterial, mammalian and plant sources. the P
FT                   protein is part of the glycine decarboxylase multienzyme
FT                   complex also annotated as glycine cleavage system or
FT                   glycine synthase. the P protein binds the alpha-amino group
FT                   of glycine through its pyridoxal phosphate cofactor, carbon
FT                   dioxide is released and the remaining methylamin moiety is
FT                   then transferred to the lipoamide cofactor of the H
FT                   protein. GDC consists of four proteins P, H, L and T. the
FT                   reaction catalysed by this protein is: glycine +
FT                   lipoylprotein = s-aminomethyldihydrolipoylprotein + CO2"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38679"
FT                   /db_xref="GOA:B2HKH4"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH4"
FT                   /protein_id="ACC38679.1"
FT                   /translation="MSETYEQLHGGRAVASSFVPRHIGPDPAAIAHMLATVGYPSLDDL
FT                   IDAAVPARIRNTAPMALPVARTEQQVLTDLASMAERNTIRVSMIGQGYSPCVTPEVLRR
FT                   NLIESPAWYTAYTPYQPEISQGRLEALLTFQTMIEDLTGLPLAGASLLDEATAVVEAML
FT                   LMRRSNKSPSARLLVDSDCFTQTLSVLRTRAAAVGIDIELVDIEKKLPEGDFFGIVLQA
FT                   PGASGAVRHLGRLIATAKARGAMTTVAADLLSLTLLTPPGELGADIAVGSAQRFGVPLF
FT                   FGGPHAGYMAVRSGLERALPGRLVGVSKDVNGAPAYRLALQTREQHIRRDKATSNICTA
FT                   QALLANVAAMYAVYHGPEGLRDIASRVHAHAVSIAASLRHHGYTVAHDQFFDTVLVEVP
FT                   GRAGELIARAESLGINLRRAGSDHVGISCDETTTTEVITLVLKAFDVERIAPSRSPLGS
FT                   ELLRTTPYLQHGVFHEHRSETAMMRFLRKLSDRDLALDRTMIPLGSCTMKLNSAVEMAP
FT                   ISWPEFAAIHPHAPIAQTTGYRELIADLERWLAEITGYDRVSLQPNAGSQGELAGLLAI
FT                   HGYHASRGEQQRRICLTPQSAHGTNAASAVLAGMQVVVVATAADGSIDLADLRAKISTH
FT                   SAELAAIMLTYPSTHGVYEPDVTTVCDLVHKAGGQVYIDGANLNALVGIARPGHFGGDV
FT                   SHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPFLPDDPHQDTSDSSVAAANYGSAGILPI
FT                   TWAYIALMGPDGLATATKSAVLSANYLAARLNDHYPVLYTGPHGLVAHECILDLRELTR
FT                   RSGVTAEDVAKRLIDYGFHAPTLAFPVSGTLMVEPTESEDLAELDRFVDAMVAIRGEID
FT                   LVMWGEWPLEASPLRQAPHTAEMVCADTWDLPYPRSVAAFPAPWLVTDKYWPPVRRIDG
FT                   VHGDRNLVCSCPSPAAFESTLPPKSASLQVL"
FT   gene            243865..243963
FT                   /locus_tag="MMAR_5544"
FT   CDS_pept        243865..243963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_5544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_5544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38680"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH5"
FT                   /protein_id="ACC38680.1"
FT                   /translation="MAVPGGWPDTARAGGWLQARGDRDRTHLTIER"
FT   gene            complement(244095..245465)
FT                   /locus_tag="MMAR_0212"
FT   CDS_pept        complement(244095..245465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0212"
FT                   /product="conserved hypothetical oxidoreductase"
FT                   /note="function unknown; involved in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38681"
FT                   /db_xref="GOA:B2HKH6"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH6"
FT                   /protein_id="ACC38681.1"
FT                   /translation="MSTAAGNPARTRDEDAIGVPPASPTLVPAQRYHSPAFAQLEIERM
FT                   WPKVWQLACMLDHVAAPGDYFEYRCGPYSVLIVHDCDGVLRAFQNVCRHRGNSLCAGSG
FT                   SGLRELKCGYHGWTWDLTGELRRVPNRKGFGSLHMPDFPLLPVRVETWEGLVFVSLDVT
FT                   AMPLMDYLDPIPEDIAWCGLSDFRCYATLTVEVDANWKTIADGYSETYHIQTLHPELLR
FT                   CVDDIHAPQQIWRHAGKSDQPYGVPSPRFEGTLSDQEVWDAYVYTQGALMGAAEGTPLP
FT                   ADERRPGQSVQDLIAARTRAFAATRGVDLEWADTDRITRLHQYNVFPNMTFLANADHLT
FT                   IMCSRPQPEHFADPDKGEMVMFLMTRMPPDAPHNKPTDVRMAADQAEPGIVLTQDIRVL
FT                   PGVQRGLHQPGFTHLVLSGEERRIINMHRNLERYLDLPEPERMSGGGLRPGPGAPRV"
FT   misc_feature    245152..253062
FT                   /note="MURD5; function unknown but may be required for
FT                   amino-acid import and degradation. Contains an amino acid
FT                   hydrolase and four genes encoding putative membrane
FT                   proteins, two of whcih may be ABC transporters involved in
FT                   glutamine transport"
FT   gene            complement(245475..247235)
FT                   /locus_tag="MMAR_0213"
FT   CDS_pept        complement(245475..247235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0213"
FT                   /product="D-amino acid aminohydrolase"
FT                   /note="hydrolizes specific D-amino acid"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38682"
FT                   /db_xref="GOA:B2HKH7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH7"
FT                   /protein_id="ACC38682.1"
FT                   /translation="MFDLKIVGGTVVDGTGAARYRADIGIKDGKIVDVVRRGTDDPGLG
FT                   GESAETIDATGQVVAPGFVDIHTHYDGQVSWDSTLEPSSGHGVTTVVTGNCGVGFAPVR
FT                   PGSEDWLIRLMEGVEDIPGTALTEGITWGWESYPQYLDTIGKQKFSIDVGSQIAHGSVR
FT                   AYTMGERGARNEPATAEDIAAMGRLVTEAIEAGALGFSTSRTLAHRAMDGEPVPGTFAA
FT                   EDELFGLGRAMAAGGQAVFELAPQGAAGEDIVGPRKELEWMRRLAGEIDRPVSFALIQV
FT                   DADPNLWREQLELSASAHAAGSRLHPQIAARPFGMMIGFQGHHAFTHRPTYRRLKADCT
FT                   RDELAQRLADPAVKAAILSEDDLPIDPNVLFDGMSAFVQYSLGRVYALGDPPDYEPTRD
FT                   RTVAAIAQARGQDPLATLYDLMLESNASAMLMLPLFNYADGNCDAIREMMLHPAGVLGL
FT                   SDGGAHCGMICDASYPTFLLTHWARDRKRGEKLPLEYVIRKQARDTAHLFGLTDRGTIE
FT                   PGKKADLNVIDLEALRLHPAAMAYDLPAGGNRILQGASGYAATIVSGAVTRRGGVDTGA
FT                   RPGRLVRGAR"
FT   gene            complement(247401..247778)
FT                   /locus_tag="MMAR_0214"
FT   CDS_pept        complement(247401..247778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown. domain identity suggests anti-
FT                   anti-sigma regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38683"
FT                   /db_xref="GOA:B2HKH8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH8"
FT                   /protein_id="ACC38683.1"
FT                   /translation="MVEQSGDPTPPTAFGIEKSRVGEAVVVTVSGELDMLTAPRLAEML
FT                   RTSLIEAPATLIVDLSKVDFLASAGMTVLVSAKAQAVAPTRFVVVADGPATSRPIRLMG
FT                   IDAMLPLYDALDDALNDISDS"
FT   gene            248068..249117
FT                   /locus_tag="MMAR_0215"
FT   CDS_pept        248068..249117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0215"
FT                   /product="glutamine-transport transmembrane protein ABC
FT                   transporter"
FT                   /note="involved in active transport of glutamine across the
FT                   membrane (import). responsible for the translocation of the
FT                   substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38684"
FT                   /db_xref="GOA:B2HKH9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKH9"
FT                   /protein_id="ACC38684.1"
FT                   /translation="MLFAALRDMQWRKRRLVIAIISTGIIFGMTLVMTGLANGFRVEAQ
FT                   HTVDSLGVDVFVVKAGAAGPFLGSIPFPDVDVARVAAEPGVVAAAPLASMGTIMKEGKS
FT                   TRNVTAFGAPEHGPGMPEVSDGRAPSKPDEVAVSSTLNRHIDDTLQLGAHKLRIVGIVP
FT                   NSTALAKIPNIFLTTEGLQRVAYNGQPMITSIGIDGSPRELPEGYQTYDREGAVNDLIR
FT                   PLKVAVNSISIVAVLLWIVAVLIVGSVVYLSALERMRDFAVFKAIGTPTHSIMAGLALQ
FT                   ALVVSLLAAVVGVVLSKLLAPLFPMIVAVPGGAYLALPVVAILIGLLASVAGLKRVMTV
FT                   DPALAFGGP"
FT   gene            249121..250113
FT                   /locus_tag="MMAR_0216"
FT   CDS_pept        249121..250113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0216"
FT                   /product="glutamine-transport ATP-binding protein ABC
FT                   transporter"
FT                   /note="involved in active transport of glutamine across the
FT                   membrane (import). responsible for the translocation of the
FT                   substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38685"
FT                   /db_xref="GOA:B2HKI0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI0"
FT                   /protein_id="ACC38685.1"
FT                   /translation="MGDLSIQDLVVEYYSGGYALRPINGLNLDVEAGSLVILLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFEDIDITTLEGTALAKYRRDKVGIVFQAFNLVPSLTALE
FT                   NVMVPLRSAGMSRAAARARAEELLKRVNLEERMKHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGDRVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPEVVELKSGDVLFEQSTMGDLIYVVSAGEFEIVHELADGGEELVKVAGPGEYFGEM
FT                   GVLFHMPRSATVRARTDATAVGYTAQAFRERLGIGGMRDLIEHRELSND"
FT   gene            complement(250135..251085)
FT                   /locus_tag="MMAR_0217"
FT   CDS_pept        complement(250135..251085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0217"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38686"
FT                   /db_xref="GOA:B2HKI1"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI1"
FT                   /protein_id="ACC38686.1"
FT                   /translation="MARETARILRMLSAVALGSLVVWTGGCSAGEHAAGAPAPATIPVG
FT                   RSAQSIQWDGAERTFNLYRPQGLTGAVPLVVMMHGGFGNGAQAERAYHWNDKADQQHFL
FT                   VAYPDGLHRAWNAGTCCGLPQRNNVDDVGFLTAMVAAIGKQIPIDSARIYATGMSNGAM
FT                   MALRLGCQTDIFAAIAPVAGALVTDCARPRPTSVLQIHGTADQSVPYDGGPGKAVKING
FT                   SPRVDGPSVPSVSATWRAIDACGPPISSTAGVVTTVTADCADGHTVELISVAGAGHQWP
FT                   GGTRGPLLERLGLPEPSTALDATDTIWQFFAGHRR"
FT   gene            complement(251170..252468)
FT                   /locus_tag="MMAR_0218"
FT   CDS_pept        complement(251170..252468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0218"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38687"
FT                   /db_xref="GOA:B2HKI2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI2"
FT                   /protein_id="ACC38687.1"
FT                   /translation="MTSLTGFPGPAELAERTPADRDRAIDVIRITALVGVVVGHTVMAT
FT                   SVIRGGVLRWDNLLTTSTTFQALTWIFQIMPLFFFAGAAACVPSWRPGTNWGGWLMKRA
FT                   ARLFRPVFYYLSFWAVALVIFYPLLPQHVYEPVAGVSIQLLWFLGAYVLVLAAMPVLSR
FT                   ITSTARLAASVTAVYAMIAAVDAVRLHCSAAPSLGYLNLAVWLIPAMFGVAYRRRLLTR
FT                   ARAIGTAAILLATNVALLCWGPYELSLVGIEGQRLPNMSPPSLLLAGHAIILSALAVVA
FT                   APAIARWARRPRVWWLAAIGNSGAMTLYLWHMPALLGVHLLFDGLGAPRYPGEPGFAVI
FT                   SAAQLLIMCGAVAALFVALRPLENNPLPGWDGAPAITSVWRGAGVGVLLCVAGAAILAS
FT                   VKWGLKDDGLACIAVTVAALVAARILAVARLPR"
FT   gene            complement(252597..252974)
FT                   /locus_tag="MMAR_0219"
FT   CDS_pept        complement(252597..252974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0219"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38688"
FT                   /db_xref="GOA:B2HKI3"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI3"
FT                   /protein_id="ACC38688.1"
FT                   /translation="MTTSSNPWGDERRRLSHQLPMRDHLFGRSQARRLSRRFAGVGVRI
FT                   SPQRLREMHAGMPASDSEMTNINFALIAIQITREKRVAKLHRLQRKCRHALLSLGMVIV
FT                   ALNFLLCIGYLLFSLTLQRSM"
FT   gene            complement(253047..254222)
FT                   /locus_tag="MMAR_0220"
FT   CDS_pept        complement(253047..254222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI4"
FT                   /protein_id="ACC38689.1"
FT                   /translation="MSMPQDRFKPERLIATACEEAGSDDFGADGWQDGLQRVTDALIHE
FT                   ARLSAIGVEIAHLDLMRALRNRLGVIAWRRQHPEIATKAIDQPIVIVGQPRTGTTILYD
FT                   LLAQDPDLRAPLTWEVDAPCPVPAPETYLSDPRIAQTQASIELSEQIIPGFLSFHPMGA
FT                   QVGQECVRITASEFTSMIYSVQYRLPSYYRWLLYEADHRGAYRFHRIFLQHLQSGVAGQ
FT                   WLLKSPAHLWQLDALLAEYPDALIVQTHRDPLNVISSIAALTHHLRRMASDESSIAECA
FT                   AQCYEEIVVGLDREMALRAGGALPAGQVIDVLYTDFINDPWSTIRGVYRKLGRELAPET
FT                   EQRMRDFLRAHPGDGGRGRYTWSDTGLDASVVRDRVRPYQDRYGVPTEQLR"
FT   gene            complement(254219..255316)
FT                   /locus_tag="MMAR_0221"
FT   CDS_pept        complement(254219..255316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38690"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI5"
FT                   /protein_id="ACC38690.1"
FT                   /translation="MSHHLARPVADAPQALAAWQFFQRMLADVTKIVTEDAESEPELLE
FT                   GLRVIARVSSLCAQMSVESDPARPVFFDMCPPNRMIGGPNPEGNYFLAMIRGDHRYRIT
FT                   GTRGTSCYLGIQILAGTGLTPRRMAGYLSDADLALQSGEFTLLLSALEPDEPGGGQWVQ
FT                   IPDDASAIVVREYVGDRSREELAKMRIEAFAPAPASPPTDDELAGQFTALAWSLMKLTT
FT                   LHRTIKPELLDHPNTLLTAQAADLGAADTTPDNLYMIGTFRLAPGQALVLDFEPPETRY
FT                   WSVALESIWHECLEPDSRHSSVTNRAVRPGADGRVRIAISEQDLGFGHWLDTGGRHRGF
FT                   VILRWLDNPQAPDIEVSVRHREQRA"
FT   gene            255379..255972
FT                   /locus_tag="MMAR_0222"
FT   CDS_pept        255379..255972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0222"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38691"
FT                   /db_xref="GOA:B2HKI6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI6"
FT                   /protein_id="ACC38691.1"
FT                   /translation="MSPPPAATSLAERKRTATRQRIATAAAQLVADLGLAAATVERIAD
FT                   TADISRATFFRYFNSKEDAVAEGMTAHWLDRIATALAAQPEHLSAVEAVVGAFGGLAVG
FT                   FAEMEDQVRELATLTRSSETLEAWTLHIYVRYESAIADLIAPRIPNLVPQDPRPRLVGA
FT                   LAMAVVRIALDDWLGQGGSLPDRVQQGLAAIVIA"
FT   gene            complement(256036..256866)
FT                   /locus_tag="MMAR_0223"
FT   CDS_pept        complement(256036..256866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0223"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38692"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI7"
FT                   /protein_id="ACC38692.1"
FT                   /translation="MPTIDINAGTIHYEVTGPEHGRPVMFVHGYLMGGQLWRQVSERLA
FT                   KRGLRCFAPTWPLGAHPRALGPDADRSITGVGDLVADVLATLDLHDVVLVGNDTGGVVA
FT                   QLVAVRHPERLGALVLTSCDAFEHFPPPILKPVILAAKSKKMFRAAIQTMRSPAARRRA
FT                   YGDLAHADIDELAQRWVQPALSNPAIAEDLRQLTLSLHTDVTRGVAARLPEFSKPALIA
FT                   WSADDKFFALEDGRRLAATIPNARLELIEGARTFSMLDRPDRLADLLSAVAVRT"
FT   gene            256927..257532
FT                   /locus_tag="MMAR_0224"
FT   CDS_pept        256927..257532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0224"
FT                   /product="transcriptional regulatory protein"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38693"
FT                   /db_xref="GOA:B2HKI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI8"
FT                   /protein_id="ACC38693.1"
FT                   /translation="MEIKRRTQEERSAATREALITAARKLWGSRGYAEVGTPEIAAEAG
FT                   VTRGAMYHQFADKAALFGEVVEAVEQDVMTRMATSVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPAVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLDRHPVRPLAHVL
FT                   IGALDEAAMFIATADDPKRARRESRQVLRRLIDGMLND"
FT   gene            257653..258273
FT                   /locus_tag="MMAR_0225"
FT   CDS_pept        257653..258273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0225"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38694"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKI9"
FT                   /protein_id="ACC38694.1"
FT                   /translation="MAFRIGMNIAAWVLCAGAVVGAPPVQAAPGAVLPPIPSTGGGPII
FT                   GGGDEAAQSRIARQLTSVGNADVQEGDGADAASFIMDSARVADSRLASAFVPLQRALGC
FT                   QKVNTSFGARAYRRSDGGWGGAMLVIAESATSDMQALTGCIRSVWPAATAGGSNAMCAH
FT                   GWTYPTSGQDHRPETYHILLAGTAADFCAKFDEDYANFATNWP"
FT   gene            258629..259237
FT                   /locus_tag="MMAR_0226"
FT   CDS_pept        258629..259237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38695"
FT                   /db_xref="GOA:B2HKJ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ0"
FT                   /protein_id="ACC38695.1"
FT                   /translation="MARRRGWNGAPPASDEEASRRIVDTAVRLIAETGSDVSLAQVAAS
FT                   LGVIRQTVYRYYPTADALMRAAAIASVDGFLDRLTEAVRGMRDPAEAMAEAVMFTLRDV
FT                   VRTPHLGILIAQPYAHTHPENLTSEEAQVFGVRMLERFDVDWAEYGFADESARHDLVEF
FT                   LLRVLLSFFVAPNVPSRSDDELKSFIKRWVGGAILAQKR"
FT   gene            complement(259288..260268)
FT                   /gene="lpqP_1"
FT                   /locus_tag="MMAR_0227"
FT   CDS_pept        complement(259288..260268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqP_1"
FT                   /locus_tag="MMAR_0227"
FT                   /product="conserved lipoprotein LpqP_1"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38696"
FT                   /db_xref="GOA:B2HKJ1"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ1"
FT                   /protein_id="ACC38696.1"
FT                   /translation="MLVKYAAGCHHVAVAVRCARVVNVCLLAALIFLANTCVVGTRLSA
FT                   TPDFPIPAGRSVQILNSGGIFRIYRVYRPRGLTGAAPLVVMLHGGFGDGAQAQRDYHWN
FT                   SQADSGGFVVAYPNGVLRAWNGGTCCGAPESFDIDDVGFITDMVATIQRRTPIDPARVY
FT                   ATGMSAGAIMALRLGCQSDKFAAIAPVAGTLLTDCAHARPTSVLQIHGTADDRVPYNGG
FT                   PGVARSFDGSARVDGPSAAAVNATWRAIDACAPPTSTTSGVVTTQSASCTDARRVTLIS
FT                   VAGAGHQWPGSRSKPVLETIAGISPPSTALDATATIWQFFSQAHL"
FT   gene            260305..260754
FT                   /locus_tag="MMAR_0228"
FT   CDS_pept        260305..260754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown. contains HTH motif. may be
FT                   involved in transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38697"
FT                   /db_xref="GOA:B2HKJ2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ2"
FT                   /protein_id="ACC38697.1"
FT                   /translation="MRRVLDAAWEPTVPALMQLVAATAAPRLRSAFAEAGLDGIRPAQA
FT                   IGLVPLAGGGLHASDLADRLGVSRQAVAQAVTALERHGYVLRAPDPADARARIIELTPR
FT                   GRQALRVMRANALDAQRRWQKILGPQRLGELRETLQLLLDAESGA"
FT   gene            complement(260799..261605)
FT                   /locus_tag="MMAR_0229"
FT   CDS_pept        complement(260799..261605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38698"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ3"
FT                   /protein_id="ACC38698.1"
FT                   /translation="MSPKSAARVRRLIGNRPLSARSVLASALLGADQARLTVAELVAVA
FT                   SLFGISDGAARTCLWRMVSSGELTGGEGSYALAGHLLERRQRVDEASRIADTAVGSWDR
FT                   TWELAVVSLDRRSAADRLELRKAAMALHLAELREGVWVRPDNLDPQRLPISRSVLDRQC
FT                   IHFHGAATDISADKASSLFSLDEWAADALALIQAMDAELDRSSRDVSAQRSSYQFALSI
FT                   AVVRHLQRDPLLPAELIGDDWPGHPLRSTYLRLDEAFKRRMSHAFR"
FT   gene            261665..262849
FT                   /locus_tag="MMAR_0230"
FT   CDS_pept        261665..262849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0230"
FT                   /product="dioxygenase"
FT                   /note="function unknown, involved in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38699"
FT                   /db_xref="GOA:B2HKJ4"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ4"
FT                   /protein_id="ACC38699.1"
FT                   /translation="MSSPTKPLVAEDAEIVRRVLAHIDAGTTDEGEAWREPVENYVSPE
FT                   RFAAELRLLRGMPSVFVPSAAIPNKGDHVERTAFGVPLFAVRGADGRARVFRNACRHRG
FT                   FALVENAGCSHALVCRYHGWIYRLDGSLSHVPHAEAFPDLDMSARGLIEVESHEVDGLI
FT                   VIGPLDPVDAGLIEDEGAIGWLTDGSPWRAKLVPAERLIVVESTLREINWKVLVEQFLE
FT                   GYHIRSTHKDTFFPVQYDDLNVVEAFGPNTRITFPYRNIERLRDRPEHTWTTGARVTYL
FT                   YQLFPNVMLATFPDVIAMVVIDPVSVDRTAVTIYSMVTPDVAERDSLDASSNLAGAGSF
FT                   IGQGLSEDNEMSEGVQRGLAAGANAFVEFGRHESAVGRFHAALGRRLARLTSVG"
FT   gene            complement(262878..265247)
FT                   /gene="ctpA_1"
FT                   /locus_tag="MMAR_0231"
FT   CDS_pept        complement(262878..265247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA_1"
FT                   /locus_tag="MMAR_0231"
FT                   /product="cation transporter p-type ATPase CtpA_1"
FT                   /note="cation-transporting ATPase; possibly catalyzes the
FT                   transport of a cation (possibly copper) with the hydrolyse
FT                   of ATP [catalytic activity: ATP + H(2)O + cation(in) = ADP
FT                   + phosphate + cation(out)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38700"
FT                   /db_xref="GOA:B2HKJ5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ5"
FT                   /protein_id="ACC38700.1"
FT                   /translation="MPETTGLPATLSNVELDIAGMTCASCAMRIEKKLNKLDGVSATVN
FT                   YATERATVTAPAGYDPQILITEVKKAGYAAALPQHRQQPAAAAKTDTHGVDPELASLRG
FT                   RLVGAVVLAGPVILMAMLPALQFRYWQWASLALAAPVIVWAGRPFHQAAWVNLKHGTAT
FT                   MDTLISVGTLAAFLWSLYALFLGTAGEPGMRHPFELTITPGDGASNIYLEVAAGVIAFV
FT                   LAGRYFEKRSKRRAGAALQALLELGAKDVAVLRNGAEIRVPVQELTVDDEFVVRPGEKI
FT                   ATDGTVVAGSSAVDASMLTGESVPVEVGPGDTVTGATTNAGGRLVVRATRVGEHTQLAQ
FT                   MAKLVEAAQSGKADVQRLADRVSGVFVPIVIAIAVTTLGVWLGAGYPVSAALTAAVAVL
FT                   IIACPCALGLATPTALLVGTGRAAALGVLIKGPEMLESTRRVDTIVLDKTGTVTTGKMT
FT                   LLEVITVPDTDRATALRYAGGLEAASEHPIAAAIVKSARAELGALPEPADFANTEGQGV
FT                   RGIIDGHAVIVGRASLLADWAQHLDPDLAAAKDRAESQGKTAVAVGWDGRARAILVIAD
FT                   TVKPTSAAAIREFKRLGLTPVLLTGDNPTVARHIADEVGIDEVIADVLPAGKVAAVRRL
FT                   QSEGKIVAMVGDGVNDAAALATADLGLAMGTGADVAIEAADLTLVRGDLRAAADAIRLS
FT                   RRTLNTIKTNLFWAFGYNVAALPLAAFGLLNPMLAGAAMAFSSVFVVGNSLRLRSFTSV
FT                   ITDAPPATGSPTRWDATPESPAELSTLPGEPSGCPR"
FT   gene            complement(265258..266148)
FT                   /locus_tag="MMAR_0232"
FT   CDS_pept        complement(265258..266148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0232"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38701"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ6"
FT                   /protein_id="ACC38701.1"
FT                   /translation="MSARARLALYATGMAALFGAAFLVGGAVIAHPISTSWARSGHAGH
FT                   QAGTQPVRGVSLSAGDLMLDDVAAPPAVGVQGTLSFRVQSLGGVPVTRYAIENAKKLHL
FT                   IVVRSDGTEFRHVHPTMSAEGRWSIPWAWNAAGTYRVFADFVPEGGNPTVLTYALNVGG
FT                   MFTPDPPPSATNVSRTDGFTVTIDGPFTAQSPSRLIATVTRDGQPVTTLQPYLGAYGHL
FT                   VVLREGDLAYLHAHPENGAASAGSASPAQIAFTTEPPTPGRYLLYLDFQVNGRVHTAQF
FT                   VRCAAEQSSHPATHQ"
FT   gene            complement(266145..266357)
FT                   /locus_tag="MMAR_0233"
FT   CDS_pept        complement(266145..266357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains copper chaperone domain"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38702"
FT                   /db_xref="GOA:B2HKJ7"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ7"
FT                   /protein_id="ACC38702.1"
FT                   /translation="MNTSEYQVAGMRCGHCESAIRSEVAQIPGVATVAVSARTGRLLVA
FT                   GSAPIDPTTVLGAIDEAGYQAVLVA"
FT   gene            266541..267032
FT                   /locus_tag="MMAR_0234"
FT   CDS_pept        266541..267032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38703"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ8"
FT                   /protein_id="ACC38703.1"
FT                   /translation="MTRGELMTVVVVDAGPRRVSRSVEVAAPAAELFAIVADPRRHSEL
FT                   DGSGTVRDNIKAPVTLVAGTKFSTNMRMFGVPYRITSTVTALKPNELVEWRHPAGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGELKNKLKYYERIGACKANAAGIEATLAKLRDRYAAR
FT                   "
FT   gene            complement(267056..267619)
FT                   /locus_tag="MMAR_0235"
FT   CDS_pept        complement(267056..267619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0235"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38704"
FT                   /db_xref="GOA:B2HKJ9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKJ9"
FT                   /protein_id="ACC38704.1"
FT                   /translation="MLLPLSAQPYTAPTDRDMLPSERREFVRTHRTCVFGYRRRNDGPG
FT                   MSIVYYIPTDDDELLVATMAGRGKARVVERDGKVSLCVLDERWPFTYLQVYADAMLDPD
FT                   RELAVDVMMAVAGRMSGQPLDAQARPSVEAMCERENRVVIRCRPYSTFATPPRHLHRND
FT                   QVEHLTHWVSGVVPWDAADPASSR"
FT   gene            complement(267658..268668)
FT                   /locus_tag="MMAR_0236"
FT   CDS_pept        complement(267658..268668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown. possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38705"
FT                   /db_xref="GOA:B2HKK0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK0"
FT                   /protein_id="ACC38705.1"
FT                   /translation="MSLLTALRLNMTNIADPAADHAQRYRAALDMAEYADHHGFTAVSA
FT                   EEHHLAATGWLPSPLILAAAVAGRTRNVRISINALIVPLYDPVRLAEDIAVLDNLSQGR
FT                   FSFVAGMGYRPQEYHAAGKDWSRRGALMDHCLSVLLQAWGDDPFEYDGRLINVTPKPRT
FT                   HPHPILFVGGMSVAAARRAAHFGLPFSPPMAMPELEAVYHQELARRNKRGFVYHPENGS
FT                   TVTLLHADPDEAWSRFGGFIMNEATEYSGWKRADVPRPNEAPAASIAELRGLDNVQILT
FT                   PDQLVGQLQRGRKEVVMNPLIGGLPVEVGWSSLRLLAEEVLPRVADIPDSATTKP"
FT   gene            complement(268665..269282)
FT                   /locus_tag="MMAR_0237"
FT   CDS_pept        complement(268665..269282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0237"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38706"
FT                   /db_xref="GOA:B2HKK1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK1"
FT                   /protein_id="ACC38706.1"
FT                   /translation="MGARGEQTRQRIITAAMRCVAEAGPAQASIREIAKAADMTSGSLY
FT                   HYFPNKSELLNATATEIEEIVLPRLHAAAASSDDIVDRLDAVLDESKRLMRDYPYLAGF
FT                   LRAVRAENADQTGGGRRTYPGSKALRDVITEIVDDARGRGVLSAGIAPGAAVDAICALT
FT                   RGLTEQAANLGPQSYDVTLDSAKQLLRGSLFAGAKPTATHRT"
FT   gene            269478..270107
FT                   /locus_tag="MMAR_0238"
FT   CDS_pept        269478..270107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0238"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38707"
FT                   /db_xref="GOA:B2HKK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK2"
FT                   /protein_id="ACC38707.1"
FT                   /translation="MTRTQLGRPVGASGEETRQRIIVATMQCVSKVGYARATIREIART
FT                   ANVTSASLYNYFPNKSELIKETIAARADAAMPRLRRAAEGGGNIVDRIEAVLDECGELI
FT                   REYPQLAAFEFAIRAEDGIALDAQEGSGQLGEVGFTAFREIIRGLVEDARRRGELAEQA
FT                   DTAGAIEAIYALIYGLTELAATLPLDQFHAALSAAKGLIRGTLFRC"
FT   gene            270210..272009
FT                   /locus_tag="MMAR_0239"
FT   CDS_pept        270210..272009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0239"
FT                   /product="monooxygenase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38708"
FT                   /db_xref="GOA:B2HKK3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK3"
FT                   /protein_id="ACC38708.1"
FT                   /translation="MTETVGCAFDVDVLRQKYAEERTKRLRPDGIAQYVEIAGEFSRFG
FT                   EDPWADEEFAREPLTDEVDVAIIGAGFGGLLTGARLRQLGVQSVRLIDRAADVGGTWYW
FT                   NRYPGIACDVESYVYMPLLEELGYIPTEKYAKGAEIFAHCQRIAAKYDLYRDACLQTDV
FT                   HEIRWDADISRWIIRTNHGDRMRARFVSMANGYQAKPKLPGIAGIASFGGKTFHTSRWD
FT                   YGYTGQGLQNLADKRVGIIGTGATAVQCVPHVAAAAQQLYVFQRTPSSVDVRANEPTDT
FT                   EWAATLQPGWQRRRITNFQVLTAGGQASEDLVADAWTSITRKLPVMRHDSAGTTDPEKR
FT                   SREIEFADFAKMEEIRARVDQLVTDRATAQALKPWYGYFCKRPCFHDEYLQTFNRDNVT
FT                   LVDTEGRGVERIIESGVVVDSVAYELDCLIFATGFEVGTDYCHRTGFELIGRDGITLTD
FT                   RWRDGVRTFQGLCANGFPNCFIESIAQAGLTVNFPYLLDVQASHVAWIIAWALEHGVSE
FT                   VEASPEAEAAWVEAVVARSAATAERAKTCTPGYYNREGKADAKTRQGSFFFGAPTEYAD
FT                   ILETWRAKGDMEGLAIRGAQVPR"
FT   gene            272006..273682
FT                   /locus_tag="MMAR_0240"
FT   CDS_pept        272006..273682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0240"
FT                   /product="monoooxygenase"
FT                   /note="function unknown, involved in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38709"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK4"
FT                   /protein_id="ACC38709.1"
FT                   /translation="MTRPAARLRYFAGRLRAATRRGRPPRVVIIGAGFGGIAAAVALRG
FT                   AGIDDLVIIEGADGVGGTWRRNTYPGAACDIQSHLYSFSFAPNKFWTRTYARQPEILAY
FT                   LESVVDDFDLRRHLMLSARVRSIRWDEDTWRWVCQVDRAGGTATLTADVVVCATGLFGP
FT                   RKLPDIAGLTDFGGTLMHTAGWDHRVDLTGKRVAVIGTGASGVQVVPELAKLAGRLTVF
FT                   QRTPPWMVPKDDRRYTATELRQFRRNPLAIRRTRWQIWKFQHDNTATFADDPVVTSRTQ
FT                   IATSFLERVVADERLRRALTPGYPFRCKRVLLGDDFYRALQHDHVELVTDPIERVTETS
FT                   VVTTAGQAVDVDAVVLATGFETSRYLSGIEVIGTGGQSLHERWGDDPAAYLGAAVGGFP
FT                   NFFMLYGPNTNQGGNSIVYILEAGARLVASAVSRLARRGGYLDVRPEAERRYNDEISTD
FT                   LERTIWTQCQSYFRSPSGRIVTQWPYTELEYARRTWRIKPRDWLHHKGVSPAAQRGGAG
FT                   SAASAQTEIDHPADQLAGNQIGVGVVDAVERVALGDHLVQE"
FT   gene            complement(273566..274723)
FT                   /gene="adhD"
FT                   /locus_tag="MMAR_0241"
FT   CDS_pept        complement(273566..274723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhD"
FT                   /locus_tag="MMAR_0241"
FT                   /product="zinc-type alcohol dehydrogenase AdhD"
FT                   /note="function unknown, generates an aldehyde (or perhaps
FT                   a ketone) from an alcohol"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38710"
FT                   /db_xref="GOA:B2HKK5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK5"
FT                   /protein_id="ACC38710.1"
FT                   /translation="MRSRAAILYEYGHPWTVEEFELDPPRAGEVLVQLSATGLCHSDEH
FT                   IRRGNLAPPPETLRSLGLPAMSPTIGGHEGSGVVLEVGEGVTRFAPGDHVVTSFIAVCG
FT                   QCRWCATGMEYLCDTGYGTLAPGMPTDGTFRHHSLDGRDLGHVSKIGAFAEHTVVSADS
FT                   LVKIDQTFPLVPAALLACAIPTGYGSAARRAQVRGGDIAVVIGAGGIGTAAIQGARIQG
FT                   ATRIIAVDPVEFKRKSALTFGATHTAATTDEAVETVRELTRGVMADVVVVSPATIGPAD
FT                   VAAALSLTRKGGTCVLTGLPAPAMHSIAVGLQDFVLMNKTLCGTVFGSCNPKSDIPLLA
FT                   TMYQSGQLLLDEMITKRYSLDSINDAYADLVAGELIRGVIDFSLS"
FT   gene            274874..276589
FT                   /locus_tag="MMAR_0242"
FT   CDS_pept        274874..276589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0242"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38711"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK6"
FT                   /protein_id="ACC38711.1"
FT                   /translation="MSHLVAIPDLLASAAADLAGVGSSVRAANVAAAGSTTALLAAAGD
FT                   EVSAAIATLLSGQGRQYQAISVQVAAFHAGFVQALGGAGGAYGAAERAGISRLQLVERD
FT                   LLGVINAPSQALTGRQLIGDGADGAPGTGRDGGPGGLLYGNGGDGGSGAAGQVGGNGGN
FT                   AGLIGTGGAGGQGGSGVSTTSAQAGGRGGSGGLLFGNGGLGGQGGSGGTSGTGGPGGPG
FT                   GSAQGIGDGGNGGSGGSGVDPGAGGAAGNGGRLYGHAGSDGAQGARVGVPGDPGDPPDP
FT                   GSGAGQNAVDAAAGRDLVASNAGPITNASLDEISGIESGVANPNIYWVHNDSGDTARVF
FT                   AIDAKSGATLGTYTLSGAKASDWEDIAIGPGPVPGQSYLYLGDIGDNGLSRSAIAVYRV
FT                   PEPIVTGTAANPVTTTLTGVDTLNLKYPDGPHNAEALMVDPRTGRMLIIDKTSSGNPAI
FT                   YSASTGLASGSTTTLQDVGTLALPSGSGYLVTGADVSPDGTQLAVRTYGHVYLWNRDPS
FT                   QDIWTALAQPAVAGPTPNESQGEAIAFHPDGNGYVTVSEGTNQNLHNFDAPSTV"
FT   gene            complement(276635..277447)
FT                   /locus_tag="MMAR_0243"
FT   CDS_pept        complement(276635..277447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0243"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38712"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK7"
FT                   /protein_id="ACC38712.1"
FT                   /translation="MSRDVLTVIGVGGMGQAIARRLGSGKTVLLADNNADTLASVSETL
FT                   AAEGHDVKSRGVDVCAAESVHDLAQYAATLGAVTQLAHTAGLSPAQASAQAILAVDLLG
FT                   VALVLQEFGAVIAPGGAGVIIASMAGHLLPPPSAEQERELAHRPPGQLLELDFVGSIVE
FT                   PAFAYPFAKQANSIRVRAASRQWGQREARVNSISPGIISTPMGQQELASPVGDGMRAMI
FT                   AMSGTGRIGTPDDIAAAAAFLLGPEATFITGADLLVDGGVVAAIRASR"
FT   gene            277563..278162
FT                   /locus_tag="MMAR_0244"
FT   CDS_pept        277563..278162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0244"
FT                   /product="methyltransferase/methylase"
FT                   /note="thought to cause methylation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38713"
FT                   /db_xref="GOA:B2HKK8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK8"
FT                   /protein_id="ACC38713.1"
FT                   /translation="MPAGQPWNINIHYDALLAATVAPGTQTALDVGCGDGFLSARLADR
FT                   VPDVTALDVDADVLRRAERRFADTSIRWVHGDVMTGELPHRGFDAVLANASLHHIEDTR
FT                   GALIRLAELVLPAGTLAVVTFVRPSLRNGLWHLTAWLATGVANRVRRKWEHTAAIKWPP
FT                   PVTFSQLRELVRELLPGARVRRLLYGRVLITWQAPG"
FT   gene            complement(278220..279029)
FT                   /gene="echA8_7"
FT                   /locus_tag="MMAR_0245"
FT   CDS_pept        complement(278220..279029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA8_7"
FT                   /locus_tag="MMAR_0245"
FT                   /product="enoyl-CoA hydratase, EchA8_7"
FT                   /note="oxidizes fatty acids using specific components (by
FT                   similarity) [catalytic activity: (3S)-3-hydroxyacyl-CoA =
FT                   TRANS-2(or 3)-enoyl-CoA + H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38714"
FT                   /db_xref="GOA:B2HKK9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKK9"
FT                   /protein_id="ACC38714.1"
FT                   /translation="MTIMDEPLRYEKLDGGVAIVTNTDAPRNRMGLAYVERLSEVVDDI
FT                   AADDEIRAFVITADGLENFSVGMNLKELPTGIQAAGSVDAFFDRRLDLIQRIENMGKPS
FT                   VATLFGHCLGAGLELPLGCTFRLAAAEGASIGLPELHLGSTPAWGGSARLAKTVGRQHA
FT                   LGMVLRAKTVTGPQAHAIGLVDEVWPLDELKDRATQLALELAGQPALAVRAMLGAFHDC
FT                   EHRTLDELLAAERRAIHATLSSDDAREGMMAFLEKRPPVFNQPKRPR"
FT   gene            279266..280096
FT                   /locus_tag="MMAR_0246"
FT   CDS_pept        279266..280096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0246"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38715"
FT                   /db_xref="GOA:B2HKL0"
FT                   /db_xref="InterPro:IPR014511"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL0"
FT                   /protein_id="ACC38715.1"
FT                   /translation="MAKPLRARLHGSRNALNDRLVTKREDHGVNRWELLVCSVTGHATY
FT                   APDDRALADRLSADTELGEVWRCLRCGDFTLGAPRGRGHPEDAPLIMRGKALRQAIIIR
FT                   TLAVERLFRAMVLGLAAWAVWEFRGARGAIQTTLDRDLPIFRAAGFKVDQMFVVQELEK
FT                   ALAAKPSTLALITFMLAAYAVLQVVEGVGLWLLKRWGEYFAVVATSVFLPLEIHDLARG
FT                   ITMTRVVTFSINVAAVLYLLISKRLFGLRGGRKAYDEELHGEQLLDLERAAMVT"
FT   gene            complement(280121..280735)
FT                   /locus_tag="MMAR_0247"
FT   CDS_pept        complement(280121..280735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38716"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL1"
FT                   /protein_id="ACC38716.1"
FT                   /translation="MSDEWPGTDFDRLESVYGPLTASIRRLIDVSIRTQADPATVTASM
FT                   AKIDSAAEELSDALHPGGFGVQLTPEGETVAWGNVVVGVRNPVAPPLSIHHEPNGLVWS
FT                   EFTLGAAYEGPPGHVHGGVCSMILDHVLGATAHLPRRPAYTGTLTLRYRRGTVLGRPLR
FT                   AEGRVERIEGVKTFSVGHIADENGITVEAEGIFIQSKQIRA"
FT   gene            280805..281665
FT                   /locus_tag="MMAR_0248"
FT   CDS_pept        280805..281665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0248"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38717"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL2"
FT                   /protein_id="ACC38717.1"
FT                   /translation="MGTYAITGSASGMGNATASRLREAGHRVIGVDLDGADVVADLSTQ
FT                   QGRLRAASDVIAACDGRLDGAVLAAGLGPSPGPGRLHRIAQVNYLGVVELLQAWRPALA
FT                   AAERAKAVVIASNSTTTVPMVPRRSVRALLDHDADKAVRAVRLFGKAAPSLMYAASKIA
FT                   VSHWVRRQAVLPEWAGSGVRLNALAPGAIMTPLLAEQLSDPTQAKAVRSFPIPIGGFGE
FT                   VTHMADWICFMLSDSADFLCGSVVFVDGGSDAYFRADDWPRSVPARRLPGYLLSFRRGS
FT                   RSNIR"
FT   gene            281711..282340
FT                   /locus_tag="MMAR_0249"
FT   CDS_pept        281711..282340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0249"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38718"
FT                   /db_xref="GOA:B2HKL3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL3"
FT                   /protein_id="ACC38718.1"
FT                   /translation="MGSTASTTAPHSPQQKVREAQRLRTRARVFDAAVAEIGRRGLAGA
FT                   DVAAIAAAAGVARGTFYFHFPTKEHVLVELERAEELAIVAKLRDPTADPTDLVSVLSSL
FT                   VHQVVAVERRLGPVVFRDMLGLHFAPTRPVEDQLGEHPLAEFVIETIARAQRANRVPPD
FT                   ADAGELGVIFLTGLFALLATGATTPDARTALLNRFVTTVVHGMEAR"
FT   gene            282337..283161
FT                   /locus_tag="MMAR_0250"
FT   CDS_pept        282337..283161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38719"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL4"
FT                   /protein_id="ACC38719.1"
FT                   /translation="MSSSGIEGYREYLARRDGEADLLHRRLATREEFFAALVAEPIRSA
FT                   RRVDRQVFLRNLRRRRPEPGLDRAMLFLLATAKLNQAERFGVNLGETYGVNSGADLPPE
FT                   RVYVELEEHYHTRLLAYVLDMFGLPFQVIAPPLLVRQFVKMSVFLPDRLAFPIVGAGEM
FT                   AGCIMFDELRRAGVELFADEPAVAARIERLYSEILTDELGHVGYCAASCNAAGRATMRR
FT                   LYPVVGRFFARQTYEISLLVDVAKFRARLDRPFDVDELAAGLTNETFVAALP"
FT   gene            283272..284027
FT                   /gene="mtn"
FT                   /locus_tag="MMAR_0251"
FT   CDS_pept        283272..284027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="MMAR_0251"
FT                   /product="bifunctional Mta/Sah nucleosidase Mtn"
FT                   /note="responsible for cleavage of the glycosidic bond in
FT                   both 5'-methylthioadenosine (MTA) and s-
FT                   adenosylhomocysteine (sah) [catalytic activity 1:
FT                   methylthioadenosine + H2O = adenine + 5-methylthio-D-
FT                   ribose] [catalytic activity 2: S-adenosyl-L-homocysteine +
FT                   H2O = adenine + S-D-ribosyl-L-homocysteine]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38720"
FT                   /db_xref="GOA:B2HKL5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL5"
FT                   /protein_id="ACC38720.1"
FT                   /translation="MTIGVICAIPQELAYLRTNLVAADQQEIAQICFYAGQLGDRRVVL
FT                   TAAGMGKVNAGLVATLLADRFDCHTVIFTGVAGGLDPALSIGDIVIADRVVQHDCGLLT
FT                   DDGLQPYQPGHVPFIKPTEQLGYRVDPELLDRVKHRLEDFTLPALSAAAGGGARPPRIN
FT                   YGTILTGDQYLHSARTRDQLYNDFAGMAIEMEGGALAQVCESFAIPWLVIRALSDLAGA
FT                   GSGLDFNRFVDEVSVSSARILLHLLSVVD"
FT   gene            284385..284870
FT                   /locus_tag="MMAR_0253"
FT   CDS_pept        284385..284870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0253"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38721"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL6"
FT                   /protein_id="ACC38721.1"
FT                   /translation="MVDTDAPLPDRSERVVSATREIAAGAAQIFELIADPSRQPDWDGN
FT                   DNLAHCAAGQRVHRVGDVFRMTLTLGSVRENHIVEFTEARLIAWRPSELGKTPPGHLWR
FT                   WELTPISGTRTLVTHTYDWTELSDPARFPRARATTTVQLRASLDRLAGHAEAAAAGD"
FT   gene            284972..285775
FT                   /locus_tag="MMAR_0254"
FT   CDS_pept        284972..285775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0254"
FT                   /product="ketoacyl reductase"
FT                   /note="function unknown, but possibly involvement in lipid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38722"
FT                   /db_xref="GOA:B2HKL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL7"
FT                   /protein_id="ACC38722.1"
FT                   /translation="MALPPPGKDRAAIVTGASSGIGEEFARILSQRGYQVVLVARSADR
FT                   LEALAGRLGSDTHPLPADLSVRSDRAGLVDRVAALGLVPDILINNAGLSTLGPVAKSVP
FT                   EQELNLVEVDVAAVVDLCSRFLPAMVERGRGAVLNVASVAGFAPLPGQAAYGAAKAFVL
FT                   SYTHSLRGELHGSGVSVTALSPGPVDTSFGDVAGFTQQETESLPKIMWKSVDQVAQAGI
FT                   DGLAAGKAVVVPGLANRISAELIRVTPPDWMGSIMARIHPAMKRQ"
FT   gene            285857..288769
FT                   /gene="mmpL5_4"
FT                   /locus_tag="MMAR_0255"
FT   CDS_pept        285857..288769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL5_4"
FT                   /locus_tag="MMAR_0255"
FT                   /product="conserved transmembrane transport protein,
FT                   MmpL5_4"
FT                   /note="thought to be involved in fatty acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38723"
FT                   /db_xref="GOA:B2HKL8"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL8"
FT                   /protein_id="ACC38723.1"
FT                   /translation="MSTTQSVPGQTGTTAAERPFVARMIRTLAVPIILFWLAVVVLLSV
FT                   FVPSLEVVGQERSVSLSPTDAPSVVALNRIGHVFNEGETDSVAMIILEGDKPLGDDAHK
FT                   FYDGLIRKLRADKKHVLSIQDFWGDPLTAAGAQSNDGMAATVQVSLAGKQGELLANESV
FT                   EAVRKIVDATPAPPGVKAYVTGGPAMAADLHKSGDRSMAKITLTTVAVILIMLLFVYRS
FT                   PVTVFLLLVTVGLELTAARGAVALLGHSGLIGLSTFAVSLLTSLAIAAGTDYGIFIVGR
FT                   YQEARQAGEDRESAFYTMYRGTAHVILGSGLTISAATFCLSFTRMPYFQTLGIPCSVGM
FT                   LVALLVALTLAPAVLVVGGRFGAFDPKRVLQVRGWRRVGTAIVRWPLPILAVTCAVALV
FT                   GLITLPGYRPSYNDRAYLPSFIPANQGLAVADRHFSQARINPEILMIESDHDMRNPTDF
FT                   LVLDKLAKGIFRVPGISRVQAITRPSGTTMDHTTIPFRLSMQNAGQVQSLHYQRARMND
FT                   LLTQADEMAKTIALTRRMYELSSQLADNTHRMVGDTIEMQQITNELRDKLADFDDFWRP
FT                   IRSYLYWEKHCYDIPNCWTFRSLFDALDGLDQIDEKLGVMVGDLENVDRLMPQMTETFP
FT                   PMIESMEHIRTMMLTMHSTMSGMVDQMTELSENANAMGKAFDTAKNDDSFYLPPEVFEN
FT                   ADFKRAMGSFLSPDGHAARFIILHRSDPASASGIASIDKIRTAAEESLKGTPLENATIY
FT                   LAGVGAIFKDVSEGAKWDLLIAGIASLCLIFVIMLILTRALVAAGVIVGTVAISLGASF
FT                   GLSVLLWQHIIGMPLHWLVIAMSVIVLLAVGSDYNLLLVSRFKQEIPAGINTGIIRSMG
FT                   GTGKVVTNAGLVFAFTMASMVVSDVRMIGQVGTTIGLGLLFDTLVVRAFMTPAIAALLG
FT                   RWFWWPLRVRSRPDRRAIQRAAQSDTEPAPVESAPATAGS"
FT   gene            complement(288793..293043)
FT                   /locus_tag="MMAR_0256"
FT   CDS_pept        complement(288793..293043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0256"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /note="involved in lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38724"
FT                   /db_xref="GOA:B2HKL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKL9"
FT                   /protein_id="ACC38724.1"
FT                   /translation="MTAPEIGCAEAIPLSKSQQNLYNGVLQDNDPALYLIGKRYRFHPL
FT                   ALSNFLAALEASVLNNPVQLCVLQMAATDADYPQLVPRLQFSDLVLVRSAAQGQPDGPG
FT                   ADLEHTWSSGILDRPLVRYTVSTDEGGNVCGLDVHTHHILLDGGATGIIEADLAHFLAA
FT                   SLEPAGVGQMPTLSQGLAKLAAAHLRETAKVAEALRRQADAVQRELTAEAGQGGGAQGA
FT                   SGTSGAAAKGVLQESIALCGPAYDALRALSEAQQVPLNVLVAAAAVAVQAGLRQSTESL
FT                   LVHAVDNRFGDPELNVATCLVNSVAHALRFRPFASVREVVRDLDRGYVKAVRRRWIREE
FT                   HYRRMYLAINRTSHVQALTLNFIRESCAPGLRPFLSEAPVATEIGPIEGTTVACVLDEQ
FT                   RHTLNLAIWDRADLPERNTGAGVAARIGAALESMAALWDQPIAMTANEWFEVGADGLPC
FT                   RTEAAGRPRPPSAPAWFVDAAPGLRQFLDRRRHVYPWVGWLVCHGVVPGDVLVCTDDDT
FT                   DKTVDLLLACHLAGCGYSMCESVDDLSLRATTIGEHCEGSSAHPVDVAAVRLGAVPDHA
FT                   LRERIDQRLDQVARDPLLATKAAYIMPTSGTTGQPKLVRISHGSLAAFCAAIGPSYGWN
FT                   SRDTILQCAPLTSDISVEEIFGAAVCGAELVRSAAMKTGDLGGLARDIHALGPTVVDLP
FT                   TAVWHLLCEDGDAVDVIGRSRLRQIVIGGESIRTSTVDKWVNSPVLAPISLVSSYGPTE
FT                   ATVVATHLPIVYDGIAAAAHTRLRVGLPMAPNTVFIAFGEVVIAGPLVSDGYLGIDDSS
FT                   FGAVAPGDGSQLRAFATADRVTIDEEGFPVFAGRKDTIVKVAGKRVDTAAVARRISADP
FT                   TVCDVAVEPHDGRLGVWFETERTREAAEDGATAGRIGLTLASLGVPAFFVVAVPSIPRK
FT                   PNGKVDGARLHTLPQLADAVPSDAEAGESAAGLARVWSRHLGRPLAADSSLLGAGIGSL
FT                   DLIRILPDTRRYLGRHLSVLELISADTAANLVCDLGSNPAAPATDGWLDAETAAAIERD
FT                   LVSLGSQCTPQPLGAKPPPHDRAAAPIVVLGASGIVGTGFARAVLERKQAGLACPEIVL
FT                   ASRSKPPEHGPWSALRGLEGIRIEQLGATLGAADLDALICDTGARSLINCIGNTNVLVP
FT                   YRGLRAANVELVSTVAQVCAQRDVRLVHLSTFVISADVTAPRVTDPRMSPYPYAASKSL
FT                   AELIVAASSPALDFTIVRLPRVLGEDYQLRESADILVSVVDACMALRAFPTLTLTEEVT
FT                   TGRAAAQAILGLLPQFSGAAGLGHGITVVRGAAVQYRELLSGYALDEIDAAEWKHRLDQ
FT                   SDWARRNPQRWSVVDAWVSLGMRLGARSYSQYLAGYPSIPLQVGTVAEIAAPPTALRAL
FT                   LEQGCAQPPRPALA"
FT   gene            complement(293040..293291)
FT                   /locus_tag="MMAR_0257"
FT   CDS_pept        complement(293040..293291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38725"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM0"
FT                   /protein_id="ACC38725.1"
FT                   /translation="MADPVRQRILLAVCDVLYIDETDLIDGDATDLRDLGLDSVRFVLL
FT                   MKRLGVDRESELPSRLAENLSIEGWVSELSQSELESPT"
FT   gene            complement(293284..294879)
FT                   /gene="fadD10"
FT                   /locus_tag="MMAR_0258"
FT   CDS_pept        complement(293284..294879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD10"
FT                   /locus_tag="MMAR_0258"
FT                   /product="fatty-acid-CoA ligase FadD10"
FT                   /note="function unknown, but involvement in lipid
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38726"
FT                   /db_xref="GOA:B2HKM1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM1"
FT                   /protein_id="ACC38726.1"
FT                   /translation="MSDLPATVLERIIEQAQRRPEAIALRRCDGTSALPYSELAAEVDR
FT                   YAGALRAQSASRGSRVLVISDNGPETYLAVLACAKLGAIAVMADGNLPPATIDRFCQIT
FT                   DPVAVLIAPGSKVGSSSLPEGLAAIPAIRVDIGSGTGEFAHSPDTDRPATEPGLGADDP
FT                   LAMIFTSGTTGEPKAVLLANRTFFAVPDILRNEGLNWVTWVDGETTYSPLPATHIGGLW
FT                   WILTCLMRGGLCITGGENTPSLMQILNSNAVNTTCLVPTLLSKLVSELKSAATTVPSLR
FT                   LLGYGGSRAIAADVRFIEATGVRTAQVYGLSETGCTALCLPTDDDSIAKIEAGAVGRPY
FT                   PGVEVYLAADDEADGAGPNAPGAGPSASFGTLWIKSPANMLGYWSNPQRTQEVLIDGWV
FT                   NTGDLLERHEDGFFYIKGRSSEMIISGGVNIAPDEVDRIAEGVPGVREAACFEIPDPEF
FT                   GALVGLAVVAATDMDASAARKLKHTIAAHYRRESESVARPSTIVIVSEIPRTQSGKVMR
FT                   TSLAAAANQVQTGG"
FT   gene            complement(294908..295462)
FT                   /locus_tag="MMAR_0259"
FT   CDS_pept        complement(294908..295462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38727"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM2"
FT                   /protein_id="ACC38727.1"
FT                   /translation="MSTTDLTSPAHAAVESAGTTAIAEDLLARVLEPYSYKGCRYLLDA
FT                   RYHADDDSVLAYGNFTISESAYIRSTGHFNAVELILCFNQLAYSAFAPAVANEEIPQLR
FT                   GWSLEDYFQHQLASMFIRNSSSRFNRPINPAKFSARLQCRNLQVVQRTWRYLLVPCAIE
FT                   FWDEDGGAASGEVELAALNIP"
FT   gene            complement(295459..296328)
FT                   /locus_tag="MMAR_0260"
FT   CDS_pept        complement(295459..296328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0260"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38728"
FT                   /db_xref="GOA:B2HKM3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM3"
FT                   /protein_id="ACC38728.1"
FT                   /translation="MTLNVKGEGLGAQITGVDPKNLDDITTDEIRDIVYANKLVILKDV
FT                   NPSPEEFLKLGKIVGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMP
FT                   EPFAFSMVLPLAVPGHDRGTYFIDLAKVWQSLPAAQQAPARGTLSTHDPRRHIKIRPSD
FT                   VYRPIGEVWDEISRATPPIKWPTVIRHPKTGEEILYICATGTTKIEDKDGNLVDPAVLA
FT                   ELLAATGQLDPEYNSPFIHTQHYEVGDIILWDNRVLMHRAKHGTASGTLTTYRLTMLDG
FT                   LETPGYPA"
FT   gene            complement(296522..297940)
FT                   /locus_tag="MMAR_0261"
FT   CDS_pept        complement(296522..297940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0261"
FT                   /product="PPE family protein, PPE1"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38729"
FT                   /db_xref="GOA:B2HKM4"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM4"
FT                   /protein_id="ACC38729.1"
FT                   /translation="MAIPPEVHSALLSAGQGPGSLLAAAAQWQELSAQYSAAVVELTQL
FT                   LAEVQATSWQGYAAHQWLAAHGPYLIWLEQAAIDSSVTAAQHRIAAAGYSSAVAAMPTL
FT                   AELAANHAIHGVLVVTNFFGINAIPIALNEADYVRMWIQAAETMTTYQAVSEVAAAAVP
FT                   PTPPAPSILRPGGESQAAASGIGSWIGQLLRDILSFLADPYKYFLEFFQRMGFSPAVAV
FT                   ILAIIALQLYDFLWYPYYASYGLLLLPFFTPALSALSALSALAYLANRTPITAPVAAPA
FT                   ERSVADLAGPQPVVGLTPAASAFAPPSPQATSPAPSAPSPAPTGSPPSSPAISYAVLGP
FT                   APPGVSSGPRATTGAAATATDTTRAAAPAALSSSRASRRKRSKNRVGVRGYRDEFLQEP
FT                   ATMDSPIDAPGTAEPAPSPSSQGAGPLGLTGTAASHDGAAAGMVRLSSHGTSTAVPLLP
FT                   ATWTNDSEGRPEGE"
FT   gene            298268..299077
FT                   /gene="omt_1"
FT                   /locus_tag="MMAR_0262"
FT   CDS_pept        298268..299077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omt_1"
FT                   /locus_tag="MMAR_0262"
FT                   /product="O-methyltransferase Omt_1"
FT                   /note="function unknown, but supposed involved in lipid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38730"
FT                   /db_xref="GOA:B2HKM5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM5"
FT                   /protein_id="ACC38730.1"
FT                   /translation="MPVIDARHLDGISETALLTLHQRATEAARPDAIIDDPMAIALRND
FT                   IDYPYHHFGRTHQATALRALAFDNSTRDFLRTHPGATVVALAEGLQTSFWRLDNGELNW
FT                   LSVDLAPIVRLREQLLPACDRLRYCAQSAFDYSWMEQVDDTNGVLITAEGLFQYLRRDV
FT                   VFELIAACAKRFPHGQLVFDSIPWLLSVYSRRRGFRLSEHYTAPPMPFWFTADHYDELR
FT                   AIPGVRAVRELPAPAGRGRFLRWALPVAYRLPGLGRLRAPVTLVEFG"
FT   gene            299159..299872
FT                   /locus_tag="MMAR_0263"
FT   CDS_pept        299159..299872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0263"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38731"
FT                   /db_xref="GOA:B2HKM6"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM6"
FT                   /protein_id="ACC38731.1"
FT                   /translation="MDCEVAREALSARLDGEREPVPSARVDEHLDECGACGLWFEQVAG
FT                   QASRLQRLIESRPVIGAVDLTGIRPTPQPRERKRMSWQRWALLFVGIAQVAVGIVQGLG
FT                   FSVGLGHHYVIGSGNHLLNESTAWTIALGVAMVVAAIWPGAAGGLAGVLMVFVAVLSVY
FT                   VVVDALSGAVTTSRVLTHLPVLLGTVLAIMVWRSRGAPRPAPDVLADEPDIVLPQNASR
FT                   GRRHGHLWPTDGSAA"
FT   gene            complement(299893..302184)
FT                   /gene="ctpA"
FT                   /locus_tag="MMAR_0264"
FT   CDS_pept        complement(299893..302184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="MMAR_0264"
FT                   /product="cation transporter p-type ATPase a CtpA"
FT                   /note="cation-transporting ATPase; possibly catalyzes the
FT                   transport of a cation (possibly copper) with the hydrolyse
FT                   of ATP [catalytic activity: ATP + H(2)O + cation(in) = ADP
FT                   + phosphate + cation(out)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38732"
FT                   /db_xref="GOA:B2HKM7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM7"
FT                   /protein_id="ACC38732.1"
FT                   /translation="MSTTIVTTDKHLERDQQVQRFQLGITGMSCFACARKVQSTLNKVP
FT                   GVRASVNFGTRTATVEAGEDVDAAALCEVIQQAGYQAEVQPDDGQGAGDPDAEHARHLL
FT                   IRLAVAAVLFVPLADLSVMFAVVPSTRFTGWEWVLTALALPVVTWAAWPFHRVALRNAR
FT                   HHGASMETLISVGITAATIWSLYTVFGSHQLADRKGIWQALLGSDAIYFEVAAGVTVFV
FT                   LAGRYFEARAKSKAGSALRALAALSAKEVAVLQPDGSELVVPADELQEQDRFVVRPGQT
FT                   IAADGLVLDGSAAVDMSTMTGEAKPTRVRPGGQVIGGTVVLDGRLIVEAAAVGADTRFA
FT                   GMVRLVEQAQAQKADAQRLADRIASVFVPCVFVIAALTAAGWLLAGGSPDRAFSAAIAV
FT                   LVIACPCALGLATPTAMMVASGRGAQLGIFLKGYQSLEATRSVDTVVFDKTGTLTSGQL
FT                   KVSAVVAAPGWDADEVLAIAATVEAASEHSVALAIAAATTQHDTVTEFRAIPGRGVSGT
FT                   VSGRSVRVGKPSWIGSSSSDAALRAARRNAESLGETAVFVEIDGAPCGVIAVADAVKDS
FT                   AADAVAALRERGLRTMLLTGDNPASAAAVADRVGIDEVIANILPEGKVDVIEQLRDRGH
FT                   VVAMVGDGINDGPALASADLGMAMGRGTDVAIGAADIILVRDNLDVVPLALGLAAATMR
FT                   TVKLNLAWAFGYNIAAIPIAAAGVLNPVVAGAAMAFSSFFVVSNSLQLRNFGAATSQTT
FT                   TSTTEPGATE"
FT   gene            302309..302863
FT                   /gene="sigC_1"
FT                   /locus_tag="MMAR_0265"
FT   CDS_pept        302309..302863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigC_1"
FT                   /locus_tag="MMAR_0265"
FT                   /product="RNA polymerase sigma factor, ECF subfamily,
FT                   SigC_1"
FT                   /note="involved in promoter recognition, transcription
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38733"
FT                   /db_xref="GOA:B2HKM8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM8"
FT                   /protein_id="ACC38733.1"
FT                   /translation="MVTGGADEQITVLAMAAGRGDRAALAEFIEATQRDVWRLVAYLSD
FT                   PACADDLTQETFLRAIGALPRFAGRSNARTWLFSIARRVVVDQIRYKTRRPRPAYVADL
FT                   GEALGQARRGSRFEDIVEIRLLLDGLDEKRREALIFTQVLGLSYAEAAQICGSPIGTIR
FT                   SRVARARDDLLRAAREGERAG"
FT   gene            complement(302899..303642)
FT                   /locus_tag="MMAR_0266"
FT   CDS_pept        complement(302899..303642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0266"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38734"
FT                   /db_xref="GOA:B2HKM9"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKM9"
FT                   /protein_id="ACC38734.1"
FT                   /translation="MINDLLIRWLATGLFVFSGADYALSALSALSALPALPALPALPAL
FT                   STFSALPASSAFSGAPTVTQQRAWTSVVSNGLHLVMAIAMVVMLWPVGAALPTTGPAVF
FT                   FLLAAGWFATLTALRAKTITALVGCSYHALMMLAMAWMYVAMSDQLLACPAAHQTMAPG
FT                   TSMPGMHMSGTDMAAGATAPGWVSAVNWFWLLAFAIAAIIWAVMSVRARPRAGTESWRS
FT                   CLTHAGRAMMAAGMAIAFAAMVFGI"
FT   gene            303807..305783
FT                   /locus_tag="MMAR_0267"
FT   CDS_pept        303807..305783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0267"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38735"
FT                   /db_xref="GOA:B2HKN0"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN0"
FT                   /protein_id="ACC38735.1"
FT                   /translation="MDTDGPGVVASSAAPPSRSGSLTSVWLLLGLLAISAVLASYGVVS
FT                   GVRRYATVGNPYPGWFLSAAEPTGYFLASLSGAVCLGGLIYVVMMSRPEHDGLIDAGAF
FT                   RIHLVTERVSVAWLVLAASMVVVQGAHDSGVSPIRLLASGAVRDAIATSEIARAWIVVT
FT                   ICALVVAVALRLNTRWVAHVVLLIPTVIAVIATAVTGNAGQGPDHDFATSAAIVFALAA
FT                   ATLTGLKAATALTGATPTRTVQLMQVACGALAVSYGAVLLYLFVPGWDFGSEFARIGLL
FT                   AGLVLVLVWVFDCWQLFVRPPRSTRGATAAALAMMAVLAAIGAMAVQTAPRFVAHQFTA
FT                   WDVFLGYELPQPPDVGRLITLWRFDSLVGVAGVVLAAGYVAGFVRLRRRGHAWPVSRLV
FT                   SWLIGCAVLVITSSSGVRTYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRALPAA
FT                   GEGQPPGPREWLTWLLHSRVTAFFSHPIIAFILFVASPYIVYFTPLFDTLVRYHWGHEF
FT                   MAVHFLIVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMNSAIGDT
FT                   FYRSVNLPWLASIESDQHLGGGIAWGATELPIIIVIVALVAQWARQDRQVAARQDRHAD
FT                   SSYADDDLEAYNAMLRELARMRE"
FT   gene            complement(305800..306018)
FT                   /locus_tag="MMAR_0268"
FT   CDS_pept        complement(305800..306018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0268"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38736"
FT                   /db_xref="GOA:B2HKN1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN1"
FT                   /protein_id="ACC38736.1"
FT                   /translation="MTEQTFAVTGLRCEGCVETITNALSALPSVRTVEVELDAAGASAV
FT                   RVCTDTELTREQVQATLADNGDFAVVG"
FT   gene            complement(306011..308284)
FT                   /gene="ctpB"
FT                   /locus_tag="MMAR_0269"
FT   CDS_pept        complement(306011..308284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="MMAR_0269"
FT                   /product="cation-transporter p-type ATPase B CtpB"
FT                   /note="cation-transporting ATPase; possibly catalyzes the
FT                   transport of a cation (possibly coopper) with the hydrolyse
FT                   of ATP [catalytic activity: ATP + H(2)O + cation(in) = ADP
FT                   + orthophosphate + cation(out)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38737"
FT                   /db_xref="GOA:B2HKN2"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN2"
FT                   /protein_id="ACC38737.1"
FT                   /translation="MAAPITGDLDLGSARRIQLDVSGMSCAACASRVETKLNKVPGVRA
FT                   SVNFATRVATIDAVDVAADQLCELVEKAGYQAVPHAESAADDRDPDAEHARTLLRRLLV
FT                   AAVLFVPLADLSTMFALVPSTRFPGWGYLLTALAAPIVTWAAWPFHSVAIRNARHRTAS
FT                   METLISVGITAATVWSLSTVFVDRQPRHSRGIWQAILNSDSIYLEVAAGVTVFVLAGRY
FT                   FEARAKSKAGGALRALAALGAKDVTVLLPDGAELVIPAAELKKRQRFVTRPGQTIAADG
FT                   VVIDGTAAIDMSAMTGESKPVRATADAPVIGGTIVLDGRLVIEATAVGADTQFAAMVRL
FT                   VEEAQAQKARAQRLADRISAVFVPVVFAIAGLAGAAWLLSGAGADRAFSVTLGVLVIAC
FT                   PCALGLATPTAMMVASGRGAQLGIFIKGYQALETIHGIDAVVFDKTGTLTVGKLTVNTV
FT                   TTTGGRVREEVLALASAVEAASEHAVATAIVAASPHPAPVTDFVAVAGCGVSGIVDGHR
FT                   IEVGKPSWITRNTAADEVLDTARAQGESRGETIVFVSVDGEVCAAVTISDTVKDSAADA
FT                   IAALRSRGLRTILLTGDNQAAADSVATQLGIDTAIADVLPDGKVNVIRQLRDQGHTVAM
FT                   VGDGINDGPALVSADLGLAIGRGTDVAIGAADIILVRDDLHIVGQALDLARATLRTIRT
FT                   NMIWAFGYNVAAIPIAAAGLLNPLIAGAAMAFSSFFVVSNSLRLRNFGPPTARIVASNG
FT                   EIDD"
FT   gene            complement(308529..309335)
FT                   /locus_tag="MMAR_0271"
FT   CDS_pept        complement(308529..309335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0271"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38738"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3TZQ"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN3"
FT                   /protein_id="ACC38738.1"
FT                   /translation="MTAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLA
FT                   GAAASVGRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDPADMLVTQMTV
FT                   DVWDDTFTVNARGTMLMCKYAIPRLISAGGGAIVNISSATAHAAYDMSTAYACTKAAIE
FT                   TLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVGLPQPIVDIFATHHLAGRIGEPHEIAE
FT                   LVCFLASDRAAFITGQVIAADSGLLAHLPGLPQIRASVAELQSQPS"
FT   gene            complement(309447..310718)
FT                   /gene="cyp226B1"
FT                   /locus_tag="MMAR_0272"
FT   CDS_pept        complement(309447..310718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp226B1"
FT                   /locus_tag="MMAR_0272"
FT                   /product="cytochrome P450 226B1 Cyp226B1"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38739"
FT                   /db_xref="GOA:B2HKN4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN4"
FT                   /protein_id="ACC38739.1"
FT                   /translation="MSPSVAELSQELGEAFRLSSMDDPYPMLAERRRETPVMKGDIMVA
FT                   LGAPSYMGQHAGETHTVFRHDDVMAILRNHETFSSSIWEISQGPLIGRSILAMDGAEHR
FT                   QWRGYLQSVFGGKLLSSWDESIFRPLAAKYVADLASKRGADLIAMALEYPLRAIYEILG
FT                   LEDFKDNYEEFHADVLTILLALWSTPDPAQADQFLLRFQKATEASARSWDRLLPIVQRK
FT                   RAAGASRNDLISSLIRAEYEGGVLDDEQITSFLRSLLLAATDTTTRQFLNTLTLLLQRP
FT                   DELDRIRRDRSRLRLALAEGERLEPPALFIPRMITRDVVIRGTELTAGTPLLLAIGSAN
FT                   RDPEAYPPDPDEFRIDRTGPHHATFGFGTHICSGMNTTRREIAALIDAMLDGLPGLRVD
FT                   PDAPAPLISGIHFRGPSALPVVWD"
FT   misc_feature    309901..324932
FT                   /note="MURD6; Four CDS in this region encode P450
FT                   hydroxlases and the presence of gcpE, dxs2, lytB2 and idsB
FT                   suggest this is a locus involved in isoprenoid biosynthesis
FT                   via the non- mevalonate pathway"
FT   gene            complement(311150..312412)
FT                   /locus_tag="MMAR_0273"
FT   CDS_pept        complement(311150..312412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0273"
FT                   /product="amidohydrolase"
FT                   /note="function unknown role in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38740"
FT                   /db_xref="GOA:B2HKN5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN5"
FT                   /protein_id="ACC38740.1"
FT                   /translation="MNTDDMILISVDDHIVEPPDMFDNHLPAKYLRDAPRLVRNPDGSD
FT                   VWKFRDSVIPNPALNAVAGRPKEEYGLEPQGLDEIRPGCYQVDERVKDMNAGGILASIC
FT                   FPSFPGFAGRRFATDDPDFSLALIQAYNDWHIDQWCGAYPARFIPMALPVIWDAQACAT
FT                   EVRRVSKKGVHALTFTENPATMGYPSFHNDYWNPLWKALCDTNTVMNIHFGSSGNLVTT
FT                   APDAPIDVLMTLGPMNIVQAAADLLWSRPIKDYPDLKIGLSEGGTGWIPYFLERADRVF
FT                   EMHSTWTHQDFGGKLPSEVFREHFLACFISDPVGVKLRNMIGIDNIAWEADYPHSDSMW
FT                   PGAPEELGEVLTANSVPDLEVDKMTHLNAMRWYSFDPFSRIPREQATVGALRKAAAGHD
FT                   VSTRPRSQHKSGERTSILVEP"
FT   gene            complement(312399..313694)
FT                   /gene="cyp271A1"
FT                   /locus_tag="MMAR_0274"
FT   CDS_pept        complement(312399..313694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp271A1"
FT                   /locus_tag="MMAR_0274"
FT                   /product="cytochrome P450 271A1 Cyp271A1"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38741"
FT                   /db_xref="GOA:B2HKN6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN6"
FT                   /protein_id="ACC38741.1"
FT                   /translation="MEGNERFVPRLAPLTLAVKSLANPQFIYNAKAQGVRAERTEAGVV
FT                   TLYRRDDLMRISRHPAVLGPGGRGGNFGNDNPLIPLEIDGEEHKKWRRLLDPLFAPKQM
FT                   ARLEAAVRNRAAQLVDGFASQTSAELYQAYCAPLPCFTFLELLGAPLEDIEFFTAFKNG
FT                   VLHPQGETREEIQANQAAAGAMLLEYFTRLVARQRAEGAQGEEVLAVLLRSRIDGQPLT
FT                   DAELFNIIHLLIFAGLDTVTASMSCILAWLGQHPHERRRLVEDTARIPAAIEELMRYES
FT                   PAPSGIRYATADIDLGDGLTIRAGEAIHVSWAAANVDPTAHPDPLHVDFDRARFHHLAF
FT                   GSGIHRCLGSHLARLELRVALEEFLARIPDYAVDTAGLVYDNVSVRTVQQLRITFNANT
FT                   PSPVDPSQRHAFMAPLTGQRDSVLERNGHEHR"
FT   gene            complement(313695..314858)
FT                   /gene="gcpE_2"
FT                   /locus_tag="MMAR_0275"
FT   CDS_pept        complement(313695..314858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE_2"
FT                   /locus_tag="MMAR_0275"
FT                   /product="GcpE protein"
FT                   /note="function unknown. GcpE is an essential gene. in
FT                   E.coli it is thought to be involved in the terminal steps
FT                   of isoprenoid biosythesis by the mevalonate-independent 2-
FT                   C-methyl-D-erythritol 4-phosphate (MEP) pathway"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38742"
FT                   /db_xref="GOA:B2HKN7"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN7"
FT                   /protein_id="ACC38742.1"
FT                   /translation="MTIGLGIPAPPAPRLAPRRVTRQLMVGNVGIGSDYPVAVQSMTTT
FT                   KTHDVNATLQQIAELTAAGCNIVRVACPRQEDADALPQIVKHSHIPVIADIHFQPKYIF
FT                   AAIDAGCAAVRVNPGNIKEFDSRVKEVAKAAADTGIPIRIGVNAGSLGKRIIQRYGKAT
FT                   PEALVESALWEASLFEEHGFGDIKISVKHHDPVVMVAAYQLLATQCDYPLHLGVTEAGP
FT                   AFQGTIKSAVAFGALLSSGIGDTIRVSLSAPPIEEVKVGTQILESLNLRPRSLEIVSCP
FT                   SCGRAQVDVYRLANEVSAGLDGLGAPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIF
FT                   VKGEVIKTVPESQIVETLIEQALRIAEERASETECTDLVGTPVVSEV"
FT   gene            complement(314855..316708)
FT                   /gene="dxs2"
FT                   /locus_tag="MMAR_0276"
FT   CDS_pept        complement(314855..316708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs2"
FT                   /locus_tag="MMAR_0276"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase Dxs2"
FT                   /note="catalyzes the acyloin condensation reaction between
FT                   C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate
FT                   to yield 1-deoxy-D-xylulose-5-phosphate (DXP). possibly
FT                   involved in deoxyxylulose-5-phosphate pathway (DXP) of
FT                   isoprenoid biosynthesis (at the first step), and
FT                   biosynthetic pathway to thiamine andpyridoxol (at the first
FT                   step)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38743"
FT                   /db_xref="GOA:B2HKN8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN8"
FT                   /protein_id="ACC38743.1"
FT                   /translation="MSITMRADRADLLSLINGPQDVQALPADQLPLLAAQIRRRMIETV
FT                   ASTGGHLGAGLGTVELIIALHRVFSSPRDIVVFDTGHQTYPHKLLTGRGDQFVTLRQPG
FT                   GLSGYPSRSESHHDWVENSHASVSLAWVDGIAKALALQGRGDRRVVSVIGDGALTGGVA
FT                   WEGLNNLGGADRAVIIVLNDNGRSYDPTTGAVATHLQALRHGVSSGPNLFETLGFTYIG
FT                   PTDGHDVESICSALRQAAALDKPVVVHTVTAKGRGYPPAEADESDRMHACGVIEVATGR
FT                   PAKPTAASWTDVFEQELVRIADERTDVVGMTAAMRLPAGLGALSRKYPDRVFDSGIAEQ
FT                   HLLACAAGLASAGAHPVVALYSTFLHRAFDQLLFDVGLHQLPVTLVLDRAGITGPDGAS
FT                   HHGMWDLALLTNVPGLRVACPRDAVRLRQQLRVAIDDTSPNALRYPKGVPDNDIPAVGQ
FT                   IDGVDVLFAGGKPDRDVLLIAVGVMAHPCVDAAERLAAAGVGVSVVDPGWVWPLNPALT
FT                   ELARQHRITVCVEDGVADAGIGSRLNHQIGWLSPRTRTLVLGLPRDYIAHAGRDQILTE
FT                   CGLSGSAISAACQSALAADSPGSHDRSEPLDPLAPSPLETP"
FT   gene            complement(316705..317706)
FT                   /gene="lytB2"
FT                   /locus_tag="MMAR_0277"
FT   CDS_pept        complement(316705..317706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB2"
FT                   /locus_tag="MMAR_0277"
FT                   /product="LytB-related protein LytB2"
FT                   /note="LytB is involved in the trunk line of the
FT                   mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate
FT                   (MEP) pathway for isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38744"
FT                   /db_xref="GOA:B2HKN9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKN9"
FT                   /protein_id="ACC38744.1"
FT                   /translation="MTTVNPSSRSRPRPLADESAATTVLLASPRSFCAGVHRAIEAVER
FT                   VLDRATGPVYVRKQIVHNRTVVAELQDRGAIFVDELDEIPDPPAPGAVVVFSAHGVSPA
FT                   VRAAANGRGLEVVDATCPLVTKVHAEAARFAGRGDTVLLIGHLGHEETDGTLGVAPNSM
FT                   LLVQNADDVTELDLPEDAQVSYLTQTTLAVDETTDVIDALRKRFPKLAEPPTEDICYAT
FT                   TNRQRAVEAIVRRCDALLVVGSQNSSNSQRLVELARRRGTPAYLIDGPTDIDPHWLDST
FT                   ATIGITAGASAPPRLVEQVIDALRLRGPINVVESPVTTESVRFALPPKVRVP"
FT   gene            complement(317703..318719)
FT                   /locus_tag="MMAR_0278"
FT   CDS_pept        complement(317703..318719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38745"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP0"
FT                   /protein_id="ACC38745.1"
FT                   /translation="MATHIQRAIAYLTEQHALGYPNAVHKMGSYSTAKFVQLAADHLDL
FT                   TADQVHRFSTFTCENKAFHVAMITDALQDALDAGHSECQAMVDENIDYLLGCRDEISWR
FT                   YFPGFEPLPYDADSLGQMTQVLVRAGKATPETLADAFKLAALNAWEDGPISTFFATDPE
FT                   DRIVINKIWGRGRDDTGRDAEVVANLLYGATLYQDQVGDSPLTPLLEIATKWLTVQQQP
FT                   MGFWRAAWYVGTSYSTYVVVRQLVAAGGHQSSVDRAVRFLRQAPAPDPLNRALAMLAIT
FT                   AANCAPDRHDASLLHDTQFHDGSWEAIPLLDNHARIWGSRAVSTAICLKALLRQESQ"
FT   gene            complement(318780..319523)
FT                   /locus_tag="MMAR_0279"
FT   CDS_pept        complement(318780..319523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0279"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38746"
FT                   /db_xref="GOA:B2HKP1"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP1"
FT                   /protein_id="ACC38746.1"
FT                   /translation="MTIGIRDATEARDIRAAGWAAIMAIIPGIVVNFLTGTPLEPYPSW
FT                   AWTDERIAGYFAGQQSAIAAQIFLTNAGFVLLLWAVAGVKRAVLTDTRPSLYTDLIIPS
FT                   AAMATVALLAGNGLYWTAGLRGLSPEFTRLACDLLIPFGYIGSLVSVAITLFCAGIAMR
FT                   RSAVFPRWLAVATPWTAIPLASAQFFLLADTGPAAPISLISLIPYLLLYLWLATTGIVM
FT                   LRRSVPITPGTDLRAEVAAIRKQGG"
FT   gene            complement(319581..320576)
FT                   /locus_tag="MMAR_0280"
FT   CDS_pept        complement(319581..320576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0280"
FT                   /product="non-plant terpene cyclase (C1 class)"
FT                   /note="involved in isoprenoid biosynthesis. enzymes in this
FT                   class catalyze the ionization of farnesyl diphosphate,
FT                   followed by the formation of a macrocyclic intermediate by
FT                   bond formation between C1 with either C10 (aristolochene
FT                   synthase) or C11 (pentalenene synthase), resulting in
FT                   production of tricyclic hydrocarbon pentalenene or bicyclic
FT                   hydrocarbon aristolochene"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38747"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP2"
FT                   /protein_id="ACC38747.1"
FT                   /translation="MSVTAICEFVLPDIYCPFPAAFAHSRHPAATEVELAMTSALPEDG
FT                   NTLIRRSVSGIHLVDHAGRLYPDVTTAGLHTVTWYFLLFSVFDECSEQQDGGGRTFNPE
FT                   TLRHIHRTALRLLDHPDASSDDDLDITRIIRPLRRFLNALGDRNARKNFRNAFERSLQA
FT                   RIWELDHLRTASIPSLAVYPRLRRQSSMAVPLLELHPVLFGLAGSVRSLDHPAIRQLRT
FT                   MLLNCVLWSNDLLSLAKELRDGSCMNLALVLQKDRGCALQQAVDEVAWLIERETLAYLD
FT                   LKGQLPRIGIGSSQELASVTALLDREERWHADSIEWHSCPRYQAGPPQRR"
FT   gene            complement(320584..321972)
FT                   /gene="cyp183B1"
FT                   /locus_tag="MMAR_0281"
FT   CDS_pept        complement(320584..321972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp183B1"
FT                   /locus_tag="MMAR_0281"
FT                   /product="cytochrome P450 183B1 Cyp183B1"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics. some have been shown to bind tightly to a
FT                   range of azole-based antifungal drugs (E.G. miconazole,
FT                   clotrimazole)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38748"
FT                   /db_xref="GOA:B2HKP3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP3"
FT                   /protein_id="ACC38748.1"
FT                   /translation="MPTSIPIAPAALPLLGHTLPLLRNPLSFLLSLPARGDLVRIRIGP
FT                   ATAVVACTAELTHEILCDDRIFDKGGIFFDRFREMLGDGLGTCPRSQHRRQRRLLQPAF
FT                   HTQRLPGYAQTMTTEVAATVGRWQNGQIIDVPAEMMAITGRTLLATMFSNSLPNPALRQ
FT                   ALDDLTAIFAVLYWRMLTPPPLDRLPTVGNRRYHRASARLRHTIGSAVAGRRAAGVDRG
FT                   DLLSAILASHEVDSSTVAFTDTEVIDQIVSFFIAGTETTALTVAWALYLLAEHPAIEQR
FT                   VHAEIDPVLAGRAATHADLPRLGLVNRIVTETLRLYPPGWIISRVATADVYLGGHRIPA
FT                   GATVIFSPYLIHHRPDLYAEPERFDPDRWLPERARAIGRNTYIPFGGGARKCIGDNFGT
FT                   TEAALALATIAANWRMQRLPGLPVRPAVAASLRPRNLALRVTARTADRVPGEPGRRLTS
FT                   REIG"
FT   gene            complement(321985..322974)
FT                   /gene="idsB_3"
FT                   /locus_tag="MMAR_0282"
FT   CDS_pept        complement(321985..322974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idsB_3"
FT                   /locus_tag="MMAR_0282"
FT                   /product="polyprenyl synthetase IdsB_3"
FT                   /note="involved in biosynthesis of membrane ether-linked
FT                   lipids. catalyzes the trans-addition of the three molecules
FT                   of IPP onto DMAPP to form geranylgeranyl pyrophosphate
FT                   which is a precursor of the ether-linked lipids. catalyzes
FT                   the consecutive condensation of homoallylic diphosphate of
FT                   isopentenyl diphosphates (IPP, C5) with allylic
FT                   diphosphates to synthesize prenyl diphosphates of various
FT                   chain lengths"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38749"
FT                   /db_xref="GOA:B2HKP4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP4"
FT                   /protein_id="ACC38749.1"
FT                   /translation="MAVLRRAQRECEPFLRNIIGSLAEPLATMAGYHFGWWDANGRDAA
FT                   ETSGKSLRAALAFGAARACGDAREAAPAAAAVELIHNFTLLHDDVMDGDSTRRGRATVW
FT                   RVWGVNNAILLGDALHALAIRTLTDSLGQGVAVNAITRLEQTCLDLCVGQHQDCSFERC
FT                   TTVTVPDYLRMAAGKTAVLMACACALGAVSARADAATVAAVERFGYELGLAFQIVDDLI
FT                   GIWGDPARTGKPVGSDLASRKATLPIVVALSSDCEAALELARLYRSDHAMTHREVVHAA
FT                   ELVETAGGRQAAQHFADERMRAAIAALPESMRCSELVALAQLVIDRDK"
FT   gene            323882..325237
FT                   /gene="cyp274A1"
FT                   /locus_tag="MMAR_0283"
FT   CDS_pept        323882..325237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp274A1"
FT                   /locus_tag="MMAR_0283"
FT                   /product="cytochrome P450 274A1 Cyp274A1"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. it oxidizes a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38750"
FT                   /db_xref="GOA:B2HKP5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP5"
FT                   /protein_id="ACC38750.1"
FT                   /translation="MTVAGSPTLRTPPVAPGRLPGLGHLSALARDPLGYLARLRSVADV
FT                   VTIYLGPRPSYLVTSHDLVRDMLVSQSECFTRGAVFERAGKALGQGLLVSDGEFHRCQR
FT                   RLLQPAFHHRQTPRYAEVMADAAQTLSRAWRPGVPIEVTHEIHTMALAVVCRGLFHTDL
FT                   GGSAVSRVERALTGINQGVIWQTLYPFDWLARLPIPVNRRFRSAITDVRDLVTQLISAC
FT                   RTTGEGREGVLAMLLQARDEETGRPMSDDQVRDEVLTLLLAATETSSTTLSWLFYELDR
FT                   HPEIERGVARELDDKLANQSITHDNLRDLDLMKRVVDETLRLHTPNSILTRRAVREVQL
FT                   GQFRIPAGAEVAFSPTAIHRDPTVYDDPLSFKPDRWLSENSAHVPRHMFIPFGMGKHKC
FT                   IGDSFAITEMHVTAATVLRDWRLSLAPNAHVRERPWAIVQPHGLRMIPFPRR"
FT   gene            325297..327039
FT                   /gene="plcB_3"
FT                   /locus_tag="MMAR_0284"
FT   CDS_pept        325297..327039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB_3"
FT                   /locus_tag="MMAR_0284"
FT                   /product="membrane-associated phospholipase C 2 PlcB_3"
FT                   /note="hydrolyzes sphingomyelin in addition to
FT                   phosphatidylcholine. probable virulence factor implicated
FT                   in the pathogenesis of mycobacterium tuberculosis at the
FT                   level of intracellular survival, by the alteration of cell
FT                   signaling events or by direct cytotoxicity [catalytic
FT                   activity: a phosphatidylcholine + H(2)O = 1,2-
FT                   diacylglycerol + choline phosphate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38751"
FT                   /db_xref="GOA:B2HKP6"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP6"
FT                   /protein_id="ACC38751.1"
FT                   /translation="MAWGVIAAAVQWGNGNGPLGIEFKFLRTNSKNKRDTRVGAPFQLA
FT                   EYVYSEPNAQGGYGLSNGSVDGMSRRQFMAKLAAASSAGALMSLAGPVIEKAYGAGPCS
FT                   GHLTDIEHIVLLMQENRSFDHYFGTLSGVRGFDDTTDPAIFDQKGWDPRTQSIDPAGIT
FT                   SPFRFDTTRGPLLNGECVNDPVEGWVAMHTAWNNGANDTWLPSQYSQIRQGNIPACMGY
FT                   YTRADLPIHYMLADTFTICDDYYCSMLTGTAPNRLYWLSAWIDPDGTNGGPLLNEPNFL
FT                   PLQPFSWRIMPENLEDAGISWKVYQNKFFGHYINSPISDNGLVQAFKQTADPRSNLARF
FT                   GIAPTYPQDFVLDVKANRLPKVSWVVPNIIQSEHPALPVNVGAVAIVNILRTLLSNPAV
FT                   WEKTALIISYDECGSFFDHVTPPTAPPGTPGEYVTVPDIDAVSGSGGIRGPIGLGYRVP
FT                   CIVISPYSRGPLVVSDTFDHTSQLRLIETRFGVPVPNLTPWRRSVTEDMTSAFNFAVPP
FT                   NPSRPKLDPPLLNALPRLPQCVPNAVLGSLGGAAVANPYRVPYPQVPPTQETTPARGTP
FT                   SGPC"
FT   gene            327193..328710
FT                   /locus_tag="MMAR_0285"
FT   CDS_pept        327193..328710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38752"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP7"
FT                   /protein_id="ACC38752.1"
FT                   /translation="MTQVTTFPLVDAIVSRRGGSLDGVVVIAAQHLLETTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHLGVADAMRADGVHVDEFSAAYAPHESFDTEYTRHVERFFAQ
FT                   SWDRLAAGRAGRVVLLDDGGSLLAAAGAALDGTANIVGIEQTSAGYAKIANCALGFPVV
FT                   NIARSSAKLLYESPIIAGNVTRCAFDRIEGLDRGDAILITGAGAIGSALADQLRPRHER
FT                   VDVYDTRVGHPGPIDLTQAIGDYDVIIGATGATSVPTELHDLLRPGVVLMSASSSDREF
FT                   SGAALRRRAIPDPNCHADLRIADGKLDATLLNSGFPVNFDGSAMCGDESMSLTMALLAA
FT                   AVLYAASAEAADIDCDHPHLGLTDQGDIVQSFLNIDVPLQALGRLPLLSVGGYRRIELR
FT                   SGDIVFRQGEPASHFYVVESGELEAFVDGQLVLRLVAGDHFGEIALLSGWRRAATVRAS
FT                   QPSVLWSLDAAAFSEVLRVDATMRELAHQAIHSRVSRVVGAPKSSSV"
FT   gene            complement(328780..330156)
FT                   /gene="lipJ"
FT                   /locus_tag="MMAR_0286"
FT   CDS_pept        complement(328780..330156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipJ"
FT                   /locus_tag="MMAR_0286"
FT                   /product="lignin peroxidase LipJ"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38753"
FT                   /db_xref="GOA:B2HKP8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP8"
FT                   /protein_id="ACC38753.1"
FT                   /translation="MSQAPRTPRTRYARCGDLDIAYQVIGDHPIDLLVIPGASIPVDTI
FT                   DSEPSMYRFHRRLASFSRLIRFDHRGVGLSSRVSSPDALGPRFWAEDAIAVMDAAGCQE
FT                   ATILASGFTATTALVLAADYPERVRSLVLINASARTLHAPDYELGIRSNTAEPFLTLGT
FT                   DPDAVEQGFDVLRIMAPSVAHDDAFRDWWDLAGNRAASPSTARAFINAVQASDARDSLP
FT                   HITAPTLILHRVGTKFVPVEHGRYLAEHIAGSRLVELPGSDSLYWVGDTAALLDEVEEF
FT                   ITGVRGGFVTERVLTTVMFTDIVGSTQRAATVGDLRWRDLLDNHDNLVRHEIQRFGGRE
FT                   VNTAGDGFVATFSSPSAAINCADAVVDAVAVLGIEVRVGIHAGEVEVRGADVAGLAVHI
FT                   GARVCALAGSSEVLVSSTVRDIVTGSSHRFAERGEHELKGVPGRWRLCALVREHLTGQR
FT                   "
FT   gene            complement(330159..330764)
FT                   /locus_tag="MMAR_0287"
FT   CDS_pept        complement(330159..330764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0287"
FT                   /product="transcriptional regulatory protein"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38754"
FT                   /db_xref="GOA:B2HKP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKP9"
FT                   /protein_id="ACC38754.1"
FT                   /translation="MQSRMGTETSTDGVESITDLDRTILDTARAVFETYGVRRANIEDV
FT                   ATRAGVSRSTIYRRFPTKDELFERVVRREAELFFAALNQATNGHNPREAVIEAFTLGVR
FT                   LIQDSPLYSRIAESEPELFGMFSRSHVFPIGQFADGIAHTLRRCGADAPDADLANIADI
FT                   LLRVAVGIIMFPTERLDTSDDAAVREYAARYLIPIITL"
FT   gene            330953..331903
FT                   /locus_tag="MMAR_0288"
FT   CDS_pept        330953..331903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38755"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ0"
FT                   /protein_id="ACC38755.1"
FT                   /translation="MATELTAGVDFDTGVREALPMPIDRPVDDEIVAQRLGPTSLIWKF
FT                   YGDVRTQLFGFQRAAGTENCIEQLGQGVLDHSVVFSDTLGRAKRTGPPLMRTVYSEDPH
FT                   GWGRTVRDFHKPIKGTIGDGSRYHALNPELFYWAHATFVDQILYNTDTFIRRLSRAEKE
FT                   QIFEESKIWYGLYGVSDRSQPQTYDEFVAYWDGMLDRFVPHKTVLYGTGYLRKGIPGPR
FT                   KLPALIWRILSAPLNAYARLVIVGTLPPQMREVCDLDWNAKKERRFQRFAALIRGLNPV
FT                   LGRLPVRLIYLPWAAQAWTRSGVDPRRLHRRAVST"
FT   gene            complement(331924..332187)
FT                   /gene="rpsR2"
FT                   /locus_tag="MMAR_0289"
FT   CDS_pept        complement(331924..332187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR2"
FT                   /locus_tag="MMAR_0289"
FT                   /product="ribosomal protein S18 RpsR2"
FT                   /note="involved in translation, amino-acyl tRNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38756"
FT                   /db_xref="GOA:B2HKQ1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HKQ1"
FT                   /protein_id="ACC38756.1"
FT                   /translation="MKKKPRRTRRPIAAPATPAKKNLLDSLGVSEVDYKDISRLRTFIS
FT                   DRGKIRSRRVTGLTVQQQRQIATAIKNAREMALLPYPASRPQ"
FT   gene            complement(332194..332499)
FT                   /gene="rpsN2"
FT                   /locus_tag="MMAR_0290"
FT   CDS_pept        complement(332194..332499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN2"
FT                   /locus_tag="MMAR_0290"
FT                   /product="ribosomal protein S14 RpsN2"
FT                   /note="involved in translation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38757"
FT                   /db_xref="GOA:B2HKQ2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HKQ2"
FT                   /protein_id="ACC38757.1"
FT                   /translation="MAKKSKIVKNNKRRDIVARYAQRRAELKQIIQSPTSSYEQRLDAQ
FT                   RALSRQPRDASAVRLRNRDAIDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKASW"
FT   gene            complement(332500..332664)
FT                   /gene="rpmG1"
FT                   /locus_tag="MMAR_0291"
FT   CDS_pept        complement(332500..332664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /locus_tag="MMAR_0291"
FT                   /product="ribosomal protein L33 RpmG1"
FT                   /note="involved in translation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38758"
FT                   /db_xref="GOA:B2HKQ3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HKQ3"
FT                   /protein_id="ACC38758.1"
FT                   /translation="MARNEIRPAVKLRSTAGTGYTYITRKNRRNDPDRLILSKYDPVIR
FT                   KHVPFREER"
FT   gene            complement(332664..332900)
FT                   /gene="rpmB2"
FT                   /locus_tag="MMAR_0292"
FT   CDS_pept        complement(332664..332900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB2"
FT                   /locus_tag="MMAR_0292"
FT                   /product="50S ribosomal protein L28 RpmB2"
FT                   /note="involved in ribosome activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38759"
FT                   /db_xref="GOA:B2HKQ4"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ4"
FT                   /protein_id="ACC38759.1"
FT                   /translation="MSARCQVTGRTVSFGNTVSHSHRRSRRRWSPNIQLKTYYLPSENR
FT                   RIKLRVSAKGIKVIDRDGIEATVARLRRAGEQI"
FT   gene            333030..334226
FT                   /locus_tag="MMAR_0293"
FT   CDS_pept        333030..334226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0293"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38760"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ5"
FT                   /protein_id="ACC38760.1"
FT                   /translation="MRTPVVLVAGQGDTDDVTGLLLRRPGTVVVEHRFDGHVVRRNIIT
FT                   FRRGELSTAEEVLELAHGCVSCTIRNDLLILLRRLHRRDGVDRIVVHLAPWLEPEPICW
FT                   AINHVRVRVGPGYPDAPAGRDVRIGAVVTCVDSANWLAQSLGDEELADGRTFAQVTVGQ
FT                   AEFADVLVLNRPDPVTLAVLPRLAPRARITVGLDRVELALANLDDYSRRGRSDHPHASL
FT                   LGGRPPLGTDGGVGIVEFNARRPFRPERLHDAVDHLLDGVIRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMSPAEVDHADPERRLFAELMWEYRFGDRHTAMTVLACGADR
FT                   AEITRVLTGALLTDREMARPQDWPAYDDPFGDWHEDPCHETPDESGQFSGHLNKGELE"
FT   gene            334223..334495
FT                   /gene="rpmE_1"
FT                   /locus_tag="MMAR_0294"
FT   CDS_pept        334223..334495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE_1"
FT                   /locus_tag="MMAR_0294"
FT                   /product="50S ribosomal protein L31 RpmE_1"
FT                   /note="involved in translation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38761"
FT                   /db_xref="GOA:B2HKQ6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ6"
FT                   /protein_id="ACC38761.1"
FT                   /translation="MKSDTHPDYHPVVFEDATTGTRFLTRSTLTSSRSIDWETPSGVHT
FT                   YPLVVVEVSADSHPFWTGTRRTLDTAGRVEKFYRRYGRADRPATG"
FT   gene            334665..335564
FT                   /locus_tag="MMAR_0295"
FT   CDS_pept        334665..335564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0295"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown; supposed involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38762"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ7"
FT                   /protein_id="ACC38762.1"
FT                   /translation="MNLATQALAKAFERASNGLANPATLADPDRLRGAVTGKTALVTGA
FT                   SYGIGEATARKLAAAGATVLMVARSAERLEDLVSAIAAGGGAAVAYPTDLTDEAAVGVL
FT                   TKQVNQNHGPLDIVVSNAGKSLRRSLHDQYDRPHDFQRTIDINYLGPIWLLLGLLPAMR
FT                   ESGRGHVVNVSSVGVRLVPGPQWGAYQASKGAFDRWLRSVAPELHGDGVDVTSVYFALV
FT                   RTRMIEPTPMLGRLPGLEPDQAADAVAKAIVERPRTNEPPWLWPAELASVLLAGPAEQA
FT                   ARVWHRRFFAPTAEAGKS"
FT   gene            335567..337153
FT                   /gene="fadD12_2"
FT                   /locus_tag="MMAR_0296"
FT   CDS_pept        335567..337153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD12_2"
FT                   /locus_tag="MMAR_0296"
FT                   /product="long-chain-fatty-acid--CoA ligase FadD12_2"
FT                   /note="function unknown, but supposed involvement in lipid
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38763"
FT                   /db_xref="GOA:B2HKQ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ8"
FT                   /protein_id="ACC38763.1"
FT                   /translation="MMAAGVVTTAARALLGSGLLSPSSPAAALRLVRELYRGGTNLYTP
FT                   LAIAAARWPERTAIVDDDGALSYREIQTMTESVAGELTLAGIGPGQAVGVMCRNGRNFV
FT                   AAAFAAGLVGADVVLVNTEFRATALAAALEAHQMRVMLCDDEFVDQVAGTGESVLVIDP
FT                   STVTARDCARPKVAPSGRIVLLTSGTTGVPKGVPRKPKVSSGIGVSVTLLERTRLRVGS
FT                   RMTLATPMFHGLGFGMLVLTISLGGTVLTRRHFDAEATLAQTSLHRADGLSVVPIMLAR
FT                   ILDLPDQVRARNPLPCLRVVISSGDRLDPSLARRFMEAYGDVLYNLYGSTEVGIGALAT
FT                   PAELRDWPETVGRPVAGCPVRIFDRNGRPVGPRVTGRIFVGGELNSDGYSGGGGKAVID
FT                   GMASTGDMGYLDESGRLYIVGREDDMIVSGGENVYPRSLENALASHPDVAENAVIGVAD
FT                   EQFGQRLAAFVVARPGCDIDADAIRDYLKGRVSRFEQPRDIHLVSSIPRNPAGKVLRKQ
FT                   LASYAEPEAQS"
FT   gene            complement(337126..341988)
FT                   /gene="ctpI"
FT                   /locus_tag="MMAR_0297"
FT   CDS_pept        complement(337126..341988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpI"
FT                   /locus_tag="MMAR_0297"
FT                   /product="cation-transporter ATPase I CtpI"
FT                   /note="cation-transporting ATPase; possibly catalyzes the
FT                   transport of a cation (possibly magnesium) with the
FT                   hydrolyse of ATP [catalytic activity: ATP + H(2)O +
FT                   cation(in) = ADP + phosphate + cation(out)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38764"
FT                   /db_xref="GOA:B2HKQ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKQ9"
FT                   /protein_id="ACC38764.1"
FT                   /translation="MKIPGVVNPVANLVAGVTGGAAQVVRAGVQTAADAAGVLQTLASP
FT                   VVELAAPVVQSVAQTTNRAIGRNGAADRAPDGVTPPLRWHSGRRVHFDLDPLLPFPRWH
FT                   EHAAVVEEPVRRIPGVAKAHVEGALGRLVVELEDGADSDTVLDEVCDTAATVAADIFLS
FT                   GSLSSPNSAPFADPGNPLAVLVPLTAAALDLAALGAAVTGWVIRLPAAPQTTRAAAALI
FT                   NHQPRMVSLLESRLGRVGTDIALAATTAAANGLTQAVGTPLLDLVQRGLQISEATAHRR
FT                   VWRDREPALASPGRPQAPVVPVISSAGVQAQEPRHSWAAAAAGEASHVMVGGSIDAAID
FT                   TAKGSMAGPVESYVNSAANGALIAAASALVAGGGTEDAAGAILAGVPRAAHMGRQAFAA
FT                   VLGRGLASEGQLVLDPGALRRLDRVQVVVIDGAALRGDHRAVLRAQGDEPGWDDDRVYE
FT                   VADALLHGEEAPEPDPDELPATGARLRWVPLRGPSATPAQGLEHADLVVDGQTVGNVDV
FT                   GWEVDPYAIPLLQTAHRTGARVVLRHVAGTEDLSASVGSTHPPGTPLLNLVRELRTDRG
FT                   PVLLITALHRDFASTDTLAALAIADIGVALDDPRAATPWTADIITGTDLAAAVRILSAI
FT                   PVARASSVSSVHLAQGGTTLAGLLLVTGEQAKTTNPASFRRWLNPVNTAAATALLSGSW
FT                   SAATVLRLPDPTPQPLTAWHALDPEIVYARLAGGARPMAVDPGTPTWRRLLDDLSYEPL
FT                   VSPLRGPAHTLAQLAAATRHELADPLTPILAVGAAASAIVGSNVDALLVAGVMTVNAIT
FT                   GGVQRLRAEAAAAELFAEQDQMVRRVVVPAVATTRRRLEAARHATRTATVSAKSLRVGD
FT                   VIDLAAPEVVPADARLLVAEDLEVDESLLTGESLPVDKQVDPVAVNDADRASMLFEGST
FT                   IVAGRARAIVVATGAGTAAHRAISAVADVETSAGVQARLRELTSKVLPLTLAGGASVSV
FT                   LALMRRATLRQAVADGVAIAVAAVPEGLPLVATLSQLAAAQRLTAHGALVRAPRTIEAL
FT                   GRVDTVCFDKTGTLTENRLRVVCAIPSSTSPLDPFIDSADPRSTEVLRAAARATTQPHD
FT                   GQGHAHATDEAIIVAANSLEGLDDSAWTVIAEVPFESSRGYAASIGTTGTSNGHPTLML
FT                   KGAPETILPRCRFADPDADLEHAEALVHSLAERGLRVLAVAKRPWEHDTADDDDTDADA
FT                   VDAAAHDLELLGYVGLADTARPSARPLIEALVDAQRNVVLITGDHPITARAIARQLGLP
FT                   EDVRVVTGAELIGLDEDACAKLAADVQVFARVSPEQKVQIVAALQRCGRVTAMVGDGAN
FT                   DAAAIRMADVGIGVSGRGSSAARGAADIVLTDDDLGVLLDALVEGRSMWAGVRDAVTIL
FT                   VGGNVGEVLFTIIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAITSQYDDPEDDSDL
FT                   SDEEIEEARRRRQRAVLTAPTPSLDAPLMRQIANRGVVTAAGATAAWAIGRWTPGTERR
FT                   TATMGLTALVTTQLAQTLLTRSHSPLVLATAFGSAGVLIGIIQTPVVSHFFGCTPLGPV
FT                   AWTGVFSATAGATAVSVLAPKWLAKTVDVALEHQDWASGSA"
FT   gene            complement(342457..342729)
FT                   /locus_tag="MMAR_0298"
FT   CDS_pept        complement(342457..342729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0298"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38765"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKR0"
FT                   /protein_id="ACC38765.1"
FT                   /translation="MFPGRQDCPTVFRVESHGTPELVAVENLHSGDPITDVNGGGQRYI
FT                   VLESKAVGDGCVVLELESRVDHQLQVIEKSFPTGYHVGRANHRIL"
FT   gene            343064..344737
FT                   /locus_tag="MMAR_0299"
FT   CDS_pept        343064..344737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0299"
FT                   /product="PE-PGRS family protein, PE_PGRS1"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38766"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKR1"
FT                   /protein_id="ACC38766.1"
FT                   /translation="MSYVFATPELVAAAATDLAGVQSVLSAANSAAAGPTMAVMAAGAD
FT                   EVSALIAGLFDAHAQAYQALSAQALVFHDQFVQMLNAGASSYAAAEAANASPLQVVQNL
FT                   GQNVLAAVNAPTQAVLGRPLIGDGANGSPNTGADGGAGGLLYGNGGNGGSGGLAQAGGN
FT                   GGAAGLIGNGGSGGAGGADFAGTSGGMGGTGGWLWGNGGAGGGGGVGTTTTGGTGGAGG
FT                   NAMGLFGNGGIGGAGGVGQNTTGTGGNGGAGGNAALLGFAGAGGVGGLGGATGGDGGQG
FT                   GNAALFGNGGDGGAGGAGANLDGGNGGLGGNAGLFGDGGHGGAGGVSFDPAGGDGGNGG
FT                   QGGNATLFGYGGHGGAGGSSLNLAGGDGGDGGQGGFFGGGGAGGDGGAGYVLANAGAAG
FT                   NGGDAGFFGNGGAGGSGQFGVGASSAGGIGGNGGRVIGDGGDGGVGGWGVLAAAGGKGG
FT                   DAIGLFGQGGAGGTGGAAVGAGNHGGNGGDGGTGALIGNGGDGGAAGTSIGQSASGGNG
FT                   GNARFLGNGGDGGPGIFGGTGGTGGQGGTLAGVPGAAGPS"
FT   gene            344862..345731
FT                   /locus_tag="MMAR_0300"
FT   CDS_pept        344862..345731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0300"
FT                   /product="rhomboid family serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38767"
FT                   /db_xref="GOA:B2HKR2"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B2HKR2"
FT                   /protein_id="ACC38767.1"
FT                   /translation="MSGPSAPESPACYRHPGRPTYVRCTRCDRYICGDCMRSGAVGHQC
FT                   VECVRADARTVRQPRTQFGGRQRSVTPVVTFSLIAVSVLVFVLQLVVAGLGPHLALWPP
FT                   AVADGQLYRLVTSAFMHYGTLHLVFNMWALYIVGPPLEMWLGRLRFGGLYALSALGGSV
FT                   LVYLIAPLNTATAGASGAIFGLFGATFVVAKRLNLDIRWVVALIAINLAITFVAPAVGS
FT                   QLISWQGHVGGLITGALVAAAYVYAPRERRNFIQGAVTLTVAVAFVVLIWWRTSELLAM
FT                   FGGHLNLG"
FT   gene            345766..346227
FT                   /locus_tag="MMAR_0301"
FT   CDS_pept        345766..346227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38768"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLL9"
FT                   /protein_id="ACC38768.1"
FT                   /translation="MTWWIAHAERALSQDVPAPPERVRDFYVDLDNLKLVHPLIVAVQA
FT                   LSRTETRDGYRQSYRVIDRIPMGPLNLEVRYRARLHVPVHGAVHTEADQFPRVRLRATV
FT                   TFAPVAAGTRLTERIAIAAPRPLASYTTRAAVQAHAAMLAGIRSYFESS"
FT   gene            complement(346209..346997)
FT                   /locus_tag="MMAR_0302"
FT   CDS_pept        complement(346209..346997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0302"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38769"
FT                   /db_xref="GOA:B2HLM0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM0"
FT                   /protein_id="ACC38769.1"
FT                   /translation="MQVAIITGATGGIGFGCAAKLAEMGMAVLGTGRDERRLAELTQLP
FT                   GGPDRIATHPVDLTDDDAPGQLTRAALERWGRIDFLINAAGVGSPKPVHETDDESLDYV
FT                   LSLMLRAPFRLTREVLPHLRPGSAIINITSTFAVVGGLRGGAYSAAKGGLTALTTHIAC
FT                   QYGAQGIRCNAVAPGVIQTAMTQHRLADERFRRINVEMTPHQRLGTVDDVANTVAFLCS
FT                   EGGAFINGQTIVVDGGWSSTKYLSDFALTAQWSPAQDDSK"
FT   gene            complement(346999..348609)
FT                   /locus_tag="MMAR_0303"
FT   CDS_pept        complement(346999..348609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0303"
FT                   /product="acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38770"
FT                   /db_xref="GOA:B2HLM1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM1"
FT                   /protein_id="ACC38770.1"
FT                   /translation="MGGPKVPQRRLIDGRWVRWDADRAAGAYAHRWWVRRTLADALREA
FT                   AQSTPQRVALVDADRQLDCQELHRQAMALAQHLRSRMPAGSVVSFMLPNWHEAAVIYLA
FT                   STLAAMVANPVLPSLREHELRFILEDAGSRMIFAPADFRGHDYTSMLRRVAAQLPSRPE
FT                   VIEVRGQCPDGVSTFQSLLVGRETAAPLPTADPDAVRMVLYTSGTTGRPKGVLHTHNSI
FT                   HALICQIRDHWMVEPGDGFLVASPIAHIGGSIYAFECPLLLGTTAVLLDRWDADRAVQL
FT                   MTSKRCTHMAGATPFLEQLLAAAQRAGTRLPDLKFFVCGGASVSPSLIRCATDYFDKAV
FT                   VTRVYGSTEVPVTTIGAPDSSAHAAATDGRVGAADVKLVAGEIRVRGPQMLVGYRHPED
FT                   EAGSFDAQGYFRTGDLGHWVDDEYLVVTGRAKDIIIRNGENISPKEIEDILITHPGIAD
FT                   VAIVGLPDDRTGERACAVIVAAADPPPGLPGVRAFLEGAGVARFKIPEQVVIWDHLPKN
FT                   HAGKIVKHRIKAALMKAEQ"
FT   gene            complement(348619..349398)
FT                   /locus_tag="MMAR_0304"
FT   CDS_pept        complement(348619..349398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0304"
FT                   /product="transcriptional regulatory protein (probably
FT                   GntR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38771"
FT                   /db_xref="GOA:B2HLM2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM2"
FT                   /protein_id="ACC38771.1"
FT                   /translation="MSEPKILDHRYLQVARTLRKEIVDGIYPVGSQLPTEHELCDRFAV
FT                   SRYTIREALRRLREDNLVSSRPRTGTLVVPRPSSDSYVQHVMSINDLLAFATGTRFVIE
FT                   SIAMATIDDEVSAQTGLASGEQWLSVCGFRRAENAEPAEPALCRTQYYINRAFAAVGRL
FT                   LHRHDGPIFPLIEDLFGLGIVEVQQEIAAVSISPALAHGLQVEPGSAALQIRRAYVTSD
FT                   EQVAQVTLNTHPASRFRHSMTMRRLRGETGSSGVTDQ"
FT   gene            complement(349411..351033)
FT                   /locus_tag="MMAR_0305"
FT   CDS_pept        complement(349411..351033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38772"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM3"
FT                   /protein_id="ACC38772.1"
FT                   /translation="MVRAVIPVTRRLQHAGRYPVTRAPNVAEGWTLTRLTAPSRLFGAN
FT                   GLRTGPDGRVYIAQVTGSQISALDLSTGRLDTVCPKGGAIIAPDDLAFDQDGNLYATEV
FT                   MDGRVSVRAPDGHTRVLRDDIPSANGITFHQGRLFVGECRDGGRLLELDLNGGAPRVLA
FT                   RNLPSPNAMEVGPDGLLYFPVMGANEIWRIDPDGGVPQCVAGDLGVPDAVKFDPHGHLV
FT                   STQVHSGEVLRINPRTGDRTVLAALHPGLDNLTFVGERLFVSSFTGEITEILGTGETRT
FT                   TLPGGLTWPLGLAVDADGDLYIADGTYFYVLLADGTLRVGGMLFSAGYPGFLRGVAALG
FT                   SGEFAVTTSNGEVARYRPWASESEVVATGLDQLYGVAVAGSGALFVAERGAGRVLSVRP
FT                   DGVEVMASGLSDPVGVAVTADGRCVVTEADAGRVRTLGDTGTLLDGLQCPQGVAICDRQ
FT                   VYVIDSGAKQLVAVDLGSRTRHTIAWDLPVGAPAGVTPKPLRGMPPFSGPQGPFAAITA
FT                   GPDATLYISADADGSVLALRRES"
FT   gene            351170..352045
FT                   /locus_tag="MMAR_0306"
FT   CDS_pept        351170..352045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0306"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown; possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38773"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM4"
FT                   /protein_id="ACC38773.1"
FT                   /translation="MTVDLLSLSGRVVVVAGAAGGGIGTAVTRMVARAGATVVAVSRGQ
FT                   DNLDRQVGPLVAEGLAVLPVAADVCTDEGIEATLEAVRRADGDLHGLVNVAGGADPSTW
FT                   MPSTRVRRSDWHELFARNLEAMFFMSQAIAAELKSRQRPGSIVSLSSISGMNAAPFHIG
FT                   YGTAKAAIVAATRTMALELACDETAAGSPIRVNAVAPGVTETPASHTYTDVDPERDRRA
FT                   IAMGRRGRPDEVAGVILFLLSDLSSYITGQTLLVDGGLNLKWGHLGADNTSLFLKDESF
FT                   RAAIKRWDEA"
FT   gene            352047..353441
FT                   /locus_tag="MMAR_0307"
FT   CDS_pept        352047..353441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0307"
FT                   /product="dioxygenase"
FT                   /note="function unknown; involved in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38774"
FT                   /db_xref="GOA:B2HLM5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM5"
FT                   /protein_id="ACC38774.1"
FT                   /translation="MTDHNDGRAEPMDAAHHDDVEATLTGAVTFGVDAYTCADYARAER
FT                   DKLWRKVWQQVGRVEDLPKVGSYLTYDILDDSIVVVRSAADTFKAHHNVCMHRGRRLVD
FT                   IPPGAKNVCGHKKSFVCGFHGWTYDQDGNCIHIPEKPDWQGALTPENTHLAAVNVDTWG
FT                   GWIWINMDPAAQPLRQYLEPAATMLDPFRLQDMRCKWRKWLTFQCNWKVAMEAFNETYH
FT                   VATTHPQFNKFGNFRGWAAAHGRHSNIGYDAPKDLAQTKSKIRLGTGADPRVSTAEMQR
FT                   YTLEETNATTTRTLVDAALRLVEELPEDAPAGQVLDHWLTSARRDDAARGVLWPTIDPE
FT                   HLAQSGTAWQIFPNFQIGQGLTTALCYSARPHGYDPDQCVFEASCYELYPKGEEPHTEW
FT                   VYAPPDDPGWRSVLPQDFSNMAAVQQGMKSGGFGGPKPNPYMERSTANLHRNLAEYMGT
FT                   GAPREL"
FT   gene            353456..354637
FT                   /locus_tag="MMAR_0308"
FT   CDS_pept        353456..354637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0308"
FT                   /product="monooxygenase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38775"
FT                   /db_xref="GOA:B2HLM6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM6"
FT                   /protein_id="ACC38775.1"
FT                   /translation="MKVNIGLGAHNSLDWERVLAEDYDRPPSTADWECVQATLALGDLA
FT                   EPLGFDGIWLPEHCGTPYGMTPNPIQALSYFAGRTERVNLGTFVAVAPWWHPIRLAHQM
FT                   AYLDIISNGRYTTLGIGRGVSKGEFAAVGVPREESRQRFNETLDILALAFSGKRFAYEG
FT                   EIFTVPEMSLRPEPFSSDLFARIYSSSSTAESLEILARRGMVPLFVGNKPIEDAGREVQ
FT                   QVNTFRQEEGLPPCQPKNVMFMYCTASAEQAAESEEWIWTANRDVTVHYGFADASNFKG
FT                   VKGYEAYAAREASATAVLASSVTGDAKGGPPKTPGYHASNLLIGTPEEIYHRITAAQAA
FT                   CSFCELTIVVQFGTMPYEQAMASTRLFAQEVLPAVHRMDAPLHPAALPANALA"
FT   gene            354634..356496
FT                   /locus_tag="MMAR_0309"
FT   CDS_pept        354634..356496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0309"
FT                   /product="monoxygenase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38776"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM7"
FT                   /protein_id="ACC38776.1"
FT                   /translation="MTEMTAPDCPPSQTPGDIDLPALREKYRHEREKRLRPEGSRQYIE
FT                   LVDDFAGYYETDPYSPPLQRDPISADIDVLVLGGGFGGLLCGAHLKKAGVADVRIIELG
FT                   GDFGGVWYWNRYPGLQCDNESYCYIPLLEELNYMPSKKFADGSEIYEHCRRIGKHYGLY
FT                   DSAIFGTQVRELHWDEAIRRWRVGTNRGDDIRARFVVMASGPFHRPKLPGIPGIKDFRG
FT                   HSFHSARWDYEYTGGDSTGGLTGLADKRVAVVGTGATAVQIVPFLGRYAKHLYVFQRTP
FT                   SSVGERNNTPTDPEWAKSLQPGWQKQRQRNFHSWTFEGMALGQPDYVCDFWTELGRNTA
FT                   ARVLALEDPAALSPEQFMAIREEEDYKVMERLRRRIQSIVDDTSTAEALKPYYRFLCKR
FT                   PCTNDDYLQTFNRPNVTLVDVSQTRGVQRATETGLVANDTEYELDCIIYASGFEITTQI
FT                   SRRYSIDEIRGRDNVSLFDYWRNGYQTLHGMTSRGFPNQFFTGFTQVGISANIAANYEL
FT                   QGEHIAYIIAEALARGATVVEPSQQAQDQWCRTIRETAIDNTQFDLECTPGYYNNEGGG
FT                   PGAAEGEGIRSHIGEPYGPGFYAFGDLLAQWRSKGDLTGLILES"
FT   gene            356496..357431
FT                   /locus_tag="MMAR_0310"
FT   CDS_pept        356496..357431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0310"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38777"
FT                   /db_xref="GOA:B2HLM8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM8"
FT                   /protein_id="ACC38777.1"
FT                   /translation="MTELRFDDRVAVVTGAGRGLGRAYALLLAARGAKVVVNDTGGSLA
FT                   GAGGDPAPAHQVVAEITALGGQAAASLDSVTTPAGGQAIIETALERYGRIDILIHNAGN
FT                   VRSAPLKEMSYEDFDAVIDVHLRGAFHVVRPAFGLMCDQLYGRIVLASSIGGLYGNQGV
FT                   ANYAAAKAGLIGLSNVAAVEGAASGVLCNVIVPSAVTRMADGLDISSYPPMGTELVAPV
FT                   VGLLAHESCPVNGEMLIAIAGRVARAVVAESPGVQRLSWSMEDVAEGLYAIRDLAAPLV
FT                   FPVVPSGHSDHIRYSFESAAWANRGSAHHV"
FT   gene            357424..358644
FT                   /locus_tag="MMAR_0311"
FT   CDS_pept        357424..358644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown. possibly involved in energy
FT                   production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38778"
FT                   /db_xref="GOA:B2HLM9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLM9"
FT                   /protein_id="ACC38778.1"
FT                   /translation="MSNCGSDCDSSLGAGAGKRTGPLSGVRVVDLTAMVMGPYCTQIMA
FT                   DMGADVIKIEPPQGDDTRYVSVGPAAGMSGVFVNVNRGKRSAVIDLKSDSGQAAVRALI
FT                   EGADVFIHSMRAKAIARLGLSYPEVAAINPAIVYTNCYGYGRRGPNRDLPAYDDTIQAA
FT                   CGLPSVQEQLTGEPSYVGTIMADKVAGLTALYATMMALFHRERTGQGQEVEIGMFEAVA
FT                   SFMLVEHANGAMFDPPLGPAVYPRTVAPNRRPYRTSDGYLAALIYNDKHWAAFVDAVRP
FT                   PWASEQYATLEGRARQIDTVYALLAETFAARTTQEWLDLLEELEIPASALSSPAELFDN
FT                   QHLNAVGFFETIDTAHGPVRFPGVPTWFSRTPGRVSGPAPQLGADTSAVLEELGINAAD
FT                   AQPAGPA"
FT   gene            358882..360894
FT                   /locus_tag="MMAR_0312"
FT   CDS_pept        358882..360894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0312"
FT                   /product="transmembrane acyltransferase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38779"
FT                   /db_xref="GOA:B2HLN0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN0"
FT                   /protein_id="ACC38779.1"
FT                   /translation="MRRAGRTAIWDRAGRQRGIPALDGLRAVAVALVLVGHGGVPGVGG
FT                   GFIGVDIFFVLSGFLITSLLLDELGRSGRIDLTGFWIRRARRLLPALVLMVLTVAAARE
FT                   LLPYQALTGLRNDALAAFLWMANWRFVAQKTDYFTQGAPPSPLQHTWSLGVEEQYYIVW
FT                   PLLLIAVTLLLAARARRYFQRATLGGVRFTIFVIGTLGALASGAAAIVFASESTRDRIY
FT                   FGTDTRAQALLVGAAAAALLVRDWTALNHGWCLVRTRWGRRVARFLPVIGVAGLAALTH
FT                   FATGNVNEFRHGLLILVALAAVFVVAPVALEQRGAVARLLAWRPLVWLGTISYGIYLWH
FT                   WPIFLALNGERTGWTGMRLFAARCALTVAIAALSWWLFEQPIRRWRPARVPLLPLAAAT
FT                   VASAAAATMLVIPVGTGPGLREVGLPPGVSAVAAVSPSPPEPAAPGPAAAPRDPNRPFT
FT                   VSVFGDSIGWTMMHYLPATPGFRFIDHTVIGCSLVRGTPYRYIGQTLEQRPECDTWPSR
FT                   WSAQVSQDRPDVALLIIGRWETVDRVNEGKWTHIGDPTFDGYLNFELQRALKIVGSSGV
FT                   RVMVATVPYSRGGEKPDGRLYPEDQPDRVRQWNDMLRKTVSQHRNVGIIDLNKKLSPDG
FT                   VYTAKVDGIQVRSDGVHLTPEGVKWLIPWLEESLR"
FT   gene            complement(360898..361563)
FT                   /locus_tag="MMAR_0313"
FT   CDS_pept        complement(360898..361563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0313"
FT                   /product="O-methyltransferase"
FT                   /note="thought to be involved in transfer of methyl group"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38780"
FT                   /db_xref="GOA:B2HLN1"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN1"
FT                   /protein_id="ACC38780.1"
FT                   /translation="MGTTLQDAKVAAALDRMYAAAANEMTALRERRAEIERLWSGDAQQ
FT                   RADAMSEFYIPVTPEAGRLMYALVRAIRPTTVVEFGMSFGISTIHLAAAVRDNGSGRVV
FT                   TTELNASKIAAAKQTFADTGLADVITVAEGDALATLTTVPGPVQFVLLDGWKDLYLPVV
FT                   RLLEPVLPAGALILADNTESAGSRPYLDYIRDPANGYVSFNFPARSSDSMEISCRTAD"
FT   gene            362138..362353
FT                   /locus_tag="MMAR_0314"
FT   CDS_pept        362138..362353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38781"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN2"
FT                   /protein_id="ACC38781.1"
FT                   /translation="MALVATQRIPYMTGFPGRSLLSAGRRLTNKWSAHFVLTPQERANR
FT                   YVSRMPIAVVTASLGGHPDLGTNNYR"
FT   gene            362455..364209
FT                   /locus_tag="MMAR_0315"
FT   CDS_pept        362455..364209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0315"
FT                   /product="divalent cation-transport integral membrane
FT                   protein"
FT                   /note="H(+)-stimulated, highly selective, divalent cation
FT                   uptake system. responsible for the translocation of the
FT                   divalent metal across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38782"
FT                   /db_xref="GOA:B2HLN3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN3"
FT                   /protein_id="ACC38782.1"
FT                   /translation="MLMTSISTSRRGAPNSAVHSADAAVLDSAHTGDIVGAFGRIRRDG
FT                   DGVASRRWQRLRTLMVISGPGLIVMVGDNDAGGVATYAQAGQNYGMTLLWTLALLIPVL
FT                   YVNQEMVLRLGAVVRVGHARLIFERFGKFWGAFSVGDLLILNALTIVTEFIGVSMALGF
FT                   LGCPKAVAIPAAAVLLFAVVAGGSFRRWEQMMFLLIAVNVVIIPMALLVHPTFSGTVGG
FT                   LVPRFPGGLDSTVLLLIVAIVGTTIAPWQLFFQQSNVVDKRITARWIPYARADLVLGIV
FT                   VVIVGATALMAVTAFGLAGTSDVGHFSDAGAVATSLTNHFGSTVGILFAVVLLDASLIG
FT                   ANAIGLATTYAVGDAMGKRHSLHWKISEAPLFYGGYAALLAISAAVAFSPDYVLGLVTQ
FT                   GVQALAGILLPSATVFLVLLCNDHAVLGPWVNTLRQNIIAWTTVWCLVLLSLALTVTTF
FT                   FPRLSTAAIEIGLVAGAAIGMMGGAAVLITGRRRSDRRDAEAISQSLGGGLDPGEVDEI
FT                   NDAKLLSRAERRAIRQQDRAQWCTPNLTDLARPAMSQAHRVGLFTLRAYLVVAVVLVVV
FT                   KVVQAGIG"
FT   gene            complement(364261..365016)
FT                   /locus_tag="MMAR_0316"
FT   CDS_pept        complement(364261..365016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0316"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38783"
FT                   /db_xref="GOA:B2HLN4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN4"
FT                   /protein_id="ACC38783.1"
FT                   /translation="MRRIIRYLFVMVAITVLAVVAAGSPATAALPAAEPIPGVASVLPA
FT                   NGAVVGVAHPVVVTFTAPVTNRRAAQRTIHVLSPSNMTGHFQWVQSNVVQWVPDRYWPT
FT                   HTRVSVGVQELTTGFETGDELLGVASISAHTFTVSRNGDVLRTMPASMGKPSRPTPIGS
FT                   FTALSKERTVVMDSRTIGIPLNSSEGYMITASYAVRVTWSGVYVHSAPWSVNSQGYANV
FT                   SHGCINLSPDNAAWYFDSVNVGDPIEVVG"
FT   gene            365147..366364
FT                   /gene="oxyS"
FT                   /locus_tag="MMAR_0317"
FT   CDS_pept        365147..366364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyS"
FT                   /locus_tag="MMAR_0317"
FT                   /product="oxidative stress response regulatory protein
FT                   OxyS"
FT                   /note="could effect functions of OxyR during evolution"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38784"
FT                   /db_xref="GOA:B2HLN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN5"
FT                   /protein_id="ACC38784.1"
FT                   /translation="MKLLGAPKINPELTLAQIPGSDSLVVIPIPRTSGLARRAAPAVQP
FT                   RCGVTRTAQWRADLVATVQDLAAQSGTGGRQRSGGGGSLSESVPMTEEVSVLFRQLEYF
FT                   VAVAQERHFARAAEKCYVSQPALSSAIAKLERELNVTLINRGHSFEGLTPEGERLVVWA
FT                   KRIIAEHDAFKAEVDAVRSGITGTLRLGTVPSASTTASLVLSDFCSAHPLVKAQICSRL
FT                   AVTELYRRLRDFELDAAIVYTSSDDGHDVDLVPLYEERYVLLAPPEMLPPGVSTLSWLD
FT                   AAQLPLALLSSDMRDRQIIDAAFADHAITVSPQVETDSVASLFAQVATGNSASIVPHTW
FT                   LWTTPAGGEIRPVQLVSPVVKAQVALATSSTGPGSPVARALMTSAQGLALDEFFQTRLM
FT                   EISRRR"
FT   gene            complement(366348..368111)
FT                   /gene="oxcA"
FT                   /locus_tag="MMAR_0318"
FT   CDS_pept        complement(366348..368111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxcA"
FT                   /locus_tag="MMAR_0318"
FT                   /product="oxalyl-CoA decarboxylase OxcA"
FT                   /note="involved in catabolism of oxalic acid [catalytic
FT                   activity: oxalyl-CoA = formyl-CoA + CO2]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38785"
FT                   /db_xref="GOA:B2HLN6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN6"
FT                   /protein_id="ACC38785.1"
FT                   /translation="MTTQSASPSDATAAGGLTDGFHLVADALKANDVATIYGIVGIPIT
FT                   DLARTVQARGIRYIGFRHEASAANAAAAAGFLTARPGVCLTTSGPGFLNALPALANATA
FT                   NCFPMIQISGSSQRAIVDLARGDYQEIDQLNAARPFAKAAYRINRVEDVGLGIARALRT
FT                   AISGRPGGVYLDVPGEVLGQAMDATAAAATVWRLVDPAPRQLPAPEAVDRALTILSQAQ
FT                   RPLIVLGKGAAYAQADNAIRDFIETTGIPFLPMSMAKGLLPDSHPCSAGAARSLAIARA
FT                   DAVLLIGARLNWLLGHGESPQWSADAKFIQVDIAASEFDSNRPIAAPLTGDIGSVMAAL
FT                   SDGLARHPIATRAPWTTELAERKARNEAKMLQRLAEDPHPMRFYNALGAIRTVLHDNPD
FT                   VYVVNEGANALDLARNVIDMQLPRHRIDTGTWGVMGIGMGYSIAAAVETGRPVVAIEGD
FT                   SAFGFSGMEVETICRYQLPVTVVILNNGGVYRGDEATKAQATDASPNDPAPTVLSAHAR
FT                   HELIAEAFGGKGYHVTTPTELRSALTAALASNGPTVIDCELDPAAGVESGHLASLNPSS
FT                   AATPARVSAGG"
FT   gene            368378..370012
FT                   /gene="fadD7"
FT                   /locus_tag="MMAR_0319"
FT   CDS_pept        368378..370012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD7"
FT                   /locus_tag="MMAR_0319"
FT                   /product="fatty-acid-CoA ligase FadD7"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38786"
FT                   /db_xref="GOA:B2HLN7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN7"
FT                   /protein_id="ACC38786.1"
FT                   /translation="MASDSITGGQAVPAHVGTQPCDSAAGPRLADLVELAAARLPEATA
FT                   VIFTADRVAVSYRDLVRLVDDLAGQLTRAGLRPGERVALRSGSNLEFVVALLAASRANL
FT                   IVVPLDPALPVADQRARAGAAGARVVLIDGTGPGDRDEPAVRWWPIAVSVARDTGILSV
FT                   HLDAAGEPTAVASAPQGLRADDAMIMFTGGTTGLPKMVPWTRANIATSIRSIIAGYRLS
FT                   PQDATVAVMPLYHGHGLMAALLSTLVSGGTVLLPARGKFSAHTFWDDIHVAHATWYTAV
FT                   PTIHQILLERAKTEREADSSGRTRAALRFIRSCSAPLTPETAQALHDEFSAPVLCAFGM
FT                   TEATHQVASTGVEGSGCDENPAESTGLVGRSTGPEIRIVGPDGHPVGPGAVGEVWLHGP
FT                   TVVRGYLGDPKITAANFTDGWLRTGDLGTLSQAGDLSIRGRIKELINRGGEKISPERVE
FT                   GVLASHPGVLENAVFGVPDALYGEAVAAVIVPREPAPTAQELTEFCREKLASFEIPATF
FT                   QMASELPHTAKGSLDRRAVAQQFGGQA"
FT   gene            complement(370009..370485)
FT                   /locus_tag="MMAR_0320"
FT   CDS_pept        complement(370009..370485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0320"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38787"
FT                   /db_xref="GOA:B2HLN8"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN8"
FT                   /protein_id="ACC38787.1"
FT                   /translation="MSTINGLPAHILLNHLVVVLGPLTAILAIVCALWTPARQRFVWLT
FT                   LLLAVITLIATPITADAGAWLQARLGPSPLVEKHQELGETLTYFMAVQALAVALLVVMH
FT                   VRRERGRAVNTATHLTITALVIVAAAATLVATYRVGDSGAQAAWGSIASAPGPY"
FT   gene            complement(370501..372657)
FT                   /gene="fusA2"
FT                   /locus_tag="MMAR_0321"
FT   CDS_pept        complement(370501..372657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="MMAR_0321"
FT                   /product="elongation factor G FusA2"
FT                   /note="involved in translation mechanism. this protein may
FT                   promote the GTP-dependent translocation of the nascent
FT                   protein chain from the A-site to the P-site of the
FT                   ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38788"
FT                   /db_xref="GOA:B2HLN9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLN9"
FT                   /protein_id="ACC38788.1"
FT                   /translation="MADRAGSSSGSGTAPTAEGPDAIRNVVLVGPSGGGKTTLVEALLV
FT                   SAGVLSRPGSVTDGTTVCDFDEAEIRQQRSVGLAVAALSHQGIKVNLVDTPGYADFVGE
FT                   LRAGLRAADCALFVIAANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYAEALAA
FT                   AQIAFGDKVLPLYLPTSDGLIGLLSQTQYAYANGTRCETAPGASDADRIEEARGSLIEG
FT                   IIEESEDESLMERYLGGEQIDESILIEDLEKAVARGSFFPVIPVCASTGVGTLELLEVA
FT                   TRGFPSPREHPLPEVFTPQGATHADLACDVDSPLLAEVVKTTSDPYVGRVSLVRVFAGT
FT                   IKPDATVHVSGHFSSFFGSANGNGAAASTHPDHDEDERIGVLSFPLGKQQRPATKVVAG
FT                   DICAIGRLSRAETGDTLSDKSEPLVLKPWTMPEPLLPMAIEAHAKTDEDKLAVGLSRLA
FT                   AEDPTLRIEQNQETHQIVLWCMGEAHAGVVLDALANRYGVTVDTVELRVPLRETFSGNA
FT                   KGHGRHVKQSGGHGQYGVCDIEVEPLPEGSGFEFLDKVVGGAVPRQFIPSVEKGVRAQM
FT                   DKGVHAGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGSLALREAAAATRVTLLEPIDEIA
FT                   VLVPDDYVGTIMGDLSGRRGRVLGTDTVGHERTVVKAEVPQVELTRYAIDLRSLAHGAA
FT                   SFTRSFARYEPMPESAAARVKTHA"
FT   gene            complement(372828..373229)
FT                   /locus_tag="MMAR_0322"
FT   CDS_pept        complement(372828..373229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38789"
FT                   /db_xref="GOA:B2HLP0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP0"
FT                   /protein_id="ACC38789.1"
FT                   /translation="MFDPAVRFTQSPVARLATVTPEGIPHVVPVVFAVDNDLIFTAVDA
FT                   KPKSTRRLRRLTNIERTPQVSLLVDHYDDDWTQLWWVRADGVAQIHPAGAVLHTGYRLL
FT                   RAKYAQYQSVLLDGPVICVAVRRWSSWHA"
FT   gene            373300..373800
FT                   /locus_tag="MMAR_0323"
FT   CDS_pept        373300..373800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0323"
FT                   /product="dioxygenase beta subunit"
FT                   /note="maybe involved in oxidization of aromatic
FT                   hydrocarbons"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38790"
FT                   /db_xref="GOA:B2HLP1"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP1"
FT                   /protein_id="ACC38790.1"
FT                   /translation="MRAETQIANLLYRYAECIDAGDLPAAAALFEHARIRIAADGDQDG
FT                   GQDTVDAAGLLKIWEALIIVYPNGTPRTKHVVSNPIIEIDPQCGIARCRSYYTVFQQVD
FT                   DFPLQPIVTGRYHDRFACVDGKWRFSYRDLTLIDMVGDVSHHLRYALEPGPSTSANNRR
FT                   SGP"
FT   gene            373913..374986
FT                   /gene="pepA"
FT                   /locus_tag="MMAR_0324"
FT   CDS_pept        373913..374986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="MMAR_0324"
FT                   /product="serine protease PepA"
FT                   /note="function unknown, possibly hydrolyzes peptides
FT                   and/or proteins (seems to cleave preferentially after
FT                   serine residues)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38791"
FT                   /db_xref="GOA:B2HLP2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP2"
FT                   /protein_id="ACC38791.1"
FT                   /translation="MSKLRHHSPRWSWLVAVLAVLGLGLATVPAPALAAPSNLALDRFA
FT                   DFPTLPLDPSAMVAQVGPQVVNVNTKLGYNNAVGAGTGIIIDPAGVVLTNNHVISGATD
FT                   ISVFSVGDGRTYGVDVVGYDRTRDVAVLQMRGAGGLPAAAIGGGVSVGEPIVAMGNTGG
FT                   QGGTPRAVPGRVVALDQTVEASDALTGAEETLNGLIQVDAAIAPGDSGGPIVNNMGQVV
FT                   GMNTAASDNFQMSGGGTGFAIPIGQAMGIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNG
FT                   TGAKVARVVGSAPAAVVGISTGDIITALGGAPINSATAMSDALNGHHPGDIVSISWTSN
FT                   SGGQRTENVTLAEGPPA"
FT   gene            375105..376892
FT                   /gene="treS"
FT                   /locus_tag="MMAR_0325"
FT   CDS_pept        375105..376892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="MMAR_0325"
FT                   /product="trehalose synthase TreS"
FT                   /note="involved in trehalose biosynthesis (protective
FT                   effect). converts maltose to trehalose. mycobacteria can
FT                   produce trehalose from glucose 6-phosphate and UDP-glucose
FT                   (the OtsA-OtsB pathway) from glycogen-like alpha(1-->4)-
FT                   linked glucose polymers (the TreY-TreZ pathway) and from
FT                   maltose (the TreS pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38792"
FT                   /db_xref="GOA:B2HLP3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP3"
FT                   /protein_id="ACC38792.1"
FT                   /translation="MMNEATNTIEHNPAEGSHVEGGVVEHPDAKDFGNAAALPADPTWF
FT                   KHAVFYEVLVRAFYDGTADGSGDLRGLMQRLDYLQWLGIDCIWLPPFYDSPLRDGGYDI
FT                   RDFYKVLPEFGTVGDFVALVDAAHRRGIRVITDLVMNHTSESHPWFQESRHDPDGPYGD
FT                   YYVWSDSSEKYTDARIIFVDTEESNWTFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMI
FT                   DVLRFWLGLGIDGFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAE
FT                   ANQWPADVVEYFGEASTGGDECHMAFHFPLMPRIFMAVRRESRFPISEILAKTPPIPDM
FT                   AQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLENDRNQIQL
FT                   FNALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRTPMQWTPDRNAGFSTANPGRLYLP
FT                   PSQDSVYGYQAVNVEAQRDTSTSLLNWTRTMLAVRRRHNAFAVGTFQELGGSNPSILAY
FT                   VREAPGPAGEDGDVVLCVNNLSRFPQPIELNLQQWNSYTPVELTGQVEFPKIGHLPYLL
FT                   TLPGHGFYWFQLSASEEER"
FT   gene            376966..378333
FT                   /locus_tag="MMAR_0326"
FT   CDS_pept        376966..378333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0326"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38793"
FT                   /db_xref="GOA:B2HLP4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HLP4"
FT                   /protein_id="ACC38793.1"
FT                   /translation="MNSPATLAAKLPWSEWLPQQRWYAGRNRELAAAEPGAVVALRDDL
FT                   DLVLVDVSYTDGSAERYQVLVRWDAGPVSEFSTLATIGSADDHTGFDALYDPVAPQVLL
FT                   SLIDSSAVRSSSDGQVSFAREPDVELPLDAYPRVSDAEQSNTSVIFDRGQAAILKVFRR
FT                   VSSGINPDIELNRVLGRAHNPHVARLLGTYEIGIPGEPPEAACPLGMATAYAANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESRRLGEAVASVHATLAEQLGTAQATFPVDHV
FT                   LARLSSTAAAVPELQQYAGTIEERFVKLVDETISVQRVHGDLHLGQVLRTPESWVLIDF
FT                   EGEPGQPLRERRAPDSPLRDVAGVLRSFEYAAYGPLVDHADDKQLAARAREWITRNRTA
FT                   FCEGYAAASGNDPRDSELLLAAYELDKAVYEAGYESRHRPGWLPIPLRSIARLTAT"
FT   gene            378448..379128
FT                   /locus_tag="MMAR_0327"
FT   CDS_pept        378448..379128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0327"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38794"
FT                   /db_xref="GOA:B2HLP5"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP5"
FT                   /protein_id="ACC38794.1"
FT                   /translation="MRSDIFDSEARLSWVLAVLAGVLGATAFTHSAGYFVTFMTGNAQR
FT                   AVLGYFRDDVWLSVTAGLLLVCFLVGVVVASVCRRHFWVDHPHGPTVLTTFSLVAATAL
FT                   DIVIGGWEGSQLDFLPIMLVVFGVGSLNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHI
FT                   AGGQAADWLGYFMLLASFILGATVGGTISLVVSGTQMLAVASTVCALTTGFTYFHSDRR
FT                   ALLK"
FT   gene            complement(379208..380248)
FT                   /gene="fbpC"
FT                   /locus_tag="MMAR_0328"
FT   CDS_pept        complement(379208..380248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="MMAR_0328"
FT                   /product="secreted antigen 85-C FbpC"
FT                   /note="proteins of the antigen 85 complex are responsible
FT                   for the high affinity of mycobacteria to fibronectin.
FT                   possesses a mycolyltransferase activity required for the
FT                   biogenesis of trehalose dimycolate (cord factor), a
FT                   dominant structure necessary for maintaining cell wall
FT                   integrity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38795"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP6"
FT                   /protein_id="ACC38795.1"
FT                   /translation="MKFVEKLRGAAAGAPRRLTIAAIGAALLSGLVGAVGGAATAGAFS
FT                   RPGLPVEYLQIPSAAMGRDIKVQFQGGGAHSVYLLDGLRAQDDYNGWDINTPAFEEYYN
FT                   SGLSVVMPVGGQSSFYSDWYQPSQGNGQGYTYKWETFLTREMPAWLQANKGVSPTGNAA
FT                   VGLSMSGGSALVLAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWG
FT                   PSTDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNMPAKFLEGLTLRTNQTF
FT                   RDTYLASGGRNGVFNFPTNGTHSWPYWNQQLVAMKGDILKVLNGPAVPAAPAAPEAPAA
FT                   PVAPAA"
FT   gene            complement(380601..381098)
FT                   /locus_tag="MMAR_0329"
FT   CDS_pept        complement(380601..381098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0329"
FT                   /product="phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38796"
FT                   /db_xref="GOA:B2HLP7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP7"
FT                   /protein_id="ACC38796.1"
FT                   /translation="MKLLLIADTHVPKRARDLPDQVWKQVARADVVIHAGDWVTVELLD
FT                   ELQSRAARLVACWGNNDGPDLRSRLPERADVVLAGLRFTVVHETGAAGGREARMSRLYP
FT                   DSDVLVFGHSHIPWDTTTSTGLRLLNPGSPTDRRRAPHCTYMTATIESGALAGVTLHNI
FT                   EK"
FT   gene            381135..381590
FT                   /locus_tag="MMAR_0330"
FT   CDS_pept        381135..381590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0330"
FT                   /product="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38797"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP8"
FT                   /protein_id="ACC38797.1"
FT                   /translation="MRTFESVADLAAAAGETIGQSDWVTITQEDVNLFADATGDHQWIH
FT                   VDPERAAKGPFGTTIAHGFMTLSLLPRLQHEMYTVKGIKLAINYGLNKVRFPAPVPVGS
FT                   RVRAQSSLVGVEDVGNGAVQATVATTVEVEGSGKPACVAESVVRYVT"
FT   gene            complement(381671..382966)
FT                   /gene="fadE1"
FT                   /locus_tag="MMAR_0331"
FT   CDS_pept        complement(381671..382966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="MMAR_0331"
FT                   /product="acyl-CoA dehydrogenase FadE1"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38798"
FT                   /db_xref="GOA:B2HLP9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLP9"
FT                   /protein_id="ACC38798.1"
FT                   /translation="MWDFETDPEYQAKLDWVQEFMVNELEPLDLVALDPYDKKNPEMMA
FT                   VLRPLQQQVKDQGLWAAHLRPELGGQGFGQVKLALLNEILGRSRWAPSVFGCQAPDSGN
FT                   AEILALFGTEDQKARYLQPLLDGEITSCYSMTEPQGGSDPGSFVTAATRDGDSWIINGE
FT                   KWFSTNAKHASFFIVMAVTNPQARTYEKMSLFIVPAETPGIEIVRNVGVGTESSKHASH
FT                   GYVRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIALARRAFDMMCERAVSR
FT                   QTRHGRLSDLQMTQEKVADSWIQIEQFRLLVLRTAWLIDKHHDYQKVRRDIAAVKVAMP
FT                   QVLHDVVQRAMHLHGALGVSDEMPFVKMMVAAESLGIADGATELHKMTVARRTLRQYEP
FT                   VTTPFPSQHIPTRRAAAEARLAERLEHSIAEF"
FT   gene            383128..383733
FT                   /locus_tag="MMAR_0332"
FT   CDS_pept        383128..383733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0332"
FT                   /product="acetyltransferase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38799"
FT                   /db_xref="GOA:B2HLQ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ0"
FT                   /protein_id="ACC38799.1"
FT                   /translation="MTPQARPAQKADIRELSRTMARAFYDDPVMTWLFPGDRARTTQLC
FT                   RLFAAMTRHHHLARGGVEVACDGPVIGAAALWDPPNQWRETRLGELAMTPALLRVFGFR
FT                   TGVGRAVQSAMKRAHPEEPHWYLAAIGSDPTVRGQGFGQALLRSRLDRCDAEYCPAYLE
FT                   SSKPENVPYYQRFGFTVTGEIALPHGGPSIWPMWRDPR"
FT   gene            complement(383770..385800)
FT                   /locus_tag="MMAR_0333"
FT   CDS_pept        complement(383770..385800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0333"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38800"
FT                   /db_xref="GOA:B2HLQ1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ1"
FT                   /protein_id="ACC38800.1"
FT                   /translation="MALAATRKLVRDPQLRRLMAVCATFLTSNSAHGVLLTVFAFSVGG
FT                   AATVGVVTLVRMLPSALLAPLAATLATSPRPQVHLAIGVGARGMTTIATVIVVVSGAPL
FT                   GVVLVVLGVDSLMSAAVRSLHAALVVRLATSVAEAATANAATGVLLYASALAGPALAGV
FT                   MLAFVGVGWALTLPAALFVVGALTALRITVAPIDDMPDTGGARPSGGVARVQLRAVGAG
FT                   FRAIIESRPAAAAATLFLLTTTLLDGFWYVASAPLAADQFGLGPSGVTTIMTIYGVGGL
FT                   LGAVAMLSIAGRGGLARMFTLARLSEALLLAAIGAASLPALGLVLAAGVGGGSAASWAI
FT                   APTLVQRSVNRASMVTAAASLQSVSQLAIAAGAGIAAVLVGSLGLTGALAIVSGAAALI
FT                   TVLAWPQVRRADKLSDDDSAKLAVIRATPVLAPLPALALEQLARTATRMAVPAGSDVIR
FT                   QGDRGDRFYMIASGLADATVNGRRVATLGPGGSFGEIALLHDVARSATVTARKDLDLVA
FT                   VDRAEFLAALSSNTAAGLRLGGLARTRLGTVPVEERLIELGPDPALNSQSLSELLAAQP
FT                   ALAGIGDGALRELADTAKVLAAPDGALITCEGDHGDTYYVILEGAAQVLDDGTAVHHLG
FT                   PGEGFGEQAILRDVPRTATVRAVGDTTLVAVDREAFQRARR"
FT   gene            complement(385931..386599)
FT                   /locus_tag="MMAR_0334"
FT   CDS_pept        complement(385931..386599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0334"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38801"
FT                   /db_xref="GOA:B2HLQ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ2"
FT                   /protein_id="ACC38801.1"
FT                   /translation="MNERTPSSRPHRSGRSRDSPSREERKEATRRAIIAAALKLVHDRS
FT                   FSALSLREVTREAGIVPAAFYRHFESMEALGLVLIDESFRTLRDTLRGARAGRLDPNRV
FT                   IESSVEILIGSVAERREHWRFIVRERSTGLSVLRYAIRTEIRLITSELATDLARFPGLN
FT                   EWSTEDLNILATLFVNAMIVTAEAIEDAQSSEALEEIRRIAVKQLRMVAIGVAGWKSRP
FT                   "
FT   gene            386670..387767
FT                   /locus_tag="MMAR_0335"
FT   CDS_pept        386670..387767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0335"
FT                   /product="flavodoxin oxidoreductase"
FT                   /note="function unknown, contains flavodoxin reductases
FT                   (ferredoxin-NADPH reductases) family 1 domain. [energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38802"
FT                   /db_xref="GOA:B2HLQ3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ3"
FT                   /protein_id="ACC38802.1"
FT                   /translation="MFTQTLTQTLAKRVLGSGLVDLLTGPHGIDRYTELVEPTWTLGEA
FT                   RAKLIDVRRTTPRSVTLTLAPNDTFRSAMAAGTGPMAGQYVNLTVDIDGRRHTRCYSPA
FT                   NAEGSETLELTIGRHDGGLVSTYLCDHARRGMVVGLAGVGGDFVLPQRRPRRILFVSGG
FT                   SGITPVLAMLRTLVAQHHLHIHGAEIAFIHYARNPAEACYRAELAALPGVRVLHGYTQS
FT                   GGGDLVGRFGPDHLAAAMDAPDAVFVCGPTTLVDAVRENCENVFTESFVPAPIEAPAQP
FT                   SGGRVRFADSGIDVVDDGRSLLEQAESAGLAPENGCRMGICHTCTRRKTSGTVRNLVTG
FT                   AVSVAPDEDVQVCVSVPVGDVDLSL"
FT   gene            387803..388936
FT                   /gene="desA3_2"
FT                   /locus_tag="MMAR_0336"
FT   CDS_pept        387803..388936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desA3_2"
FT                   /locus_tag="MMAR_0336"
FT                   /product="linoleoyl-CoA desaturase, DesA3_2"
FT                   /note="thought to be involved in lipid metabolism
FT                   [catalytic activity: linoleoyl-CoA + ah(2) + O(2) = gamma-
FT                   linolenoyl-CoA + a + 2 H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38803"
FT                   /db_xref="GOA:B2HLQ4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ4"
FT                   /protein_id="ACC38803.1"
FT                   /translation="MGNNNIATIAETADTATRANFALTPEQAEAFGRELDAIKERVIAD
FT                   LGEADADYIRRVIKAQRALEVGGRALLFAGILPPAWLAGTAMLGLSKILDNMEIGHNVM
FT                   HGQYDWMRDPAISGRSFEWDTACPADQWRHSHNYMHHTHTNIVGMDRDIGYGIIRMSED
FT                   QPWQPYYLGNPVYAFLLMVLFQYGVALHELETERIRSGEITLRDKRETLMEIWKKTRRQ
FT                   TLKDYVAFPLLAGPFAPFVFAGNLTANLMRNVWSYMIIFCGHFPDGTQEFSVEETQNES
FT                   RGQWYFRQVLGSANLTGGKTFHLLSGNLSHQIEHHLFPDIPARRYAEIAPEVQEICERY
FT                   GIPYNRGPLLRQFGTVVRKIVKLAFRGSDRQEAHALA"
FT   gene            389206..389730
FT                   /locus_tag="MMAR_0337"
FT   CDS_pept        389206..389730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38804"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ5"
FT                   /protein_id="ACC38804.1"
FT                   /translation="MGSVEWTGARYADRPTVEASTWIDAEPERVWSLISDIALMPTLSN
FT                   ELQAVEWVGGVSEPRVGARFIGHNQHEAFGQWTSTSQVVRCDPPREFAWAVGEPDYPAA
FT                   VWRFRLVPRDGGTNLTYRTQIGPGRSGLSNAIDAMPDKEEKIVFVRLREFEAAIDKTLA
FT                   AIKRLAEHGVR"
FT   gene            389730..390788
FT                   /locus_tag="MMAR_0338"
FT   CDS_pept        389730..390788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0338"
FT                   /product="coenzyme F420-dependent oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38805"
FT                   /db_xref="GOA:B2HLQ6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ6"
FT                   /protein_id="ACC38805.1"
FT                   /translation="MRTATTVELSGGKDSKDGKDVVDFVVEAEKLGLHTCWVAEAWGSD
FT                   APSALGYIAARTERMQLGSGVLQVGTRSPVLVAQTAITLSNLSCGRFLLGLGASGPQVI
FT                   EGLHGVAFDRPLARLKETVEIVRQVFAGGKVTYSGSEFQIPRRGGEARPMRLSTRPEYD
FT                   IPIYLAALSPAMLRLTGRIADGWLGTSFVPEGAGDAYFTHLDAGLAAAGRSRADIDFCQ
FT                   GAEVAFASGVEELRDMVAARKTELAFSLGGMGSASTNYYNQAYSRQGWSEVAAAVRERW
FT                   QRGDREGAARLVTDEMVLATTLIGTEEMVRSRLVAWRDAGVNTVRLYPAGDTMDAKLST
FT                   LGRAIELVRAVR"
FT   gene            complement(390790..391902)
FT                   /locus_tag="MMAR_0339"
FT   CDS_pept        complement(390790..391902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38806"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ7"
FT                   /protein_id="ACC38806.1"
FT                   /translation="MTYESTTAWQELLDTLRTLDSSFLEGERAVTDDRHVADGYRMLAT
FT                   TLGVAFDAYLFPEPGRPQFVAVNTPFRRDRRWGGDNTDAYYFMCPVDPDRRYRISGNKG
FT                   DSVYFSVTAYNEPAPGAWSDRIVAIVRDSDLDVDADGNFSFELGPTPDAAVLMTRDYQA
FT                   NPLTGRPITWHIEALDEPDPIRHADPQTAAGLRSVATWLRTMFAIMPLPVGTRDQDLPD
FT                   EHALGHNTAHAANQFADPYQVPDANFGWSARDACYCYGSFVLDDDEALVITHRPPSCRF
FT                   WNLVVWNQFMATCGAADARCSVNGHSAIANSDGSVTVVLSRGVTTHPNSLTTLDYPRGN
FT                   LAFRWFLADGVPARPEVKLVKLADAPTEVA"
FT   gene            complement(391899..392498)
FT                   /locus_tag="MMAR_0340"
FT   CDS_pept        complement(391899..392498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0340"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38807"
FT                   /db_xref="GOA:B2HLQ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ8"
FT                   /protein_id="ACC38807.1"
FT                   /translation="MVADFGRPRDPRIDGAVLRATVELLAETGYAGLLVSAIAKRAGTS
FT                   KPAIYRRWPSKAHLVHEAVFPIDAATAVPDTGSPVDDLREMVRRTTAVLSTPAAKAALP
FT                   GLIGEMAADPTLHSALLVRFGEIFGHGLTTWLDNAAARGQVRADVTAPELAEAIAGIVL
FT                   IGLLTRPGELEPGVGDAWIDRTTTLLLKGIRKGTPQ"
FT   gene            392605..393768
FT                   /locus_tag="MMAR_0341"
FT   CDS_pept        392605..393768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38808"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLQ9"
FT                   /protein_id="ACC38808.1"
FT                   /translation="MMAALAPDCSLDSDALHAKASADTGLHDFGDDDYRERLDVYLAAL
FT                   AEIDGMQPAGVVNFYGQLLQLLKNRLLLSELRHRHPEIDDIELQPPVVIAGLPRTGTTH
FT                   LHNMLAAPTTFRTMPYWESVEPFPLPQEAGVEPDPRLVRMDVAVGVINTVMPHFALMHE
FT                   MTADHVHEEIQLLANDFSTMLFETLGHVPRWRDYYETHDQTPHYQYLATQLKAMQFLRG
FT                   GRRWLLKSPQHLEQVPVLDRVFPGSIVLFTHRDPVPVALSMLAMITYSARMHRWPVPVE
FT                   QIAHYWVDRLDRMLATLVRDRDTIGPERSIDIRFDDFMADEVGVAERIYALAGEPFTDS
FT                   VRTATAGYLAGHQRGRLGAVQTSCEMFGLTEESLRERFAPYLKRFLG"
FT   gene            393807..394697
FT                   /gene="ephF"
FT                   /locus_tag="MMAR_0342"
FT   CDS_pept        393807..394697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ephF"
FT                   /locus_tag="MMAR_0342"
FT                   /product="epoxide hydrolase EphF"
FT                   /note="thought to be involved in detoxification reactions
FT                   following oxidative damage to lipids [catalytic activity:
FT                   an epoxide + H(2)O = a glycol]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38809"
FT                   /db_xref="GOA:B2HLR0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR0"
FT                   /protein_id="ACC38809.1"
FT                   /translation="MSTLPALDGVEHRFVDLDGGITIHVADAGPADGPAVMLVHGFPEN
FT                   WWEWHELIGPLAADGYRVLCPDLRGAGWSSAPRSRYTKKEMADDLAGVLDRLGIASVRL
FT                   VAHDWGGPVAFIMMLRYPAKVTGFFGMNTAAPWFPRDLGMVRDIWRFWYQIPIMLPVIG
FT                   PRVIADPKARYFRVLTSWVGGGFTIADEDVRMYVERMRQPGHAVAGSRWYRTFQSSEAL
FT                   PWMRGEYADARVDVPVRWLHGTEDPVLTPQLLRGYEDHISDFEVEFVDGVGHWIVEQRP
FT                   DLVLDRLRAFLRIET"
FT   gene            complement(394761..395804)
FT                   /locus_tag="MMAR_0343"
FT   CDS_pept        complement(394761..395804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0343"
FT                   /product="zinc-dependent alcohol dehydrogenase"
FT                   /note="oxido-reduction"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38810"
FT                   /db_xref="GOA:B2HLR1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR1"
FT                   /protein_id="ACC38810.1"
FT                   /translation="MAATMRAERFYADSKTVVLEDVPIPEPGPGEVLVKVAYCGICHSD
FT                   LSLINGTFPTQAPVVTQGHEASGTIAKLGPEVDGWSEGDRVVVAAGRPCQSCPNCRRGD
FT                   TVNCLRIQLMAFAYDGAWAEYTVAQAAGLTRVPDNVSLDQAAILADAVSTPFGAVVRTG
FT                   KVAVGESVGVWGVGGVGTHIVQLARLVGAVPVIALDINPVVLDRALELGADYAFDSRDD
FT                   QLHDKLAEITGGRMLDVAFDAVGLKATFEQALGSLTAGGRLVGVGMSAESPTVGPTSMF
FT                   GLTHKQVLGHLGYQNVDIETLAKLVSLGRLDLSRSISEIVPLEDLPLGIEKLERQDGNP
FT                   IRILVQP"
FT   gene            complement(395811..396023)
FT                   /locus_tag="MMAR_0344"
FT   CDS_pept        complement(395811..396023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0344"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38811"
FT                   /db_xref="GOA:B2HLR2"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR2"
FT                   /protein_id="ACC38811.1"
FT                   /translation="MRLSTRNQLKGTIIEVDLGAVMAVVKVRLDGGDQVITSSVTKDAA
FT                   TDLGLAVGQPATVFIKSTEVTIGVE"
FT   gene            complement(396069..396674)
FT                   /locus_tag="MMAR_0345"
FT   CDS_pept        complement(396069..396674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0345"
FT                   /product="transcriptional regulatory protein"
FT                   /note="could be involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38812"
FT                   /db_xref="GOA:B2HLR3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR3"
FT                   /protein_id="ACC38812.1"
FT                   /translation="MTAAASSPAALDSDPFRQRLLEGLVASIGERGYHATTVADIVRHA
FT                   RTSKRTFYDRFESKEQCFLDLLRADNERLAKRIRAAVDPEADWQAQIRQAVEAYVSHIE
FT                   SRLAVTLSWIREFPSLGPISYPVQRHGMNLLTSLLVELSASPGFRRAGLPAVPGALAVI
FT                   LLGGLRELTALTVEDGRDIREIVEPAVDASIALVGPRH"
FT   gene            396804..398129
FT                   /gene="cyp138A3"
FT                   /locus_tag="MMAR_0346"
FT   CDS_pept        396804..398129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp138A3"
FT                   /locus_tag="MMAR_0346"
FT                   /product="cytochrome P450 138A3 Cyp138A3"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38813"
FT                   /db_xref="GOA:B2HLR4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR4"
FT                   /protein_id="ACC38813.1"
FT                   /translation="MNQAISDAPAVPAVKMAQATRIPKLLQGLAFATSRRRMMDWLSRR
FT                   NGDVFALNVPIYGHMVVVNDPQLAKQVFTASPEDLGNIQPNLSRMFGSGSVFGLDGDDH
FT                   RRRRRLLAPPFHGKSMKNYEIIIEQETLRETANWPEGQLFPTLPSMMRITLNAILRAVF
FT                   GADGAELDELRRIIPPWTTLGSRLASMPKPKRRYGRFSPWGRLAEYRRQYDVIIDRLID
FT                   QERSDPNFSDRTDVLALMLRSTYDDGSRMSRKDIGDELLALLAAGHETTASTLSWAFER
FT                   VTRHPELLAALVAEAEDAGGELRQATILEVQRARTVIDFAARHVYAPQYQLGQWMIPRG
FT                   QSILVNIAQMHANPDIFPDPQRFDPQRFIGGRPSTFGWIPFGGGTRRCVGAAFANMEMD
FT                   VVLRTVLRNFTIEPTTAAGERLFCRGVAYTPKNGGRIVVHRR"
FT   gene            complement(398166..398681)
FT                   /gene="msrA"
FT                   /locus_tag="MMAR_0347"
FT   CDS_pept        complement(398166..398681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="MMAR_0347"
FT                   /product="peptide methionine sulfoxide reductase MsrA"
FT                   /note="has an important function as a repair enzyme for
FT                   proteins that have been inactivated by oxidation. catalyzes
FT                   the reversible oxidation-reduction of methionine sulfoxide
FT                   in proteins to methionine [catalytic activity: protein
FT                   L-methionine + oxidized thioredoxin = protein L- methionine
FT                   S-oxide + reduced thioredoxin]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38814"
FT                   /db_xref="GOA:B2HLR5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HLR5"
FT                   /protein_id="ACC38814.1"
FT                   /translation="MTSPQKAILAGGCFWGMQDLIRKQPGVIATRVGYSGGDVANATYR
FT                   NHGTHAEAVEIIFDPQATDYRTLLEFFFQIHDPTTPNRQGNDRGTSYRSAIYYLDDEQK
FT                   RVALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPSGYTCHFIRPGWKL
FT                   PRRATAGQ"
FT   gene            398841..399347
FT                   /locus_tag="MMAR_0348"
FT   CDS_pept        398841..399347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38815"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR6"
FT                   /protein_id="ACC38815.1"
FT                   /translation="MNGPEFSRSELAAAFEKFEDTVARAAASRDWDAWVQHYTPDVEYI
FT                   EHAAGTMHGREQVRAWIWQTMTTFPGSHMVAFPSLWSVIDESTGRIILELDNPMRDPGD
FT                   GSVISATNISIITYAGDGQWCRQEDIYNPLRFLRAGLKWCRKAAELGTIDEAAANWMQQ
FT                   YGGSQ"
FT   gene            399344..400366
FT                   /locus_tag="MMAR_0349"
FT   CDS_pept        399344..400366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0349"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38816"
FT                   /db_xref="GOA:B2HLR7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR7"
FT                   /protein_id="ACC38816.1"
FT                   /translation="MSVGPKLVIGANGFLGSHVTRMLIEDGAQVRVMVRPTANTRSIDD
FT                   LPVTRFHGDIFDTAVVREAMQGCDDVYYCVVDARAWLRDPAPLFHTNVEGLRNVLDVAK
FT                   NAGLRRFVFTSSYATVDRRHGHVATEEDRIGSRRVSSYVQSRVQAEDLVMDYVAQHGLP
FT                   AVAMCVSTTYGSGDWGRTPHGAFIAGAVFGKLPFLMNGIKLEVVGVDDAARAMILAAER
FT                   GRSGQRYLISERMIALKEVVRIAADEAGVAPPQRTISVPTLYALGALGSLRARLTGKDA
FT                   ELSLESVRMMRAEAEVDHAKAVRELGWQPRPVEESIREAARFWASMRKNTQGARTGQSE
FT                   "
FT   gene            400476..400856
FT                   /locus_tag="MMAR_0350"
FT   CDS_pept        400476..400856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0350"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38817"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR8"
FT                   /protein_id="ACC38817.1"
FT                   /translation="MSHRKVLEPSAGHPITIEPTKGRVQVRVNGELIADTAAALELREA
FT                   TLPAVQYIPRADVVADRLTSTDTSSYCPFKGDASYYSVTTSTGDTVADVIWTYEQPYPA
FT                   VAEIAGHVAFYPNKAEISVIPD"
FT   gene            complement(400843..401244)
FT                   /locus_tag="MMAR_0351"
FT   CDS_pept        complement(400843..401244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38818"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLR9"
FT                   /protein_id="ACC38818.1"
FT                   /translation="MTPFDDPQAELAWMFLQSMCEGGDLDEGFALLSDDFTYWSIITRS
FT                   AFEKDALRRAVEQRKKVFEINIDLRRCVNEGETVVIEGQSEGMTATGVRYDSPFVCIFE
FT                   TKDGLIVSLREYSDTQSFAAVFPAGANPV"
FT   gene            401317..402228
FT                   /locus_tag="MMAR_0352"
FT   CDS_pept        401317..402228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0352"
FT                   /product="DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38819"
FT                   /db_xref="GOA:B2HLS0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS0"
FT                   /protein_id="ACC38819.1"
FT                   /translation="MKIERTVTFAGAAGFGHTLAPLRRGRGDPCFRVPGDGTIWRTSLL
FT                   GSGPVAARFSRCAPDTAHCQAWGSGAEEFIDRLPALLGADDDAADFVPRDPTVAAAHRR
FT                   LPNLRLGRTGQVLEAVLPAVIEQRVPGAEAFRSWRLLVTRYGTPAPGPAPDGMRVPPSA
FT                   DAWRAIPSWEFHRANVDPGRARTVVGCAQRASALQRLVTRPVGEALAALTSLPGVGVWT
FT                   AAETVQRAFGDADAVSVGDYHIPKMIGWTLLGHPVDDAGMLELLEPMRPHRHRVVRLLE
FT                   ASGLAREPRRGPRLPVQNIRSL"
FT   gene            complement(402310..403716)
FT                   /locus_tag="MMAR_0353"
FT   CDS_pept        complement(402310..403716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0353"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="function unknown; possibly ion channel involved in
FT                   transport of chloride across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38820"
FT                   /db_xref="GOA:B2HLS1"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS1"
FT                   /protein_id="ACC38820.1"
FT                   /translation="MSPAAAGGRFGASIRNAGYLQKWFLLGITIGGIAGLGAVVFYLAL
FT                   KYTGEFLLGYLADYHIPTPVGEGGSHGSSGFVRPWAIPLITTGGALLSAFIVARFAPEA
FT                   TGHGTDEAIEAVHTNPRSIRSRAVLVKMVASALTIGSGGSGGREGPTAQISAGFCSFLT
FT                   RRLGLSDEDGRTAVALGIGAGIGAIFAAPLGGAVLAASITYRDDFDYRSLLPGFITSGT
FT                   AYAVLGAFMGFDPLFGYIDAEYRFEKAWPLLWFVVIGVVAAAIGYLYARVFHASVGLAH
FT                   RLPGGPVIKPAVGGLLVGLMGLLIPQILSSGYGWAQLAADRNALMAIPLWIIIVLPVAK
FT                   ILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLGELTGLPGVPDAPGIFVVVAMMTCF
FT                   GSVSRAPLAVMIMVAEMTGSFSVVPGAILAVGIASLLMSRTNVTIYEAQRLNRETAEAE
FT                   RAARAADRGN"
FT   gene            403853..404839
FT                   /locus_tag="MMAR_0354"
FT   CDS_pept        403853..404839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0354"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38821"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS2"
FT                   /protein_id="ACC38821.1"
FT                   /translation="MPAVTADTLTLPRVRPPRPVDTERPVRSITSGPRGYEGEGFPVVR
FT                   AFAGVGMADLDPFVHMDQIGEVEYEPGEPRGTDWHPHRGFETVTYMIDGKLAHQDSHGG
FT                   GGLITDGATQWMTAGSGILHIETPPVDTVLRGGTFHGIQLWVNLPRKKKFTPPRYQAIE
FT                   GGDVELLASADGGALVRIIAGEIDGHRGPGITHTPITLAHATVHAGAQLNIPWQRDLNS
FT                   LVYVLAGRGAVGPAGHPIHQGQLAVMGAGDRISVVADSVSDKYRGTALELLILGGRPIR
FT                   EPVVHYGPFVMNSKAEVIEAFEDYQSGKFRSIPANALEPHRGGGTLE"
FT   gene            404839..405474
FT                   /locus_tag="MMAR_0355"
FT   CDS_pept        404839..405474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0355"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38822"
FT                   /db_xref="GOA:B2HLS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS3"
FT                   /protein_id="ACC38822.1"
FT                   /translation="MQLTASRGPGRPPAAKADDTRRRIVGAAREVFSERGYDGATFQAI
FT                   AVSADLTRPAINHYFASKQALYREVVVQTNELVVAAGVERARSVQTLLGQLCTFVMVAK
FT                   EADASHPATTAFLATAVLESQRHPELRRSDHDAVAATREFLDTAVRDAIQRGELEAGVD
FT                   ASQLAEALLLLLCGVGFYAGFVGSYRDMENILDTLCKMMAGTLWKPRS"
FT   gene            405619..406551
FT                   /locus_tag="MMAR_0356"
FT   CDS_pept        405619..406551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38823"
FT                   /db_xref="GOA:B2HLS4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HLS4"
FT                   /protein_id="ACC38823.1"
FT                   /translation="MTELDEVDSLRSDGDSWTVTESVGATALGVAAARAVETAGANPLI
FT                   RDEFAPILVSSAGPAWARLADPDIGWLDDDPHGQRLHRLGCDYQAVRTHFFDEYFAAAA
FT                   GAGIEQAVILAAGLDCRAYRLNWPPEAVVFEIDQPKVLEYKAQILESHGVTAAATRHGV
FT                   AVDLREDWPAALLRAGFDRDRPTAWLAEGLLPYLPGDAQDRLFEMITDLSAPRSRIAVE
FT                   SFTMNLTGNKQRWNRMRDRLGLDINVEALTYREPGRADAAEWLANHGWQVYSVSNREEM
FT                   ARLGRPVPEDLVDEAITTTLLRASLEISR"
FT   gene            406565..407506
FT                   /locus_tag="MMAR_0357"
FT   CDS_pept        406565..407506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0357"
FT                   /product="O-Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38824"
FT                   /db_xref="GOA:B2HLS5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HLS5"
FT                   /protein_id="ACC38824.1"
FT                   /translation="MSTMRTHDDTWDIRTSVGATAVMVAAARAVETSKPEPLIRDPYAR
FT                   MLVTNANAGVIWEAMLDQEMVAKVEAIDAETAATVEHMRSYQAVRTNFFDTYFADAVAA
FT                   GIRQVVILASGLDSRAYRLDWPAGTTVYEIDQPQVLAYKSATLAENGVTPAAERREVAI
FT                   DLRQDWPSALRAAGFDPSARTAWLAEGLLMYLPAEAQDRLFTQIGELSCAGSRIAAETA
FT                   GNHADERREQMRERFRKVAQTLGLEQTIDVHELIYHDPDRALLGQWLNEHGWRANAQNA
FT                   CDEMHRVGRWVEGVPMADDKQAYSEFVTAERL"
FT   gene            407506..408441
FT                   /locus_tag="MMAR_0358"
FT   CDS_pept        407506..408441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0358"
FT                   /product="O-Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38825"
FT                   /db_xref="GOA:B2HLS6"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HLS6"
FT                   /protein_id="ACC38825.1"
FT                   /translation="MPRTADDSWDIATSVGATAVMVALARAAETASETPLIRDQFAEPL
FT                   VSTPELAAVREQVAAWWAQTDDDDDPDFTVDSQQMTDYLAVRTHFFDSYFIDAVAAGIR
FT                   QVVILAAGLDSRAYRLDWPGGTTVYEIDLPKVLDYKEHTLARHGAAPVAALRAVPVDLR
FT                   HDWPQALRDAGFQTSLPTAWLAEGLLPFLPAAAQHALFTAIDANSATGSRVAVEMFGVD
FT                   EDARRAAEERAQRWARQRAKRQARGQDTSFDPFDLWFDDEGQPDPADWFAAHGWTTDSV
FT                   QAGAEALRLGRTAHSQEGPFVNRFVTAGKP"
FT   gene            408591..410075
FT                   /locus_tag="MMAR_0359"
FT   CDS_pept        408591..410075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0359"
FT                   /product="aldehyde dehydrogenase (NAD+) dependent"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism [catalytic activity: an aldehyde + NAD+ + H2O =
FT                   an acid + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38826"
FT                   /db_xref="GOA:B2HLS7"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS7"
FT                   /protein_id="ACC38826.1"
FT                   /translation="MMTTESVAAKAQERGANGAGGVRAPSDDSKPTDVGATVARLRQTF
FT                   ASGRTRNVQWRKQQLLQLQRLMEENEDAITKALVEDLDRNPVEAFIADIATTIAEAKYA
FT                   AKKVRKWMRRKHVLLEAPQLPGRGWVQYEPYGTVLIIGAWNYPFYLTLGPAVGAIAAGN
FT                   TVVLKPSEIAEASSRLMAELVPRYLDRDAIAVIEGDGAVSQELIGQGLDRVMFTGGTEI
FT                   GRKVYEGAAPHLTPVTLELGGKSPVIVAADADIDVAAKRIAWIKLLNGGQTCVAPDYVL
FT                   ADATIRDELVGKIGAAVTKFRSQDDPDGLRIVNRRQFDRLSGYIAAAESEAKAGGKCKV
FT                   EVGGKCTAESLRIQPTVVVDPDPSGPVMTNEIFGPILPVLTVKSLDEAIGFVNSRPKPL
FT                   SAYLFTKSREIRERVINEVPAGGMMVNHLAFQVSTAKLPFGGVGASGMGAYHGKWGFDE
FT                   FSHRKSVLTKPTRPDLSNIIYPPYTERAFKLARRLF"
FT   gene            410148..411008
FT                   /locus_tag="MMAR_0360"
FT   CDS_pept        410148..411008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0360"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown, possibly involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38827"
FT                   /db_xref="GOA:B2HLS8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS8"
FT                   /protein_id="ACC38827.1"
FT                   /translation="MPGVQDRVVVVTGAGGGLGREYALTLAREGASVVVNDLGGARDGT
FT                   GAGSAMADQVVTEIREGGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILR
FT                   DGTFHKMTSENWDAVLKVHLYGGYNVVRAAWPHFREQSYGRVVVATSTSGLFGNFGQTN
FT                   YGAAKLGLVGLINTLALEGAKYNIHSNAVAPIAATRMTQDIMPPEVLEKLTPEFVAPVV
FT                   AYLCTEECADNGSVFIVGGGKVQRAALFQNDGANFQTPPSVQDIAAQWAQITDLSGAQK
FT                   AGFKL"
FT   gene            411013..411981
FT                   /locus_tag="MMAR_0361"
FT   CDS_pept        411013..411981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0361"
FT                   /product="quinone oxidoreductase"
FT                   /note="possibly binds NADP and acts through a one-electron
FT                   transfer process. quinones are supposed to be the best
FT                   substrates. may act in the detoxification of xenobiotics
FT                   [catalytic activity: NADPH + quinone = NADP+ +
FT                   semiquinone]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38828"
FT                   /db_xref="GOA:B2HLS9"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLS9"
FT                   /protein_id="ACC38828.1"
FT                   /translation="MKACVVQELSGPSGLVYTEVDDVSDGGGNVVIDVRAAGVCFPDLL
FT                   LTKGEYQLKLPPPFVPGLETAGVVRSAPARSGFRVGERVSAFGVLGGYAEQVAVPVSNV
FT                   VRSPAELDDAEAVSLLVNYNTMYFALARRAAMRPGETVLVLGGAGGVGTAAIQIAKAMG
FT                   AGQVIAVVHREGAIDYVASVGADVVLPLTEGWVDEVHKHTHGRGVDIVVDPIGGPVFDD
FT                   AIRALAIDGKLLAIGFAAGSIPTLAVNRLLRRNVGVLGVAWGEYLNRVPGSVYLFSWGL
FT                   NHLVSLGLRPPPPQRFPLSEAQAALQSLADGAVLGKIVLEP"
FT   gene            complement(412063..412443)
FT                   /locus_tag="MMAR_0362"
FT   CDS_pept        complement(412063..412443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0362"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38829"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT0"
FT                   /protein_id="ACC38829.1"
FT                   /translation="MCRRAGISVKKPTQDELVSIVAYLLGSAALTDQEAPAITALHFVG
FT                   AGMRILEIVAQETDDDFAQAKMKTIEQRIQQVLGDPAALSEYLHCIAKEFAKEVANRRQ
FT                   VAAGSGLPSDRATESPTEPPTS"
FT   gene            complement(412445..413020)
FT                   /locus_tag="MMAR_0363"
FT   CDS_pept        complement(412445..413020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0363"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38830"
FT                   /db_xref="GOA:B2HLT1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT1"
FT                   /protein_id="ACC38830.1"
FT                   /translation="MGTSADHDHRDLKLWDAFRKRRTHRDFEQTELSTEAIGALVEAAA
FT                   SAQTFRPGVRHIVVVTEPASVATLGDVVPGWVSNATAAIVLCTDVDKAAALAGSRAVDI
FT                   YAKLDAGAALAHITLAAVGLGVGICTVGSFTEGAVQAVLDIPDHIRPDVVIGIGIPIRN
FT                   PLPAPPRAAFQPGVHYNRFGKPTESTAP"
FT   gene            413350..413568
FT                   /locus_tag="MMAR_0364"
FT   CDS_pept        413350..413568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38831"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT2"
FT                   /protein_id="ACC38831.1"
FT                   /translation="MLHEIATIRLRLKSRLASTAHRGGIRPSKTGASVVQANVNFYRRA
FT                   GNIPIRAHLLDEGLVRRGTGRWPGRVL"
FT   gene            413629..416613
FT                   /gene="pknK_2"
FT                   /locus_tag="MMAR_0365"
FT   CDS_pept        413629..416613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknK_2"
FT                   /locus_tag="MMAR_0365"
FT                   /product="serine/threonine-protein kinase transcriptional
FT                   regulatory protein PknK_2"
FT                   /note="involved in signal transduction (via
FT                   phosphorylation). involved in transcriptional regulatory
FT                   mechanism and in the regulation of secondary metabolites
FT                   [catalytic activity: ATP + a protein = ADP + a
FT                   phosphoprotein]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38832"
FT                   /db_xref="GOA:B2HLT3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT3"
FT                   /protein_id="ACC38832.1"
FT                   /translation="MVSQLIGQLGADGFADAVEVGRGGFGVVYRARQVELDRVVAVKVL
FT                   TADLEQNRPRFEREQRAMARLTGHPNIVSVLQVGHTPGGYPYLVMPFCSRGSVQEVITE
FT                   CGGLAVSEVLRLGVAVAAGLESAHRLGIVHRDVKPANVLLTEFGDPALTDFGIAHMVGG
FT                   FHTASGVFSATPDFTAPEVLSGKEPDQASDVYGLGATLFCALTGQPPFARRDGEVLMAQ
FT                   LLRIATESAPDLRAYGVDDDLAVVIGAALAPEPTARPAMVEFGEALQELQATRGLAIDA
FT                   MALQGAKHTGKTAAARPVPPPRVRGNLPAPLSEFVGRAAELAALAELFSTARLVTLVGV
FT                   GGVGKTTLALRAARTRAADYPAGVWVIDIGELRDGALLPGLAAGALGIHDQGSRALPEV
FT                   MVDAIGEREMLLVFDNCEHVIDEAAALIDTLLRGCPRLQIVATSRELLSLDGEAVFAVS
FT                   PLRYPDTTTGTSRAALADYDAVALFVERAQAARPGFTLTEHNAGAIALICSRLDGVPLA
FT                   VELAAARVRAMSVQQIAARLSESFALLSRGYRGSPTHQQTLRCCIDWSYQRCSTAEQQL
FT                   WARLSVFAGSFDLDLAHHVCAPDTCPDDLLDQLCELVDKSILSRIDNNDDAEVRFRLLA
FT                   TLREYGASCLTAADHQLLRQRHLDGYRQLVAKAHAEWFSEHQVNWIRRMRRELPNVQEA
FT                   LQFGLTHAPDTALEMVADLRMLFIVSGKLKEGRRWLDRALSATPESSTKNRIRGLTTGV
FT                   GFAYFQMDWPAVTQWLAEARNLLELEPYPEMDGLLCGYDGFSTLLRGEIDQARVSAERG
FT                   LAITGDYDDYQVRIGCMWVMSFHSALVGDADQALHWAERAYALAESRHEVQMRTFTVSA
FT                   LVVGWLTRGDVEHADSALRKALELCRASDYPFAGAQCLEGMAWTSAANNNLRRAVVLMT
FT                   AAATISQITTGSSTTFFAVMGPFHADCERRARAELSETEFESARIQGESLTFDEAVAFA
FT                   LGHEW"
FT   gene            416727..419777
FT                   /gene="pknK_3"
FT                   /locus_tag="MMAR_0366"
FT   CDS_pept        416727..419777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknK_3"
FT                   /locus_tag="MMAR_0366"
FT                   /product="serine/threonine-protein kinase transcriptional
FT                   regulatory protein PknK_3"
FT                   /note="involved in signal transduction (via
FT                   phosphorylation). involved in transcriptional regulatory
FT                   mechanism and in the regulation of secondary metabolites
FT                   [catalytic activity: ATP + a protein = ADP + a
FT                   phosphoprotein]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38833"
FT                   /db_xref="GOA:B2HLT4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT4"
FT                   /protein_id="ACC38833.1"
FT                   /translation="MNRGQNRSQNHYTRQLASKTVRRKACGLINPLAEQLNVDGFADAA
FT                   EVGRGGFGVVYRCRQVDLDRVVAIKVLTIDLDENRPRFEREQRAMAKLTGHPNIVSVLQ
FT                   IGETRDGHPYLVMPYCRRGSVQTEISRLGRLSLADVLQLGVALAAGLESAHRLDILHRD
FT                   IKPANVLLTDFGEPALTDFGLAHMAGGFRTATGLFTASPAFTASELARGGEPDRASDVY
FT                   GVGATLFCALTGHPPFERRKGESVIAQILRVANDPVPDLAEYDVAEDVASVVNRALSRD
FT                   PAARPTMVELGEAIQSLQAAHGQAVDAMALEGGKRSTSVSSESAWHVSARQTRGNLPAK
FT                   LAGFVGRQAELAELGALISTSRLVTLTGVGGVGKTSLAVQAAGEHVSHFHDGVWLVDIG
FT                   ELSDGALLAGLAARMLGIRDQGARPLTEVLTDALAERDALVIFDGCEHVIDHAAQLIDT
FT                   LLQGCPQLHILATSRELLGIGGEAVLALSPLPYPDAASVSSRSSVARYDAVALFVERAR
FT                   TARPGFTLTQRNAAAVARICERLDGLPLAIELAAARLRAMSVEQIADRLSDRFGLLTRG
FT                   QRGAPTRQQTLSYCIDWSYDHCTPIQQQLWARLSVFAGSFDLDAAQYVAPQDMDADDLL
FT                   DELCALVDKSILIRTEDDGAVRFRLLSTMREYGNSRIDAEQYQGLQQSHFDWCERLVTQ
FT                   AHLEWFSQKQVDWIHRLRSELPNIEEALQFGLEKAPESVLLMAAKLRNLFVASGKLQVG
FT                   RLWVERALSTTTSAQPSGARIAALAALAMFAVLQTDWPTAQSCVAQAHEHGAAVPDPIA
FT                   ESLLGVARGLGALLQGQVEQVQTDAEQGLAAGDFELQVLGMWLMSLRHLAVGDPEPALR
FT                   WAEKAHSVSESRVEVQMRTYSLSALAVSHLMLGDTGSAERSLREGLKLCQVIDDPWSGA
FT                   SYLEGLAWTAGANGNLRRAVVLMAAAAALSRSSGAGSTVIALVGSMHQQCERAAREELS
FT                   DAVFEAARVEGESLSFDEAAAVALTEP"
FT   gene            complement(419959..420684)
FT                   /locus_tag="MMAR_0367"
FT   CDS_pept        complement(419959..420684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0367"
FT                   /product="thioesterase"
FT                   /note="function unknown; probably involved in lipid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38834"
FT                   /db_xref="GOA:B2HLT5"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT5"
FT                   /protein_id="ACC38834.1"
FT                   /translation="MPPALRVYCVPHAIGSASLYGEWSDRLPSWVRVVPLEYPGHGRRF
FT                   GQPPLTAIDEIARVFARELAADLDGPYALFGHSMGALVTFELARELRQQRAPLPVKLYA
FT                   AASRPPVVFWPPNRGQYLSALSDSALLSRLNSFGGTPSELLHNAELMDLMLPIARADLT
FT                   ACEEYLYRPAPPLSCPITALGGVGDVTFDQSELTRWGEMTSATFEVVAMPGGHFFVRTA
FT                   AALLSWLAEDFRRVLGFSR"
FT   gene            complement(420690..430259)
FT                   /locus_tag="MMAR_0368"
FT   CDS_pept        complement(420690..430259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0368"
FT                   /product="peptide synthetase Nrp (peptide synthase)"
FT                   /note="function unknown but contains 3 modules for the
FT                   potential synthesis of a tripeptide"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38835"
FT                   /db_xref="GOA:B2HLT6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT6"
FT                   /protein_id="ACC38835.1"
FT                   /translation="MTVRAETSVSDDGENPETGRVDGHQVGPTAPLDPQLAEFTDSVAH
FT                   FGHVSSTEPGDRVDLKALLPDVERTAGTDVGHAAALTVHHAALQAVLRHGHEELRRRYL
FT                   DQLLAGKTLAALAITEPEVSSSNPRMLASKATRDADGWVLDATKSCITAAGWAGLLVTV
FT                   VPFTVDEGTALTAVAVAADSPGVTIAPREDTIGLRSVPVCGIRFDGVRIEPWQILGEIG
FT                   GGLDVVGEGFLIGRICTGAISAGVMKRCAQVMYRFASRREVATGRLIADPVVVRRIGRI
FT                   TSEITAIEAVLADIAANPAVPQDVSLALKVASSEFAYRAADDAVQMLGWRGYVENHQVA
FT                   RLLRDARFLRIGEGPSEALLTELGARLAARSDTIYHWIDERTANADLISRLREAVDELV
FT                   VDESVNAFYHLGWLCVWAVLEAVAEPGSAAMAFIADAWHSERARAGASARLEEAFEQVL
FT                   PTYAEAVGTLDENLTSRAAVVDHLLAPVVDLGQRGEPIVGPDRPGWHHTVHGLVYGQID
FT                   RTPDAVALESTGLSITYAQLGEHADALAGRLAELGVLSGDVVGVFLSNSVHVAVAALAV
FT                   QRAAAVLLILNPAHPISRVAGMLADAAARCVIIDAETREILPSDAPELIEVDNIGEVAV
FT                   PPMSTDPDAPTYVNFTSGSTGRPKAVMGAHRAFANQLLWRRDEFDLGPDDAILQSASPG
FT                   FDIFLWELFGPLVAGARLVFMDAARREWNPSTIVEHVLQFEITVLQIVPSQLDVLLDEP
FT                   RLSECQSLRYVFCGGEPLSLATARRFAEILPHAQLVNLYGPTETAIDALYWRADITDQA
FT                   SWAPIGRPIANARLYIVDTEGDLAVEGQPGELWIGGAGVALGYLGAPALTTQRFRRDVR
FT                   APEQGLRVYRTGDRVRQRADGTVEFLGRLDRQLKVHGVRIEPGEIERALCGHPGVQHAV
FT                   VDVRERAPGQKALIGYVVAGTPNKILDPESVLDHVRDKLPTTMVPAALVLLDSLPRTPS
FT                   GKVDLAALPSASFDDAGPGAGPLPEDLIPLARVWEEILGTPVTNADANFFNIGGHSLAA
FT                   LRVIMRLRERMGVTLQMRDFVRAGSLTALAALIEEKRGQAEPIDDAAITGPVPIDRTKP
FT                   LPLSPVQANLWYLQQLVPTMAAYNIPEAVRIRGPVDAKRLRAAFAEVVACHEALRTVFP
FT                   AREGQPVQVILPPGPVQLEHADLTDLPADQREAAGQERIAKLAARPFDLFRDSPVRVLL
FT                   VTLADDDHYLAWVLHHIVADGWSAAGLLPAEMSKAYAALDAGERLPSLDVQPVDYVEWA
FT                   GRLLSTERRGELEDFWRDHLDGAPPEIELPRDFPRPALGSFRGGRVRIALTEADRQAVR
FT                   ALARQHSATPYSVLVAAFMVWIASYGRQRDMVVGAVTAGRNHPSVERTIGNFANMVALR
FT                   CQLGDDPTFEELVVRTRDEIRTVVDHAALSFPEVVNAVKPERVGSRNPVFQAAVTLYDG
FT                   DVTPLEVEGAHVHNLPVDPGSAKFDLLASFVDESATLSGFLEYDADLFRARTAQRLAAE
FT                   FTAALRELVTNSECTVEEHAERVRPATDRSQEPAPLTQAQRRIWLLDRMSGGGKELCSQ
FT                   RYFNLLGDIDAVRLRKALELLARRHPSLATIFPERDQGVVQIIGSPGRVQMHDLRDRDA
FT                   AIREQLAQDLIDADARRPINIAVDPPFRAMIIQIDDDRLILGMNYHHIVADFWAEAQLF
FT                   AELSAIYANPRHGASGPGRDITMSELARAQVARSAGPHNKQSLAYWDRTLTGMPARLEL
FT                   PTDRPQTTSPSFRGARVSLQLENDVRIELDEVAGRLDVDRSTIILAMWQYLLHRYTSQD
FT                   TVVVGVPTPNRPPSVPSTTIGYFADLSPIRADFAEGLTLATHAARTAARLGEARAHGDV
FT                   SFDDLLERFGPQLAKSAQLIEVSFVPEISGSSGPVIDGVRVTAVPHDPGRALFKLGLSV
FT                   EPDAAGGLHLVFDFSVALWNTDTIERMAGHLVTLLKSALAQPRIALAGFSMLTDDEIDE
FT                   LEVLDARRDIAPAYPTLHRGFEVQAAAHPDATAVRFAGRDLSYAVLDAESNALAALLID
FT                   SGVAHGDKVALLLERTDRLPVAILAILKTGAAYVPIDPSWPAARVELVLSDCGPSMIVT
FT                   ESALRHVVSAHGAPTIEVDVISATPAPARHVEVSADDTAYVIYTSGSTGRPKGVAVTHH
FT                   NVVRLFSATDELFEFNSDDRWTMFHSVAFDFSVWELWGALLHGACVVVVPYLVTRNPAE
FT                   FRELLSNERITVLSQTPSAFRLVRDADADIEGAASRLFLRYVIFGGEMLTFADLIPWVK
FT                   AHGDEHPELINMYGITETTVHVTFRRLMRADIFGAHSSIIGRPIPDLECLLTDSVGNLV
FT                   PYGVPGEICVGGPGLANGYLGMPELTAQRFIEHPFRAGERLYRSGDSGRRLSNGEIEYF
FT                   GRLDHQVQLRGFRIELGEVETAVLGLEQVMACYAMVRTEGGEPRLVAYVVTRGGEELPV
FT                   AQTRRALTSRLPDYMLPSSFVTLESLPLTVNGKIDRAALPAPREPQARTGPSAPAAGDT
FT                   VEELTVRIDLNDTIRIARDATIKLIKKSTDDVGPVLDRICGVFAEVLELSSVAADDNFF
FT                   DIGGDSMMAVRVSAKAKALGLQLSVQDVFRHQTPAELATGLVPTETPQQPARIERKAKR
FT                   LLVPEGSEGALPADVSDAYPLSALQAGMLFHSRVDGPSVYHDVVSYLVQSPWDENAFRS
FT                   ALFEMTLRHPILRTTFDLSAYSVPLQLVHESVSTPLKVFDLSGLTEAEQEASLSEWMET
FT                   EARRPIEWRTRTPLELIVHVRGEDRFDMSLSFHHALLDGWSVVELQRDLLCSYDSFRTA
FT                   GQPPTRERLQTHFRDFIMLESEAEGSPSRAFWRHQLQGLIPCLFPATRSGTSRLEVIFH
FT                   ELPSEAEGRLRDLARQRRVSIKSTLLAAHLVVMGRMAASDDVVTGLVVNGRPETEDAES
FT                   VLGMFLNTVPLRIRLNAASYAALLDGVFAAEHDGLPHRRVPLRTIQRDNGIGRLFDTAF
FT                   NYVDLDPAKAEDSVTEQATVLRRKIIEHTNLPFVIVFSREAGALGIGVEFDPRLLAADY
FT                   VHMILEAYEEAIAALADGGSAPLPDFASETQLHCLHASRRVALRQAANAQAAARAHLGR
FT                   IWEDVLGRPVGAHDSLQDSGGDSIQALVVSERIAVAFGCEPPLRELLNGATVERLSYWL
FT                   ARPHGAPPNGATARRSG"
FT   gene            complement(430989..432758)
FT                   /locus_tag="MMAR_0369"
FT   CDS_pept        complement(430989..432758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0369"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38836"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT7"
FT                   /protein_id="ACC38836.1"
FT                   /translation="MTYMMTQPQLLTSAAADVEGIRWALTQANAAAAGPTTSLVAAAAD
FT                   EVSTAAAKLFGGYALEYQSVIGHVTAFHEEFVRTLAAAGTAYAGAEAVNTATISGALNA
FT                   LRTPIQSLLGGGAASTVAAGGAAVAPAALADPFVALIMGGSGTPIPPPDYLQDVAPYIP
FT                   GMPTQLLPLNTPEGLYPLTAIKDLPLNTSVANGVQILDNALFGPQGLITLGNNVNVLGY
FT                   SQSAVVSSLEMRNLQALGSPNTDNLAFTLLGNPMAPNGGLLSRFPGLSLPALGLDFYGG
FT                   TPSNTGYELNQYTLLYDGYADFPQYPLNLLADLNAFAGIQFVHGDYPDLDPNNLPAGYN
FT                   LVQLPVSPGNNGLENYYMITYPGLPILEPLRAIPVIGNPLADLVEPNLTYLVNLGYGDP
FT                   NYGYSTGYADVTTPFGLLPPIDPVDFAGAMVNGTQQGVTAFVNDISAIPATLPSLSLPD
FT                   FSQTGGSSVPSTLPAVPTVTNASINGFIDALQAANTNIANAITNVSADTYAALLPTADI
FT                   INTVLTTVPSYNVNLFLDGIQQFVNGDPVGLINAIGYPIAADVAVAALAGGFEVIVLAD
FT                   TAQEVVSDIVGAF"
FT   gene            complement(433165..434817)
FT                   /locus_tag="MMAR_0370"
FT   CDS_pept        complement(433165..434817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0370"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38837"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT8"
FT                   /protein_id="ACC38837.1"
FT                   /translation="MSYLLAEPELLASVATEIDGIGSAISTAGTAAAGPTSSLLAAAGD
FT                   EVSGAIANLFSVYGRECQAVLAQVEAFRSEFAQTLAAAGVAYAQTEAASLAALRGALGI
FT                   PSAAPAVSSASTIPPFTANLTSLFLGPTGVPIPDESYVQAANNLFVRSSDILRPLYTPE
FT                   ELYPLTGVKSLTLNASVEEGLTILDNAIMAQLSIPGNSVTVFGYSQSAIIASLEMQKLA
FT                   ALGPSAPTASQLNFVLVGNEMNPNGGMLARFPDLSLPSLGLTFYGATPSDTIYPTAIYT
FT                   LEYDGFADFPRYPLNFIADLNAVMGIPFVHVKYLDLTAAQVDSAIELPTSPGYSGVTSY
FT                   YVIPTENLPLLEPLRAIPVIGNPLANLIQPDLKVIVNLGYGDPNYGYSTSYADVRTPFG
FT                   LFPDVSPGTIVDALAAGTQEGIQDFTADLQAMFGQPIPTPDIVPPTPADILGKLSELPS
FT                   PAQVVNTLTAVVANDYAVLLPTADIGLAVVTTLPLYSTQLFFDQLLQGNLIDAFGYPIA
FT                   ATVGLLTIGGAVEFLTIAAAAQTTVQDIGSLIP"
FT   gene            complement(434987..436735)
FT                   /locus_tag="MMAR_0371"
FT   CDS_pept        complement(434987..436735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0371"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38838"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLT9"
FT                   /protein_id="ACC38838.1"
FT                   /translation="MTYVFVEPETITTMAADLEGIGSTIDAASAAAAGPTSRLVSAAAD
FT                   EVSTAIAGLFGGYGQQYQAVVAHAAAFHQQFTQTVAAAGLAYAQTEASSVAAISNALEA
FT                   FGTQAHSLLGGGNAAASATPSASITTTPLTGPTVSLVMGGSGNPLPGPDYLADFFNYIT
FT                   PQFGVTTSQALFTPEQLYPLTGEKSLPLAISVSQGVQILHNAILGQIAEGNSVVVGGYS
FT                   QSAIIASLEMQNLAAMPPGTAPTADQLGFLLLANPMNPNGGLLSRFAGLTLPSLGVDFY
FT                   GSTPADTIYPTSIYTHEYDGFADFPRYPLNIVSDLNAIAGIAFVHTDTPTINPETLPPG
FT                   DLIKLDTSADYTGNTSYYLIHTERLPLLEPLRFIPVVGNPLADLLQPDLTTIVNLGYGD
FT                   PRYGYSTAPANIETPFGLFPEVDPKVVAQQLVIGTQQGFHSAAHDLVAPQPSPPTPRLF
FT                   LDIPNPLASIALPPPASLVAPTSIDGFINALQTANTTVTNAFTDVLATSYAKLLPTADI
FT                   INAGLTTVPSYNLNLFLDGIEQAVDGDPIGLINAIGYPIAADAALLGLAGGLEALVLLG
FT                   AIVTDF"
FT   gene            complement(436835..438487)
FT                   /locus_tag="MMAR_0372"
FT   CDS_pept        complement(436835..438487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0372"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38839"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU0"
FT                   /protein_id="ACC38839.1"
FT                   /translation="MSYVVAQPPAIAAAATELTGIGSALSEATAAAAGPTTAILSAAAD
FT                   EVSTAIAQLLGTFGAEYQGISTQLAAFHAQIAQRLATVANYYINAEEINNAALLEEATA
FT                   GLYSPNSPPTVPAVFNDYVAIAMGGTGTPIPSTSYLDAVNTLYIQHIAPGAIAKALFTP
FT                   EQLYPITGVKSLPFQTSVQEGLKILDISIWNEINAGNHVTVFGYSQSAVIASLEMQHFI
FT                   SLGPNAPDPSQINFILTGNEMNPNGGILARIPGLNVASLGLPFYGATPDNPYYTTTYTL
FT                   EYDGFADFPRYPLNVLSDVNAVFGILTVHRTYPDLTPEQIASATLLPTEGPTTGTYYMI
FT                   RTENLPLLDPVRAIPVIGEPLAALVQPDLKVLVNLGYGDPNYGYSTSPANVPTPFGLFP
FT                   DVSLQVVADALVAGTHQGINDFGAALPTALSTTPQIAPLEFPPYVQSVLPPAPPPMPAT
FT                   PINIANTLASVVSTGYSVLLPTADIGLGFVTSLPAYNLTLFLSQLAQGDLRAAIELPLA
FT                   ATFGLGALGGMIEFIAVMEAAAEIAQDLQSLYL"
FT   gene            complement(438612..439442)
FT                   /gene="ptpB"
FT                   /locus_tag="MMAR_0373"
FT   CDS_pept        complement(438612..439442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpB"
FT                   /locus_tag="MMAR_0373"
FT                   /product="phosphotyrosine protein phosphatase PtpB"
FT                   /note="involved in signal transduction (via
FT                   dephosphorylation). can dephosphorylated in vitro the
FT                   phosphotyrosine residue of myelin basic protein (MBP) at ph
FT                   7.0. could be involved in virulence by interfering with
FT                   phosphotyrosine-mediated signals in macrophages [catalytic
FT                   activity: protein tyrosine phosphate + H(2)O = protein
FT                   tyrosine + phosphate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38840"
FT                   /db_xref="GOA:B2HLU1"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU1"
FT                   /protein_id="ACC38840.1"
FT                   /translation="MAETGPELPGAWNFRDVADSTAALRPGRLFRSSELSGLDDQGRAA
FT                   LRRFKITDVADLRSSREVARRGPGQVPAGVDVHLLPFPDLADDQAGTDDNAPHETAFKR
FT                   LLTDGDAGESSEAIDQVAARYMADEYRQFPMRTGAQRAVHRVFTLLAAGRPVLTHCFAG
FT                   KDRTGFVVATVLEAVGVDREVILADYLRSNDAVPQLRDRISEMIRERTDVELTPEVVTF
FT                   TKARLSDGVLGVRPEYLAAAWQTIDETFGSLDGYLADSGITEADRHQLRSALLG"
FT   gene            complement(439435..440685)
FT                   /gene="fadE2"
FT                   /locus_tag="MMAR_0374"
FT   CDS_pept        complement(439435..440685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE2"
FT                   /locus_tag="MMAR_0374"
FT                   /product="acyl-CoA dehydrogenase FadE2"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38841"
FT                   /db_xref="GOA:B2HLU2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU2"
FT                   /protein_id="ACC38841.1"
FT                   /translation="MSYRGGMDFAMSAKAIDYHQRLSDFMTEYVFPAEADYDKYREDAG
FT                   PNDHTVPPVVEELKANAKARGLWNLFLPAESGLTNLEYAPLAELTGWSLEIAPEALNCA
FT                   APDTGNMEILHMFGTDEQRRQWLDPLLHGEIRSAFSMTEPAVASSDARNIETTISRDGA
FT                   DYIINGRKWWTSGAADPRCKILIVMGRTNPDAAAHQQQSMILVPTDTPGVTIARSTPVF
FT                   GWQDQHGHCEVVYDNVRVPATNLLGEEGTGFAIAQARLGPGRIHHCMRALGGAERALAL
FT                   MVDRARNRVAFGRPLAEQGVVQQAIAKSRNEIDQARLLCEKAAWTIDRHGNKEARHLVA
FT                   MIKAVAPQVACDVIDRAIQVHGAAGVSNDTPLARLYSWHRAMRIFDGPDEVHMRSIARA
FT                   ELGREKSAFAAAVTSHG"
FT   gene            440810..441688
FT                   /locus_tag="MMAR_0375"
FT   CDS_pept        440810..441688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38842"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU3"
FT                   /protein_id="ACC38842.1"
FT                   /translation="MDAREARAARSEDVFVGSEAVRRGRLSPYRLRTEFRAIYPDVYLP
FT                   AHAAPSFRTRCKAAWLWTGRRGVLAGLAAAGLHGSDWIGDDEPVELIWRNPHPPAGVIT
FT                   RNQRIEPDEVTRVAGLAVTTLARTAFDLGRQLPGGESVARLDALMRATAFSGEDVLLLA
FT                   KRYSGARGLRRLRATLPLVDAGAASPRETWLRMVLIDAGLPVPVTQIPVHQNWRLVAVL
FT                   DMGWQKYQVAAEYDGDQHRFDRRQYARDQWRLRKLDELGWIVIRVIAGDAPEDVVRRVR
FT                   QALARRGHRET"
FT   gene            441754..442224
FT                   /locus_tag="MMAR_0376"
FT   CDS_pept        441754..442224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0376"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38843"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU4"
FT                   /protein_id="ACC38843.1"
FT                   /translation="MNPMTESRPPFPPFTFETATQKVQAAEDAWNTRDPQRVSLAYTVD
FT                   SRWRNRDEYVVGREQIVAFLTRKWQRELDYSLRKSLWSFGEDRIAVRFQYESRDATGQW
FT                   YRSYGNELWEFTPSGLMARREASINDVAITESQRRFFGPRPAAEHGQEIPMW"
FT   gene            442468..443556
FT                   /gene="pntAa"
FT                   /locus_tag="MMAR_0377"
FT   CDS_pept        442468..443556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAa"
FT                   /locus_tag="MMAR_0377"
FT                   /product="NAD(P) transhydrogenase (subunit alpha) PntAa"
FT                   /note="the transhydrogenation between NADH and NADP is
FT                   coupled to respiration and ATP hydrolysis and functions as
FT                   a proton pump across the membrane [catalytic activity:
FT                   NADPH + NAD+ = NADP+ + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38844"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU5"
FT                   /protein_id="ACC38844.1"
FT                   /translation="MTDPQTTVGVVAESTPDERRVALVPKAVGSLVNSGVAVVVESGAG
FT                   ERALLPDDLYTEAGATIGDAWAADVVVKVAPPSADEVGKLRSGQTLIGFLAPRNADNSI
FT                   GALKQAGVQAFALEAIPRISRAQVMDALSSQANVAGYKAVLLAASESTRFFPMLTTAAG
FT                   TVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLNIGIDAAG
FT                   EGGYARELTDEERAQQQKALETAISGFDVVITTALVPGRPAPRLVTAAAVEAMKPGSVV
FT                   VDLAGETGGNCELTEPGRVVVKHDVTIASPLNLPATMPEHASELYSKNITALLDLLLTD
FT                   GKLAPDFDDEVIADSCVTRGDD"
FT   gene            443572..443910
FT                   /gene="pntAb"
FT                   /locus_tag="MMAR_0378"
FT   CDS_pept        443572..443910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAb"
FT                   /locus_tag="MMAR_0378"
FT                   /product="NAD(P) transhydrogenase (subunit alpha) PntAb"
FT                   /note="the transhydrogenation between NADH and NADP is
FT                   coupled to respiration and ATP hydrolysis and functions as
FT                   a proton pump across the membrane [catalytic activity:
FT                   NADPH + NAD+ = NADP+ + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38845"
FT                   /db_xref="GOA:B2HLU6"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU6"
FT                   /protein_id="ACC38845.1"
FT                   /translation="MYDELLANLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEVEHPSLAVQIILFVAVVFGTLNVIGGFIVTDRMLGMFKGKKKVAAVKAE
FT                   KAEGSAAK"
FT   gene            443907..445331
FT                   /gene="pntB"
FT                   /locus_tag="MMAR_0379"
FT   CDS_pept        443907..445331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="MMAR_0379"
FT                   /product="NAD(P) transhydrogenase (subunit beta) PntB"
FT                   /note="the transhydrogenation between NADH and NADP is
FT                   coupled to respiration and ATP hydrolysis and functions as
FT                   a proton pump across the membrane [catalytic activity:
FT                   NADPH + NAD+ = NADP+ + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38846"
FT                   /db_xref="GOA:B2HLU7"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU7"
FT                   /protein_id="ACC38846.1"
FT                   /translation="MNYLVIGLYILAFSLFIYGLMGLTGPKTAVRGNLIAAVGMAIAVA
FT                   ATLVKIRHTDQWVLIIAGLVVGVALGVPPARLTKMTAMPQLVAFFNGVGGGTVALIALS
FT                   EFIETKGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIIAFGKLQELISGAPIGFGK
FT                   AQQPVNLLLLVGAVVAAVVIGLDAHPGSGGVSLWWMIGLLAAAGVLGLMVVLPIGGADM
FT                   PVVISLLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIVAG
FT                   GFGGGGVSPSADGGGDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDMAS
FT                   LLEDKGVAVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVAIVIGA
FT                   NDVTNPAARNDASSPIYGMPILNVDKAKSVIVLKRSMNSGFAGIDNPLFYGEGTTMLFG
FT                   DAKKSVTEVAEELKAL"
FT   gene            complement(445374..445499)
FT                   /locus_tag="MMAR_0380"
FT   CDS_pept        complement(445374..445499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38847"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU8"
FT                   /protein_id="ACC38847.1"
FT                   /translation="MDPSPDYDASDEIEFFFNYLTWGLRGVTDGNGYPPPAYPPV"
FT   gene            445667..446290
FT                   /locus_tag="MMAR_0381"
FT   CDS_pept        445667..446290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0381"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38848"
FT                   /db_xref="GOA:B2HLU9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLU9"
FT                   /protein_id="ACC38848.1"
FT                   /translation="MPSETGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNKATV
FT                   YHYYASKSLILFDIYRQAAEGTLGALHAEPSWTAREALYQYTVRLLTGIADNPERAAVY
FT                   FQEQPYIAEWFTPEQVAEVREKEAQVHEHVHGLIDRGIASGEFYECDSHVVALGYIGMT
FT                   LGSYRWLRPHGRRTAREIAAEFSTALLRGLIRDESIRNQSPLGS"
FT   gene            complement(446304..447785)
FT                   /locus_tag="MMAR_0382"
FT   CDS_pept        complement(446304..447785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0382"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38849"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV0"
FT                   /protein_id="ACC38849.1"
FT                   /translation="MSYVRTIPEFLSTAAADIGGIGSALTDASSAAAGPTTNLLAAAAD
FT                   EVSAVVSKVFGGYGLSAQAVLTQASAFHDEFTELLANAGGIYAQAEVDNAEALTNAVGE
FT                   FSEPFIQLWDPSYTYVGSNIATGPNPQPNEPSLTPEFALIMGGTFDPQPFPLYVTTINN
FT                   AFIQPFFPGATSVGLSYPAQFWPLTSGLTLNQSVAEGVIDLNNALSVQINGGQHVINFG
FT                   FSQSAVVATQEMQRLMALPVGMRPDPSDLSFVLAGNPATPNGGIFTRFPGMHIPFVDLT
FT                   FTSPTPPDTPYPTTIYATQYDPTSDFPRYPLNILSDLNTLMSLGQHELYPNLDVSNAVQ
FT                   LPTSPDYTGNTTYYMFMTKNLPLLEPVRAIPFIGNPIADFIQPDLRVLVDLGYSDWGSG
FT                   QDYANVPTPATLFPIPNPFVIGTDLVIGAVHGSTALAVDLGLLPASALPNAYPYLPSLD
FT                   TDLNFFLGQPGVTDISLVTNAIGPVLQRLPAINPG"
FT   gene            complement(447995..449485)
FT                   /locus_tag="MMAR_0383"
FT   CDS_pept        complement(447995..449485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0383"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38850"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV1"
FT                   /protein_id="ACC38850.1"
FT                   /translation="MSYVITAPEMLTTAATDLDGIGSAIKAASAAVAGPTTGVAAAAAD
FT                   EVSGAIAKLFGMFGQEYQSVVAQASAFQTEFTRLLATAGDSYAITEASNALGALNTQAQ
FT                   TLLGGAFGTAAGTSATGPLAAGTHVAFVMGGTAIPWPDATYVTAVQDLFIDPHFPGFTT
FT                   QVLFTPEQLWPFTSNLGSLTFGQSVAQGVAILRDALSAQLSDPANTAVVFGYSQSATIA
FT                   TNQIRAFMSQLNPPSPSQLSFVLTGNPNNPDGGVLERFNGLYLPIVDVLFNGATPPDSP
FT                   YPTAIYTAQYDGIANFPRYPLNVVSDVNAIMGFLYDEHYYAGLTSDPNAIGSGPTVANA
FT                   VQLPTSPGYTGNTEYYMVLGQHLPLTDPLRQIPYVGTPIADLIQPSLRVIVDLGYSDYG
FT                   PGQNYADIPTPASLFSLPNPLAVSYYLGKGAVQGVQAFMVDEGWLPQSYLPDTYPYVAS
FT                   LSPGLNVYLGQPSVTGLSLLTGALGTAARDLGWIPSWD"
FT   gene            complement(449637..451154)
FT                   /locus_tag="MMAR_0384"
FT   CDS_pept        complement(449637..451154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0384"
FT                   /product="PE family protein, PE4"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38851"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV2"
FT                   /protein_id="ACC38851.1"
FT                   /translation="MSYVLTAPDLLASAATDVDGIAATLQVANSAAAAPTSGLLAAAQD
FT                   EVSAAIAKVFSAYGQEYQAAIAQASAFHTEFTRALAAAGAAYAQAEAANASLITAGVSD
FT                   ALTAITTPIQSLLGPAAIGTGGAGSAGALTAVSSTLMADPVVALIMGGTSVPLPGPGYV
FT                   SDINNNYIQPLFSGAIPQALFTPEQFWPVTPGLGNLTFNQSVAQGVTLLNDAINTQLAL
FT                   GNKVVAFGYSQSATIVNNEILALMAMGTGAPDPGDLSFIMVGAPNNPDGGLLARFPGFY
FT                   IPFLDVSFNGATPAANPYPTSIFTAQYDGIAHAPQYPLNILSDINAIMGYFYVHGNYPD
FT                   LMSGQAIQLPTSPGYTGNTDYYMYLTQDLPLVQPIRDIPYAGPPLADLIQPQLRVLVDL
FT                   GYSDYGPGLSYADVPTPAGLLSVPNPFAVSYYLLKGSLQAPYGAAVEIGVEAGLLGPES
FT                   FPDTYPWVPSLNPGLNFYLGQPSVTLLSLLSGGLGDIFHLIPPPVFP"
FT   gene            complement(451282..452190)
FT                   /locus_tag="MMAR_0385"
FT   CDS_pept        complement(451282..452190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38852"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV3"
FT                   /protein_id="ACC38852.1"
FT                   /translation="MTQRQDVRFPCGEAMISAWLYRPAGADPARPVPMLVMAHGLGAVR
FT                   TMRLDAYAQRFSAAGYACLVFDYRNFGDSEGQPRQLLDIRMQLQDWAAAVAYARTCDGV
FT                   DQARIGLWGTSFGGGHVIATAARLPGIAAVVAQCPFTDGIASVLAIAPTTAIRVTARSM
FT                   RDLIGSRLGRPPVMIPTAGKPGEVALMTAPDAYPGYLGLMPQGTQVPNEVAARIGIKVL
FT                   GYRPGRSARKIACPILFCVCETDSVAPAGPTLRYAARAPRGEVIRYPEGHFAIYLGDAF
FT                   ERVVADQLGFLDKHLKPAGQP"
FT   gene            452296..453378
FT                   /locus_tag="MMAR_0386"
FT   CDS_pept        452296..453378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38853"
FT                   /db_xref="GOA:B2HLV4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV4"
FT                   /protein_id="ACC38853.1"
FT                   /translation="MAIRVAHVGTGNVGRLALSELVTNPAFELTAVCVSTPEKVGRDAG
FT                   DLAGVGIETGIAAINDLDAVLATAPECVVYCAMGDTRLPDAMADVMRILAAGSNVVGSS
FT                   PGLLQYPWGVIPDKYIARVQRAAEQGNSSIFITGVDPGFINDLLPFALAGTCQRIEQVR
FT                   CMEIHDYASYDGAEVMHYMGFGRSLDEVPMLLQPGVLGIAWGTAIRQLAAGLGIEVDEI
FT                   TESYQREPAPEDFEIAVGPVAKGTQAVLQFEIRGMVDGQAAIVIEHITRLRPDLRPDWP
FT                   QPASGGGSYRIEITGEPSYAVDIVPSSRNGDHNHAAIVGAAGRIVNAIPAVLTATPGIR
FT                   TTLDLPLITGKGLYTPMVSN"
FT   gene            453398..454138
FT                   /gene="fabG3"
FT                   /locus_tag="MMAR_0387"
FT   CDS_pept        453398..454138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="MMAR_0387"
FT                   /product="20-beta-hydroxysteroid dehydrogenase FabG3"
FT                   /note="thought to be involved in lipid biosynthesis
FT                   [catalytic activity: androstan-3-alpha,17- beta-diol + NAD+
FT                   = 17-beta-hydroxyandrostan-3-one + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38854"
FT                   /db_xref="GOA:B2HLV5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV5"
FT                   /protein_id="ACC38854.1"
FT                   /translation="MGRVDGKVALISGGARGMGASHARLLVQEGAKVVIGDILDEEGKA
FT                   LAEEIGDAARYVHLDVTQPDQWEAAVATAVDEFGKLDVLVNNAGIVALGQLKKFDLGKW
FT                   QKVIDVNLTGTFLGMRAAVEPMTAAGSGSIINVSSIEGLRGAPAVHPYVASKWAVRGLT
FT                   KSAALELAPLNIRVNSIHPGFIRTPMTANLPDDMVTIPLGRPAESREVSTFVVFLASDD
FT                   ASYATGSEFVMDGGLVTDVPHKQF"
FT   gene            454159..455499
FT                   /locus_tag="MMAR_0388"
FT   CDS_pept        454159..455499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0388"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38855"
FT                   /db_xref="GOA:B2HLV6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV6"
FT                   /protein_id="ACC38855.1"
FT                   /translation="MLRSLANVVGSSHVLTDPDVLAGRSVDHTGRYRGRASALVRPASA
FT                   DQVAEVLRVCRDAGAHVTVQGGRTSLVAGTVPEHDDVLLSTERICDVADVDTLERRVAV
FT                   GAGATLAAVQRAATAAGLVFGVDLSARESATVGGMASTNAGGLRTVRYGNMGEQVVGLD
FT                   VALPDGSVLRRHSLVRSDNTGYDLPALFVGAEGTLGVITALDLRLHPTPSHRLTAVCGF
FT                   ADLEALVDAGRVFRDVGGIAALELIDGRAAALTREHLGVPAPVPGDWLLLVELAADHDQ
FT                   TERLADLLDGVRLCGDPAVGVDVAAQQRLWRIRESLAEVLGVYGPPLKFDVSLPLAAIS
FT                   EFAAAAATLVAAHVPEAIPLLFGHIGEGNLHLNVLRCPVPREPALYQEMMSLIAQCGGN
FT                   VSSEHGIGSRKRPYLQMSREDTDIAVMRAVKAALDPTGYLNPAVLFD"
FT   gene            complement(455506..456051)
FT                   /locus_tag="MMAR_0389"
FT   CDS_pept        complement(455506..456051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0389"
FT                   /product="conserved hypothetical regulatory protein"
FT                   /note="function unknown. contains TetR_N, bacterial
FT                   regulatory proteins, TetR family domain. possibly involved
FT                   in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38856"
FT                   /db_xref="GOA:B2HLV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV7"
FT                   /protein_id="ACC38856.1"
FT                   /translation="MSQAFGAIDTTDGDTSTRQRILAATAEVLARSGKTKLSLSEVAAQ
FT                   AGVSRPTLYRWFASKEELLATFSRYERQVFESGLSKATAGLKGVDKLDAALRFIVDYQY
FT                   SYSGVRMVDIEPELVISQMSGVIPEMREGLQRLLPGPNAAVKAATAIRIAISHYIVRSD
FT                   DADQFLAQLRHAVGLKGG"
FT   gene            complement(456110..456925)
FT                   /locus_tag="MMAR_0390"
FT   CDS_pept        complement(456110..456925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38857"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV8"
FT                   /protein_id="ACC38857.1"
FT                   /translation="MTDSYYELIDDADALGEKFAATDLVRGTWSASIQHGAPVSALLVR
FT                   ALQRCAWREDTRLSRVVVDLIGAVPADGDLWVSSRIERGGKQIELVSAELAAPGPDGRP
FT                   RAVARASGWRLAQLDTQELRHAAEQPPRPLAEARNRKLAPMSWDRNYVHSLDWRWLTEP
FT                   MTPGPGECWIKPTVDLVNGETMTPLERLFAVADCANGIGSKLDITKWTFLNTDLAVHVF
FT                   RIPAGDWIGIRAETSYGPDGIGTAAGTLFDQQGAVGTIAQSVLVRRRAR"
FT   gene            complement(456965..457822)
FT                   /locus_tag="MMAR_0391"
FT   CDS_pept        complement(456965..457822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38858"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLV9"
FT                   /protein_id="ACC38858.1"
FT                   /translation="MHDTFAVICNGTRREVSPLARGFCFGEGPRWFEGLLWFSDMLGEA
FT                   VHTSDMHGSLTTLPLPGHSPCGLGFRPDGTLLIASAHDRLVLRYDGDTVVTVADLRDLA
FT                   PADLGDMVIDRAGRAYIGCQSFSGGVIIRLDTDNSAQVVAEDLDFPNGMVITPDHDTLI
FT                   VAESVGRRLSAFTVSADGALNDRRVFAAGLDGPPDGIALDAEGAVWAAMTLAHQFERIV
FT                   AGGVVTDRIDMGDRVAIACALGGPGRRTLFLLSSTDAYPKRLIGTRLSQLDAVTVATPG
FT                   AGLP"
FT   gene            457915..458805
FT                   /locus_tag="MMAR_0392"
FT   CDS_pept        457915..458805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38859"
FT                   /db_xref="GOA:B2HLW0"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW0"
FT                   /protein_id="ACC38859.1"
FT                   /translation="MSALTTDSEQAQWSVDGLLELFQVRAEGVDRFTADTGIAGHDGRQ
FT                   VVEGTQVVAQAIMAVASRFEGKSVRSAHAVFCRAVIVGPPLELVLDVVHEGRSTATAIV
FT                   AANQNGKRCLTVTVLADIPTGDVIKHHLPRPPVVAPADANVSEMPMAGRQLRLVDVVDV
FT                   NSPDEVGPPELYAWLHYEPIPDRDDLAKALIAYFTGHLGISTTMRAHPGIGTSQAHLSV
FT                   STAPMTISVAFHEPVHWDGWLLYSHESTQVGAGMSYVRGTVHTEQGALIASFAQEALIR
FT                   PLRTSDTSIDARSRF"
FT   gene            458820..459740
FT                   /locus_tag="MMAR_0393"
FT   CDS_pept        458820..459740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38860"
FT                   /db_xref="GOA:B2HLW1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW1"
FT                   /protein_id="ACC38860.1"
FT                   /translation="MRFIITHPMHSHPYHPELASGAGVAAVAAAAERAGFHGFGFTDHP
FT                   APSQRWLEAGGHDSLDPFVALGFAAAQTTSLRLIPNIVVLPYRNPFVVAKSAATLDLLS
FT                   GGRFILAVGVGYLKREFAALGVDHAERAELFEEALQVIRAVWTSDDISFEGRHFSARGI
FT                   TAHPRPASNPYPPIWVGGNTAAARRRVAAHGDGWCPFPAPAPLAQTAGTAAIDSADRLA
FT                   AGIDDLRRKCDAAGRDFSAIDVTFTNFDGGGPASADFNADAYLGGLEKLATLGVTWVHV
FT                   GLPGDGLAHALECIDRFRVQVIEAA"
FT   gene            complement(459763..460440)
FT                   /locus_tag="MMAR_0394"
FT   CDS_pept        complement(459763..460440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38861"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW2"
FT                   /protein_id="ACC38861.1"
FT                   /translation="MSLAAGHGPLSTHPAGRFCPPVPDGLVYVEPHPRRIQAFRNGRLV
FT                   IDTERALMVHRRGHPLRYVFPTDEIADLPTQPETAAPGFVHVRWDAVDMWLEEGRRLVH
FT                   YPPNPYHRVDCRPTTRQLHVELAGTTLVNTQDTVIVFETSLQPRLYVTPAQVRTDLLVR
FT                   SQTSSYCNYKGVATYWSAVVGDMVAPDIAWSYEDPPPESVPIKGFLSFDEGAVQVTAEL
FT                   PAR"
FT   gene            complement(460437..461606)
FT                   /locus_tag="MMAR_0395"
FT   CDS_pept        complement(460437..461606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38862"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015897"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW3"
FT                   /protein_id="ACC38862.1"
FT                   /translation="MPENRVIALARLATHLGRGLGRVATDAVLRNARAFPRRIHDLDAP
FT                   ALSEIMGRRVSSVSVLDDSSGTTSRARLALSGNDVPESVFVKMAAATAATRFIGELGRL
FT                   AETEVSFYRDLSPELAPDAPTAYGCAYDPLTGRFVLVLEDLAAPAEGTCDFSDTLHPFD
FT                   NDQAALVVELLARLHATYWVRLNHGGVRPFGWLYAASRDPSVPLVPTMLRASWRRLGGH
FT                   AAALLPGRDYVFEHYRAITGLIDAPPHTVLHGDAHPGNWYFRSSGGPLAAGLLDWQAVR
FT                   LGHPARDLAYTLITGMTTTDRRVTERELLDVYRRALAAAGGPELDREELWLRYRQAAAY
FT                   AYVATTIVAGLGGMQAADIALTGLDLTVAALHDLQTVAALRAADLGGTS"
FT   gene            461708..462877
FT                   /locus_tag="MMAR_0396"
FT   CDS_pept        461708..462877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0396"
FT                   /product="acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38863"
FT                   /db_xref="GOA:B2HLW4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW4"
FT                   /protein_id="ACC38863.1"
FT                   /translation="MAGPVEGIKVVELGVWVAAPAAAAILADWGADVIKIEPQAGDPGR
FT                   LFGRMLGCDLGMNPPFEMDNRCKRSVVLDLSTDTGRELAYELLSDADVFITNVRPAALR
FT                   RLGLDFAAVSDRNPRLVYGLITGYGETGPDADRAAYDVAAFWSRGGLAHLLTRPGDTPP
FT                   FQRGGMGDHTTGMTLAAAVCAALLARERTGTGQLVSTSLYRQGAYTVSFDLNTYLLTGQ
FT                   QIAIGQRESMGNPCMNNYTAGDGRRFWIVGLEIDRHWPALCRVVERPDWLADPRYGDAR
FT                   GRAANAVELIAQLDQIFATRSLAEWTEIFDAEPDFFWSPINSLEDIVADEQFHAAGGIV
FT                   DVPDGASSVPMVATPADFHGTPCTPRSVAPQLGQHTDQVLGELAARRKS"
FT   gene            463020..463568
FT                   /locus_tag="MMAR_0397"
FT   CDS_pept        463020..463568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38864"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW5"
FT                   /protein_id="ACC38864.1"
FT                   /translation="MLTPTLDLGATADGGTLRRTGADDDGLHYRVEVVAASVIDVVQAA
FT                   GGWLCDRVMAGWQVRVLVPGGDDIRPLQILGATAMDLEAGLTGRAPMGHSLAVGAAAFA
FT                   ADERVRAKLTEALQCRWTEVALWGQGWPLGVDRAIAPVQHVLSAAALAFKRQALTAAGI
FT                   PYGCVVSVEQLLADTAWSG"
FT   gene            463606..464310
FT                   /locus_tag="MMAR_0398"
FT   CDS_pept        463606..464310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38865"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW6"
FT                   /protein_id="ACC38865.1"
FT                   /translation="MKKYYGHTLLYLHETIKLGSGRSDRFTELFVQVCQPMMEELGARL
FT                   FAIWESTPYNGRWPEVTIIWEIDGFADYSRIGAAQAKGGSQEAAAGKWAAFLADIGARG
FT                   EGRIMYPGPANKTLAQLRASNFTAPLVIQEIMQTKPGRQDDYIRELERLYVPWSERTGK
FT                   HWLGSFTTTFRYNEVIHYWALEGGWECFANHYPSWKESPPAEIVTWMSVAPALRDGWED
FT                   SILQSLPPSPLQ"
FT   gene            464307..465515
FT                   /gene="cyp191A3"
FT                   /locus_tag="MMAR_0399"
FT   CDS_pept        464307..465515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp191A3"
FT                   /locus_tag="MMAR_0399"
FT                   /product="cytochrome P450 191A3 Cyp191A3"
FT                   /note="cytochrome P450 are a group of heme-thiolate
FT                   monooxygenases. they oxidize a variety of structurally
FT                   unrelated compounds, including steroids, fatty acids, and
FT                   xenobiotics"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38866"
FT                   /db_xref="GOA:B2HLW7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW7"
FT                   /protein_id="ACC38866.1"
FT                   /translation="MNFSYDPFGARVMADPLPYYRVLRDQHPVYYLPQWDTFAISRFDD
FT                   IWRVLEVNDGTFVASEGTLPAASVLARHNSGPVDDPPWHPLPFHAVFDAPLYGEIRRAH
FT                   SPPLRPKSVAGLEARIRELANERLDRLLPQGSFDLTQDYGGVVVASIVCELLGMPASLA
FT                   PEVLAAVNAGSLTEPGVGVDTAETRPNYLEFLVPVVRQRRADPTGELPVVDGLLRYRLP
FT                   DGSALDDTEVATQMLCIFIGGTETVPKIVAHGLWELSRRPDQLAAVRTDPQSNVNVARE
FT                   EMIRYCAPAQWFARTARKPFTIGDQTIEPGQRVITLLASANRDEREYPDPDEFIWDRPI
FT                   RRSLAFGRGQHFCIGYHLARLEISVLLQEWFRRVPEFQICAAQATRLPSSFQWGWNKIP
FT                   VEV"
FT   gene            465517..466485
FT                   /locus_tag="MMAR_0400"
FT   CDS_pept        465517..466485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0400"
FT                   /product="dehydrogenase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38867"
FT                   /db_xref="GOA:B2HLW8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW8"
FT                   /protein_id="ACC38867.1"
FT                   /translation="MWSYRIIAPYLFERTSIADKTPECLAEGQVLLRFQAAGVCGSDLP
FT                   AFRGARGHLPGDDGHSAAAKDGFPIHEVAGEVIASRHRAHHQGDRVVGWASGFDGLMQR
FT                   VIADGDGLAPYDPGLTPTQAVGLQPLACVLYACAQLPDLAGRHVAVIGQGSIGLLFSHA
FT                   AKVAGARRVTGVDPIDRENLSATFGVDDAVRATSDRWVSQLGAGDRADIVIEAVGHQVA
FT                   TLGHAIDAAAPGGTVFYFGVADDDAYPISMRTMLRNNLTLKSGVTQDRRRMLELAGKFA
FT                   AEHPELLSGYLTHNFDVEDVQAAFELACRPVPERVKIAITA"
FT   gene            466482..467243
FT                   /locus_tag="MMAR_0401"
FT   CDS_pept        466482..467243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38868"
FT                   /db_xref="GOA:B2HLW9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLW9"
FT                   /protein_id="ACC38868.1"
FT                   /translation="MKVVSNLQQRLGRGTPLWGGWITGPTWLGPEEFARAGYDYVGFDT
FT                   QHGYLDDADVAGLLRRLEGVPIATVVRLPNADPAPIGRVLDAGADAVIIAMIESAEQAA
FT                   AAVAATRYPPAGVRSYGPLRASLGTDPAELQSRAGVYAMVETAAALSTIDDICAVDGLA
FT                   GIYVGPADLAISLGTGVVGALDHPAVRQAVVGIHRAASAASLHTGIHAGAAKAGKAMAQ
FT                   LGFEMITLAAESQALRRGAAEYLNEATAGTR"
FT   gene            467240..467974
FT                   /locus_tag="MMAR_0402"
FT   CDS_pept        467240..467974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0402"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38869"
FT                   /db_xref="GOA:B2HLX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX0"
FT                   /protein_id="ACC38869.1"
FT                   /translation="MTGGGRVALVTGAAGGQGWAIVQRLRAEGHSVAACDLRADRLDAL
FT                   VAESGDDAVISLALDVTDEAQWQEAVERAVTRFGALTALINNAGVLHRAALVDETAAGF
FT                   ESAWRVNCLGAFLGMRAALGALSAAEGPVIVNICSTGAIRPFPHHCAYGAAKWALRGLT
FT                   QTAAAELAPAGIRVNAVFPGPIATSMLDEPTQARLAAVSMFGRLGRPAEVADAVAFLVS
FT                   ENSSFITGSELVVDGGQCLQVP"
FT   gene            467971..469476
FT                   /locus_tag="MMAR_0403"
FT   CDS_pept        467971..469476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0403"
FT                   /product="monooxygenase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38870"
FT                   /db_xref="GOA:B2HLX1"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX1"
FT                   /protein_id="ACC38870.1"
FT                   /translation="MTSPLSVGIIGAGPGGLALGILLKNRGFENFTIFDRESDVGGTWR
FT                   INTYPGLACDVKSHLYSYSFDLNPGWSRLWSGQPEILAYFQRCADRYGLRPHLRLSTEI
FT                   RSARWESQTRQWTLSTADGEQHQFSVVVSAVGIFSRPAYPDLVEQQRFTGTVMHSSRWD
FT                   HSVPLAGARIAVLGTGSTAAQLVPELAKVADRVYSIQRSPTWILPKPDRPYSRWERWVF
FT                   AHVPFAARLYRTRLWLRSESNISVIEHGSPKTKEFTELALRMLENTVSDPQLRRQLTPD
FT                   HPMGCKRLVFSSEFLTALARPNVELVTSPARYLRQRSLVTADGAEYDVDVVVCATGYAA
FT                   ADYLGQLEVLGEDGAGLHEVWRDGAHAYLGMAVPGFPNFFMLYGPNTNVGSNSVIFMLE
FT                   AQARYIVAALAHLRRKSKTYIAVRPGVLAEFMAKVDRWMTGTVWTTECSNYFRAPNGRV
FT                   VTQWPRSARSFWGMTRRFKPADFSFQPAAVFAADGGDRNAGQR"
FT   gene            469473..470414
FT                   /gene="lipW"
FT                   /locus_tag="MMAR_0404"
FT   CDS_pept        469473..470414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipW"
FT                   /locus_tag="MMAR_0404"
FT                   /product="esterase LipW"
FT                   /note="function unknown, lipolytic enzyme probably involved
FT                   in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38871"
FT                   /db_xref="GOA:B2HLX2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:3QH4"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX2"
FT                   /protein_id="ACC38871.1"
FT                   /translation="MTQPEAVDRLDPLLRAVATARIDFTAESILTIRESMNQRRREAAA
FT                   TETAAAGVAVADDVVTGEAGRPVPVRIYRAAPTPAPVVVYCHAGGFALGNLDTDHRQCL
FT                   ELARRARCAVVSVDYRLAPEHPYPAALHDAIEVLTWVVGNATRLGFDARRLAVAGSSAG
FT                   ATLAAGLAHGAADGSLPPVIFQLLHQPVLDDRPTASRSEFRATPAFDGEAASLMWRHYL
FT                   AGQTPSPESVPGRRGQLAGLPATLITCGEIDPFRDEVLDYAQRLLGAGVSTELHIFPRA
FT                   CHGFDSLLPEWTTSQRLFAMQGHALADAFYPD"
FT   gene            complement(470419..471561)
FT                   /gene="adhE"
FT                   /locus_tag="MMAR_0405"
FT   CDS_pept        complement(470419..471561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="MMAR_0405"
FT                   /product="zinc-type alcohol dehydrogenase (E subunit) AdhE"
FT                   /note="dehydrogeneses a alcohol (oxido-reduction)
FT                   [catalytic activity: an alcohol + NAD+ = an aldehyde or
FT                   ketone + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38872"
FT                   /db_xref="GOA:B2HLX3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX3"
FT                   /protein_id="ACC38872.1"
FT                   /translation="MELGLQPWLYSNMIHIRGAVLERIGSPRPYAQSRPISVVDLDLDP
FT                   PGDDEVLVRIEAAGVCHSDLSVVDGNRVRPVPMLLGHEAAGIVERVGDRVDDLAVGQRV
FT                   VLVFLPRCGHCPSCATEGITPCAPGSATNAAGTLLGGGIRISRSGQPIYHHLGVSGFAT
FT                   HAVVNRASAVAVPDEVPPQVAALLGCAVLTGGGAVLNVGKPVAGQSVAVVGLGGVGMAA
FT                   VLTALTQDGVAVFGVDQLPQKLSAAEALGASATYTPQQAAAAGVKADVVIEAAGHPAAL
FT                   ETAIGLTAPGGRTITVGLPPPDARISVAPLGFVAEGRSLIGSYLGSAVPSRDIPRFVSL
FT                   WQSGRLPVESLVSATIRLDDLNEAMDHLADGTAVRQIIVF"
FT   gene            471564..472037
FT                   /locus_tag="MMAR_0406"
FT   CDS_pept        471564..472037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38873"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX4"
FT                   /protein_id="ACC38873.1"
FT                   /translation="MPAGPSPDELSSGDFPVLWPVLTRWADNDMFGHLNNAVYYQLFDS
FT                   AINAWINTRTGLDPLTTAALGIVAESGCRYFSELHFPQELVVGLAVTRLGRSSVTYRLA
FT                   VFNSSPGAGEGPAGPGPIAALGHWVHVYVDRVSRKPVPIPETIRTLLATACVN"
FT   gene            472089..472550
FT                   /locus_tag="MMAR_0407"
FT   CDS_pept        472089..472550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0407"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38874"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2HLX5"
FT                   /protein_id="ACC38874.1"
FT                   /translation="MPRYASPMPVLSKTVEVSADAGSIMGIVADIERYPEWNEGVKGAW
FT                   VLARYDDGRPSQVRLDASVQGFEGVYIHAVYYPGENQIQTVMQQGDLFLKQEQLFSVVE
FT                   AGAASLLTVDIDVEPSMPVPPPMVKLLLNNVLEQLAANLKLRAEQLTAG"
FT   gene            complement(472575..473267)
FT                   /locus_tag="MMAR_0408"
FT   CDS_pept        complement(472575..473267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0408"
FT                   /product="transcriptional regulatory protein (probably
FT                   GntR-family)"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38875"
FT                   /db_xref="GOA:B2HMT6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMT6"
FT                   /protein_id="ACC38875.1"
FT                   /translation="MNIPLSARRKSRRPLRRAQLSDEVAGHLRAAIMSGTLRPGTFIRL
FT                   DETAAELGVSITPVREALLKLRGEGMVQLEPHRGHVVLPLTRQDIDDIFWLQATIAREL
FT                   AVTATERISEIDIGELEHINDALTAAVGAGDTEAIAALEFAFHRVLNQSSGRIKLAWFL
FT                   LNAARYMPAQLYASDPQWGAAAVDNHRQLIAALRRRDTAAVIEHSVWQFTDAAHRLTQM
FT                   LETNGIFN"
FT   gene            473427..475076
FT                   /gene="fadD5"
FT                   /locus_tag="MMAR_0409"
FT   CDS_pept        473427..475076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD5"
FT                   /locus_tag="MMAR_0409"
FT                   /product="fatty-acid-CoA ligase FadD5"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38876"
FT                   /db_xref="GOA:B2HMT7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMT7"
FT                   /protein_id="ACC38876.1"
FT                   /translation="MTAELASHLPQAAHALEQPYLARRQNWVNQLERHAMMQPRATAIR
FT                   YLGHTVTWADLRYRVAALAGSLSRRGVGFGDRVMILMLNRTEFVESVLAANMLGAIAVP
FT                   LNFRLTPSEIAFLVEDCAPRLVITEEVLAQVAVGVREIAPALSTIVVAGGASDPTVVGY
FT                   DELISETGDPPEPVDIPNDSPALIMYTSGTTGRPKGAVLTHTNLTGQVMTALYTGGANI
FT                   NSDVGFIGVPFFHIAGIGNMLSGMLLGVPTVIYPLGAFNPGQLLDVLEAERVSGIFLVP
FT                   AQWQAVCAEQQARPRELSLRVMSWGAAPAPDALLRQMSEVFPGTQIMAAFGQTEMSPVT
FT                   CMLLGEDAIRKRGSVGKVIPTVSARVVDDEMNDVPIGQVGEIVYRAPTLMSGYWNNPDA
FT                   TAEAFAGGWFHSGDLVRMDEDGYVWVVDRKKDMIISGGENVYCAEVENVLASHPSIVEV
FT                   AVIGRADEKWGEVPIAVAAVTKDHLRIEDLDEYLTERLARYKHPKALEIVDALPRNPSG
FT                   KVLKTELRLRYGVGVYSESRSVSRSFEFREGS"
FT   gene            475292..476095
FT                   /gene="yrbE1A"
FT                   /locus_tag="MMAR_0410"
FT   CDS_pept        475292..476095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="MMAR_0410"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE1A"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38877"
FT                   /db_xref="GOA:B2HMT8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMT8"
FT                   /protein_id="ACC38877.1"
FT                   /translation="MTTSSGPHLMGYLRDQLETPLTMVGGFFRMCVLTGKALFRRPFQW
FT                   RELILQCWFVMRVALLPTIMVSIPLTVLLIFTLNVLLAQFGAADISGAGAAIGAVTQLG
FT                   PLTTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVIAATFVATLLN
FT                   ALVITVGLVGGYLFGVYLQNINGGAYLATLTTITGMPEVTIAMVKAATFGLIAGLVGCY
FT                   RGLTVRGGSKGLGTAVNETVVLCVVALYAVNVILTTIGVRFGTGH"
FT   gene            476097..476966
FT                   /gene="yrbE1B"
FT                   /locus_tag="MMAR_0411"
FT   CDS_pept        476097..476966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="MMAR_0411"
FT                   /product="conserved hypothetical integral membrane protein
FT                   YrbE1B"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38878"
FT                   /db_xref="GOA:B2HMT9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMT9"
FT                   /protein_id="ACC38878.1"
FT                   /translation="MSTAAVLRARFPRAIANFNRYAGSVTRGLDESGRLAWFILTSLGQ
FT                   SGHALRYYRKEILRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLIAIQGFASLGNIG
FT                   VEAFTGFFSALVNVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   YLASTRIMAGLVVIIPLYALAMIMSFFSPQMVTTVLYGQSSGTYEHYFRTFLRPDDVFW
FT                   SFLEAIIIAAIVMVTHCYYGYNAGGGPVGVGEAVGRSMRFSLVSVNVVVLCAALALYGV
FT                   NPNFALTV"
FT   gene            476971..478275
FT                   /gene="mce1A"
FT                   /locus_tag="MMAR_0412"
FT   CDS_pept        476971..478275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /locus_tag="MMAR_0412"
FT                   /product="MCE-family protein Mce1A"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion (entry and survival inside macrophages)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38879"
FT                   /db_xref="GOA:B2HMU0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU0"
FT                   /protein_id="ACC38879.1"
FT                   /translation="MTKPGKLNKVNEPPYKIAGIALFLVGLLILSLVYLQFRGDFDRKV
FT                   KLTMFSERAGLVMDPGSKVTYNGVQIGRVDTISEITRDGKPAAKFVLNVYPRYLPLIPE
FT                   NVDAQIKATTVFGGKYVSLTTPEHPSNKKLSAHSVINASAVTTEINTLFETLTSISEKV
FT                   DPVKLNLTLSAAAEALTGLGNRFGEAIANGNEILDDINPQMPQARRDIQQLAALGDVYA
FT                   DAAPDLFDFLNNSVPTARTINAQQHDLDAALLAAVGFGNTGADVFERGGPYLARGAADL
FT                   VPSAQLLDTYSPELFCTLRNYHDVEPQAYKFLGGNGYSLNSHTTPLSALGMMLNPASLV
FT                   PLLISQVGGLAAGLVGGAPNPYIYPENLPRVNAHGGPGGAPGCWQSITHDFWPAPELVM
FT                   DTGNSLAPYNHLETGSPFVLEYVWGRQVGDYTINP"
FT   gene            478272..479312
FT                   /gene="mce1B"
FT                   /locus_tag="MMAR_0413"
FT   CDS_pept        478272..479312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="MMAR_0413"
FT                   /product="MCE-family protein Mce1B"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38880"
FT                   /db_xref="GOA:B2HMU1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU1"
FT                   /protein_id="ACC38880.1"
FT                   /translation="MKITGTAIRLGIFSLVLMLFSVMIIIVFGQIRFDRTYAYSAEFSN
FT                   ASGLRPGQFVRASGVEIGKVKSVSLIDGGKRVRVNFDVDRSVPLYQSTSAQIRYLDLIG
FT                   NRYLELKRGEGDGSDRIMPPGGFIPLSRTSPALDLDALIGGFKPVFRALDPDKVNTIAS
FT                   ALVTVFQGQGGTINDILDQTAQLTSQLAERDQAIGEVIKNLNTVLDATVRHRKDFDQTV
FT                   NNLEVLITGLNEHRDDLSGGIAHVSNAAGTVADLLGEDRALLHKTVNYLDAVQQPLIDQ
FT                   RQELADFLHKVPTALNMIGRAIGSYGDFVNFYSCDISLKINGLQPGGPVRTVRLFSQPT
FT                   GRCAPQ"
FT   gene            479309..480874
FT                   /gene="mce1C"
FT                   /locus_tag="MMAR_0414"
FT   CDS_pept        479309..480874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="MMAR_0414"
FT                   /product="MCE-family protein Mce1C"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38881"
FT                   /db_xref="GOA:B2HMU2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU2"
FT                   /protein_id="ACC38881.1"
FT                   /translation="MRTLEPPNRLRIGLMGIVVMLVVVGVGQSFTSVPMIFARPSYYGQ
FT                   FTDSGGINNGDKVRIAGLDVGKVEGLRIDGDHIVMKFSIGTNTIGTDSRLSIRTDTILG
FT                   KKVVEIEARGNQPLRPGGTLPLGQSTTPYQIYDAFFDVTRAATGWDIDTVKKSLHVLSE
FT                   TIDQTYPHLSSALDGVAKFSDTLGKRDDELKHLLAQANQVASVLGDRSAQVDRLLVNAK
FT                   TLLVAFNERGRAIDALLGNIASFSAQVQGLINDNPNLNHVLEQLRTVSDVLIERKEDLA
FT                   KGLEMVGAFLPSLNESIASGPFFKVVIHNLVPGQILQPFIDAAFKKRGLSPEDFWRSAG
FT                   LPEYRFPDPNGTRFPNGAPPPGPRVLEGTPDHPLPAVPPGSPCSYTPAADALPRPDNPL
FT                   PCAGVLEGPFGGFGFPAPLDGVESSPPNPNGLPPTPGIPIAGRPGEPAPDAPGTPVPLP
FT                   PDAPPGARTEPVGPAGPTPPPSTFAPGLPPGPPAPPGPGPQLPDPYITPGGTGGSGATG
FT                   GSQN"
FT   gene            480871..482478
FT                   /gene="mce1D"
FT                   /locus_tag="MMAR_0415"
FT   CDS_pept        480871..482478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="MMAR_0415"
FT                   /product="MCE-family protein Mce1D"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38882"
FT                   /db_xref="GOA:B2HMU3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU3"
FT                   /protein_id="ACC38882.1"
FT                   /translation="MSTIFDIRNIRLPKVSRATVIIGSLVLVLGLVAAFVGLKLYQKLT
FT                   NNTVVAYFPSANALYPGDKVQIMGLQVGKIDNIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRTIQLEPPYKGGPVLADNAVIPLERTQVPVEWDELRNSITNIIDKLGPTK
FT                   DQPTGPFGEVLESFANGLEGKGKQINTTLDSLSRALTALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDKQFVALNQNLADVTGRLVGYDRDLSNALQQFDSLLSTVRPFLDKNREVLTYDVN
FT                   NLAEATNTLLQPDPLNGLETALHVLPTAASNVNQIYHPAHGSVVAVPEITSFANPMQFV
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNAFNTAEVLPKQVAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWIVAPGMQGQQVGPITAGLMTPESLSELMG
FT                   GPDIEPVQSTLQTPPGPPNAYDEYPVLPPIGLQAPVPIQPPPPGPEVIPGPVAPTPAPG
FT                   PAPAPVGAPLPAEAGAGQ"
FT   gene            482475..483701
FT                   /gene="lprK"
FT                   /locus_tag="MMAR_0416"
FT   CDS_pept        482475..483701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprK"
FT                   /locus_tag="MMAR_0416"
FT                   /product="MCE-family lipoprotein LprK (MCE-family
FT                   lipoprotein Mce1E)"
FT                   /note="function unknown, but thought to be involved in host
FT                   cell invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38883"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU4"
FT                   /protein_id="ACC38883.1"
FT                   /translation="MRRGVSVMGAIGKSKQSAARRGVGAMRAVSRRAWQGLALLMVALV
FT                   LSSCGWRGISNVAIPGAPGTGKGSYTVYVQVPDTLAINGNSKVMVADVPVGSIRNIQLK
FT                   NWVATLTLGIDQGVKLPKNALAKIGQTSLLGSQHVELAAPPNPSSQLLKNGDTIPLKNS
FT                   SAYPNTEQTLASISLILRGGGIPNLEVLQNEVYDIFHGRGDQIRGFLTRLDTFTRQLNE
FT                   QRDDITHAIDSTNRLMAYVGGRADVVDRALTDLPPLIKHFADTRDLLINAVNSVGQLSD
FT                   VTGRYLSEARGNLHTDLQSLQCPLKELGRGSQYLIGALKLILTQPFDIDAVPKIFRGDY
FT                   QNVSATLDVTFSAMDNAVLTGTGFSGALRALEQSFGRDPETMIPDVRYTPNPNDAPGGP
FT                   LVERGDRQC"
FT   gene            483695..485248
FT                   /gene="mce1F"
FT                   /locus_tag="MMAR_0417"
FT   CDS_pept        483695..485248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="MMAR_0417"
FT                   /product="MCE-family protein Mce1F"
FT                   /note="function unknown, but thought involved in host cell
FT                   invasion"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38884"
FT                   /db_xref="GOA:B2HMU5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU5"
FT                   /protein_id="ACC38884.1"
FT                   /translation="MLTPFIKRQLIMFGTLTVLSLLVLGVYYLQIPALLGVGRYPLKAE
FT                   LPASGGLYPTANVTYRGITIGKVTGVEPTATGVEATMSIDSRYKIPVDASANVHSVSAV
FT                   GEQYLDLVSTGAPAKFLSPGQTITKGTVPSEIGPALDTANRGLEVLPADKIPVLLDETA
FT                   QAVGGLGPALQRLVDATQAIVGDFHTQINDVNDIIQNSGPILDSQVNSGDAISRWAHNL
FT                   NVLATQTAERDQNVKSILTQAAPTADQLNSVFSDVRDSLPQTLANLEVVFDLLKRYHKG
FT                   LEQVLVFLPQGASIAQTVAAPFPNMAALDMALAINQPPPCLTGFIPAEQWRSFADTSLQ
FT                   PLPKGTYCKIPMDTPANSVRGSRNIPCVDVPGKRAATPRECRDPKPYVPAGTNPWYGDP
FT                   NQLLTCPAPGARCDQPVKPGLVAQAPSVNNGMNPAPADKLPPGGTPPPISDPLQRPGSG
FT                   TVQCNGQQPNPCVYTPGPPTAVYSPQSGELVGPDGVKYSVENSTKTGDDGWKEMLAPAG
FT                   "
FT   gene            485341..486021
FT                   /locus_tag="MMAR_0418"
FT   CDS_pept        485341..486021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0418"
FT                   /product="conserved Mce associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38885"
FT                   /db_xref="GOA:B2HMU6"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU6"
FT                   /protein_id="ACC38885.1"
FT                   /translation="MTTEDSAESEAAPDSTDQPEPEAAAEPEASAGSDDAAQEQAEDTE
FT                   QSGDGQAVEPGVERRPSRLGRGWLVGISAVLLLAAGGIGAGGYLALRSHQESQVIARND
FT                   AAALEAAKDCVAATQAPDTSAMAASEQKIIDCGTDQYRSQAVLYSSMLVQAYQAANVHV
FT                   QLTDMRAAVERNNPDGSVDVLVALRVKMSNDQDQNQETGYRLRVRMTPTEGQYKISKLD
FT                   QVAK"
FT   gene            486018..487007
FT                   /locus_tag="MMAR_0419"
FT   CDS_pept        486018..487007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0419"
FT                   /product="conserved Mce associated transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38886"
FT                   /db_xref="GOA:B2HMU7"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU7"
FT                   /protein_id="ACC38886.1"
FT                   /translation="MTVVVDKIETTDVVAELPQKVLAPWHLRLGAFAVDVLSGAAVVAT
FT                   LGLVAETVPPDSVWWWVCVSLLALVVLVMAANRLLLPPILGWSLGRALCGITVVRRDSH
FT                   DGDDALGPWLLLVRDLAHLLDTLPLLIGWLWPLWDSRRRTFADLLLRTEVRYRDPEQRP
FT                   AHVRQWTVAALLTAAALCVGGSALSYGLVYARDQATDQTRAEIATQGPKIVAQMLTYDP
FT                   STLQEDFARARSLTTDKYREQLAVQQETVAKGHPVLNEYWVTDSSIQAATPDHATMLMF
FT                   MQGRRGSPPEIRYISATVRVSFAKDGANQWRVDDLTVLTKPKPPGNGK"
FT   gene            487004..487561
FT                   /locus_tag="MMAR_0420"
FT   CDS_pept        487004..487561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0420"
FT                   /product="conserved Mce associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38887"
FT                   /db_xref="GOA:B2HMU8"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU8"
FT                   /protein_id="ACC38887.1"
FT                   /translation="MSPRRKFVPGEASLLVASYPEVPKRQWGLPLAATAAAVLMAAAIT
FT                   VCSLMFASHVTRYHAARKDHEVVNSVKSFMSEFTSVDPYHANEYIEGILAHATGDFAKQ
FT                   YREKANEILIQIARAEPATGTVLDAGVERWNDDGSANVLVATEVTSKSPDGKQVFENTN
FT                   RWAATAKWEGNQWKISNLLQVI"
FT   gene            487528..488349
FT                   /locus_tag="MMAR_0421"
FT   CDS_pept        487528..488349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0421"
FT                   /product="conserved Mce associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38888"
FT                   /db_xref="GOA:B2HMU9"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMU9"
FT                   /protein_id="ACC38888.1"
FT                   /translation="MEDQQPAAGDLTDAVSDGETEAAAAASDDEAQPDEAVQTPAAEAE
FT                   PAEGAADDEATTDSVEDTGEASADSTDPDTDADADADAEADGAKGKAAARRARPKRLTG
FT                   RRLAAVGAAITALLFVGSAAFAGAAVQPYLADRAVVAIKLNVARTAANAITTLWTYNPE
FT                   NMDGLPDRAATYLSGDFGAQYRKFVDTIVAPNKQAKITNNTEVTGVAVESLDGPNAIAI
FT                   VYTNTTTTSPLTKNIPSMKYLSYRLIMKRDRSRWFVTRMTTITSLDLTPRV"
FT   gene            complement(488417..489562)
FT                   /gene="lprO"
FT                   /locus_tag="MMAR_0422"
FT   CDS_pept        complement(488417..489562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lprO"
FT                   /locus_tag="MMAR_0422"
FT                   /product="lipoprotein LprO"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38889"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV0"
FT                   /protein_id="ACC38889.1"
FT                   /translation="MGRMCLMLGGLLLDLGRKGYLVLTAFASLRRLTACFAVLAVCATL
FT                   ATTTGRPLARAADGREMLEHAIATTRGSYLVYNFGGGHPMPLLNGAGHWYEMNNGGHLM
FT                   IVKNASQRLQPHLLVDTHTGDQARCERNPGARTSEGLWQASEIYPPLQAWQRMGQPTIA
FT                   INANFFDVRGQKGGSWRTTGCSSPLGAFVDNTHGMGRANQAVTGTVAYAGKQGLSGGNE
FT                   VWTSLTTMIIPVGGAPYVLRPKGRQDYDLATPVIQDLLNKNAKFVAVAGIGLLSPGDIG
FT                   QLHDGGPSAARTALAYSKPKDEMYIFEGGSYTPDNIQDLFRGLGSDTAILLDGGGSSAI
FT                   VLRRDTGGMWAGAGAPKGSCDTRQVLCDSHERALPSWLAFN"
FT   gene            complement(489608..490981)
FT                   /locus_tag="MMAR_0423"
FT   CDS_pept        complement(489608..490981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0423"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38890"
FT                   /db_xref="GOA:B2HMV1"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV1"
FT                   /protein_id="ACC38890.1"
FT                   /translation="MSQSQPRHAAPNPKRSIKSLRTVRFWTAPVVITLALMSALAALYL
FT                   GGILNPTTNLRQFPIALVNEDAGPAGKQIVDGIVAGLDKNKFDVRVVDHEQAQRLLDRA
FT                   QVYGSAVIPPTFSSQLRDFAVSAVQPGSTDRPVITISTNPRAGTLGASIAGQTLTQAMA
FT                   AANSKVGERVTAEVAAQTGGAPLSGASALGLASPIDVKTTVYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSLLGYVPAEFGPVYRFAEQVNISRFRTLLLKWGLMTVLAL
FT                   LTSAVYMAIAHGLGMPIPAGWKLWLYGVFAITAVGVTSSSLIAVLGSMGLLASMLVFVI
FT                   LGLPSAGATVPLEAVPPFFRWLAKFEPMHQVFLGVRSLLYLNGQPESGLSHALLMTAIG
FT                   LVIGLLLGGLTTHLYDRKGFHRIPGAVEMAIAAEHQAQHQAKERARDRDSTESSSEET"
FT   gene            complement(491031..491756)
FT                   /locus_tag="MMAR_0424"
FT   CDS_pept        complement(491031..491756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38891"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV2"
FT                   /protein_id="ACC38891.1"
FT                   /translation="MPATVQIRRAADRAVTTTSWLTSRHSFSFGDHYDPDNTHHGLLLV
FT                   SNDDVVQPRSGFDTHPHRDMEIVTWVLEGELTHRDSTGNHGVIYPGLAQRMSAGSGILH
FT                   SETNDSQSQPVHFVQMWVAPDETGITPSYQQREIDHRLFDGGLVTVASGIPGQDAAITL
FT                   HNRHAALHCARLRPGDTIDLPSASYLHLFVARGRLGLESFGDVSTGDAVRFTDVEAPRL
FT                   SAHAPAEVLIWEMRAILGS"
FT   gene            complement(491956..493383)
FT                   /locus_tag="MMAR_0425"
FT   CDS_pept        complement(491956..493383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0425"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38892"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV3"
FT                   /protein_id="ACC38892.1"
FT                   /translation="MAGSLRVAPVPGKPALLLGAFDLGGLGYVVEEFFVSGTAHSYVPA
FT                   AELGADGRWDVIPSDTADYTTRMVVLTPADPARFNGTVLLEWLNVSGGIDAPAVWMMAH
FT                   REIVRAGYAYVAISAQRVGVEGGPSLLGADLSLKNQDPPRYRSLHHPGDAFCYDIFSQA
FT                   GGLLRDADRHDLLRGLRLQHLVAMGESQSAMFLTTYINAVDPLAEIYDGFLVHSRFASA
FT                   APLDGGSVFEESETPQAVTFRPDLRVPLITIITETDLFGGVRQGYVYARQPDNQWLRVW
FT                   EIPGAAHADNYTIQVAPIDTGDAPLDAIVAAYAPTDTLMGRQLDYYINFAPQHHYVVQA
FT                   AVSALSSWVRTGEPAPHAARIAMHDSDLPRPVLDRNGLATDGIRTPWVDVPIARTSGHG
FT                   AQDSIMAAIFGSGEPFDAATLDRLYPGGAQQYLDNFSAALDRTIESGFILSADRGEILQ
FT                   LATATFPGSGSQRPTRR"
FT   gene            complement(493386..494417)
FT                   /gene="sigG"
FT                   /locus_tag="MMAR_0426"
FT   CDS_pept        complement(493386..494417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigG"
FT                   /locus_tag="MMAR_0426"
FT                   /product="alternative RNA polymerase sigma factor SigG"
FT                   /note="the sigma factor is an initiation factor that
FT                   promotes attachment of the RNA polymerase to specific
FT                   initiation sites and then is released"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38893"
FT                   /db_xref="GOA:B2HMV4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV4"
FT                   /protein_id="ACC38893.1"
FT                   /translation="MSALAGNSTQNSIANFTAPTAERERPAGDEFAVHAEPYRRELLAH
FT                   CYRMTGSVHDAEDLVQETLLRAWKSYHRFEGKSSLRTWLHRIATNTCLSALEGRQRRPL
FT                   PTGLAASGSDPTAPLVERAEVPWLEPLPDLMADPADPSVIVGSRESVRLAFVAALQHLS
FT                   PRQRAVLLLRDVLQWKAAEVAEAIGTTTVAVNSLLQRARAQLETAQPSADDGLVAPDSP
FT                   EAQDLLTRYITAFEAYDIDRLVEIFTAEAIWEMPPYAGWYQGARDIITLIHQQCPAECP
FT                   GDMRLIPLVANGQPAAAMYMRAGETHVPFQLHVLDMVDGRVSHVTAFLDGSLFPKFGLP
FT                   ASI"
FT   gene            494479..495318
FT                   /locus_tag="MMAR_0427"
FT   CDS_pept        494479..495318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0427"
FT                   /product="lysophospholipase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38894"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV5"
FT                   /protein_id="ACC38894.1"
FT                   /translation="MNTTRTERTFDGVGGVHIVYDVWTPDAAPKAVVVLAHGLGEHARR
FT                   YDHVAQRLGAAGLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATRDNPGLKC
FT                   IVLGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVIAAAAKVLGVVVPGLPV
FT                   QELDFTAISRDPEVVAAYQNDPQVYHGRVPAGIGRALLQVGETMPRRAPALTAPLLVIH
FT                   GTDDRLIPIEGSRRLVGHVGSADVELKEYPGLYHEAFNEPERDQVLDDVVSWITARL"
FT   gene            495365..496114
FT                   /locus_tag="MMAR_0428"
FT   CDS_pept        495365..496114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38895"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV6"
FT                   /protein_id="ACC38895.1"
FT                   /translation="MTDDKMLARIAALLRQAEGTDNAHEADAFMSAAQRLATAASIDLA
FT                   VARSHSAHRSAASAPTQRTITIGTAGTRGLRTYAQLFVLIGAANDVRCDIATNSTFLYA
FT                   YGFTEDIDATHALYASLVVQMVRASDGYLATGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   EAREQAKTEVAMDRSRAPGTEIALRDKELELRDHYRSASQARGTWRATRASAGYSSAAR
FT                   RAGDRAGRQARLGKSPELPGARTALDR"
FT   gene            496111..496635
FT                   /locus_tag="MMAR_0429"
FT   CDS_pept        496111..496635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="function unknown, probably involved in a cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38896"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV7"
FT                   /protein_id="ACC38896.1"
FT                   /translation="MTAAESSKRDFQRAKVYAAEEFVRTLFDRAAEHGTPSVEFFGTQL
FT                   TLPPEGRFASVSSVQSYVDSVLGLPAVRQHWPAVSPLRVRARQAATAAHYENRGGVGTI
FT                   AVPGAGPGRGAGDWAMRELVVLHEVAHHLCQVPPPHGPEFVATMCTLAELVMGPELGHV
FT                   LRVVYAKEGVR"
FT   gene            496632..498767
FT                   /gene="bglS"
FT                   /locus_tag="MMAR_0430"
FT   CDS_pept        496632..498767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglS"
FT                   /locus_tag="MMAR_0430"
FT                   /product="beta-glucosidase BglS"
FT                   /note="possibly involved in degradation [catalytic
FT                   activity: hydrolysis of terminal, non-reducing beta-D-
FT                   glucose residues with release of beta-D-glucose]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38897"
FT                   /db_xref="GOA:B2HMV8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV8"
FT                   /protein_id="ACC38897.1"
FT                   /translation="MSSSGHNAPADVRARQVESEMTDEERFSLLLGVMGAGDLWPLRDE
FT                   RIPADVPMSAGYVPGIARLGVPALLMSDAGLGVTNPGYRPGDTATALPAGLALAASFNP
FT                   ALARSAGEVIGREARSRGFNVQLAGAMNLARDPRNGRNFEYLSEDPFLTAAMVAESIIG
FT                   IQQQGVISTVKHFSLNCNETNRHWLDAVIDPDAHRESDLLAFEIAIERAQPGAVMAAYN
FT                   KVNGVYAAANGELINEVLKGAWGYRGWVMSDWGGTPGWECALGGLDQECGAQIDAILWQ
FT                   SEAFGDPLRAAYHEGRLPKARLSEMVRRILRSMFAVGVDRWEPAPAPDMDAHDEVAAEI
FT                   ARQGIVLLQNRGVLPLTPAPGTRIAVIGGYAQLGVVAGYGSSAVVPPGGYAEVIPIGGA
FT                   GLTAGVRNLYLLGSSPLDELRTQFGNAELEFDPGINPAEAVAVARRADVAVVFAIRAEG
FT                   EGFDSADLTLPWGQDAVISAVAAANPNTVVVLETGNPVAMPWQDSVNAIVQAWYPGQAG
FT                   ARVIAEVLAGRVNPCGRLPITFPVGLGQTPRPELPGYGAPVGAPMRIHYREGADIGYRW
FT                   FATTGEVPNFAFGHGLTYTSFGYRDLAVSGGDTVTVTFGVANTGDRSGADVPQVYLTAV
FT                   TGEPRLRLLGFERVELEPGQSCAVEIVADPRLLACYDGAAGCWRIEAGTYTVAVGASAA
FT                   ALSAVAEVELAGRTFGR"
FT   gene            complement(499089..502493)
FT                   /locus_tag="MMAR_0431"
FT   CDS_pept        complement(499089..502493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0431"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38898"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMV9"
FT                   /protein_id="ACC38898.1"
FT                   /translation="MTFVLVSPEAMASAAADIERIGALLTQGNAAAASPTINVASAAAD
FT                   EVSTAIAALFSQHAKTYQLLAAELAAIPDRFTKTVLASANSYASAEATNAADALLGVIN
FT                   TPTQALLGRPLIGNGANGTTVNGVGTPGGDGGILYGNGGNGGTSTNAATAGGAGGSAGL
FT                   IGNGGIGGQGGAGGIGGAGGSAAFFGNGGAGGHGGAGGAGGIGGNGGFFGNGGAGGAGG
FT                   NGSTGGVGLAGGDGGAGGAGGRAGLLGYGGAGGAGGLGGSGGAGLPNQQSGNGGGGGHG
FT                   GAGGAAGWFGHAGVGGDGGTGGAGGNGQAGQLSNDVGGDGGRGGAGGAAGAGGDAGLLG
FT                   LNGAGGHGGGGGMGGTGGTGAAAAAGINAAAGGTGGDGGAAGAGGAAGVGGFGGSAGSY
FT                   GNGGGGGNGGTGGAGANAVAGTGDNGSDGAAGGQGGSGGNSGAGGTNGSGGNGGLGGAG
FT                   GDGGSGTADTGGGAGNGGSGGKGGTGGVSGVAGGGGAGGTGGTGGTGGAGGTGGNGAAG
FT                   KSDTGDIGGSGGYGGDGGNGGNSLPGGTNGAGGTGGTGGEGGGGGTGTPDTGSGGGDGG
FT                   DGGYGGYGGSGGLPGHGDGADGVAGTGGKGGAGGAAGTGANATAGTDRYGGYGGDGGGG
FT                   GGGGYGGNSIRGTGGVGGEGGTGGNSAAGGTSGDGTQVAWGRGGDGGDGGQGGYGGAGS
FT                   FEQPGGTGGAGGTGGTGGNSGTGGTSGNGGTGGTGGGGGYGGPGDYNENGYAGGSGGTG
FT                   GTGGDPGTGGTAAVGGDGGTGGIGGGGGYGGTGFDAAGAMGGIGGTGGTGGNPGPGGIG
FT                   GNGGDGGTGGPGGYGDTGFGTAGYAGGTGGTGGTGGAPGPGGSAAGNGGGGGIGGIGGT
FT                   GGSGATTAGFAGGDGGKGGTGGTGGSAGAGAANGSGGTGGQGGYAGKGGYGGITNGTYE
FT                   GMPGGVGGTGGAGGEGGLPGTGAGTAGSIGSAGNGGEGGFGGTGGNSYYAGNAGPGGQG
FT                   GQGGAGANGAPGLAGGTGGAGGFGGTGGIANGTGNGGTGGKGGTGGDGGTGGTATTAGQ
FT                   TGGDGGDGGKGGGGGTGGKANGGDGGDGGDGGDGGAGGAGGNGDGAVGGIGGGGGTGGT
FT                   GGTGTPPGGANGGPGKTGADGLGGHTS"
FT   gene            complement(502719..504413)
FT                   /gene="ilvD"
FT                   /locus_tag="MMAR_0432"
FT   CDS_pept        complement(502719..504413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="MMAR_0432"
FT                   /product="dihydroxy-acid dehydratase IlvD"
FT                   /note="involved in valine and isoleucine biosynthesis (at
FT                   the fourth step) [catalytic activity: 2,3-dihydroxy-3-
FT                   methylbutanoate = 3-methyl-2- oxobutanoate + H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38899"
FT                   /db_xref="GOA:B2HMW0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW0"
FT                   /protein_id="ACC38899.1"
FT                   /translation="MPEADIKPRSRDVTDGLEKAAARGMLRAVGMVDEDFAKAQIGVAS
FT                   SWNEITPCNLSLDRLAKSVKEGVFAAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVI
FT                   ADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGVAKLSDGS
FT                   EREVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANTMASAAEALGMS
FT                   LPGSAAPPATDRRRDGFARQSGQAVIELLRQGITARDIMTREAFENAIAVVMAFGGSTN
FT                   AVLHLLAIAHEANVELTLDDFSRIGSKVPHLADVKPFGRHVMSHVDHIGGVPVVMKTLL
FT                   DAGLLHGDCLTVTGRTVAENLEAIAPPDPDGKVLRALNNPIHATGGITILRGSLAPEGA
FT                   VVKTAGLDTDVFEGTARVFDGERAALDALEDGTITHGDVVVIRYEGPKGGPGMREMLAI
FT                   TGAIKGAGLGKDVLLLTDGRFSGGTTGFCVGHIAPEAVDAGPIAFVRDGDRIRLDVAGR
FT                   TLDVLTDPAEFAARQQNFTPPAPRYKTGVLAKYVKLVGSAAIGAVCG"
FT   gene            504553..504843
FT                   /locus_tag="MMAR_0433"
FT   CDS_pept        504553..504843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38900"
FT                   /db_xref="GOA:B2HMW1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW1"
FT                   /protein_id="ACC38900.1"
FT                   /translation="MTTAHGYSQQKENYAKRLRRIEGQVRGIARMIDEDKYCIDVLTQI
FT                   SAVNSALRSVALNLLDEHLNHCVTRAVAEGGTDADGKLAEASAAIARLVRS"
FT   gene            504961..506217
FT                   /locus_tag="MMAR_0434"
FT   CDS_pept        504961..506217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0434"
FT                   /product="conserved integral membrane protein"
FT                   /note="function unknown, possibly involved in transport of
FT                   drug across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38901"
FT                   /db_xref="GOA:B2HMW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW2"
FT                   /protein_id="ACC38901.1"
FT                   /translation="MTSEARTATTAARPWTPRVAAQLSVLAAAAFIYVTAEILPVGALS
FT                   AIARNLHISVVLVGTLLSWYALVAALTTVPLVRWTAHWPRRHALMVSLVCLTISQLISA
FT                   LAPNFAVLAAGRALCAITHGLLWSVIAPIATRLVPPSHAGRATTSIYIGTSLALVIGSP
FT                   LTAALSLMWGWRLAAVCVTVAAAVVTVAARLLLPEMVLSADQLQYVGPRSRHHRNRALI
FT                   IVSLITMVGVTGHFVSYTYIVVIIRQVVGVRGPSLAWLLAAYGVAGVVAVALVARPLDR
FT                   RPKGTIIFCVAGLTFAFVLLTALAFGGHLAPMTALVVGTGAIVLWGAAATAVSPMLQSA
FT                   AMRSGADDPDGASGLYVTAFQVGIMAGSLIGGLLYERSVAMMLTASAGLMGVALVGMTS
FT                   ARRVFEAPVAVAGATSHNQ"
FT   gene            506337..507362
FT                   /locus_tag="MMAR_0435"
FT   CDS_pept        506337..507362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0435"
FT                   /product="conserved secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38902"
FT                   /db_xref="GOA:B2HMW3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW3"
FT                   /protein_id="ACC38902.1"
FT                   /translation="MSRWTRGRIRGSLFAAVNAAGVVGVLLLGAGPAVADPDDAPGDPP
FT                   VIAPAEPAPDPLAPPPGPLALPPMPDPLAPPPFPDPLAPPPLVPVAAGPVAGQDPTPFF
FT                   GPPPFRPPSFNPVDGAMVGVAKPIIINFQVPIADQAMAESAIHISSIPPVPGKFYWMTP
FT                   TQVRWRPFQFWPANTAVNIDAAGTKSSFRTGDSLVATADDATHQMTITRNGVVEQTFPM
FT                   SMGMAAGNHQTPNGTYYVLEKMPTVVMDSSTYGVPVNSPQGYKVTVADAVRIDNSGNFV
FT                   HSAPWSVGDQGKRDVSHGCINLSPTNAKWFFDNFGSGDPIVVKNSVGTYNKNDGAQDWQ
FT                   I"
FT   gene            507560..508156
FT                   /locus_tag="MMAR_0436"
FT   CDS_pept        507560..508156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0436"
FT                   /product="transcriptional regulatory protein"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38903"
FT                   /db_xref="GOA:B2HMW4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW4"
FT                   /protein_id="ACC38903.1"
FT                   /translation="MPSPRERMVISAVLLIRERGARATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGAHVAKIIGSANRSLDLLDTLIDQYREQLRATDFRAGCPVAAVSV
FT                   EAGEPSDRERMAPVVEHAAAVFDRWSDLIAQRFVSDGIPLDSAHELAVTAMSTLEGALL
FT                   LARVRRDLTPLDVVHRQLRSMLLAQLPEGNRNDHN"
FT   gene            508143..510380
FT                   /locus_tag="MMAR_0437"
FT   CDS_pept        508143..510380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0437"
FT                   /product="oxidoreductase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38904"
FT                   /db_xref="GOA:B2HMW5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW5"
FT                   /protein_id="ACC38904.1"
FT                   /translation="MTTTDWQPTACILCECNCGIVVQVEDRTLAHIRGDKAHPASRGYT
FT                   CNKALRLDHYQNSRGRLTAPLRRRPDGTYEEIDWDTAIVEIAEGFKRIRDVHGGDKIFY
FT                   YGGGGQGNHLGGVYSGAFLKALGSRYRSNALAQEKTGEAWIDGKLYGGHTRGEFEHAEV
FT                   SVFIGKNPWMSQSFPRARVVLNEIAKDPARSMIVIDPVVTDTAKMADFHLRVRPGADAW
FT                   CVAALAAVLVQENLCDEAFLAEHVRGVEEVREVLAEVPVAEFAQRCGVDEELLRAAARR
FT                   IGGAASVAVFEDLGVQQAPNSTLVSYLNKMLWILTGNFAKKGGQHLHSSFAPLFSMTSG
FT                   RTPVTGARIIAGLVPGNVVPEEILTDHPDRFRAMIVESANPAHSLADSAACRQAFEALE
FT                   LMVVIDVAMTETARLAHYVLPAASQFEKPEATFFNLEFPHNAVHLRHPLLDPLPGTLPE
FT                   PEIWARLVRALGFVTDDDLRPLREAAQRGRQAYTEAFLVAVASNPSVAKLLPYVLYETL
FT                   GPTLPDGMAGAAALWGLAQKTAMTYPDAVRRAGHTDGNALFDAILNGRSGVTFTAHNYE
FT                   DDFELINNDDHKIALGIPEMLDEIRSLADLKMSLTTTELPIVLSVGERRAYTANDIFRD
FT                   PSWRKRDADGALRVSVEDAQALGLTDGCRARITTAAGAAEATVEVTEVMLPGHASLPNG
FT                   FGLDYVDGDGRTVVPGVAPNALTSTKWRDPYAGTPWHKHVPARIEACRADA"
FT   gene            complement(510437..512431)
FT                   /locus_tag="MMAR_0438"
FT   CDS_pept        complement(510437..512431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0438"
FT                   /product="zinc metalloprotease"
FT                   /note="function unknown, hydrolyzes peptides and/or
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38905"
FT                   /db_xref="GOA:B2HMW6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW6"
FT                   /protein_id="ACC38905.1"
FT                   /translation="MTYAAVRSGIDLSHVDPDARPQDDLFGHVNGRWLKEYDIPADRAT
FT                   DGAFRHLFDRAEEQVRELIIEASQQGAATGTDEQRIGDLYASFLDEETVERVGLQPLHD
FT                   EVTAIDDAADRDALAAAIGALQRTGMGGGVGLYVDTDSKDSTRYLMHFSQSGIGLPDES
FT                   YFREERHAAVLAAYPGHIARMFSLVFGGDSTDHADVAARIVALEAKLAAAHWDVVKRRD
FT                   AELTYNLRTFAELQTEGSGFDWTGWVTAVGTTPAAVAELVVRQPDYLRTFASLWTSESL
FT                   EDWKCWARWRLIRARAPWLTSDLVAEDFEFYGRRLTGAEQIRDRWKRAVALVESLTGDA
FT                   VGKLYVQRHFPPDAKDRVDKLVANLREAYRVSITDLDWMTPQTRERALTKLAKFTAKVG
FT                   YPVRWRDYSKLVIDRGDLYGNFRRGYAVDHDRELAKLGGPVDHDEWFMTPQTVNAYYNP
FT                   GMNEIVFPAAILQPPFFDAQADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWW
FT                   TDADRTEFAHRTKALIDQYEAYVPRDLAASEGPPHVQGAFTVGENIGDLGGLSIALLAY
FT                   QLSLQGKRAPVIDGLTGVQRVFFGWAQVWRTKSRDAEAIRRLAVDPHSPPEFRCNGVVR
FT                   NLDAFYDAFDVAEDDELFLTPQSRVRIWN"
FT   gene            512474..513121
FT                   /locus_tag="MMAR_0439"
FT   CDS_pept        512474..513121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0439"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38906"
FT                   /db_xref="GOA:B2HMW7"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW7"
FT                   /protein_id="ACC38906.1"
FT                   /translation="MPDDAAADTAKDSDPDSADSAPAATEGESSGEGMFSSYGVGSAFL
FT                   GVLSVAAVVLGVLIWIGHRDEISERVYLTRVMQAAAEWTDVLINMNAGNIDSSLQQLHD
FT                   GTVGQLNTDFDAAVQPYRQVVEKLQTHSSGRIEAVAIETVHRDLDTRPGTARPVVTTKL
FT                   PPFASRTDSVLLVATSVAENAGVKPQTVHWSLRVEVSDVDGKLLVSGLASIR"
FT   gene            513118..513807
FT                   /locus_tag="MMAR_0440"
FT   CDS_pept        513118..513807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0440"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38907"
FT                   /db_xref="GOA:B2HMW8"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW8"
FT                   /protein_id="ACC38907.1"
FT                   /translation="MRNAWRLAAFDILAPLVAIAALVMIGFILGWPWWWISACSVLVLL
FT                   VLEGVAVNFWLFRRDAVTVGTDDEAPGLRLAVVFLCTAALVAAVLTGYTHWTSPDRDFN
FT                   RDSRRVVAIATGMAEAVASFSPGAPNASADRAAAMMVPERVAEFKAQYAKSSADLVQHK
FT                   ITAQADTLSAGVEALGPSAASVAVILRVTQNSPGQPPSQAAPALRVSLTKRGNDWLVLD
FT                   VVPINSR"
FT   gene            complement(513794..514333)
FT                   /locus_tag="MMAR_0441"
FT   CDS_pept        complement(513794..514333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38908"
FT                   /db_xref="GOA:B2HMW9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMW9"
FT                   /protein_id="ACC38908.1"
FT                   /translation="MTLATDQRKPAQVQPPHRPDGDNREHFVDQPVEFWPTAAIRSALQ
FT                   SGDIATWKRIAAALKRDPYGRTARQVEEVLGGARPIGISKALWEVLDRARAHLEANERA
FT                   EVARHVKLLMDRSGLGQQEFASRIGVSPEDLAAYLDGSVSPSASLMIRMRRLSDRFVRV
FT                   KNTRAADSDQDAASGS"
FT   gene            complement(514330..517347)
FT                   /gene="mmpL11"
FT                   /locus_tag="MMAR_0442"
FT   CDS_pept        complement(514330..517347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL11"
FT                   /locus_tag="MMAR_0442"
FT                   /product="conserved transmembrane transport protein MmpL11"
FT                   /note="function unknown. thought to be involved in fatty
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38909"
FT                   /db_xref="GOA:B2HMX0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX0"
FT                   /protein_id="ACC38909.1"
FT                   /translation="MMRLSRNLRRFRWLVFTGWMLALVPAIYLALTQSGNLTGGGFEVA
FT                   GSQSLQVHDVLEAQYPDQGASSLALVATPRPDASYQDITDAVAQLRRIAGEFPGVSEVP
FT                   DPTQRPPQPDRPYVVSLRLDARNAGTSDLAKKLRARVGVEGDKPGQTADGRVRLYVIGQ
FT                   GALSAAAAANTKHDIAAAERWNLPIILIVLLAVFGSLTAAAIPLALGICTVVVTMGLVY
FT                   LLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRFREELRSGRQPQEAVDAAMATSGLA
FT                   VVLSGMTVVASLSGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALLHWSRRPESTQSRFWTRWVGWVMHRPWITALSASVVLLLMAAPAASMVLGNSLLRQ
FT                   FDSSHEIRAGVSAAAQALGPGALGPVQVLIKFPDGGASTPAHSQTVGAVRQRMAQGPNV
FT                   TTVAPPKFAEDNDSALLSAVLSVDPEDMGARHTVDWMRSELPQVAGGAQVDVGGSTALI
FT                   KDFDDRVSATEPLVLAFVALIAFVMLLISIHSVLLALKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWGERLGFPQLTSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLHTGRTRDAVAYG
FT                   VSTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATIVRLIMVPALMAM
FT                   FSQWNWWLPRWLGRILPSVDFDRPLPEVDLADVVVIPEDIAATIPPGADLRMVLKSAAK
FT                   LKQLAPDTICVADPLAFTGCERVGKGPERIPELVKDGLNLAGGTDTAGPGGAAEAKNGS
FT                   NGQSAARKAVGLAYRSGIARAMSWAERPVHPVTVWRGRLSIALDALETNASERRAGPGG
FT                   GREPSYRRRSPVETTNVQLPTGDRLLIPTGAETLRLKGYLIMSRNSSRDYAELADMVEA
FT                   MEPETAAVVLAGMDRYYCCQPPRRQWIATQLVRRLADPHPSDVDVEWPQPDDKADWEEV
FT                   RQRCLAVAVAMLEEAR"
FT   gene            517702..518211
FT                   /locus_tag="MMAR_0443"
FT   CDS_pept        517702..518211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0443"
FT                   /product="exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38910"
FT                   /db_xref="GOA:B2HMX1"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX1"
FT                   /protein_id="ACC38910.1"
FT                   /translation="MKSGNATKRRGLFAALVAVGLPGLALVTVAEPTATGATDPCAASE
FT                   VARTIGSVAKQTGDYLDSHPETNQAMTAAFQGSAGPQSFGSLKSYLEKNPKVASDLQSL
FT                   SQPLTNLSTQCRLPITLSQAVGLAQAAQDGGALSGLPAVGLPLTPGNLPVAAGPLPGPA
FT                   PANRAG"
FT   gene            complement(518213..519430)
FT                   /locus_tag="MMAR_0444"
FT   CDS_pept        complement(518213..519430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0444"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38911"
FT                   /db_xref="GOA:B2HMX2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX2"
FT                   /protein_id="ACC38911.1"
FT                   /translation="MSFDAPVRKLRQRVGALPRARGTEAPRGKYWWLRWAVLGIVAIVL
FT                   AVEVALGWDQLAKAWMSMYQAKWWWLLAAMVAAAASMHSFAQIQRTLLKSAGVHVRQLR
FT                   SEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVLQAVGLALLG
FT                   LGGAFFLGAKNNPFSLLFTLGGFIALLLLAQAVASRPELLEGIGRRVLAWVNSIRGRPA
FT                   ATGMEKWRQILMQLESVSLSRRDLGVAFSWSLFNWIADVACLGFAAYAAGDHASVAGLT
FT                   VAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMALPNAISAMLIYRLISWLFIAAIG
FT                   WVVFFFMFRTEKAADSDADDPPTDPNLAIVIPIPGELYEDPAETALQGPLPPPDRGCEG
FT                   NPGRVG"
FT   gene            519613..520782
FT                   /locus_tag="MMAR_0445"
FT   CDS_pept        519613..520782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0445"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38912"
FT                   /db_xref="GOA:B2HMX3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX3"
FT                   /protein_id="ACC38912.1"
FT                   /translation="MSASLDDASVAPLVRKTAAWSWRLLVILAALVALLLVIKKLEIIV
FT                   VPVLLALMLSALLVPVVDWLDARGLPRGAAVSLVLLGGFSILGGILTFVISQFIVGLPD
FT                   LAYQVEHSIDSSRKWLIEGPPHLRREQIDNAGNAAIEALHNNQAKLTSGAISTAATITE
FT                   LLTAAVLVLFTLIFFLYGGRNIWQYVAKIIPAHVRDRAMAAGRAGYGSLIGYVRATFLV
FT                   ALTDAAGVGTGLAVMGVPLALPLASIVFLGAFIPLIGALISGLLAVVVALLAKGLVYAL
FT                   LTLALLITVNQLEAHLLQPLVMGRAVSIHPLGVVLAISTGGVLAGIVGALLAVPTVAFL
FT                   NNAMRVLLAEDPIAEAQQQDQDPLALIAAQPDEPDEGTEAEAGADQTRP"
FT   gene            complement(520843..523725)
FT                   /gene="mmpL3"
FT                   /locus_tag="MMAR_0446"
FT   CDS_pept        complement(520843..523725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL3"
FT                   /locus_tag="MMAR_0446"
FT                   /product="conserved transmembrane transport protein MmpL3"
FT                   /note="function unknown. thought to be involved in fatty
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38913"
FT                   /db_xref="GOA:B2HMX4"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX4"
FT                   /protein_id="ACC38913.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVTVALCLGGGVFGLSLGKHVTQSGFYD
FT                   EGSQSVTASILGDEVYGRDRTGHIVAVFKAPDGKTVNDPAWSKKITDQLNQFVKDHPDQ
FT                   VLGWAGYLRAPDSTSPVIKGMATDDKKYTFVSIPLKGDDDDTILNNYKDIAPSLQKLDG
FT                   GTVQLAGLEPVAEGLTGTIATDQRRMEVLALPLVAVVLFLVFGGAVAACLPVMVGGLSI
FT                   AGALGILRLVAVFGPVHFFAQPVVSLIGLGIAVDYGLFVVSRFREEIAEGYDTETAVRR
FT                   TVMTAGRTVAFSAVLIMASGASLLMLPQGFVKSLTYALLAAVGLAALLSITLLPACLGV
FT                   LGRHVDALGVRTAFRVPFLRNWKVSRAYLNWLADRLQKTKTREEVEAGFWGNLTNRVMR
FT                   RPLVFAIPIVLGMILLVIPLFNLSLGGMSEKYLPPNNAVRQSQEHFDQLFPGYRTNPLT
FT                   LVIKSTNNQPVTDQQIADIRSKAMSISGFIDQDNDADSMWQERSYAPGGSKDPSVRVLQ
FT                   NGLINPGDAPTKLAELRAITPPKGLEIFVGGTPALEQDSIHSLFENMPAMLVILLTTTT
FT                   LLMFLAFGSVVLPIKAAVMSALTLGSTMGILTWIFVDGHGSGVLNFTATPLTAPVIALV
FT                   VAVGYGLATDYEVFLVSRMVEARENGMSTQEAIRIGTATTGRLITAAALVLAVVAGSFV
FT                   FSDLVMMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWMRRLQTRIGLGE
FT                   IQLPDERKRPANNGSARPPVKAALAAATARAPHDPTHPSAPEAARPSRSGGPARTELGS
FT                   AQSGPSSAGTKEIQTRASQPSDPPTTRLTAPGAPPARGSSNPAPPAQTRPTTPAPPAPA
FT                   PPPAPSAGQTRAMQIPTNRSSDTGGDPADPTAALPIQRPEGTDTEAATEQLNARGGQPD
FT                   GGENPRPRRRGAGGAGGLSAQDLLRREGRL"
FT   gene            complement(523831..524568)
FT                   /locus_tag="MMAR_0447"
FT   CDS_pept        complement(523831..524568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38914"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX5"
FT                   /protein_id="ACC38914.1"
FT                   /translation="MSLTEDVTTQGSDPVAEPPMVAGDLSRDGLSGSAAPAGRVLLVWD
FT                   APNLDMGLGSILGRRPTALERPRFDALGRWLLARTTQVSATAPDGPDVRVEPEATVFTN
FT                   IAPGSAEVVRPWVDALRNVGFAVFAKPKIDEDSDVDRDMLEHIDQRYREGLAALVVASA
FT                   DGQAFRQPLEKISRAGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLD
FT                   SLPEQGAWLQPFRPLSSLLNSRA"
FT   gene            complement(524606..525514)
FT                   /locus_tag="MMAR_0448"
FT   CDS_pept        complement(524606..525514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0448"
FT                   /product="S-adenosylmethionine-dependentmethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38915"
FT                   /db_xref="GOA:B2HMX6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX6"
FT                   /protein_id="ACC38915.1"
FT                   /translation="MPAATTRRQLLGINLDQERLRPGFMRHDGPMHVQPGVGLQSDTSS
FT                   STGTGSGPADEPEAEKSAWGYLPPTAFRSRHSALSSIQQQTWERLWPQLGRQATAHSQP
FT                   SARGHEPIDPIDARAWFGREAPVVLEIGCGSGTSTLAMAQAEPNVDVIAVEVYRRGLAQ
FT                   LLCAIDRADLQRINIRLIRGNGIDVLRDLIAPESLTGVRVFFPDPWPKARHHKRRLIQP
FT                   STVALIADRLLPGGVFHAATDHPGYAEHIIAAGDAEPALARVDPGVDSLPVSVVRPTTK
FT                   YEMKAHNAGSSINELIWKKQR"
FT   gene            525604..526716
FT                   /locus_tag="MMAR_0449"
FT   CDS_pept        525604..526716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38916"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX7"
FT                   /protein_id="ACC38916.1"
FT                   /translation="MQTGHQAFVDELTCLAASTADQRIRSIAERAARPLRVAVRGRRGV
FT                   GRNTLVRALDGAGSAAGLAATSGGDPADVVVYALAEVVKPEDRAGIAVLEPTERPVLAV
FT                   LTMADKTDVFGFAGAGPMAGALQRCELLSTLAGVPVEPISALLAVAALDDLDGRSWYAL
FT                   RALAAHPAAGAALDGSHAGFLSADLGVPTGQRLRLLESLDLFGVAIAIEALRRGAARTQ
FT                   VRALLRKISGIDAVVANAVAAGAGVRYGRVLEAVAALEVLAVADEQVSEFLAGEAAVLA
FT                   RMSAALDAASAWGLDPFGAAVPPDDPGAQLQRALRWRRHRSQRGPAAESPDSDLRRWCG
FT                   ADIVRGSLRLWSRAAGSLACAGPPEGGRPR"
FT   gene            526713..528266
FT                   /locus_tag="MMAR_0450"
FT   CDS_pept        526713..528266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0450"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38917"
FT                   /db_xref="GOA:B2HMX8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMX8"
FT                   /protein_id="ACC38917.1"
FT                   /translation="MIGSAHHEAVARVDELVLAIGPKLGAPSINRRDVVLVTGPWLAGT
FT                   SSVITALRRRLPQHRFVESPWLGAGAVPTAVVFVVSAATPMTESDCALLDAAAGHTDVV
FT                   IAAVTKIDLHRTWREVLAANRAKLAAHAPRYGAVPWVGVAAAPQLGPPGVDDLVATVRT
FT                   ELAAPDIARRNRLRAWQAGLLLAGQRFNRDAAGAGRRARVDGLREERGSVLQRRRQDRT
FT                   GRTIALRGQIQQARVQLCYFARSRCASVRTELQEDIAGLARRRLADFQSYARGRIDEIV
FT                   TEVGDGITAQLVGVSREMSLPVDFPPADPLPAVAMPAPPLASRRLETRLMMVLGVGFGL
FT                   GVALTLSRLLAGLAPGLDLGLTLAGILGCVVVGLAVALWVVRTRALLADRAVLERWTAD
FT                   VLLSLGCTLEQLVASRVLAAETLLATALWGSDEAANARAAAQVSAIDSELREHARAAAR
FT                   AAARRDREMPTIRAALEAVCAELGESGTSSGTATPGTATAGGGAGLPRHSEANGRDFGS
FT                   "
FT   gene            528469..530298
FT                   /gene="pckA"
FT                   /locus_tag="MMAR_0451"
FT   CDS_pept        528469..530298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="MMAR_0451"
FT                   /product="iron-regulated phosphoenolpyruvate carboxykinase
FT                   [GTP] PckA"
FT                   /note="rate-limiting gluconeogenic enzyme [catalytic
FT                   activity: GTP + oxaloacetate = GDP + phosphoenolpyruvate +
FT                   CO2]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38918"
FT                   /db_xref="GOA:B2HMX9"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HMX9"
FT                   /protein_id="ACC38918.1"
FT                   /translation="MTSATIPGLDTAPTNHQGLLSWVQEVAELTQPDRVVFADGSDEEF
FT                   HRLSAQLVDAGTFTRLNDEKFPNSYLALSDPSDVARVESRTFICSEREIDAGPTNNWMD
FT                   PSEMRTLMTDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMKVMTRMG
FT                   TAALEKMGQDGFFVKALHSVGAPLEDGQADVPWPCSDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMARDEGWLAEHMLILKLISPENKAYYIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETLGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGN
FT                   TVFTNVALTDDGEVWWEGLEGDPQHLVDWKGNEWYFRETETTAAHPNSRYCTPMSQCPI
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLVTQARDWQHGVFIGATLGSEQTAAAEGKVGN
FT                   VRRDPMAMLPFMGYNVGDYVQHWIDIGKNSDESKLPQVFFVNWFRRGEDHRFLWPGFGE
FT                   NSRVMKWIVDRIEHKAGGKTTPIGTVPTVEDLDLEGLDANPADVSEALAVNAQEWREEL
FT                   PLIEEWLQFIGEKLPTGIKDEFDALKERLRDAE"
FT   gene            530308..531831
FT                   /gene="fadD4"
FT                   /locus_tag="MMAR_0452"
FT   CDS_pept        530308..531831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD4"
FT                   /locus_tag="MMAR_0452"
FT                   /product="fatty-acid-CoA ligase FadD4"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38919"
FT                   /db_xref="GOA:B2HMY0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY0"
FT                   /protein_id="ACC38919.1"
FT                   /translation="MQIRQHVGADKPAVILHPSGTVVSFDELEARANRLAHRFRRAGLR
FT                   EGDAVAILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEAAYIIENSGAKAIVGSAAL
FT                   RDTCAGLGEHLRAGPPELLILAGPEGCLTGWEPYPQCVADQPDTAIDDELEGDLLQYSS
FT                   GTTGRPKGIKRELLHVAPDAAPGMMSALVGYWMDADSIYLSPAPLYHTAPSVWSMSAQA
FT                   GGITTVVLEKFDPEGALEAIQRHRVTHAQFVPAMFTRMLKLPESIRNSYDVSSLKRVMH
FT                   AAAPCPVEIKKQMMDWWGPIIDEYYASSEAIGSTLITAEDWLEHPGSVGKPMQGGVHIL
FT                   GADGVELPPGQAGEIYFEGGYSFEYLNDPSKTAASRDKHGWVTVGDVGYLDDQGYLFLT
FT                   DRRHHMIISGGVNIYPQEAENILVTHPKVMDAAVFGVPDDEMGQRVMAVVQTVDPADAT
FT                   SQFGDELMEWLRDRLSHFKCPRSVAFEAQLPRTDTGKLYKNGLIEKYSG"
FT   gene            531834..532802
FT                   /gene="echA8_4"
FT                   /locus_tag="MMAR_0453"
FT   CDS_pept        531834..532802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA8_4"
FT                   /locus_tag="MMAR_0453"
FT                   /product="enoyl-CoA hydratase, EchA8_4"
FT                   /note="oxidizes fatty acids using specific components (by
FT                   similarity) [catalytic activity: (3S)-3-hydroxyacyl-CoA =
FT                   TRANS-2(or 3)-enoyl-CoA + H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38920"
FT                   /db_xref="GOA:B2HMY1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY1"
FT                   /protein_id="ACC38920.1"
FT                   /translation="MFGVVDLSRAPDATRAAGEISAPGVTVAHGWASELAEAEPWLSAA
FT                   TFTLAEGPCADRRVITVESVSQTLAELRQRCQRWPQASAVCDDVLRTIDPDGPTLAGVL
FT                   TESLAYSTLQAGPEFARWLDERGPADLPDIADPVQTERDDDTLRIRFNRPQRHNAFSGD
FT                   ARAALLEALTVAQLDPSVSGIVLSGNGPSFCSGGDLAEFGTFADPASAHLARTRHSPAL
FT                   ALAALTARLGRACRAEVHGRVLGSGLEMAAFCGWVQAHPDSVFGLPELSLGLIPGAGGT
FT                   VSVTRRIGRWRTAYLVLSGRTIDAGTARDWGLVDSIAVTGD"
FT   gene            complement(532837..533238)
FT                   /locus_tag="MMAR_0454"
FT   CDS_pept        complement(532837..533238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0454"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38921"
FT                   /db_xref="GOA:B2HMY2"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY2"
FT                   /protein_id="ACC38921.1"
FT                   /translation="MSYPPGPYGGSPEWQGQQPGWQPPQPGWPAQQPGYAPEPDNYLIW
FT                   AILTTLFCCLPLGIVSIVYSSKVSGLWAQGRYAEAQAASASAKKWAIISAIGGVVVAVA
FT                   FAVIYIALILVAVSVDHNTPSTITTYSDF"
FT   gene            complement(533349..534521)
FT                   /gene="fadE3_2"
FT                   /locus_tag="MMAR_0455"
FT   CDS_pept        complement(533349..534521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE3_2"
FT                   /locus_tag="MMAR_0455"
FT                   /product="acyl-CoA dehydrogenase FadE3_2"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38922"
FT                   /db_xref="GOA:B2HMY3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY3"
FT                   /protein_id="ACC38922.1"
FT                   /translation="MDNQRADSQLDEDEAMLVATVRAFIDRDVKPSVREVEHANTYPQA
FT                   WIEQMKRIGIYGLAIGEAYGGSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLML
FT                   FGTDEQKSTYLPAMATGELRATMALTEPGGGSDLQNMSTTAMADGPDQLLITGAKTWIS
FT                   NARRSGLIALLCKTDPHATPRHHGISIVLVEPGPGLNISADLPKLGYKGVEACELSFDN
FT                   YRAPTSAILGGQPGQGFSQMMKGLETGRIQVAARALGVASAALDDALAYAQQRHSFGQP
FT                   IWKHQAIGNYLADMATKLTAARQLTHYAAQRYDSGQRCDMEAGMAKLFASETAMEIALN
FT                   AVRIHGGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIARQLIARGGI"
FT   gene            534577..535584
FT                   /locus_tag="MMAR_0456"
FT   CDS_pept        534577..535584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0456"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38923"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY4"
FT                   /protein_id="ACC38923.1"
FT                   /translation="MHTGYMGIREGGPYFDDLSVGQVFDWAPALTLSAGLAAAHQAILG
FT                   DRLRLALDSSLCGAVTGAPAALAHPGLVCNAAIGQSTLVTQRVKANLFYRGLTFHRYPL
FT                   IGDTIYTRTEVVALRANTAKPGRAPTGMAALRMTTIDQADRLVLDFYRCAMLPASADWD
FT                   PAGAADDDLSGIGADAKPPAIDPTAHWDAEAYRTRVPGPHFDAGIAGKVMHSTGDLVSS
FT                   APELARLTLNIAATHHDSRVAGQRLVYGGHTIGLALAQASRLMPNLVTVLGWEHCDHTG
FT                   PVREGDTLYSELHVESAEPTANGGVLGLRSLVYAVGDSEPDRQVLDWRFTALQY"
FT   gene            535599..536820
FT                   /pseudo
FT                   /locus_tag="MMAR_0457"
FT                   /note="conserved hypothetical protein; frame shift
FT                   mutation"
FT   gene            536820..538121
FT                   /locus_tag="MMAR_0459"
FT   CDS_pept        536820..538121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38924"
FT                   /db_xref="GOA:B2HMY5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY5"
FT                   /protein_id="ACC38924.1"
FT                   /translation="MLIRRATLLDGSTADIRVCARIQEVGQGLVARPGERVLDAAGQTV
FT                   LPGLHDHHVHLRSAASALDSLTLGPPTVDSKEKFRQHLSSAQPGPDGWIRAVGYHESVA
FT                   GPLDRTVLDALVPHLPVRVQHRSGALWILNSAALNRIGLAGHVDGRLRSADSDWSDALP
FT                   RRKTDLAALGDRLTAAGVTGVTDATPDLSDEDMAALTVAHQRGEFRPRVRFLSPGKKIL
FT                   RDDHLDLEALMAWITDSHGAGQPVAIHCVTAAQLVVTIAAVRAVGRHPHDRIEHAAVVP
FT                   DDLVADLAGLGLTVVTQPNFVAERGDQYLDEIPAAEHGQLWRVASLLNANVPVAFSTDL
FT                   PFGSGDPWAAMRAAVHRRTPRGVVLGVDECVTARAALTMFLGRPDQPGRVRAVAAGQPG
FT                   DLCVLAQTPAMVLTELDASLVSATIIGGEVAYAA"
FT   gene            538398..539141
FT                   /locus_tag="MMAR_0460"
FT   CDS_pept        538398..539141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0460"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38925"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY6"
FT                   /protein_id="ACC38925.1"
FT                   /translation="MDVRPGRARCKGREMLGHLYERALGGERCWIRHEDGELRPLPTHR
FT                   WLGAGAAERGCASAEGSSSGDVGTGDEDAASDEDFDEAVAQMCSGPTIELGCGPGRLVA
FT                   RLVQRGIPALGIDRSVTAIRLAGRGGAPAILGDVFEPLPGMGRWQTVLLVDGNVGLGGD
FT                   PLRILGRAAELLSRGGRCVVEFDAQTIGVCSRWVRLESARDVGPWFRWASVGVDSAAML
FT                   AAQVGLTLIGVRMLGGRVIANLAAL"
FT   gene            539138..540484
FT                   /locus_tag="MMAR_0461"
FT   CDS_pept        539138..540484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0461"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38926"
FT                   /db_xref="GOA:B2HMY7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY7"
FT                   /protein_id="ACC38926.1"
FT                   /translation="MNCPAEDDPERELEPEPAHGFPARLWRTLERHPPPGVRRLAAFRS
FT                   PLRGPWLTSVFGLVLLVAMPIVILTGLLSYIAYAPQFGQAIPADVGWLRLPGFDWPAHP
FT                   SWLYRLTQGLHVGLGLVLIPVVLAKLWSVIPKLFVWPPARSIATLLERLSLLMLVGGVL
FT                   FEIVTGVLNIQYDYIFGFSFYDGHYFGAWVFIAGFLMHIAVKMPKMITGLRSFSIREVL
FT                   RTNVTDTRPEPPDASGLVSEDPAEPTVSRRGALALVGSGVLLLGVLTVGQTLGGPLRNI
FT                   ALLLPRGRPAQGNREFPVNKTAAVAGITPEAVGPAWRLVLRGGPNEVVLDRAALAGLPQ
FT                   HTARLPIACVEGWSTVQTWTGVRLSELARRAGVAAPRSARVTSLQRGGAFGEATLQGNQ
FT                   VGAPDALLALRVNGEDLPLDHGYPARIIVPALPGVHNTKWVASINFEAG"
FT   gene            540486..541004
FT                   /locus_tag="MMAR_0462"
FT   CDS_pept        540486..541004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0462"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38927"
FT                   /db_xref="GOA:B2HMY8"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY8"
FT                   /protein_id="ACC38927.1"
FT                   /translation="MRELTRRFGRYYGAHPLHLLTMLAGLALVGYIVATFKIATLWNPG
FT                   TWWQSIAVWFAAAVIGHDLVAFPVYSLVDRIFAVRWGRARSGSREVSVRNYLRIPAMGS
FT                   ALTLLIFLPGIIEQGASTYHAATGETQQPFLGRWLLLTAVMFALSAATYAVRLVLAHRR
FT                   RVSEVQLSR"
FT   gene            541118..542338
FT                   /gene="lipC"
FT                   /locus_tag="MMAR_0463"
FT   CDS_pept        541118..542338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="MMAR_0463"
FT                   /product="esterase LipC"
FT                   /note="function unknown, lipolytic enzyme probably involved
FT                   in cellular metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38928"
FT                   /db_xref="GOA:B2HMY9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMY9"
FT                   /protein_id="ACC38928.1"
FT                   /translation="MAATGPTTMSMTSMMSRVKWMLRARPADYLLAMSVAGASLPVVGK
FT                   HLEPLGCVTAMGVWGARHTPEFFAARAKDLFTPGINVTRQRDRDSTNEVSAAALRGIVS
FT                   TADLDVEWPAPQRTPPVCEAFRHRRYLHRGGVHYGNSPAQVLDVWRRDDLPTEPAPVLI
FT                   FVPGGAWIHGSRAIQGYALLSRLAEQGWVCLSIDYRVAPHHRWPRHIHDVKAAIAWARA
FT                   NVDKFGGDRNFIAVAGCSAGGHLSALAGLTANDPDYQSELPEGSDTSVDAAVGIYGRYD
FT                   WEDRSTAERARFVDFLERVVVKRSIKRHPQVFRDASPVARVHTNAPPFLVIHGSRDGVI
FT                   PVAQARSFVERLRAVSRSLVAYVELPGAGHGFDLLDGARTGSATHAISLFLNQIHRTRA
FT                   QLSKEVI"
FT   gene            542383..543822
FT                   /locus_tag="MMAR_0464"
FT   CDS_pept        542383..543822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38929"
FT                   /db_xref="GOA:B2HMZ0"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ0"
FT                   /protein_id="ACC38929.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDPDRRAFGVDAFRA
FT                   VIGERMAKLEPFGYQLVDIPFKFHHPMWREHCEVDLDYHIRPWQLRPPGGRRELDEAIG
FT                   EIASTPLDRRYPLWEMYFVEGLANHRVAVVGKIHHALADGVASANLMARGMDLLPGPEG
FT                   DPYVSDPAPTKRELMSSAFLDHLRHLGRIPATMRYTAQGLARVRRSSRKLSPELTRPFT
FT                   PPPTFMNHMLTPQRRFATATLALADVKQTGKQLGATINDMVLAMSTGALRNLLLRYDGR
FT                   AEPLLASVPVSYDFSPDRISGNYFSGMMVALPTDCADPLERVQACHENALSAKESHQLL
FT                   GPELISRWAAYWPPGATEAAFRWASSRDGQNKVLNLNISNVPGPREHGRVGGALVTEIY
FT                   SVGPLTAGSGLNITVWSYVDQLNISVLTDGATVEDPHEVTEAMMADFVEIRRAAGLSAE
FT                   LTVIEAAMAQARSMNEGAGSA"
FT   gene            543819..544601
FT                   /gene="echA1"
FT                   /locus_tag="MMAR_0465"
FT   CDS_pept        543819..544601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA1"
FT                   /locus_tag="MMAR_0465"
FT                   /product="enoyl-CoA hydratase EchA1"
FT                   /note="oxidizes fatty acids using specific components
FT                   [catalytic activity: (3S)-3-hydroxyacyl-CoA = TRANS-2(or
FT                   3)-enoyl-CoA + H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38930"
FT                   /db_xref="GOA:B2HMZ1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:3QXI"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ1"
FT                   /protein_id="ACC38930.1"
FT                   /translation="MSELNGDTEPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADA
FT                   MDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAV
FT                   EGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELAL
FT                   TGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSL
FT                   DTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT"
FT   gene            544700..546187
FT                   /locus_tag="MMAR_0466"
FT   CDS_pept        544700..546187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0466"
FT                   /product="long-chain-fatty-acid-CoA ligase"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38931"
FT                   /db_xref="GOA:B2HMZ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ2"
FT                   /protein_id="ACC38931.1"
FT                   /translation="MSVSLLLEMAASASPDRIAVVSGDLRLTTQQLSDLADGGAGAIAA
FT                   SDAQHVVYVGTGGAMLPLLIFASARAGLPFTSINYRLSADGIAALIRRLPRPLVVVDER
FT                   YRDTIAADQSLSSQQFLELAGRAEPVAEFPDPDSVAIVLFTSGTTSQPKAVELTHSNLT
FT                   SYVTTTVEFGCAAPSDAALICVPPYHIAGVSAVLSNLYAGRKMVYLTNFDAHEWVRLTN
FT                   AEQVTTATVVPTMLDRIVAVLETGEHKLPSLRNLAYGGSKVGLPLVRRALELLPDVGFV
FT                   NAYGLTETSSTIAVLTPDDHRAAQSAAAAGLARRLGSVGRPVPGVELQIRGQDGRVLGP
FT                   GETGELFVRGGQVSGRYTGIGSVLDGHGWFGTKDIAMLDEDGYLFIGGRSDDTIIRGGE
FT                   NIAPAELEEVLIEHPQVRDVAVVGVEDAQWGQEIVAVVVPVAGVDPDPEELREFVRRSL
FT                   RGSRTPDRVVFRHELPTTATGKILRREIIEELAGTKS"
FT   gene            546184..546480
FT                   /locus_tag="MMAR_0467"
FT   CDS_pept        546184..546480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38932"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ3"
FT                   /protein_id="ACC38932.1"
FT                   /translation="MIKNGTRLASQVCDTQVIVVRSADTLDDLRCGGAPMVEIGVQRSG
FT                   QLDPEFADGSVLGKRYVDEAGAELLVTKPGAGSLSVGATKLALKEVKPLPASD"
FT   gene            547031..548785
FT                   /locus_tag="MMAR_0468"
FT   CDS_pept        547031..548785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0468"
FT                   /product="fatty-acid-CoA ligase"
FT                   /note="function unknown, but involvement in lipid
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38933"
FT                   /db_xref="GOA:B2HMZ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ4"
FT                   /protein_id="ACC38933.1"
FT                   /translation="MNESIPGGRVAHLPPPHLNLVERLAWRARNQPDELAMVELRGMRG
FT                   ETDKATYARLDARARAIAFQLKSLGNQGDRVLLVMGNCLDYVVGFLACAYARRVAVNLP
FT                   VPRRAKHLDRLAHVVADCGAEVLLTSGPEAKELTVSVAADLRLDFLTVLRLDWLLAIPD
FT                   EDWQPVAPASKDVCLLQYTSGSTSAPRGVVVTHDNLMFNCAQIQYGFGLTAEDRALSWL
FT                   PLYHDMGLILGVLTPIFAGFPVVLADPLSFVKRPDLWLRAISDYRITFTGGPNFAYDLC
FT                   ADAASYADLSGIDLSCWNVALNGAEPIRATTLERFNAALAPLGWAPTYMQPSYGLAENT
FT                   LAVSTKIPATEPTVVEIDVAALRQSQVCAPRGDSPSRRLVSSGRILAGTMVKIVDPETG
FT                   HPVGPDRVGEIWLTGRSVAKGYWGRDIQTEEVFAARLPGDPARYLRTGDLGFCRDDELF
FT                   VVGRLKDLVIVHGANHYPQDLEETAEGAHPAVRSHFVAVFAEEREDREALIVVAEIRRE
FT                   AERGLDPRDVGQRIARAITREHEVSVDAVFLARCGEVPKTTSGKIQRSLCRELLRQGGL
FT                   ALHGALEK"
FT   gene            548897..553561
FT                   /locus_tag="MMAR_0469"
FT   CDS_pept        548897..553561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0469"
FT                   /product="peptide synthetase"
FT                   /note="involved in peptide synthesis and/or lipid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38934"
FT                   /db_xref="GOA:B2HMZ5"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ5"
FT                   /protein_id="ACC38934.1"
FT                   /translation="MFKEDVDFVASGGNTTTVRSLETFRDWLRHEIAKSSDAGFTGVDF
FT                   SRSLADLGFSSVHTVRLAGELEKLLEIDIEPTLLAEFESIDAMCVTLFRMREGMRSRDT
FT                   NAPYVQTVRVAASFTAELIEPTVCNLLGRLGMPANVQFAGYNQVFQALLNPEGVFAGEG
FT                   GINVVLMRVEDLFRHHNTPPGREELERAVAELCDALLGHADRSGAPTLVALAPHSPHSV
FT                   RALGLAELLEDLDQRIIAAAGSHPSLFPVDLRRVYEDWPVVRIWDEARDSLGHLPFTQG
FT                   CFSAIGACIARRIAAVLSEPAKVIVLDCDNTLWGGVVGEDGPEGITLSEHFLVLQRFMV
FT                   AQAEAGKLLCIVSKNNDADVLAAFAAHPDMPLGLEHICLRRINWLPKSENMRLLADELG
FT                   LGLDTFIFIDDSAMEVAEVSEALPQVLAIELPQPECFESFLNHHWAFDAARTTEEDRSR
FT                   TAMMRQSVQRAEIEASAPTIDDFLSRLDLEIDLAPLSLEDELARAAQLTHRTNQFNARK
FT                   RSMSEAELRAFCREPGRRTWRARVSDRFGDYGFVGLVSAVSRDSALVCDLFLMSCRVLG
FT                   RRVEQALVRRLAVDASEAGCDQLLLEVETSARNVPVRSFYDSLAGVSVPAGVGDLQKII
FT                   LEVADIEAHLLASTRVILREETDPARDESAPVPSRSGARTRAAGGYAEIARIGSNVDAL
FT                   MTALAVTAHARRPALATPYVTPRDSQEKAIARIWCDVLGIDRVGVNDNFYELGGDSLRA
FT                   AEAFARMWDMGVAESISLQTIIEPTVAVLAQAIRDVEAGRAPQLLADSFSLKEEGHLAA
FT                   DICRPGYDPSTYDRPMHHILLTGGTGYLGAYLIRELLIQTEARISCLVRASTPEEGRQR
FT                   ILNNLCRYGLWDVSFESRVDVVLGDLTAPWLGLDGLAPFQALARSIDTIVHSAAWVNFV
FT                   YPYQHLKATNVESTETILRLAVSSEAPIQVHFVSTLGVIMSTGYGRHSVVQDREAITHC
FT                   DDLLNGYEQTKYVSDVMMWQAFTERGIPGAIYRPGMVSGLSDGTYHKLDEFLPQFLKGC
FT                   IQLGAWPLLETTWEMAPVDFTSKAIVHIAKRPQNLNQAYFVVHPRSRQVSDYIDWHREV
FT                   GYDIRGLPWDVWKRELLGLGTEGLRKNALFPFVDFIRALSEEQVFFPPTGRALFDSATA
FT                   DLDFDVPDQLELLARYTRHFVACDYYDQLPSNPRAGLSDEPALVLHPPGESGQTLDDRL
FT                   RFDGVQLDFVETYYVLFNDPVRGLSFMARYVLHNGFLESDKLAEVWSTFRDRQRPGTEL
FT                   AIRQRYPLGHARLENSAKVRLEIGPSGYGEEKVWGRVDSADGVIEWDLELDRSEAIALD
FT                   RLPEASAYDLLPHFQSNGARQHLRGVVTVCGQTYEIGRTVASDGHYWNTKNLRESAWVH
FT                   GANFEGDPDFLIEGFGARFNDWSQTSLWLTFSYKGECIESNLIDAFHHNRELDSATDSW
FT                   DFVAERGDLRFVVRVKADPARMLLSVRPLPGDEYVYTHFTDEADVTIDIEQRSGRGWWK
FT                   NDQRIARGTAVFESTRKVRNPGATREFRIVRGKC"
FT   gene            complement(553639..554259)
FT                   /locus_tag="MMAR_0470"
FT   CDS_pept        complement(553639..554259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0470"
FT                   /product="transcriptional regulatory protein"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38935"
FT                   /db_xref="GOA:B2HMZ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ6"
FT                   /protein_id="ACC38935.1"
FT                   /translation="MTPPSTSTPKRGGTREKMLISAAQVMRERGAAGVTIDSVLARSGA
FT                   PRGSVYYHFPDGRNQILIEALRYAGDSITAVIDKAADKGARALLREFVRLWEHLLTDGG
FT                   FAAGCPVVAAALGPADDEVELAAEAGTILDSWCAALGRAFVADGFDESTAASLAVTSIA
FT                   ALEGAIMLCRSTRSAEPLRQVGEQLEFLVKARGFVAQSRLDSE"
FT   gene            554570..555385
FT                   /locus_tag="MMAR_0471"
FT   CDS_pept        554570..555385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0471"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="oxidizes fatty acids using specific components
FT                   [catalytic activity: (3S)-3-hydroxyacyl-CoA = TRANS-2(or
FT                   3)-enoyl-CoA + H(2)O]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38936"
FT                   /db_xref="GOA:B2HMZ7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ7"
FT                   /protein_id="ACC38936.1"
FT                   /translation="MQMTTTETSLPKLATVSLERDGHVLLIGLNRPQKRNSFDRAMFAD
FT                   LSRAYALLETDDSVRAGVLFAHGDHFTGGLDLVDVAPSIAAGQSPFPADGRDPWRLDGP
FT                   WRTPLIAVAHGWCMTLGIELLLASDIRIAAAGTRFSQLEVQRGIYPFGGATIRLTRDAG
FT                   WGNAMRWLLTGDEFDAAEAHRIGLVQEVADDAATALTRAREIAQTIADRAAPLGVRATL
FT                   ASAHLARREGEAAAIERLVPDIRALFTSADAAEGVQSFIERRQARFTGR"
FT   gene            complement(555450..556916)
FT                   /locus_tag="MMAR_0472"
FT   CDS_pept        complement(555450..556916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0472"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="thought to oxidize a wide variety of aliphatic and
FT                   aromatic aldehydes"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38937"
FT                   /db_xref="GOA:B2HMZ8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2HMZ8"
FT                   /protein_id="ACC38937.1"
FT                   /translation="MGEKTEYDKLFIGGKWTEPSTSEVIEVHCPATGEYVGKVPLAAAA
FT                   DVDAAVAAARAAFDNGPWPSTPPKERATVIANALKLLEERKDHFAKLLADETGQPPMTV
FT                   ETMHWMGSIGALNFFAGPAVDQVRWKEIRNGSYGQTIVHREPIGVVGAIVAWNVPLFLA
FT                   INKLGPALLAGCTVVLKPAAETPLTANALAEVFAEAGLPEGVLSVVPGGVETGQALTSN
FT                   PGVDLFTFTGSSAVGKEIGRRAAEMLKPCTLELGGKSAAILLEDVDLSTAVPMMVFSGI
FT                   MNTGQACVGQTRILAPRSRYEEIVEAVSAFVQALPVGPPSDPAAQIGSLISEKQRARVE
FT                   GYIAKGIEEGARLVSGGGRPEGLDNGFFVQPTVFADVDNKMTIAQEEIFGPVLVVIPYD
FT                   TEEDAIKIANDSVYGLAGSVWTSNVPKGIEISEKIRTGTYAINWYAFDPCCPFGGYKNS
FT                   GIGRENGPEGVEHFTQQKSVLMPMGYTLES"
FT   gene            complement(556961..557728)
FT                   /locus_tag="MMAR_0473"
FT   CDS_pept        complement(556961..557728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0473"
FT                   /product="methyltransferase"
FT                   /note="causes methylation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38938"
FT                   /db_xref="GOA:B2HMZ9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HMZ9"
FT                   /protein_id="ACC38938.1"
FT                   /translation="MAVTDRFARRATLSRSLRLLSEFRYEQPDPARFYGALAADTATLV
FT                   SDLWLAARGESVAGRTLLDVGGGPGYFASAFAAAGVGYIGVEPDPNEMHAAGPAHAGGP
FT                   GSFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGAEMLRVTRPGGLAVLSYTVWLG
FT                   PFGGHEMGLSHYLGGARAAARYARRHGHPAKNNYGSSLFAVSAAEGLRWAEGTGTLIAA
FT                   FPRYHPRWAWWMTSVPMLREFLVSNLVLVLSPR"
FT   gene            557784..558947
FT                   /locus_tag="MMAR_0474"
FT   CDS_pept        557784..558947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0474"
FT                   /product="glycosyltransferase"
FT                   /note="function unknown, contains a glycosyltransferase
FT                   domain (cell envelope biogenesis, outer membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38939"
FT                   /db_xref="GOA:B2HN00"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN00"
FT                   /protein_id="ACC38939.1"
FT                   /translation="MSDLRSVLLLCWRDTGHPQGGGSETYLQRIGAQLAASGIEVTLRT
FT                   ARYPGAPRWELVDGVRVNRAGGRYSVYVWALLAMVAARMGLGPLRRVRPAAVIDTQNGL
FT                   PFLARLVYGRRVVVLVHHCHREQWPVAGPVLGRLGWFVESKLSPWLNRRNQYVTVSLPS
FT                   ARDLVALGVDNERIAVVRNGLDEAPGQTLSGPRAATPRVVVLSRLVPHKQIEDALEAVA
FT                   QLRRRTPGSPNLHIDVVGGGWWRQRLIDHVHRLGISDAVTFHGHVDDVTKHHVLQSSWV
FT                   QLLPSRKEGWGLAVVEAAQHGVPTIGYRSSGGLSDSIIDGVTGILVDSHAELVDQLERL
FT                   LADPVLRDQLGAKAQVRSAEFSWQESVDGMRSVLEAVPAGRFVSGVV"
FT   gene            complement(558957..560756)
FT                   /locus_tag="MMAR_0475"
FT   CDS_pept        complement(558957..560756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0475"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38940"
FT                   /db_xref="GOA:B2HN01"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN01"
FT                   /protein_id="ACC38940.1"
FT                   /translation="MRAKMARGEGAGWASPRCACWWRPGYALVLALLVVGPVLGPGYLL
FT                   LRDAVSTPRSYLSDSALGLMAAPRATPQDFAIALASQVIDGGILVKALLVLGLWLAGWG
FT                   AAVLVARALPAAGAGGQFVAITLAIWNPYVAERLLQGHWSLLLGYGCLPWVAATMLGLR
FT                   ASEASQTGFFGLAFWIALAGLTPTGLLLAATVALTCVAAPGGGKPRWLCATAALTAALV
FT                   GALPWLTASALGSSLTTHTAANGLGVAAFAPRAEPGLGTLLSLASLGGIWNGDAVPGSR
FT                   TTLFAVASAAVLLVVVAVGLPTVARRPALVPLLVLAAVSVLVPAALATGPGLHILAAAV
FT                   DAAPGLGVLRDGQKWVALAMPGYAVSAAAAVSTLSRCKTAATPLKSTLAASACCLALVL
FT                   ALPDLAWGVLGRVAPVHYPPGWTAVATAINHQPGTVAVLPIGTMRRFSWAGRAPVLDPL
FT                   PRWVRPDVLSSGDLVISGVLVPGDGVRARTVQKLLLAGADPAALAQAGVGWLVVEVHGG
FT                   GEVGEAGRTLDRLTPTYRDDELALYRIGGRSAGVPAGDRRAMMLAHWAWLSMLLAGGAG
FT                   MAAGRVRRHLSGREESPTDLAAD"
FT   gene            complement(560767..562047)
FT                   /locus_tag="MMAR_0476"
FT   CDS_pept        complement(560767..562047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0476"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38941"
FT                   /db_xref="GOA:B2HN02"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN02"
FT                   /protein_id="ACC38941.1"
FT                   /translation="MNRAVMLRIAALGTIGLGSALLIAALLLSTYTSSKITKIPLDIDA
FT                   TLISEGKGSALDSASLATDHIVINQNVPLVSQQQITVESPANADVVTLQVGTSVRRTDK
FT                   QKDTGLLLAIVDTVTLNRHTAMAISDDTHTGGTVQKPRGFGDESPPTAIPLRHEGLSYR
FT                   FPFHTEKKSYPYFDPIAQKPFDANYDSEEDVNGLTTYRFTQNIGYNSEGKLVAPVKYPS
FT                   LYAGDEDGKVTTTAAMWGVPGEPDEEITMTRYYAAQRTFWVDPVTGTIVKQTVHANHYF
FT                   AREAMKPEVTLADYKVTSNEDTVETQVNTARDERDRLALWSRVLPITFTAIGLVALVGG
FT                   GLLTSFSLRTESILMDPSLDRDDTDFLRRVGLEQPVPGAEAETEKLPAQRPDSSDDGPD
FT                   SDKTPPDSAESSSESGSAEPSGPEERT"
FT   gene            562227..563393
FT                   /locus_tag="MMAR_0477"
FT   CDS_pept        562227..563393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0477"
FT                   /product="integral membrane acyltransferase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38942"
FT                   /db_xref="GOA:B2HN03"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN03"
FT                   /protein_id="ACC38942.1"
FT                   /translation="MVTDGQQVGGTRSFLPPVEGMRACAAMGVVVTHVAFQTGHSSGVA
FT                   GRLFGRFDLAVAVFFALSGFLLWRGHAAAARGGSPRPRTGHYLRSRAVRIMPAYVVAVV
FT                   VILSLLPDSDHASLTVWLANLTLTQIYVPLTLTGGLTQMWSLSVEVGFYLALPLLAFLA
FT                   RRVPVGARVPVIAAAAALSLAWAWLPVAAGSGMNPLNWPPAFFSWFAAGMLLAEWVHSP
FT                   IGLVHRLARHRVLIGVVAMLAYLVAASPLAGPAGLVQGSATQFAVKTAMGAVVAFALVA
FT                   PLVLDRPGTPHRLLGSTTMVTLGRWSYGLFIWHLAALDMVFPVIGTFAFTGRMPTVLVL
FT                   TLIFGFAIAAVSYALVESPCREALRRWEKRTEHSAGQDIDREADAIAP"
FT   gene            complement(563405..565432)
FT                   /locus_tag="MMAR_0478"
FT   CDS_pept        complement(563405..565432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0478"
FT                   /product="PE-PGRS family protein"
FT                   /note="function unknown. has fibronectin-binding activity
FT                   (could thus mediate bacterial attachment to host cells).
FT                   thought to be expressed during infection"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38943"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN04"
FT                   /protein_id="ACC38943.1"
FT                   /translation="MSFVSVIPEQLTAAATNLAGVGSTISTANATAAGPTAAALAAGAD
FT                   DVSAAVSSFFGAYARDYQAFSVQVEALHDQFVRAVTSGAASYAGAEATSVQQILLDAIN
FT                   APTQALLGRPLIGNGANAAPGSGANGGDGGILYGNGGAGGSGAAGGNGGAGGAAGLVGN
FT                   GGAGGAGGNNAAGGSGGAGGLLYGNGGAGGIGGTSAGSGGAGGAGGLLFGTGGAGGTGG
FT                   FGGGLMTSGGAGGTGGAGGLLFGTGGSGGAGGGSNAFTAGDGGAGGAGGLLFGTGGSGG
FT                   DGGLAPGAMFGNGGHGGTGGAGGTLSGIGGHGGAGGLGQVSGGAGGDGGNGGVFFGGGG
FT                   DGGIGGHGITGSGGSGGSGGSGGFLPGGAGVAGLIGDGGAGGHGGSGGSGGGTGGSGGS
FT                   AGTLLGNGGAGGGGGSGSTTAGGGGSGGDAGALFGNGGAGGAGGSGAATGGSGGTGGSS
FT                   ALLFGTGGVGGVGGSGGDSGGTGGAGGQGGAMFGNGGAGGGGGDGINVGGKGGAGGAAA
FT                   TLFGSGGTGGDGGNAGAGVTFGGAGGEGGAAALLGGNGGSGGHGGIGNVGGKGGAGAAG
FT                   AMLLGNGGDGGDGGNSLASLAGAGGAAGNAGLIGSGGTGGAGGQSFSGTGGKGGDGGSA
FT                   LLIGDGGNGGNGGTGATAGVGGTAGTGGFLFGLDGMNGSP"
FT   gene            complement(565698..565994)
FT                   /locus_tag="MMAR_0479"
FT   CDS_pept        complement(565698..565994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38944"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN05"
FT                   /protein_id="ACC38944.1"
FT                   /translation="MVPTLSQVRAWSTGHLIEATSYWTQTADQWEDVFLQMRHEVASHG
FT                   PGQVVRLRGCTMARPTMGAPEPAVTLSGDGAGSAAGRCPTAANHRHSMESTSR"
FT   gene            complement(565995..566288)
FT                   /locus_tag="MMAR_0480"
FT   CDS_pept        complement(565995..566288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38945"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN06"
FT                   /protein_id="ACC38945.1"
FT                   /translation="MQPGQLRVEVPQLEATAGEWSQRSATLAALTPPSPGQPFQPTTAA
FT                   VSSAHTAVGLAAAALTTHTQETIVAVESGATRYATNETTSPAEMAAVQPRLV"
FT   gene            complement(566639..566908)
FT                   /locus_tag="MMAR_0481"
FT   CDS_pept        complement(566639..566908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38946"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN07"
FT                   /protein_id="ACC38946.1"
FT                   /translation="MEESVNNILDVVPSEHRVLIMDELTRRNPDLLAELRTVQKPTNDQ
FT                   SDAVVDALSHALSANYGPGHVPNDYGLAVERAIDAYLEAWPIYR"
FT   gene            complement(566893..568008)
FT                   /locus_tag="MMAR_0482"
FT   CDS_pept        complement(566893..568008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38947"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN08"
FT                   /protein_id="ACC38947.1"
FT                   /translation="MAASGIPDLSALLAWPTDHLTEAAAHWDNVGEHTYAVAHQLWRDA
FT                   TSIDWSGHAAGALRAATHADLQTTSAAVDQLQEAARVARNGASDLYAARSRVRYAVTDA
FT                   QAAGFQVEEDLSVTDRMTGGSAAQRAARQAQAQAFAGDLRQRAAQLVGLDAQVATKVTA
FT                   AVAGIGSSFPQIPAPAAPPMGNPVRAVDNRTFKQNPPPAPVDPKDMTAEEARAAWADIN
FT                   SEIGKYNARCGRTFVLPTEQGAYDACIADKGPLLDRQAAIRARLGQLGIPVEGEDPTHP
FT                   GTAEPPFPPPTRINGLTEHGAQRVEGRDGHGVNDNAMQDAVAHPIEPPQFMPDQYGGTW
FT                   RYIGKDATVSLNENGQVTTAWANSRNGWRNP"
FT   gene            complement(568011..568337)
FT                   /locus_tag="MMAR_0483"
FT   CDS_pept        complement(568011..568337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0483"
FT                   /product="conserved hypothetical alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38948"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN09"
FT                   /protein_id="ACC38948.1"
FT                   /translation="MLCLPTLRFVGSSLRVDTAGVQAMAWRWGIAAGELTSMDAPAGLG
FT                   LSCQLSAAAVDAAHGEVAAFTTGLAIQVNARTAGVTQADSGYLANEAASADVLAAVAPS
FT                   VTRV"
FT   gene            complement(568627..569241)
FT                   /locus_tag="MMAR_0484"
FT   CDS_pept        complement(568627..569241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0484"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38949"
FT                   /db_xref="GOA:B2HN10"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN10"
FT                   /protein_id="ACC38949.1"
FT                   /translation="MVLTLSQVQAWSTEHLIEAATYWSKTADQWEDVFLQMRNQSHTLV
FT                   WEGAGGDALRQRTGADLAIVSTKADELRQASKIARDGAGTIGIAQRRVLHAVEDAHNAG
FT                   FTVGEDFSVTDIRTSRSSAEQAARQAQAQAQALATDIRQRAVEPLPPPAPGRLPPLTPG
FT                   EMATPRLPAPPPQPPIRGGADLAPAEPPPVVCAHLWSHQPV"
FT   gene            569706..571183
FT                   /pseudo
FT                   /locus_tag="MMAR_0485"
FT                   /note="DNA polymerase; frame shift mutation; uknown;
FT                   contains a C-term ExoIII, exonuclease domain found in
FT                   DNA-polymerase alpha and epsilon chain, ribonuclease T and
FT                   other exonucleases"
FT   gene            complement(571687..572736)
FT                   /locus_tag="MMAR_5555"
FT   CDS_pept        complement(571687..572736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_5555"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_5555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38950"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN11"
FT                   /protein_id="ACC38950.1"
FT                   /translation="MVTIPEQLSIAATSLANIGSTISTANTAAAAPTTTLLAAGADEVS
FT                   TAIAALFGSHGQAFQALSAQAENLHGQFVTTLNSSAFSYASAEAANASQNLVNALNMPA
FT                   EGLLGRPLIGDGADGAPGTGQDGGDGGILWGNGGNGGSGAPGQRGGDGGDAGLLGKGGY
FT                   GGNGGAGQTGGTGGSVGLFGNGGGGGGGGAGGGAGGLGGDAGLVFGVGGPGGDGGDGGG
FT                   TGGAGGAGGTFWGPGGAGGSGGHGGAGIAGNGGAGGPGGAVFGTGGDGGQGGLGGSGGT
FT                   AEQAATAACCSARAGRAAKAHPTTTRGARVERAAMAACCWVTAGKAGRAERRASAAAEP
FT                   AAPAAAPAC"
FT   gene            complement(572917..573897)
FT                   /gene="php"
FT                   /locus_tag="MMAR_0487"
FT   CDS_pept        complement(572917..573897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="php"
FT                   /locus_tag="MMAR_0487"
FT                   /product="phosphotriesterase Php"
FT                   /note="enzymatic activity is not yet known [catalytic
FT                   activity: aryl dialkyl phosphate + H2O = dialkyl phosphate
FT                   + an aryl alcohol]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38951"
FT                   /db_xref="GOA:B2HN12"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN12"
FT                   /protein_id="ACC38951.1"
FT                   /translation="MSALNTARGPIDTADLGVTLMHEHVFIMTTEVAQNYPEAWGDEEK
FT                   RVADAITRLNELKSRGVDTIVDLTVIGLGRYIPRIARIAAATDLNIVVATGLYTYNDVP
FT                   YRFHYQGPGGMLDGPEIMTDMFVRDIEQGIADTGVKAGILKCATDEPGITPGVERVLRA
FT                   VAQTHKRTGVPISTHTHAGLRRGLEQQRIFEEEGVDLSRVIIGHSGDSTDVGYLEELIA
FT                   AGSYLGMDRFGIDLILPFEDRVSIVATMCERGHADKMVLSHDANCYFDALPEELTAVAT
FT                   PNWHYLHIHNDVIPALKERGVTDEQVHTMLVDNPRRIFERQGGYQ"
FT   gene            574239..575945
FT                   /gene="fadE4"
FT                   /locus_tag="MMAR_0488"
FT   CDS_pept        574239..575945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE4"
FT                   /locus_tag="MMAR_0488"
FT                   /product="acyl-CoA dehydrogenase FadE4"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38952"
FT                   /db_xref="GOA:B2HN13"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN13"
FT                   /protein_id="ACC38952.1"
FT                   /translation="MLLNPNRLQRKYPDARSAEIMAATVDFFESRGKARLKRDDHDRAW
FT                   YSDFLNHIAEHRIFASLLTPSEYGADDCRWDTYRISEFAEIIGFYGLSYWYPFQVTALG
FT                   LGPIWMSDNEDAKRKAAAQLEQGEVFAFGLSEQAHGADVYQTDMILTPSEHGWTASGEK
FT                   YYIGNANVARMVSTFGKIEDSSKEPEYVFFAADSQHDRYELKKNVVNSQNYVANYALHD
FT                   YPVTEADLLHRGMGAFHAALNTVNVCKYNLGWGAVGMCTHAFYEAITHAANRHLYGTVV
FT                   TDFSHVRRLLTDAYARLVAMRLVASRASDYMRSASAEDRRYLLYSPLTKAKVTSEGERV
FT                   IAALWDVIAAKGVEKDTFFETVAREIGLLPRLEGTVHINIGLLAKFMPNFLFVPDAALP
FT                   LIPRRDDAADDTFLFNQGPTGGLGKVRFHDWRAPFDSYGHLPNVALLREQIDVLTEMLA
FT                   GATPDASQQKDIDFAFGVGQIFALVPYAQLILEEAPLSGVDDALLDEIFGLLVRDFNSY
FT                   AVELNDKAATTDQQAQFAMRMIRRPAHDAARYDQVWKEHVLPLNGAYEMRP"
FT   gene            576044..576715
FT                   /locus_tag="MMAR_0489"
FT   CDS_pept        576044..576715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0489"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR/AcrR-family)"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38953"
FT                   /db_xref="GOA:B2HN14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN14"
FT                   /protein_id="ACC38953.1"
FT                   /translation="MPTVTWARVDPARRAAIVEAAEAEFGAHGFSQGSLNVIARRARVA
FT                   KGSLFQYFADKRDLYAYIADIASQRVRTHIEGLIRELDSSRPFFEFLTDLLDGWVAYFA
FT                   EHPRERALHAAATLEVDTDARISVRSVIHRHYLEVLRPLVRDALARGDLRADSDTDALL
FT                   SLLLMIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLTAAYSPSLTVEVRKV
FT                   T"
FT   gene            complement(576837..578213)
FT                   /gene="gabD1"
FT                   /locus_tag="MMAR_0490"
FT   CDS_pept        complement(576837..578213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD1"
FT                   /locus_tag="MMAR_0490"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]
FT                   dependent (SsdH) GabD1"
FT                   /note="involved in 4-aminobutyrate (GabA) degradation
FT                   pathway [catalytic activity: succinate semialdehyde +
FT                   NAD(P)(+) + H(2)O = succinate + NAD(P)H]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38954"
FT                   /db_xref="GOA:B2HN15"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN15"
FT                   /protein_id="ACC38954.1"
FT                   /translation="MPIATTNPATGETVKTFTAASNDEVDAAIARAYARFQDYRRNTTL
FT                   AQRAEWAHATADLIEAEADQTAALMTLEMGKTIASAKAEVLKSAKGFRYYADNAAALLA
FT                   DEPADAGKVGASQAYTRYQPLGVVLAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNV
FT                   PQSALYLADVIARGGFPDGCFQTLLVSASAVEGILRDPRVAAATLTGSEPAGQSVGAIA
FT                   GDEIKPTVLELGGSDPFIVMPSADLDKAVSTAVTGRVQNNGQSCIAAKRFIAHADIYDA
FT                   FVDKFVEQMSALTVGDPTDPQTQVGPLATEQSRDEIAQQVDDAAAAGAVIRCGGKPLAG
FT                   PGWYYPPTVITDITKDMNLYTEEVFGPVASVYRAADIDEAIEIANATTFGLGSNAWTQD
FT                   EAEQRRFINDIEAGQVFINGMTVSYPELPFGGIKRSGYGRELAGHGIREFCNIKTVWVG
FT                   "
FT   gene            578650..579834
FT                   /locus_tag="MMAR_0491"
FT   CDS_pept        578650..579834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0491"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38955"
FT                   /db_xref="GOA:B2HN16"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN16"
FT                   /protein_id="ACC38955.1"
FT                   /translation="MTAPLWMASAPEVHSALLSAGPGPGSLLAAAQTWTELSAEYLAVA
FT                   EELTAILTGVQAGAWDGPSAQCCIAAYVPYLSWLMQASADSAATAAAHQAAATAYTGAL
FT                   AAMPTLGELAANHATHAVLVATNFFGLNTIPIALNEVDYVRMWIQAATTMSVYQAVAAD
FT                   ALLAVPRTPPAPVIIKPGADAAAQFASAVVQAVAETPIQRLLLELATLVGAEFINVFEL
FT                   IVGIVVLSTYGLKLPLLALLDFLTGHFSVALSLLWNYAMLWFGFVVLPALQIVFDPLLV
FT                   VAAVIEWILGGGAALGSVGALGANLAAGLALPAVAAAPVADAAVGSLGVLTSAAAVTAA
FT                   AAAAPGQGVGLVGFAATMPNPTTLPAGGLVTVGGADPCAGARVPMLPASWVALA"
FT   gene            580024..582498
FT                   /locus_tag="MMAR_0492"
FT   CDS_pept        580024..582498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0492"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38956"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN17"
FT                   /protein_id="ACC38956.1"
FT                   /translation="MSGVIAALDTLTAAATDVAGLGAAINAANAAAAVSTTRLMAAAGD
FT                   EVSAAIAALFSDHALQYQAVSAEAVAFHGRFVQALTGGVQMYAAAETANTASLQTLGQD
FT                   LLGMVNAPAAAVLGRPLIGNGTNGAPGSGDAGGPGGLLFGNGGNGGSGSAGMAGGAGGS
FT                   AGLIGNGGAGGAGGADAAGGPGGAGGWLWGGGGAGGLGGAASGAGNGGAGGAGGAGGAF
FT                   IAIGGVGGDGGAASSGTGGVGGAGGNADGLIVSLGGAGGHGGDATTGIGGAGGAGGMAT
FT                   ARIPAGINFNVGGAGGHGGAGATGGAGGGGGSAYSGYVGIAFGQGGAGGIGGAASTGMA
FT                   GAGGSGGSCVAFDFVGFAAAHGGAGGTGGAATGVGATAGAAGSGGLGVAIVGSGVGGVG
FT                   GVGGAATGAGATAAAGGAGGLGLAAVGSGTGGAGGAGGVGAGTGGAGGAGAHGFGLLSG
FT                   TAGAGGAGGAASAGTGGAGGLGGTGFGLIAAGGDGGGAGTGVGSNGGDGGGGGGAHAVL
FT                   AAIAGSGGQGQAGTSGFGGFGGSGGSAESLFFSIGGAGGAGGDASTGGGGLGGNGGVAV
FT                   AHSPIGIDIGIGGAGGHGGSGTSGADGGAGGVSISEGIFAIDVNLGGAGGDGGTATTGT
FT                   AGSGGNGGFVENFDFFGFGVAHGGDGGSGGAASGAGGIGGAGGNGGSGTTPLFGAYSGG
FT                   AGGDGGAATGTGGAGGNGGAGGAASGLGVGIGGAGGHGGAAPTGNGGSGGAGAGGLGLI
FT                   GAGGNGGDAGAGVAAADGGDGGNAGLVINGTYEASPYGNGGNGGNGVNGGSGGKGGSAG
FT                   QVGGTPGQNGSP"
FT   gene            complement(582580..584004)
FT                   /locus_tag="MMAR_0493"
FT   CDS_pept        complement(582580..584004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0493"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38957"
FT                   /db_xref="GOA:B2HN18"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN18"
FT                   /protein_id="ACC38957.1"
FT                   /translation="MEWFSASEYWLGRLVLERGVAAVYLTAFVASALQFRALIGEHGML
FT                   PVPRYLAHRSFWRTPSVFHFRYSDRLFAGVCWLGAALSAAVVGGTADLVPLWGAMLMWL
FT                   TLWVLYLSIVNVGQVWYGFGWESLLLETGFLMVFLGNDRVAPPLVMLWLVRWLLFRVEF
FT                   GAGLIKMRGDACWRNLTCLYYHHETQPMPGPLSWFFHRMPRPLHRIEVAGNHFAQLVVP
FT                   FGLFAPQPIASIAAVIIIVTQLWLVMSGNFSWLNWLTILLACSAIEQSAARKVLPIPVR
FT                   AALPPPPTWFAALVLIFAATVLVLSYWPARNMLSPRQRMNMSFNPLHLVNTYGAFGSIC
FT                   RTRREVVIEGTSEAELNAQTVWQEYEFKGKPGRVGRLPRQWAPYHLRLDWLMWFAAISP
FT                   GYALPWMTPLLTRLLRNDRATLRLLRRNPFPDTPPRYVRAQLYQYRFTTLQELRRDHAW
FT                   WHRTLIGKYAAPMSLD"
FT   gene            complement(584129..584917)
FT                   /gene="glpQ2"
FT                   /locus_tag="MMAR_0494"
FT   CDS_pept        complement(584129..584917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ2"
FT                   /locus_tag="MMAR_0494"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   GlpQ2"
FT                   /note="glycerophosphoryl diester phosphodiesterase
FT                   hydrolyzes deacylated phospholipids to G3P and the
FT                   corresponding alcohols [catalytic activity: a
FT                   glycerophosphodiester + H(2)O = an alcohol + SN-glycerol 3-
FT                   phosphate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38958"
FT                   /db_xref="GOA:B2HN19"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN19"
FT                   /protein_id="ACC38958.1"
FT                   /translation="MGGDAHPQEVEFLRDARRIAMAHRGFTSFRFPMNSMGAFHEAAKI
FT                   GFRYIETDVRATRDGVAVIQHDRKLAPESGVAGAVDQLTWPEVSTADLGGGEPIPTLEE
FT                   LLVALPQMRFNIDIKADSAVEPTVEVIERLQAHRRVLIASFSERRRQRALRLMSQRVAS
FT                   AAGMGAFLGFMAARTAGRRASAMRMLRDSDCLQLPARFGGLPVITPALVRSVHASRRQV
FT                   HAWTIDDPAMMHALFDIGVDGIITDRADVLCDVLGARGEW"
FT   gene            585057..585614
FT                   /locus_tag="MMAR_0495"
FT   CDS_pept        585057..585614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0495"
FT                   /product="conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38959"
FT                   /db_xref="GOA:B2HN20"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN20"
FT                   /protein_id="ACC38959.1"
FT                   /translation="MEGNVNSAEHIGLKLGRRRLLALGAGTLGLGALASNAPGNATTDP
FT                   PPEGYEALLLMCIDPRFVHPTNEYMVQRGLLNRYSQFALAGAAAGAVSQHWESWHNTFW
FT                   DNLAASIELHSIDGVIAVNHRDCGAVQIAYGEDSISTPEIETATHERILGTFRQEALRR
FT                   HPGIDVETWLMALDGTVQKIGP"
FT   gene            complement(585618..589796)
FT                   /locus_tag="MMAR_0496"
FT   CDS_pept        complement(585618..589796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0496"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38960"
FT                   /db_xref="GOA:B2HN21"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN21"
FT                   /protein_id="ACC38960.1"
FT                   /translation="MAAVSLALTFAQSPGRVSPDTKLDLTANPLRFLARATSLWNSELP
FT                   FGQSQNQAYGYMFPHGTFFLVGHLLQLPGWITQRLWWALLLTIGFWGLLRVAEALGIGS
FT                   PTSRIIAAAAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRATSERPLRTLAAQ
FT                   AGLAVALMGAVNAIATLAGCLPAMIWLACHRPNRRWWRHTAWFMLALLLATLWWLVALT
FT                   QLRGVSPPFLDFIESSGVTTQWSSLVEMLRGTDSWTPFVAPNATAGAPLVTGSVAILGT
FT                   CLVAAAGLAGLASREMPARGRLVTMLLVGVVLLAVGYSGGLGSPLAHQVQAFLDAEGTP
FT                   LRNVHKLGPVIRLPLVLGLAELLGRIPLPGSAPKPVWLGAFAHPERDKRVAAGIVALTA
FT                   LLVSTSLAWTGRLTPPGTYTAIPAYWHQAADWLSEHNTGAPAPGRVLVVPGAPFATQVW
FT                   GTSHDEVLQVLGASPWGVRDSIPLTPPQTIRALDSVQRLIASGRPSVGLADSLARQGIS
FT                   YLVLRNDLDPESSRSTRPILAHRAITGSPRLQKVAEFGEPVGPGSLAGFVNDSGLRPRY
FT                   SAIEIFRVIDQVGGAGNPGAPYFADTASLPRVDGGPEVLLRLDERRRLLGQTALGPVLL
FT                   TQDARAAQLPVPVVTVTDTPVARETDYGRVDQHSSAVRAPGDARHTYNRVPDYPVPGAE
FT                   VVYGGWTGGRITVSSSSSDSTAMPDVAPGASAAAAVDGDPATAWVSNALQAAVGQWLQV
FT                   DFDHPVTNAVITLTPSPTAVGAQVRRILVETVNGSTTLRFDDAGKPLTAALPYGETPWV
FT                   RITAAGTDDGSPGVQFGITDLTITQYDASGFAHSVQLRHTVLVPGPPPGAEIARWDLGS
FT                   ELLGRPGCAPAPDTMRCAASMALAPEEPVNLSRTLTVPHPMTVTPTVWVRPRQGPKLAD
FT                   LIAQPDTTRARGDSDGLEVLGSAYAATDGDRATSWTAPQRVVQRKTPPTLTLTLPRPTE
FT                   VTGLRVAPSRSALPAHPTMVAINLGDGPQIRSLSPDGGPQTVSLHPRVTGTVTVSLLDW
FT                   EDVIDRNALGFDQLKPPGLAELVVLGAGGRPIAPADAAHNRAREVRIGCDHGPVIAVAG
FT                   RFVHMSVRTTVGALLDDEPIQAQPCEPEPIALPPGQQELLISPGTQFVVDGAQLTPPAA
FT                   GELPGAAAVPAETGAWSATRREVRAPASQTPRVLVIPESINPGWVARTGAGAQLTPVAV
FT                   NGWQQGWVVPAGDPGTITLSFAANSLYRAGLAIGLSLLPVLVLLVLWRARRRGPDDPPA
FT                   RPWTTGWAAAVAALAAGALIAGPLGAVLVGAALGVCYALRRRERLRDRLTIATSAGGLI
FT                   LAGAALSRHPWRSVDGYAGHSAIVQLLALISIAALVAATVAPGLTRGEK"
FT   gene            complement(589885..590058)
FT                   /locus_tag="MMAR_0497"
FT   CDS_pept        complement(589885..590058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0497"
FT                   /product="small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38961"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN22"
FT                   /protein_id="ACC38961.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGITVMVQQDTKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
FT   gene            complement(590127..590384)
FT                   /locus_tag="MMAR_0498"
FT   CDS_pept        complement(590127..590384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0498"
FT                   /product="conserved hypothetical small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38962"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN23"
FT                   /protein_id="ACC38962.1"
FT                   /translation="MPGFTLAAAASIAAGLSIGAAATVGLTLVVHSGSTVSTGVPSDPA
FT                   APTIVEYGDRCLHDYCPPPCGETTPCLNSQQRPADRSRQP"
FT   gene            590488..591681
FT                   /gene="lpqI"
FT                   /locus_tag="MMAR_0499"
FT   CDS_pept        590488..591681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqI"
FT                   /locus_tag="MMAR_0499"
FT                   /product="conserved lipoprotein LpqI"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38963"
FT                   /db_xref="GOA:B2HN24"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN24"
FT                   /protein_id="ACC38963.1"
FT                   /translation="MAFPRTLAVLAAASALVAACSHGGTRTGSSSTTTSAGASPSATSS
FT                   TPMAAAAPRICADPAAVPAAMPNVRDKLAQLLMVGVRDGDDARAVVTNYRVGGILIGSD
FT                   TDLSILTNGVLKDIVAGSGPLPVAVSVDEEGGRVSRLKSLLGGRGPSARELARTDTVDQ
FT                   VYDVALQRGRKMKELGITVDLAPVVDVTDAPDDTVIGDRSFGSNPETVTEYAGAYARGL
FT                   RDAGLLPVLKHFPGHGRASGDSHTGGVVTPPLSDLQDSDLVPYRTLVTQTPVAVMLGHL
FT                   QVPGLTGDEPASLSKNAVDLLRNGTGYGGPPFDGPIFSDDLSSMAAISDRYGVTEAVLR
FT                   SLQAGTDIALWVSTEEVPAVLDRLEQALAAGELQMSAVDASLVRVARMKNVSASCGH"
FT   gene            591768..592394
FT                   /locus_tag="MMAR_0500"
FT   CDS_pept        591768..592394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0500"
FT                   /product="transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /note="possibly involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38964"
FT                   /db_xref="GOA:B2HN25"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN25"
FT                   /protein_id="ACC38964.1"
FT                   /translation="MAGGTKRLPRAIREQQMLDAAVQMFSANGYHETSMDTIAAAAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDAVRADIDLSQSPKDLLRNAIVSFLRYIDQNQ
FT                   ASWIVMYTQAVSSQAFAQTVREGREQIVELVAGMLRAGTRSPRSDAEIDMMAAALVGAG
FT                   EAVANRLSAGDTDVDEAAEMMIDLFWRGLKGAPSDREIGSNFAAG"
FT   gene            592522..593826
FT                   /locus_tag="MMAR_0501"
FT   CDS_pept        592522..593826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0501"
FT                   /product="conserved transmembrane protein"
FT                   /note="function unknown, possibly ion channel involved in
FT                   transport of chloride across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38965"
FT                   /db_xref="GOA:B2HN26"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN26"
FT                   /protein_id="ACC38965.1"
FT                   /translation="MTILPASSSGRFASVLRRASRPDVDFFCAVVIVGLLAGVAGLSTT
FT                   VVLRFVEHLTYHYAFGSLLEGITGSSPVRRALGPMVGGALAGLGWWLLRRRTDVPPLAG
FT                   TIADHARIPRRTWSIDALLQVVLVGSGASLGREGAPRQFAAALSDFATTWLRRLSPGDR
FT                   EILLACAAGAGLGAVYAVPLAGALFALRIMLNTWNIRALGAALITSSLAVAIGSLVTHD
FT                   RPELDWPSAESTYLLSAHALALAPVAFVVGVAFNRIMAAARPASLVRSWTLIPGLAAAG
FT                   LAIGICSHWWPELPGNGKSILTVSLASGMTLSAAAVILVLKPLLTALFLRVGGAGGMLT
FT                   PSLATGAAAGSLLVLAIDAVAGTHLHGPVISLAAAAGVLAVTQGSPIWAAIFVWELARP
FT                   PIWMLVVFLVTAVGAHGLKTLVLGRRLPLRDHRAG"
FT   gene            complement(593838..594689)
FT                   /locus_tag="MMAR_0502"
FT   CDS_pept        complement(593838..594689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0502"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38966"
FT                   /db_xref="GOA:B2HN27"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN27"
FT                   /protein_id="ACC38966.1"
FT                   /translation="MNQPSGLKNMLRAAAGALPVVPRGDALPNRTVSVEELPIDHTNVA
FT                   AYAAVTGLRYRNNVPLTYPFVLAFPSVMALVTGFDFPFAAMGSVHTENHITQYRPIAVT
FT                   DTVGVKVHAENLREHRKGLMVDLVTDINVGNELAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   QPKLPPPAAVLRITPAQIRRYAAVGGDHNPIHTNSIAAKLFGFPTVIAHGMFSAAAVLA
FT                   NIEAKIPDAVRYSVRFGKPVLLPATAGLYIDEADAADPGWEIALRNMSKGYPHLTATIK
FT                   PL"
FT   gene            complement(594708..596072)
FT                   /gene="fabG4"
FT                   /locus_tag="MMAR_0503"
FT   CDS_pept        complement(594708..596072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG4"
FT                   /locus_tag="MMAR_0503"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase FabG4"
FT                   /note="involved in the fatty acid biosynthesis pathway
FT                   (first reduction step) [catalytic activity: (3R)-3-
FT                   hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-
FT                   [acyl-carrier protein] + NADPH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38967"
FT                   /db_xref="GOA:B2HN28"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN28"
FT                   /protein_id="ACC38967.1"
FT                   /translation="MAPKLSSDLFSQVVNSGPGTFVAKQLGVPQAETLRRYRPGDPPLA
FT                   GSLLIGGEGRVAEPLRAALAKDYDQVSNNLGGRWADSFGGLVFDATGITDPAGLKGLHD
FT                   FFKPVLRNLGASARVVVVGTTPDAIDNSHERIAQRALEGFTRSLAKELRRGSTAALVYL
FT                   SPEAKPAATGLESTVRFILSAKSAYVDGQVFYVGAADSTPPADWDRPLEGKVAIVTGAA
FT                   RGIGQTIAEVFARDGASVVAIDVESAADALAETAASVGGTPLWLDVTADDAVDKITEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDSVIAVNLLAPLRLTEGLVGNGSIGAGG
FT                   RVIGLSSIAGIAGNRGQTNYGATKAGMIGIAQALAPSLAEKDITINAVAPGFIETKMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
FT   gene            596242..597567
FT                   /gene="fadA2"
FT                   /locus_tag="MMAR_0504"
FT   CDS_pept        596242..597567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="MMAR_0504"
FT                   /product="acetyl-CoA acyltransferase FadA2"
FT                   /note="function unknown, but involved in lipid degradation
FT                   [catalytic activity: acyl-CoA + acetyl-CoA = CoA + 3-
FT                   oxoacyl-CoA]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38968"
FT                   /db_xref="GOA:B2HN29"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN29"
FT                   /protein_id="ACC38968.1"
FT                   /translation="MAPAAEKNAQTKRRVAVLGGNRIPFARSDGAYAEASNQDMFTAAL
FT                   AGLVDRFDLRGQRLGAVVGGAVLKHSRDFNLMRECVLGSELSPYTAACDLQQACGTGLQ
FT                   AAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGEDLRRTLLRLRRAKSNVHRLRLVGGL
FT                   PANLGVEIPANSEPRTGLSMGDHAAITAKQMGIKRVDQDELAAASHRNMADAYDRGFFD
FT                   DLVTPFLGLYRDDNLRPNSSVEKLASLRPVFGVKAGDATMTAGNSTPLTDGASVALLSS
FT                   EQWAQEHSLSPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLTLQDFDFYEI
FT                   HEAFASVVLAHLQAWESEEYCKQRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRI
FT                   LAQTAKQLAEKKAERKGSAQPVRALISICAAGGQGVAAILEA"
FT   gene            complement(597865..599700)
FT                   /gene="fadE5"
FT                   /locus_tag="MMAR_0505"
FT   CDS_pept        complement(597865..599700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE5"
FT                   /locus_tag="MMAR_0505"
FT                   /product="acyl-CoA dehydrogenase FadE5"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38969"
FT                   /db_xref="GOA:B2HN30"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN30"
FT                   /protein_id="ACC38969.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKALGEGQFSDLDTDTAREMLTEI
FT                   SRLAEGPVAASFIEGDRNPPVFDPKTHTVTLPESFKDSVRAVIEAGWDKAGLDEELGGM
FT                   PMPRALMWALHEHLLGANPAVWMYSGGAGFAQIMYHLGTEEQKKWAVMASERGWGSTMV
FT                   LTEPDAGSDVGAGRTKAVEQADGSWHIDGVKRFITSGDSDDLFENIFHLVLARPEGAGP
FT                   GTKGLSLFFVPKFLFDFETGELGERNGVFVTNVEHKMGLKVSATCELSLGQHGVPAKGW
FT                   LIGEVHEGIAQMFEVIEQARMMVGTKAIATLSTGYLNALEYAKSRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDAAVAEAAHGVDAKLAVKINDLL
FT                   LPVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVSGQIQEFVDSETGNGRLKTERALLAKALTDVQAMAATLTGYLMA
FT                   AQQDINSLYKVGLGSVRFLMSVGDLVIAWLLQRQAAVAVAALDAGATGDERSFYEGKVA
FT                   VASFFAKNFLPLLTSTREVIDTLDNDIMELDEAAF"
FT   gene            600242..600730
FT                   /locus_tag="MMAR_0506"
FT   CDS_pept        600242..600730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0506"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38970"
FT                   /db_xref="GOA:B2HN31"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN31"
FT                   /protein_id="ACC38970.1"
FT                   /translation="MNPQSNLTPSSLREAFGHFPSGVVAIAAEINGAREGLAASTFVPV
FT                   SLDPPLVSFCVQNVSTTWPKLKGAPMLGISVLGEAHDEAARTLAAKTGDRFAGLETVCN
FT                   DSGAVFIKGTSLWLESAIEQLIPAGDHTIVVLRVSEVTVDAQVAPIVFHRSVFRRLGV"
FT   gene            600855..601163
FT                   /locus_tag="MMAR_0507"
FT   CDS_pept        600855..601163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0507"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38971"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN32"
FT                   /protein_id="ACC38971.1"
FT                   /translation="MRVRVWGAKLWTRMPGAAAVLISTLFFCVSVQEVQMGIDRDFAHS
FT                   IPGAPDTADSDAFAAIIGGAEGVAGLIASPMRWKGPSGHSCWFANAPDVGATRVAGG"
FT   gene            601170..602420
FT                   /locus_tag="MMAR_0508"
FT   CDS_pept        601170..602420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0508"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38972"
FT                   /db_xref="GOA:B2HN33"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN33"
FT                   /protein_id="ACC38972.1"
FT                   /translation="MVETSRPEGRIDGPSKRVLWLVITQSGFYRTALQLGNVPIVLPFV
FT                   VAELHAELWMAALIFPAFTAGAAIGNMLAPAVLAAVPRRRRLVIIVFGLTVLAAVNAMG
FT                   ATMGDGNEAGSLFLVNVLFIGAVSAFSFVAFADLVAAMPSGTDRAQVLLTEAGVGAALT
FT                   AIVTVALSFVPHEDHLTNNIRLLWTATAAMAISGLICLGLPQRIVPPVHKAPGLNKVVH
FT                   VGLAALRRESWYRRYLAVQLLFGSVVLGSSFYSIRVAAIPGDEHDNVVVLVLFVCVGLV
FT                   GGIRVWNRIRERFGLVGLFAGSAILSIAAAVIAIAFQLAGSWPNLVAISLVIALASIAN
FT                   QSVFTAGQLWIAHNADPTLRISLIAFGRLVISAGLVGLSSLLGILAQFHDVVWPVMIVL
FT                   LLNVAAAYSAKRLAPAD"
FT   gene            complement(602461..602619)
FT                   /locus_tag="MMAR_0509"
FT   CDS_pept        complement(602461..602619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38973"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN34"
FT                   /protein_id="ACC38973.1"
FT                   /translation="MMRETTSISDIRTAIRELTVRAELAHKQGRHDDAAEIERRIAGYR
FT                   DELGDRP"
FT   gene            complement(602667..603413)
FT                   /gene="sdhB_1"
FT                   /locus_tag="MMAR_0510"
FT   CDS_pept        complement(602667..603413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB_1"
FT                   /locus_tag="MMAR_0510"
FT                   /product="succinate dehydrogenase (iron-sulfur subunit),
FT                   SdhB_1"
FT                   /note="involved in interconversion of fumarate and
FT                   succinate (aerobic respiration) [catalytic activity:
FT                   succinate + acceptor = fumarate + reduced acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38974"
FT                   /db_xref="GOA:B2HN35"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN35"
FT                   /protein_id="ACC38974.1"
FT                   /translation="MGYNASLRVWRGDESNGELRDFTVEVNEGEVVLDVIHRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFAEDEIVTVTPLRTFPVIRDLVTDV
FT                   SFNYEKAREIPSFAPPKELQPGEYRMAQVDVARSQEFRKCIECFLCQNVCHVIRDHEEN
FT                   KKAFAGPRFLMRIAELEMHPLDTRDRRNEAQEAHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVVDRKYDPVVWLGNKLFRR"
FT   gene            complement(603413..605341)
FT                   /gene="sdhA_1"
FT                   /locus_tag="MMAR_0511"
FT   CDS_pept        complement(603413..605341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA_1"
FT                   /locus_tag="MMAR_0511"
FT                   /product="succinate dehydrogenase (iron-sulfur subunit),
FT                   SdhA_1"
FT                   /note="involved in interconversion of fumarate and
FT                   succinate (aerobic respiration) [catalytic activity:
FT                   succinate + acceptor = fumarate + reduced acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38975"
FT                   /db_xref="GOA:B2HN36"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN36"
FT                   /protein_id="ACC38975.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNSNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRLKDGKISQRNFGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDFAEVGDYE
FT                   ARIKVFAECTITELLKDGPENGGRIAGAFGYWRESGRFILFEAPAVVMATGGIGKSFKV
FT                   TSNSWEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKN
FT                   SDDDRFMFGYIPPVFKGQYAETAEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAG
FT                   RGTPHGGVYLDIASRLTPEEIKRRLPSMYHQFMELAGVDITKEPMEVGPTCHYVMGGIE
FT                   VDADTGAATVPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRP
FT                   TVSPESVDAAARLALAPFEGPTDGTAPENPYALQMDLQFLMNDLVGIIRNADEISKALT
FT                   LLRELWARYEHVQVEGHRQYNPGWNLAIDMRNMLTVSECVARAALERTESRGGHTRDDH
FT                   PGMDPNWRNVLLVCRAAQEATDGSHITITRQPQVPMRPDLLDLFQISELEKYYTAEELA
FT                   DHPGRRT"
FT   gene            complement(605388..606209)
FT                   /locus_tag="MMAR_0512"
FT   CDS_pept        complement(605388..606209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0512"
FT                   /product="succinate dehydrogenase (membrane anchor
FT                   subunit)"
FT                   /note="could be involved in interconversion of fumarate and
FT                   succinate (aerobic respiration). this hydrophobic component
FT                   may be required to anchor the catalytic components of the
FT                   succinate dehydrogenase complex to the cytoplasmic
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38976"
FT                   /db_xref="GOA:B2HN37"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN37"
FT                   /protein_id="ACC38976.1"
FT                   /translation="MSAPTANRPDTGVFSPSRAKIPQRTLRTDLWWWAPLVTNIGFLAF
FT                   IVYATTRAFWGSGYWVEKYHYLTPFYSPCVSASCAPGASHLGVWFGHFPWWIPLGSLVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTGCAVPEPRAHYTGETRLPLIIQNSHRYFFYVAV
FT                   VVSLINTYDAIMAFHSPTGFGFGLGNVILVTNVLLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMLFAWITLGTLSLTDFYIMLVATNTITDLRFIG"
FT   gene            complement(606288..606584)
FT                   /locus_tag="MMAR_0513"
FT   CDS_pept        complement(606288..606584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="In M. tuberculosis this gene is down regulated by
FT                   HspR|Rv0353"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38977"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN38"
FT                   /protein_id="ACC38977.1"
FT                   /translation="MSPTNELAELHDLIGDLRRCVTSLKSRYGDDSGMRRVVIDADRIL
FT                   TDIQLLDTDIAELDLDRASVQQSVEKIAIPDTDYDRDFWRDVDDEGVGGHSRY"
FT   gene            606700..607470
FT                   /locus_tag="MMAR_0514"
FT   CDS_pept        606700..607470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0514"
FT                   /product="PEP phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38978"
FT                   /db_xref="GOA:B2HN39"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN39"
FT                   /protein_id="ACC38978.1"
FT                   /translation="MPSEQGLNVTAERALALLALHQPGNPVVLPTVWDAWSARLAANAG
FT                   FAALTVGSHPLADSIGKPDNEGMSFDDVLARVTQITAAVDIPVSVDIESGYGLDAQRLI
FT                   EGLLSVGAVGLNIEDTVHSEGARLRSRREHAELVGALRSAADAAGVHVVLNARTDLFLR
FT                   RDGDPADRFERAVARLTEAAAAGADVLYPVGRHDPDTLRRLAAQLPLPINAIALPDQDD
FT                   PASFGRLGVARISFGPFLQAALSGRATELLARWR"
FT   gene            complement(607545..608003)
FT                   /gene="hsp"
FT                   /locus_tag="MMAR_0515"
FT   CDS_pept        complement(607545..608003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="MMAR_0515"
FT                   /product="heat shock protein Hsp"
FT                   /note="thought to be involved in the initiation step of
FT                   translation at high temperature. bound to 30S ribosomal
FT                   subunit. possibly a molecular chaperone. in M. tuberculosis
FT                   H37Rv seems to be regulated positively by SigE and
FT                   negatively by HspR"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38979"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN40"
FT                   /protein_id="ACC38979.1"
FT                   /translation="MSNLALWSRPAWSTDRWLRDFFGPAAASDWYKPLDTGFNPAAEIV
FT                   KDGDDAVVRLELPGVDVENDVNVEVERGELVIRGEHRDEHAQEAGEADRRTLREIRYGS
FT                   FRRSFQLPEHVTSEAVSASYDAGVLTVRVQGAYRDPAASEPQRIAITK"
FT   gene            608237..610795
FT                   /gene="nirB"
FT                   /locus_tag="MMAR_0516"
FT   CDS_pept        608237..610795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="MMAR_0516"
FT                   /product="nitrite reductase [NAD(P)H] large subunit [fad
FT                   flavoprotein] NirB"
FT                   /note="involved in nitrate assimilation (denitrification)
FT                   (at the second step). this enzyme is a fad flavoprotein
FT                   that also contains a siroheme and one 2Fe-2S iron-sulfur
FT                   center [catalytic activity: 3 NAD(P)H + nitrite = 3 NAD(P)+
FT                   + NH4OH + H2O.]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38980"
FT                   /db_xref="GOA:B2HN41"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN41"
FT                   /protein_id="ACC38980.1"
FT                   /translation="MRAHDANPGVPRHVIVVGHGMVGHRMVEALRARDTDDRWRVTVLA
FT                   EEADAAYDRVGLTSYTETWDRAQLALPGNDYAGDERVRVLLNTRVTEIDRAAKSVVTAD
FT                   GTRHGYDALVLATGSYAFVPPLPGHDLPGCHVYRTLDDLDAIHACAERALRDGHGGAGV
FT                   VIGGGLLGLEAANALRQFGLQTHVIEMMPRLMAQQIDEAGGALLARMVSDLGIAVHVGT
FT                   GTDSIESVEHSDGATSLRVRLAGGDVIDAGALIFAAGIRPRDELARAAGLAIAERGGVL
FT                   TDLSCQTSDPDIYAVGEVAAIEGRCYGLVGPGYTSAEVVADRLLNGVAEFPEADLSTKL
FT                   KLLGVDVASFGDAMGATENCLEVAVNDAVNRTYAKLVLSDDAKTLLGGVLVGDASAYGV
FT                   LRPMVGSELPGDPLALISPASGDGAGALGIGALPDSAQICSCNNVTKGELKCAIADGCA
FT                   DVPALKACTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFQIISATEIRT
FT                   FSGLLQRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNGSYS
FT                   VVPRVPGGDIKPEHLILIGQIAQEFGLYTKITGGQRIDMFGARVDQLPLIWKRLVDAGM
FT                   ESGHAYGKALRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGCARE
FT                   CAEARSKDVGVIATEKGWNLYVGGNGGMTPKHAQLLASDLDTETLVRYIDRFLMYYVRT
FT                   ADRLQRTAPWVESLEGGLDHVREVVCDDSLGLAEEFEAAVQHHIANYKCEWKGVLEDPD
FT                   KLSRFVSFVNAPDAADPTVAFTERAGRKVPVSIGIPRVRS"
FT   gene            610821..611177
FT                   /gene="nirD"
FT                   /locus_tag="MMAR_0517"
FT   CDS_pept        610821..611177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="MMAR_0517"
FT                   /product="nitrite reductase [NAD(P)H] small subunit NirD"
FT                   /note="involved in nitrate assimilation (denitrification);
FT                   required for activity of the reductase [catalytic activity:
FT                   3 NAD(P)H + nitrite = 3 NAD(P)+ + NH4OH + H2O.]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38981"
FT                   /db_xref="GOA:B2HN42"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2HN42"
FT                   /protein_id="ACC38981.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQAALFRLDDGSV
FT                   HALGNIDPFSGAAVLSRGIVGDRDGRAAVQSPIQKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTAEGKIQVARLAA"
FT   gene            complement(611314..611769)
FT                   /locus_tag="MMAR_0518"
FT   CDS_pept        complement(611314..611769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38982"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU0"
FT                   /protein_id="ACC38982.1"
FT                   /translation="MANNEEPSRGLLDPVAKMLRLPFGTPEFIDKIVAGSVNQVGRRTL
FT                   YMLITTWDAAGGGPFAASAVASTGLAKTAEIVQSMFIGPIFNPLLKMLGADKIAVRASL
FT                   CASQLVGLGIMRYGLRSEPMHSMSVDALVDAIGPTMQHYLVGDISRG"
FT   gene            complement(611826..612587)
FT                   /locus_tag="MMAR_0519"
FT   CDS_pept        complement(611826..612587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38983"
FT                   /db_xref="GOA:B2HNU1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU1"
FT                   /protein_id="ACC38983.1"
FT                   /translation="MHLILTAHGTRRPAGVAMIGDLAARVSALLKQTVQVAFVDVLGPT
FT                   PSEVLGRPAPGRGSAQSAIVVPAFLSRGYHVRIDLPAHVAASGHPDVTVTPALGPSREI
FT                   ARILIQQLLESGWRPDDSVILAAAGTSDRRALDDLRTARAFLCALTGSPVTLGFAATGR
FT                   PDLRTAVRAARRNGARRVVVVSYLLAEGLFQERLRACGADVVTPPLGNHPGLAELIATR
FT                   FHSAISAAVPTVPRSPMHTRAESHETQSIVG"
FT   gene            complement(612578..613729)
FT                   /locus_tag="MMAR_0520"
FT   CDS_pept        complement(612578..613729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0520"
FT                   /product="transcriptional regulatory protein"
FT                   /note="could be involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38984"
FT                   /db_xref="GOA:B2HNU2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU2"
FT                   /protein_id="ACC38984.1"
FT                   /translation="MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMI
FT                   ALPEDDELQGNTEALIANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISR
FT                   GPKATGELRAAGLREEWSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFV
FT                   GGLRAAGAEVVPIRVYRWKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRE
FT                   LDIEEELLEALRNDVHAMCVGPVTSRPLIRKGVPTSSPERMRLGALARHIAEELPLLGS
FT                   CTVNAAGHVVDIRGTCVLVDGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGD
FT                   DTHAVDTAVLRLRTALGDKNIIATVVKRGYRLALDTQDDTACT"
FT   gene            complement(613808..615211)
FT                   /gene="narK3_2"
FT                   /locus_tag="MMAR_0521"
FT   CDS_pept        complement(613808..615211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK3_2"
FT                   /locus_tag="MMAR_0521"
FT                   /product="integral membrane nitrite extrusion protein
FT                   NarK3_2"
FT                   /note="involved in excretion of nitrite produced by the
FT                   dissimilatory reduction of nitrate. responsible for the
FT                   translocation of the substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38985"
FT                   /db_xref="GOA:B2HNU3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU3"
FT                   /protein_id="ACC38985.1"
FT                   /translation="MNRNHRIEHWDPEDAQAWEASNHAVARRNLLWITACDHVAFGVWT
FT                   LWPVLVLFMPYDVYGFSAADKFLLGATATFVAACLRIPYSLGIATFGGRNWTVFSIAVL
FT                   AIPTIGTIWLLSHPGLPLWPYLACAALTGCGGANYAASMTNTNAFYPHRRKGFALGFNA
FT                   GAGNLGVPMIQLVGLLVIAIAGYHQPYWVCGLYLLLLTVVAVGAARQMDNLAHATYDVG
FT                   HLRAILTQRDTWVLALLYLGTFGSWIGFSFAFGQVLQINFVGSGQSHAQAALHAAEFAF
FT                   IGPALGSLARIYGGRLADRVGGSRVTLAVFITMALFTGLLVAISTHGDHTPGPATVAMT
FT                   AGYIGGFLALFALAGLGNGSVYKMIPSVFEALSHRNQITEFERRRWSQAMSGAVIGFVA
FT                   AFGALGGVGINLALRQSYLSTGTDTSAYWVFLLFYVGAALLTWSRYGRRAVPVAGTAGT
FT                   ASGSRLARV"
FT   gene            complement(615441..615986)
FT                   /gene="aac"
FT                   /locus_tag="MMAR_0522"
FT   CDS_pept        complement(615441..615986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aac"
FT                   /locus_tag="MMAR_0522"
FT                   /product="aminoglycoside 2'-N-acetyltransferase Aac"
FT                   /note="confers resistance to aminoglycosides (gentamicin,
FT                   tobramycin, dibekacin, netilmicin, and 6'-N-
FT                   ethylnetilmicin)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38986"
FT                   /db_xref="GOA:B2HNU4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU4"
FT                   /protein_id="ACC38986.1"
FT                   /translation="MHTEVHTARLVHTADLDSETRQGIRQMVTAAFAGDFTDHDWEHAL
FT                   GGMHALIWHRGAIIAHGAVVQRRLIYRGSALRCGYVEGVAVREDWRGQGLATAVLDATE
FT                   QVIRGAYELGALSSSAGARRLYTSRGWLPWHGPTSVLSPTGPTPTPDDDGTVFVLPVDA
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(616013..616882)
FT                   /locus_tag="MMAR_0523"
FT   CDS_pept        complement(616013..616882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0523"
FT                   /product="urea amidolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38987"
FT                   /db_xref="GOA:B2HNU5"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU5"
FT                   /protein_id="ACC38987.1"
FT                   /translation="MITLEILRSGPLAIVEDLGRAGLGHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTLGGFSARVRGGDIDIAVTGADTDPTVNGTLFGTNSIHHVRDGSVIS
FT                   LGTPNAGLRTYLAVRGGISVTPVLGSRSYDVMSAIGPAPLRTGDVLPIGDRSQDYPELD
FT                   QAPVAAITDRVVELRAIPGPRDDWFVDPEALVHTDWVVSGQSDRVGTRLVGRPLTHRNP
FT                   DRQLPSEGTTRGAIQVPPNGLPVILGPDHPITGGYPVVGVVIDDDIDKVAQVRPGQHVW
FT                   LHWARPRR"
FT   gene            complement(616898..617569)
FT                   /locus_tag="MMAR_0524"
FT   CDS_pept        complement(616898..617569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38988"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU6"
FT                   /protein_id="ACC38988.1"
FT                   /translation="MSVTDISTELAADMVTRNIFDYGDQALMLECDSTAQVLAWTQTLR
FT                   AAALPGVVDIVGASRTVLVKLAGPRFQGVTRQRIRRLPVDPDLLASEHQGEPLPAPVID
FT                   VIYDGPDLAEVASHTGLTTAQVIHAHTATRWRVGFSGFAPGFAYLIGGDPRLQVPRRSE
FT                   PRTSVPAGSVALAGEYSAVYPRHSPGGWQIIGHTDAVLWDIDRPNPALLTQGMWVQFRP
FT                   A"
FT   gene            complement(617682..618674)
FT                   /locus_tag="MMAR_0525"
FT   CDS_pept        complement(617682..618674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0525"
FT                   /product="periplasmic iron-transport lipoprotein"
FT                   /note="thought to be involved in iron transport across the
FT                   membrane (import)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38989"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU7"
FT                   /protein_id="ACC38989.1"
FT                   /translation="MQQGWSRRGFLQVAAATGLLASGVAACSSSKPQAGTADTGAVTIT
FT                   HLFGQTVIKEPPKRVVSAGFTEQDDLLALGVVPIAVTRWFGDQPFAVWPWAQPKLGAAQ
FT                   PVVLSLDDGIQVDQIANLKPDLIVAINAGVDAETYQKLSAIAPTIPQSGGDAFFEPWKL
FT                   QASTVGEAVFQSAQMKSLIDAVGQKFAAVAQQHPQWMGKKALLLQGRLWQGNVIATMAG
FT                   WRTDFLNEMGLVISEGIKPFAVDQRGVIPRDHIKEVLDSADVLIWLTESPEDEQALLAD
FT                   PEIAASAATEQKRHVFTTGDQAGAIAFASPLSYPVVADELPALIAKVLG"
FT   gene            618928..620325
FT                   /gene="narU"
FT                   /locus_tag="MMAR_0526"
FT   CDS_pept        618928..620325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narU"
FT                   /locus_tag="MMAR_0526"
FT                   /product="integral membrane nitrite extrusion protein NarU"
FT                   /note="involved in excretion of nitrite produced by the
FT                   dissimilatory reduction of nitrate. responsible for the
FT                   translocation of the substrate across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38990"
FT                   /db_xref="GOA:B2HNU8"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU8"
FT                   /protein_id="ACC38990.1"
FT                   /translation="MTITPVRQHTAPREQHVGRHWIHDWRPEDPEFWDTIGRPIARRNL
FT                   VFSIFAEHIGFSVWMLWSIVVVQMMAVGAPGHPSHPAASGWALSPSQALCLVAVPSGVG
FT                   ALLRLPYTFAIPVFGGRNWTTISASLLVIPCLLLSWAVSHPGIPFVLLTLIAATAGVGG
FT                   GNFASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGGGMALARAGLF
FT                   YVPLAVVAAVCAFAFMNNLAEAKADVKPVWQSLRHADTWILALLYIGTFGSFIGYSAAF
FT                   PTLLKTVFDRGDIALGWAFLGAGIGSVIRPLGGRLADRVGGARVTAVSFLMLAIGAAAA
FT                   LWSVQIVNLPLFFASFMFLFVATGIGNGSTYRMISRIFKVKGELAGGDPDTMVQMRRQA
FT                   AGALGVISAVGAFGGFLVPLAYAWSKAQFGNIEPALRFYVVFFLALLFVTWHCYLRSKT
FT                   PMAQLGV"
FT   gene            complement(620326..621588)
FT                   /locus_tag="MMAR_0527"
FT   CDS_pept        complement(620326..621588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0527"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38991"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNU9"
FT                   /protein_id="ACC38991.1"
FT                   /translation="MTGPVSLELAGRQVKITHPDRVVFPGQGDRPSRTKLDLVRYYLSV
FT                   ADGALRGVAGRPMMLKRFVKGIDVEAVFQKRAPTNRPDWVDVAELRYASGTSAQEAVIH
FT                   DAAGLAWAINLGCVDLNPHPVLARDLDHPDELRIDLDPMPGVEWRRILDVAQVVREVLE
FT                   DYGLTPWPKTSGSRGFHVYARIAPQWSFSQVRLAAQTVAREVERRMPGVATSRWWKEER
FT                   EGVFVDFNQNAKDRTVASAYSVRANPDARVSTPLHWHEVADCDPQDFTLDTVPDRFAEM
FT                   GDPWSGMDGAVGALDRLLMLAEELGPPQRAPAGAGKRSDGRRQPSMPLIEVARTKTKDE
FT                   AMAALDTWRARHPAVADRLQPADVLVDGMRGPSSIWYRIRINLQHIPPEARPPQEELIA
FT                   EYNPWHGYRPPDGRGRPGADG"
FT   gene            621656..623329
FT                   /gene="fadD2"
FT                   /locus_tag="MMAR_0528"
FT   CDS_pept        621656..623329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD2"
FT                   /locus_tag="MMAR_0528"
FT                   /product="fatty-acid-CoA ligase FadD2"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38992"
FT                   /db_xref="GOA:B2HNV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV0"
FT                   /protein_id="ACC38992.1"
FT                   /translation="MPNLSDLPGVAKIQQYVDRGAAELHYVRKIIESGAFRLESPLNYA
FT                   AMATEIAKWGEFGMLPSFNARRHPHRAACIDEEGEFTYQQLDEAAHAVANALLAKGVSA
FT                   GDGVAILARNHRWFLIANYGAARAGARIILLNSEFSGPQIKEVSEREGAKLIIYDDEYT
FT                   GAVSKAEPPLGKLRALGVNPDSEEDSGSTDETLAELIARSSTAPAPKAGKHASIIILTS
FT                   GTTGTPKGANRSTPPTLAPVGGILSHVPFKANEVTSLPAPMFHALGYLHATIAMFLGST
FT                   LVLRRKFKPQLVLEDIEKHKVTAMVVVPVMLSRLLDAVEKIDKKPDLSSLKIVFVSGSQ
FT                   LGAELASRALKDLGPVIYNMYGSTEIAFATIAGPEDLQRNAATVGPVVKGVKVKILDDN
FT                   GNEVSQGQVGRIFVGNAFPFEGYTGGGHKQIIDGLMSSGDVGYFDEHGLLYVSGRDDEM
FT                   IVSGGENVFPAEVEDLISGHPDVVEATALGVDDKEWGARLRAFVVKKPDTDLDEETVKH
FT                   YVRDHLARYKVPREVIFLEELPRNPTGKILKRELREMEIE"
FT   gene            complement(623773..625134)
FT                   /locus_tag="MMAR_0529"
FT   CDS_pept        complement(623773..625134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0529"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38993"
FT                   /db_xref="GOA:B2HNV1"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV1"
FT                   /protein_id="ACC38993.1"
FT                   /translation="MTSMELMMPTDASFLFTESREHPMHVAGLQLFDPPDAAGPGFVDE
FT                   IYRCLAANREGQPAFRKHPATLLGGITNLGWQYDNEIDTDYHVRRSVLPYPGRVSELLQ
FT                   LVSQLHSHLLDRHYPLWEMHVVDGLADGRFAIYSKFHHALLDGASALMLLQRALSDDPR
FT                   DTEVRAPWNLPPQPDHAVGSSRLGSLANTAGSLMALGPSTVSLIRAALVEQQLTLPFGA
FT                   PRTLFNVKVGGARRCAAQSWSLDRFRAVAKCAGVTINDVVLAMCAGALRQYLLEQNALP
FT                   DAPLVALVPVSLRSQTDDSGGTMVGTVLCGLATDTTDPAKRLEMISQSMRRNKKAFSEL
FT                   SPLQAKALWAFNMAPLTLTAVPGFVPWTKPSFNVIVSNLPGPTKPMYWHGARLDSIYPL
FT                   SIAHDGQALSITLLSNAGTLEFGLVGCRRSVPHLQRLLLHLETSLHGLEQAVGL"
FT   gene            complement(625361..627547)
FT                   /gene="fadE6"
FT                   /locus_tag="MMAR_0530"
FT   CDS_pept        complement(625361..627547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE6"
FT                   /locus_tag="MMAR_0530"
FT                   /product="acyl-CoA dehydrogenase FadE6"
FT                   /note="function unknown, but involved in lipid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38994"
FT                   /db_xref="GOA:B2HNV2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV2"
FT                   /protein_id="ACC38994.1"
FT                   /translation="MPIAITPEHRDLADSVRSLVARVAPSEVLHAAMETPVENPPPYWQ
FT                   AAAEQGLQGVHLAESVGGQGYGILELAVALAEFGYGAVPGPFVPSAIASALISVHDPEA
FT                   KVLSELASGAAIAAYALDSGLTATRQGLEDGGVLVIRGEVRAVPAAAQASILVLPVAID
FT                   SGDEWVVLRAEQLEIEPVRSLDPLRPVAHVRANAVEVGDDVVLSNLSMTTAHALMSTLL
FT                   SAEAVGVARWATDAASGYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARA
FT                   LDEDSPHIEFAAAVAATLAPAAAQRCTQDCIQVHGGIGYTWEHDTNVYYRRALMLAACF
FT                   GRSVEYPQRVVDTATTTGMRAVDIDLDPDTEKLRAEIRADVEALKRMDREPRKAAIAEG
FT                   GWVLPYLPKPWGRASSPVEQVIIAQEFSTGRVKRPQVGIAAWILPSIVAFGTEEQKQRF
FT                   LPPTFRGEMIWCQLFSEPGAGSDLAGLSTKATRVDGGWRITGQKIWTTAAQYSQWGALL
FT                   ARTDPNAPKHNGITYFLLDMKSEGVQVKPLRELTGHEMFNTVYIDDVFVPDECVLGEVN
FT                   RGWEVSRNTLTAERVSIGSTDNNFLATLPQFVEFVRDGQFDQVAQHRAGHLIAEGHAAK
FT                   VLNLRSTLLTLSGGDAMPSAAISKLLSMRTGQGYAEFAVSSFGTDAAIGDTDELAGKWG
FT                   EYLLSSRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(627604..628566)
FT                   /gene="serA3"
FT                   /locus_tag="MMAR_0531"
FT   CDS_pept        complement(627604..628566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA3"
FT                   /locus_tag="MMAR_0531"
FT                   /product="D-3-phosphoglycerate dehydrogenase SerA3"
FT                   /note="involved at the first committed step in the
FT                   'phosphorylated' pathway of L-serine biosynthesis
FT                   [catalytic activity: 3-phosphoglycerate + NAD(+) = 3-
FT                   phosphohydroxypyruvate + NADH]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38995"
FT                   /db_xref="GOA:B2HNV3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV3"
FT                   /protein_id="ACC38995.1"
FT                   /translation="MNQPLRVLAHFVPGEKVLEFVAAQRDWLDIRWCAEDDDSGFYREL
FT                   DHAEVIWHVLRPLSGADLQRAPRLRLVQKLGAGVNTIDVATATKHGIAVANMPGANAPS
FT                   VAEGTVLLMLAALRRLPELDAATRQGRGWPTDPQLGESVRDIGSCTVGLIGYGNIAKRV
FT                   ATIVSAMGATVLHTSTRDDGRPGWRPLPELLATSDIVSLHLPLTPHTDRLLDADALAQM
FT                   KPNSLLINTSRGAVIDEDALVDALRSGSLAAAGLDVFAVEPVVPENPLLRLDNVVLTPH
FT                   VTWYTVDTMRRYLTEAVDNCRRLRDGLSLANVVNCQADC"
FT   gene            complement(628563..629561)
FT                   /locus_tag="MMAR_0532"
FT   CDS_pept        complement(628563..629561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0532"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38996"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV4"
FT                   /protein_id="ACC38996.1"
FT                   /translation="MAMIATHYQIDFSEHYLADYMAARGIGFLGWNTRFRGFESNFALD
FT                   HALVDIGVGVRWLREVAGAETVVLLGNSGGGSLMAAYQSQAVDPNVTPLAGTRPAAGVN
FT                   ELPTADGYVATAAHPGRPEVLTAWMDAAVIDENDPVATDPDLDLFNERNGPPYSPEFLS
FT                   RYRAAQAARNESITDWAEDELKRVRAAGFSDRPFTVMRTWADPRMVDASIEPTNREPNL
FT                   CYAGKPVRANRSARGIAAACTLRNWLGMWSLRVAQTRAAPHLARITCPALVINADADTG
FT                   VFPSDAQCIYDGLASTDKARASIDTDHYFTTPGARDEQADTITNWIAKRWQ"
FT   gene            complement(629698..630306)
FT                   /locus_tag="MMAR_0533"
FT   CDS_pept        complement(629698..630306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0533"
FT                   /product="transcriptional regulatory protein"
FT                   /note="could be involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38997"
FT                   /db_xref="GOA:B2HNV5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV5"
FT                   /protein_id="ACC38997.1"
FT                   /translation="MPEFPTHRGRQTQAAIDTAARTVIARKGILATTIADIAAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDEVNQRALSVTSHGLSNRERAYEAAAAHWNTYRNRLA
FT                   EMVSVSQLAMVNEDFAQQWADMCAIPISFIKETVKRAQAEGYCPGDDPQLVAEAIVAMF
FT                   NQFCYIQLSGSRTKEPDDLACIQTLANIYYRAIYGVEVS"
FT   gene            630397..630978
FT                   /locus_tag="MMAR_0534"
FT   CDS_pept        630397..630978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0534"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38998"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV6"
FT                   /protein_id="ACC38998.1"
FT                   /translation="MIKPHNTNTEFEFGGINHVALVCSDMARTVDFYSNILGMPLIKSL
FT                   DLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGISSPGAIPGIGDITSAVSTMNHLAF
FT                   HVPAEKFDAYRQRLKDKGVRVGPVLNHDHSEFQVSATVHPGVYVRSFYFQDPDGITLEF
FT                   ACWIKEFTADDTPAVPRTAADRRPPVAAGH"
FT   gene            630985..631533
FT                   /locus_tag="MMAR_0535"
FT   CDS_pept        630985..631533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0535"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACC38999"
FT                   /db_xref="GOA:B2HNV7"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV7"
FT                   /protein_id="ACC38999.1"
FT                   /translation="MTDAILTDDQIAALSPQQRRDLISRLERPLGELVDPTILSRTRRI
FT                   RLRLIISCALVLIPWTVFLGLTLPGNYVAHNWPATWVGFDILLVAFMAATAVLGYLRRQ
FT                   LLLLTAFTTGVLLICDAWFDLMTAGPSDRWWSVGSALFIELPIAVVMITGAQRIMRLTL
FT                   ARLWLIEPGTRLWHLPLFP"
FT   gene            complement(631487..632143)
FT                   /locus_tag="MMAR_0536"
FT   CDS_pept        complement(631487..632143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0536"
FT                   /product="transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /note="could be involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39000"
FT                   /db_xref="GOA:B2HNV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV8"
FT                   /protein_id="ACC39000.1"
FT                   /translation="MRPYRGVEATERLAARRSQLLESGLELLGSSDRDIAELTVRGICR
FT                   QAGLSARYFYESFPDKDEFIGGVFDWVVGDLATTIQAAVATVPPPEQARAGIAEIVRTI
FT                   VGDARIGRLLFSTHLANPVVVRKRTESSALFAMLSGQHAGDALRIPANDRIKVGAHFIV
FT                   GGVAQTISAWIEGDVELEPGQLVDQLASLLDELSDPRLYGLRGTRAGATAASPAQ"
FT   gene            632268..633170
FT                   /locus_tag="MMAR_0537"
FT   CDS_pept        632268..633170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39001"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNV9"
FT                   /protein_id="ACC39001.1"
FT                   /translation="MTIQEAAGRLAPHVERPISDPPRQVRRRKRGGFGDGLMGVALLAG
FT                   PANVIMELARPGVGHGVMESRVESGRIDRHPIKRARTTFTYVAVASAGTDEQKAAFRRA
FT                   VNRVHAQVYSTPESPVSYSAFDVELQLWVAACLYKGGVDIYRTFVGEMDDEEADRHYRD
FT                   GMSMGTTLQVPAELWPPDRAAFDRYWQESLQKIHIDDAVREYLYPIAASRVRGVALPGP
FT                   LRRWSEGLALLITTGFLPQRFRDEMRLPWDAAKQRRFDRLIAVVGALNRMMPRIVREFP
FT                   FNLMLWDLDRRIRTGRRLV"
FT   gene            633414..634982
FT                   /locus_tag="MMAR_0538"
FT   CDS_pept        633414..634982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0538"
FT                   /product="PPE family protein, PPE3"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39002"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW0"
FT                   /protein_id="ACC39002.1"
FT                   /translation="MVAPVWFASPPEVHSALLSSGPGPASLLSGAAAWAGLSTEYASVA
FT                   DELMGVLAAVQGGAWEGLSAELYVAAHVPYLMWLMRASATSAQAAAQHEAAAAAYTTAL
FT                   AAMPTMPELAANHVIHGVLMATNFFGINTIPIAANEADYVRMWIQAATTMSTYQAVSAA
FT                   AVASTPPSTPAPRILAAPAAAHDHDHDHGGDPTPIDYFVAEVLRIISGGRIIWDPAEGT
FT                   VNGIPYDDYVNAAQPIWWLVRALEFGQDFQTFIKELFTNPIGAIEFMVELVLFDWPTHI
FT                   AQIIQALAQSPQLLAVALGGVVANLGAISGLAGLSGLAGLHSAALPAAIAPIAPPMPPG
FT                   VALAPTVATSVAAPTPPSAPPSATSTVANAAPPPPPAPAAAGFGFPFVVGGGPGIGYGE
FT                   GMSASAAASARRKAPEPDSAALAAAAAAREEARRRRRKRKTERGYGEEFMDVEVDPDWG
FT                   GPRDDEPVASTQGAGRLGFAGTVHSESAATAAGLTTLVADEFGGGPKMPMLPGTWDTDS
FT                   DAPSD"
FT   gene            635001..635906
FT                   /locus_tag="MMAR_0539"
FT   CDS_pept        635001..635906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0539"
FT                   /product="O-Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39003"
FT                   /db_xref="GOA:B2HNW1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HNW1"
FT                   /protein_id="ACC39003.1"
FT                   /translation="MRSEGDSWDITTSVGSTALFVATARALEALKPDPLAVDPYAELFC
FT                   RAVGGSWADVLDGNAADHELQSDDFGKHFVNFQGARTKYFDAYFRRAVEAGVRQVVVLA
FT                   AGLDSRAYRLSWPDGTTIFELDRPQVLDFKREVLGGHGVRPRTERREIAVDLRDDWPQA
FT                   LRDSGFDAEAPSAWIAEGLLIYLPAAAQEQLFTGIDSLACLGSHVAVEDGAPLPDAEFA
FT                   AKLEEERAAVAAGGERPFFQLLYNERCAPAADWFSEHGWTALGTPLNNYLREVGRPVPG
FT                   PGSEVAAMFARNTLMSATKP"
FT   misc_feature    636000..651200
FT                   /note="ESX-3"
FT   gene            636034..636183
FT                   /locus_tag="MMAR_0540"
FT   CDS_pept        636034..636183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39004"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW2"
FT                   /protein_id="ACC39004.1"
FT                   /translation="MVRGRLVGGPGVNQGLIMKIMFTTLECLVTLGGLVWGGNIHHVDA
FT                   SCVQ"
FT   gene            636348..638210
FT                   /locus_tag="MMAR_0541"
FT   CDS_pept        636348..638210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0541"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39005"
FT                   /db_xref="GOA:B2HNW3"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW3"
FT                   /protein_id="ACC39005.1"
FT                   /translation="MKRGDIGMPAAQSPTSRVSGRVDADVVSRFATCCRALGIAVYDRK
FT                   RPADLDAARSGFGALTRVASDQCDAWTGLAAAGDQSIGVLEAVSRTAGTAGTLQRHVEL
FT                   AAGSLGFLYDTGLYLRFRATDPDGFHLAYAAALALAGESAQFAKANELVSGIVDRRPSW
FT                   RDARWLAVVINYRAQRWSDVVKLLTPIVNDSELDEAFAHAAKITLGTALARLGMFAPAL
FT                   SYLEEPDGPVPVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPENEQIEHALSDTS
FT                   FGIVTTTTGQIEARTDPWDPETEPSADDFVDPSAHERKGVLLHEAELQLAEFIGLEEVK
FT                   NQVSRLKSSVAMELVRKQRGLAVAQRTHHLIFAGPPGTGKTTIARVVAKIYCGLGLLKR
FT                   ENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGLVAIDT
FT                   LLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRSIDFPSYTSHELVEIAHKMA
FT                   EQRDSIFEPAALQDLEGLFARLAAGSTPDSNGVSRRSLDIAGNGRFVRNIVERSEEERE
FT                   FRLDHSEHAGSGEFSDDELMTITGSDVGRSVEPLLRGLGLSVPA"
FT   gene            638207..639808
FT                   /locus_tag="MMAR_0542"
FT   CDS_pept        638207..639808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0542"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39006"
FT                   /db_xref="GOA:B2HNW4"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW4"
FT                   /protein_id="ACC39006.1"
FT                   /translation="MTTNEPDGEWAGARRSFTSRTPVNDNPDKVEYRRGFVTRHQVTGW
FT                   RFVMRRIASGIALHDTRMLVDPLRTQSRSVLMGVLIFITGLVGCFVFSLIRPNGQVGSN
FT                   AVLADRSTAALYVRVGDTLHPVLNLTSARLIVGHPVNPTTVKSTELDRFPRGNLIGIPG
FT                   APERMVQSEARDSDWTVCDAISSGSQGGSAAHSTGVTVIAGSPEPSGHRATALGAGQVI
FT                   LVNDGTSSWLLWDGKRSRMDLADHAVTNALGFGTDLPAPRPIAPGLFNAIPEAAPLAAP
FT                   AIPDAGNPAAFAVPGPIGSVVQAYTLGDNSIQYYAVLPDGLQPISPVLAAILRNTNSYG
FT                   LQQPPRIGADDVAKLPVSRMLDTTRYPATPMHLVDTESNPITCAYWSKPVGATTSSLTL
FT                   LSGAALPVPDAVHTVDLVGGGSQNGAVATRVALAPGTGYFTQTAGGGPAAPPTGSLFWV
FT                   SDTGVRYGIDTEGEGGRKTVEALGLQDPPVLIPWSVLSLFAPGPTLSRADALMAHDGLA
FT                   PDSKPGRPASAEGEPR"
FT   gene            639805..643806
FT                   /locus_tag="MMAR_0543"
FT   CDS_pept        639805..643806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0543"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39007"
FT                   /db_xref="GOA:B2HNW5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW5"
FT                   /protein_id="ACC39007.1"
FT                   /translation="MSRLIFEARRRLAPPNTRKGTITIEAPPELPRVIPPSMLRRAMPV
FT                   LIVILIVGMIIALVATGMKMISPQTLFFPFVLLLAATALFRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAQQRAAAQWSHPDPDALAAVPGSRRQWERDPHDPDFLVLRAGRH
FT                   SVPLTTTLRVSDTADEIDLEPVSHSALRSLLDTQRTVRDVPTGIDLTKVSRVTLVGDRA
FT                   QVRDALRAWVAQAVTWHDPTVLGVALATRDLESGQWSWLKWLPHVDIPGQADGVGPARY
FT                   LAADPDDLVEMLAPAILDRPAYAGSAADALRHLLIVVDDPDYDINASMLAMGRAGVTVV
FT                   HCSSTLPHREQYSDPEKPILRIEDGAITRWQTGGGWQAYIDHADQLGADEASHLARRLS
FT                   RWDSNPTHAGLRSAATRGASFTTLLGIPDASQLDVQAIWGQRRRDDELRVPIGITASGE
FT                   PLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEA
FT                   GADSFRNFPQVVAVISNMAEKKSLADRFADTLRGEVARRETLLREAGRKIQGSAFNSVL
FT                   EYENARESAGVAGLDLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILF
FT                   ASQTLDVGKIKDIDKNTSYRIGLKVASASVSRQIIGVEDAYHIEAGKEHKGVGFLVPAP
FT                   GAAPIRFRSTYVDGIYEPPQQTKTRVVHNIPEPKLFTATAVEPDPDTVISEVEEEHPVG
FT                   PPRKLIATIGEQLARYGPQAPRLWLPPLDEPIPLSTLLATAGVAQRQWRWPLGEIDKPF
FT                   EMRRDPLVFDATSSAGNLVIHGGPKSGKSTALQSFMLSAASLHSPSEVTFYCLDYGGGQ
FT                   LRALQDLAHVGSVASALEPERIRRTFGELEQLLLARQQREVFRDRGGNGQAHGSVPDDG
FT                   FGEVFLVIDNLYAFSRDNTDQFNTRNPLLARVTELVNVGMAYGIHVIITTPSWLEVPLA
FT                   MRDGLGMRLELRLHDARDSNVRVVGALRRPAESVPHDQPGRGLTMAAEHFLFAAPELDQ
FT                   VPAINARYPGMAAPPVRLLPIDLAPDAVGNLYRGPDQIVIGQREEDLAPVVLNLAENPL
FT                   LMVFGDSKSGKTTLLRHIIRTVREHSTEDQVAFTVLDRRLHLVDEPLFPENEYTANIDR
FT                   IVPAMLGLANLIDSRRPPAGMSAAELARWTYQGHTHYLIIDDVDQIPDTAAMSGPFAGQ
FT                   RPWTPLIGLLAQAADLGLRVIVTARASGSAHALMTSPLLRRFNDLQATTLMLAGNPQDS
FT                   GKIRGQRFSRLPAGRAMLLGDSDDPTYVQLVNPLVGEAATVTETQQKGN"
FT   gene            643809..644117
FT                   /locus_tag="MMAR_0544"
FT   CDS_pept        643809..644117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0544"
FT                   /product="PE family protein, PE5"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39008"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW6"
FT                   /protein_id="ACC39008.1"
FT                   /translation="MTLRVVPEGLAAASAAVEALTARLAAAHASASPVISAVVPAAVDP
FT                   VSLQTAAGFSAQGIEHAAVAAEGVEELGRAGLGVGESGVSYLAGDAVAAATYGIAGA"
FT   gene            644120..645673
FT                   /locus_tag="MMAR_0545"
FT   CDS_pept        644120..645673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0545"
FT                   /product="PPE family protein, PPE4"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39009"
FT                   /db_xref="GOA:B2HNW7"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW7"
FT                   /protein_id="ACC39009.1"
FT                   /translation="MAVAAGPIWIASPPEVHSAMLSSGPGPASLLAAAGVWSALSAEYA
FT                   LTAAELSEVLAAVQAGAWQGPSGFQYVAAHLPYVAWLLQASADGAGKAAEHEAAAVAYS
FT                   GALAAMPTLTELGANHALHGVLVATNFFGLNAIPIALNEADYVRMWVQAATTMGLYQAT
FT                   AGAALASAPRTGPPPKVVNPGGGQVAHLAADAAQAQSGAAAAGGSDPWQLLWQLLQYLW
FT                   NAYTGFNTWMFDLIWEFLQDPIGNTIKIIIAFLTNPLQAIITYGPLLFALSYQIFFNLV
FT                   GWPTWALILSSPFLLPAALGLALSAIAFTPIQIAAEVPAAAAPLAAAAVTAKSVFPAAS
FT                   LASPGTGSAGAPASGAGAGAPGSAPPGPAAPAPASFLYAVGGSGDWGPSLGPTVGGRSG
FT                   AKAPAATIPAAGAAAASRASARSRRRRRTEMRDYGDEFLDMDANGVTGPAATDDAARAS
FT                   ERGAGQFGFAGTVSTEAVLQAAGLTELAVDEFGNGPRMPMVPGSWDSPQEGREDGLQSE
FT                   "
FT   gene            645710..646003
FT                   /gene="esxG"
FT                   /locus_tag="MMAR_0546"
FT   CDS_pept        645710..646003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxG"
FT                   /locus_tag="MMAR_0546"
FT                   /product="EsaT-6 like protein EsxG"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39010"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW8"
FT                   /protein_id="ACC39010.1"
FT                   /translation="MSLLDAHIPQLVASQAAFGAKAGLMRHTISQAEQAALSAQAFHQG
FT                   ESAASFQAAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASAYTGF"
FT   gene            646032..646322
FT                   /gene="esxH"
FT                   /locus_tag="MMAR_0547"
FT   CDS_pept        646032..646322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="esxH"
FT                   /locus_tag="MMAR_0547"
FT                   /product="EsaT-6 like protein EsxH"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39011"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNW9"
FT                   /protein_id="ACC39011.1"
FT                   /translation="MSQIMYNYPAMLAHAGDMSGYAGTMQGLGADISAEQAALSSAWQG
FT                   DTGVTYQAWQAQWNQAMEDLVRAYQSMSGTHEANTMAMLARDTSEAAKWGG"
FT   gene            646331..647227
FT                   /locus_tag="MMAR_0548"
FT   CDS_pept        646331..647227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0548"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39012"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="PDB:5DLB"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX0"
FT                   /protein_id="ACC39012.1"
FT                   /translation="MESMPNAVELTVENAWFIAEMVGAGTFPWVLAITTPYSDEAQRSA
FT                   FFARQRDELTQLGLLSSDGVVNPAVAEWIKVVCFPERWLDLRYVGPGTGNGGEDLLRGI
FT                   VAQSAGIMGKAGKAHPSFNTVVALRNAQLVTFTAMDIDDPRALVPVLGVGLSARPPARF
FT                   EEFSMPMRVGARADERLRSGESLDEVLDYLGIPVSARPVVQAVFSGPRSYVEIVAGCNR
FT                   DGEHTTTDVGLSIVDTTAGRVLVSPSRAFDGEWVSTFSAGTPFATAVAIDQLIANLPDG
FT                   QWFPGQRLSRDFSSQPS"
FT   gene            647299..648717
FT                   /locus_tag="MMAR_0549"
FT   CDS_pept        647299..648717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0549"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39013"
FT                   /db_xref="GOA:B2HNX1"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX1"
FT                   /protein_id="ACC39013.1"
FT                   /translation="MSGTVMPIVRVAILADSRLTEVALPAELPLREILPAVQRLVIPVA
FT                   EDGDAGSADLGIAGHLSLAPVGGAPFSLDASLDTVGVVDGDLLVLQPVPTGPAAPGIVE
FT                   DIADAAMIFSTSRLRPWDARHLQRGALAALIGVALAGSGLAVAYRAATGALAGLLIVSV
FT                   IAVAMALAGLLLGARSPRTGIALSIAALAPVGAALALAVPGSFGAAQVLLAAAGVTAWS
FT                   LICLMVPGEQRERIVALFTAVAVVGAALLLAAGAELLWQLPVSSIGCGLIVAALLVTIQ
FT                   AAQLSAVWARFPLPVIPAPGDPTPSAPSLRVLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIALRPDTVSALGWYVVAATAATATLRARIWDSAACKAWLLTQPYLVGGTLLVLYA
FT                   ATGHFIAAFGALVVLAVLAVAWVVVALNPVIASPESYSLPLRRLLGFLAAGLDASLIPV
FT                   MAYLVGLFTWVLNR"
FT   gene            648714..650138
FT                   /gene="mycP3"
FT                   /locus_tag="MMAR_0550"
FT   CDS_pept        648714..650138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mycP3"
FT                   /locus_tag="MMAR_0550"
FT                   /product="membrane-anchored mycosin MycP3"
FT                   /note="thought to have proteolytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39014"
FT                   /db_xref="GOA:B2HNX2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX2"
FT                   /protein_id="ACC39014.1"
FT                   /translation="MKRAGSACLTAILAIFTTGALWAAPPVSAISPPAVDDSVQPPSGT
FT                   PGPVQTMEQRGACSVSGLIPGTDISVPGASQAMLNLPAAWQFSRGEGQLVAILDTGVQP
FT                   GPRLPNVDAGGDFVDSTDGLTDCDGRGTLVAGIVAGQPGNDGFSGVAPAARLLSIRVTS
FT                   DKFSARSSGGDPSVERATIDVAALGRAIVHAADRGARVINISSITCLPADRQVDQAALG
FT                   AAIRYAAVDKDVVIVAAAGNSGAGGSGSGGTCESNPLTDLSHPDDPRNWAGVTSVSIPS
FT                   LWQPYVLSVASLTAGGQPSKFTMAGPWVGIAAPGENIVSVSNADGGGLANGLPNQRQQL
FT                   TPLSGTSYAAGYVSGVAALVRSKYPELTAAQVMHRLTATAHNGARDPSNVVGAGILDPA
FT                   AALTWELPAADGGAPQVAPAKPVSVPPAPQPRNTTPRNVAFAGAAALTVLVAGVAATVA
FT                   IARRRKDAEGRTAREL"
FT   gene            650128..651141
FT                   /locus_tag="MMAR_0551"
FT   CDS_pept        650128..651141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0551"
FT                   /product="conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39015"
FT                   /db_xref="GOA:B2HNX3"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX3"
FT                   /protein_id="ACC39015.1"
FT                   /translation="MSFDRSIPRPGSGRITLALLAVVPAVMAYPWHSRRDYWLIGIAAF
FT                   VVIVLFAWWRGLYLTTILHRRVAMMRRRPAEPGAEADTSTTVTLRIGPPASDIDVLPLP
FT                   VIARYLNCYGIRVDAIRITGRTTGSGETQTWIGLTVSAATNLAALQARAARIPLHETAR
FT                   VTARRLADHLREIGWEVSLVAAEDLPSLLDPDSDHALRETWRGVQHGDSEYLAAYRVIV
FT                   DAALPDTLAEIWSHPALETWMAIEIAARGRSGADYSVAAACAFRTDEQPAVAAPLATLI
FT                   PQRGNHGPTLAAMELSSTRALDGYADAPENLLMRLVWSTPGAGLHRAAPTETASRT"
FT   gene            complement(651128..652348)
FT                   /locus_tag="MMAR_0552"
FT   CDS_pept        complement(651128..652348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0552"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39016"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX4"
FT                   /protein_id="ACC39016.1"
FT                   /translation="MSEISETSGTSETDPIDPPVPIPDVPGGEAGAEGLPPLSALSLRQ
FT                   RLVVESSAVGDIALRTYASSLLSTTVAPAVVAHALRRLDSGGERANLNFYAELAAEQDP
FT                   RKSFPAPTELPRISARPASPLAEWIARGSVDDISFTSGFRAINPNMRQHWSALTSNNVV
FT                   RAQHWRHDDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGKRAER
FT                   FSPFSGFGFFASGLSGFAESMAQAVYDFRSIVDYLHHTGVTRIALTGISLGGYTSALVS
FT                   SVENRLEAVIPNCPVVTPAKLFEQWFPASKLVRLGLCLSSISRGELDAGLAFHSPLNYR
FT                   PQLPKHRRMIIAGLGDRMAPPDHAETLWEHWDRCALHWFPGSHVLHVSQLDYLRRMTAF
FT                   LGDFMFD"
FT   gene            652505..653296
FT                   /gene="tam"
FT                   /locus_tag="MMAR_0553"
FT   CDS_pept        652505..653296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tam"
FT                   /locus_tag="MMAR_0553"
FT                   /product="trans-aconitate methyltransferase Tam"
FT                   /note="may catalyze the s-adenosylmethionine monomethyl
FT                   esterification of trans-aconitate at high affinity and of
FT                   cis-aconitate, isocitrate, and citrate at lower velocities
FT                   and affinities"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39017"
FT                   /db_xref="GOA:B2HNX5"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HNX5"
FT                   /protein_id="ACC39017.1"
FT                   /translation="MWDPDVYLAFADHRGRPFYDLVSRIGAKRARRVVDLGCGPGNLTR
FT                   YLARRWPEAIIEAWDSSPQMVAAARERGIDATTGDLRTWKPKPDTDVVISSAALHWVPE
FT                   HADLMVQWATELPHGSWIAVQVPGNFETPSHAVVRALARREPYAKLMRDIPFRVGAVVG
FT                   SPASYAGLLMDAGCKVDAWETTYLHQLTGKNPVLEWITGTALVPVRERLDDVSWEQFRQ
FT                   ELIPLLDDAYPPRSDGTTMFPFRRLFIVAEVGGARRSADVS"
FT   gene            complement(653314..654711)
FT                   /locus_tag="MMAR_0554"
FT   CDS_pept        complement(653314..654711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0554"
FT                   /product="sulfatase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39018"
FT                   /db_xref="GOA:B2HNX6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX6"
FT                   /protein_id="ACC39018.1"
FT                   /translation="MTGAGSGSNDGRENVLIVHWHDLGRYLGAYGHRDVDSPRLDRLAG
FT                   EAILFTRAHATAPLCSPSRGSLFTGRYPQSNGLVGLAHHGWEYRSGVRTLPQLLGEHGW
FT                   HSALFGMQHETSQPSRLGFDELDVSNSYCDYVVDKVQNWLHEGVAALAGQPFLLTAGFF
FT                   ETHRPYPHERYEPADSSSVDLPDYLPDTPEVRQDLADFYGAITTADAAVGRILDTLEQT
FT                   GLDASTWVVFLTDHGPAFPRAKSTLYDAGTGIAMIVRPPKRLAVPPRVYDELFSGVDLL
FT                   PTLLSLLGIDIPADVEGLSHAHALISPEADADGRPVREHVYAMKTYHDSFDPIRAIRTK
FT                   EYSYIENYVSRPMLDLPKDIEESPSGLAVAPLVSSPRPAQELYDLRSDPTETANLLAGE
FT                   GAASADTVAAELAALLNDWRQSTGDVIPSDFAGSHIAARYTETYLKSHQPTPREDSSAA
FT                   ADRDIEG"
FT   gene            complement(654778..655428)
FT                   /locus_tag="MMAR_0555"
FT   CDS_pept        complement(654778..655428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0555"
FT                   /product="oxidoreductase"
FT                   /note="function unknown, probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39019"
FT                   /db_xref="GOA:B2HNX7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX7"
FT                   /protein_id="ACC39019.1"
FT                   /translation="MADYAFTAQERQAVYRVITERRDMRRFVPGAMVPEDVLTRLLHAA
FT                   HAAPNVGLMQPWRFIRITDTGLRRRIHTLVDEERALTAGALGERAEEFLALKVEGILEC
FT                   AELMVVALRDGRDGHIFGRRTLPQMDLASVSCAIQNLWLAARAEGLGMGWVSLFDPHRL
FT                   ADLLRMPDGAEPVAVLCLGPVPEFPQQPALELDGWAVARPLPEFVSENRWDQP"
FT   gene            complement(655471..655623)
FT                   /pseudo
FT                   /locus_tag="MMAR_5554"
FT                   /note="membrane protein; frame shift mutation"
FT   gene            655616..655873
FT                   /locus_tag="MMAR_0556"
FT   CDS_pept        655616..655873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0556"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39020"
FT                   /db_xref="GOA:B2HNX8"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX8"
FT                   /protein_id="ACC39020.1"
FT                   /translation="MAKIQEGRGRLRRGPDADSGQPYGLAAVPIGVFVIHGGDAKWVPA
FT                   VDANRIALVGVLTGLFAAVIGSLAVLRRPPWPDITIRDCR"
FT   gene            complement(655857..656339)
FT                   /locus_tag="MMAR_0557"
FT   CDS_pept        complement(655857..656339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0557"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39021"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNX9"
FT                   /protein_id="ACC39021.1"
FT                   /translation="MAVIIRRLFGIGKLSEDFRAQVEAEGLIYLEEYVPVTRRFTGTIP
FT                   GVRASHSVASYPGALAFTHERVLGTLSSLPKLAGRAIDVRWDAPHSGAATAEISSTGVQ
FT                   VDIDVAKVDPRFHGDLSLHFKADIPEDVLARLPLRSLAFDVPPEYVFRAVGVTYSP"
FT   gene            656396..657064
FT                   /locus_tag="MMAR_0558"
FT   CDS_pept        656396..657064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0558"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39022"
FT                   /db_xref="GOA:B2HNY0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY0"
FT                   /protein_id="ACC39022.1"
FT                   /translation="MTRPRMTLPLLLALAAIVVYALMWIGYRQDWGWLHAMDWSLLNAS
FT                   HDIGVKHPGWVNFWFAVSFVLGPITTRIVGLVAITIALVQRKMRMALLLLACVPLNWII
FT                   TMIAKGLADRPRPVTKLVAAHSASFPSGHALELTASVLAMLTFLLPMIRVHWMRILAVV
FT                   VGALSVLLVGISRVALNVHHPSDVIAGWALGYVYFLFWLWVLRPVPVAEQEPAELVSAG
FT                   "
FT   gene            657170..657826
FT                   /locus_tag="MMAR_0559"
FT   CDS_pept        657170..657826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0559"
FT                   /product="conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39023"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY1"
FT                   /protein_id="ACC39023.1"
FT                   /translation="MRRLVAVLFAGVCTVGVAVGLAPVTAAAGNPWFANSVGNATQVVS
FT                   VVSTGGSNAKMDIYQRTTAGWQPLKAGITTHVGSAGMAPKAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCKKSDCPFSTSASENLQIPQYKHS
FT                   VVMGVNKNKVPGGGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
FT   gene            complement(657835..658323)
FT                   /locus_tag="MMAR_0560"
FT   CDS_pept        complement(657835..658323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39024"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY2"
FT                   /protein_id="ACC39024.1"
FT                   /translation="MSRNDVSPDVTADIAAIQQVKYRYLRALDTKHWDEFADTLTEDVV
FT                   GDYGSSVGTELHFTNRTDLVDYMRSALGPTIITEHRVTHPEITVTADTATGRWYLQDRV
FT                   IVAEANFMLIGAAFYRDQYRRTAAGWRISATGYDRTYEATMSLANIGFQVKPGRALAD"
FT   gene            658401..659630
FT                   /locus_tag="MMAR_0561"
FT   CDS_pept        658401..659630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39025"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY3"
FT                   /protein_id="ACC39025.1"
FT                   /translation="MSQSRYAGLSRSELAILVPELLLIGQLIDRSGMAWCIQAFGREEM
FT                   LQIAIEEWAGASPIYTKRMQRALNFEGTDVPTIFKGLQLDIGAPPQFMDFRYALHDRWH
FT                   GEFHLDHCGALLDVEPMGDEYVFGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRSPAD
FT                   RHPHCAWTVIIDEAYPEVKGIPALDVVRETKAAAWKLAAIDPSEEGLADYSGALLSDLD
FT                   FTDFSHSALVRMAEEVCLQMHLLNLSFGIAVRERAGADAELAVSVGTRQLTGVAGLAAE
FT                   RIQRALGLPGGAEGVLRVFELHPLFNPTGYVVAETVADRLLVHRSPAHDDGAWISLCTP
FT                   ESVQPLQAIATAIDPHLEVRVAGTDTDWTAELVRTERPADELPEVLVAKVSHGAQFQFQ
FT                   PRRSLPLTVV"
FT   gene            659783..661663
FT                   /locus_tag="MMAR_0562"
FT   CDS_pept        659783..661663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0562"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39026"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY4"
FT                   /protein_id="ACC39026.1"
FT                   /translation="MYDPLGLSIGTMNLVAASNGKPAVIRRAVLTLYPHCAPKIGVLGE
FT                   NPSLDQPGTFMSGFVERIGDSVALVSPDGSAHDPDLLMVEALDAMVVAAGADSSSSEIV
FT                   IAVPAHWKPTAVQALRNGLRTHVGFVRSGMAPRLVPDAVAAMAAANSELGIPADGVVGL
FT                   LDFGASASYVTLMEAKSDFEPVCATMRYEDFSGNQIDQALMLHVIEELGPNGVDQAGTA
FT                   AASQLGLLREQCRAAKERLSIDAVTELAVDLAGSAATIEVTRDQLEDLIQDQLTGFVYA
FT                   FDDLLARNNASWADLSAVVTVGGGASIPLVTQRLSVHTRLPVLAVPEPACAAANGALAL
FT                   AARGKELDFRTRTSIGLPAASAATAATTVIEPPAGDVMVIDQDALTDRELAWSQTDFPS
FT                   EGLVRFEGDSYSEEGPCWSMRLNMIEPLKEPAWRRFRVSQVLIGLSAVVAMTAIGGVAF
FT                   TLTAIERRQSPVVPSVGPLPAPSRSIAASSAPPKALEPSFVPPPASAARAPSAAPAPTS
FT                   VAPPPPPPRPVATATTTVAPPVTTTKTTVPPTTAATTTPTTTPPPTTTAPPTTTAPPST
FT                   TSTVKMTTEWLHVPLLPIPIPIRVPASQAPPSPVSQNPGPQNPFMSPGTP"
FT   gene            661885..663321
FT                   /locus_tag="MMAR_0563"
FT   CDS_pept        661885..663321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0563"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39027"
FT                   /db_xref="GOA:B2HNY5"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY5"
FT                   /protein_id="ACC39027.1"
FT                   /translation="MDIVLGVSMEPGAVRLVLVEGIDADGVTVEEDTFELDTADRSQSA
FT                   PAAAVAALIGTREGAIEGGYRLMSAGVTWTDPTDVAALRAELAGHDAGSVMLVSPLLAA
FT                   AALAQTVGCALDYEYIAMLFVEADSATLAVVDIGDGSIVDLHRRSLGAESTAADLTSLV
FT                   GGLATAQSVAEGVFVVGCGVDIVALKPVLEVATSLVVSVPEEPDMALARGAALASANAP
FT                   LFASSTSALAYALDPGTGEVNPRALAPSYLDVCANADRGAGALAYSALADDGEDAVEGR
FT                   RRPLVLAGSAMLGIAAFAAGLMVVTLTSDVRPAAATQPSPREGVLTPASPAAPPKTAAP
FT                   VPAKAPAQVPAPGPAPAASPVPVAAPPSVVQPPPVVRAPRPTVVKPPPQYIAPATQPRR
FT                   TPAPQAPALTPVQAPAPEVRPPVAVPEPAPAPPVPTQAPMTMYLHLPFVSIPIPINPPP
FT                   PPAPPPEPAPVEPPPPEPGP"
FT   gene            663389..663775
FT                   /locus_tag="MMAR_0564"
FT   CDS_pept        663389..663775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39028"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY6"
FT                   /protein_id="ACC39028.1"
FT                   /translation="MGDNGGFGFDPDDFDRVIREGSEGLRDAFERIGRFVSGPGDRPAW
FT                   SMIFEDLGHRRRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDS
FT                   RRKVRFLPYGIAVSVLDDSSGEPE"
FT   gene            complement(663823..664542)
FT                   /locus_tag="MMAR_0565"
FT   CDS_pept        complement(663823..664542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0565"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39029"
FT                   /db_xref="GOA:B2HNY7"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY7"
FT                   /protein_id="ACC39029.1"
FT                   /translation="MNPEDDPEARIRQLEQPLADAARASELGSSQPAGESAYQNYQGYQ
FT                   GYQGYPGYQPPPGSVPPSYGYQPAFPGATPRSSSGNRAFWIIAAVFVVGILGAVAAVAL
FT                   FAVNRVSEPFTTLSPGTTVISTPPGPMSPGNKTQTPTAGPSTSAGPPAGSTISVVGVNQ
FT                   SQTITCNDNIVNVSGMSNTVTITGHCASVSVSGLQNTVTVETADRITASGLNNKVTYQS
FT                   GSPKISKSGSGNVIEQG"
FT   gene            664606..665625
FT                   /locus_tag="MMAR_0566"
FT   CDS_pept        664606..665625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39030"
FT                   /db_xref="GOA:B2HNY8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY8"
FT                   /protein_id="ACC39030.1"
FT                   /translation="MSDLLNSQIVLRRRPSGLVQPGDTMLVTMPAPEPADGEALLRTTY
FT                   VGIDAAARTWLDDQPGYLPPVRLGEVIRAAGIGEVVESRCDAYAVGDVVTTLTGFQEYV
FT                   IIRDDVFSTPIPGEDDQLAIMSVYGPTGATAYFGMTDIGRPQPGETVVVSAAAGATGSI
FT                   AGQIAKIAGARVVGIAGGREKCRAVVENFGFDACIDYKNDDLDAALKAHCPRRVDVYFD
FT                   NVGGPILDAVLGRLAPKARVVLCGVISSYLTGEHPGPANYVNLLSKTALMQGFNALDQW
FT                   GRFDEAFANLRKWEAEGRLKHRQTVYEGIDSCVDALNGLFTGANIGKTLVKLGEPSSG"
FT   gene            665837..666715
FT                   /locus_tag="MMAR_0567"
FT   CDS_pept        665837..666715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0567"
FT                   /product="beta-1,3-glucanase precursor"
FT                   /note="possibly hydrolyzes specific sugar (hydrolyzation of
FT                   glycosidic bond) and could be involved in exopolysaccharide
FT                   biosynthesis/degradation. could also have a lytic activity
FT                   against cell walls"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39031"
FT                   /db_xref="GOA:B2HNY9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNY9"
FT                   /protein_id="ACC39031.1"
FT                   /translation="MLMQEIDRRRMIMMAGFGALAAAIPAPTAGAAPTPPAAPEPAPAA
FT                   PAAGAGPIFLWHDEFDGPAGSAPDPAKWQVSNHRTPIRNPVGFDRPEFWGQYRDNRQNV
FT                   FLDGNSNLVLRATRSGNDYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSNDD
FT                   PGRSGEIDLIEWYGNGSWPSGTTVHANPDGTAFETFPIGVDDNWHNWRVTWNVTGMYFW
FT                   LDYADGMQPYFSVPATGIEDLNEPIREWPFNDPDYTVFPVLNLAVGGSGGGDPAAGTYP
FT                   QEMLVDWVRVF"
FT   gene            666815..667474
FT                   /locus_tag="MMAR_0568"
FT   CDS_pept        666815..667474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0568"
FT                   /product="muconolactone isomerase"
FT                   /note="could be involved in the catabolism of catechol to
FT                   succinate- and acetyl-CoA in the beta-ketoadipate pathway
FT                   (at the third step) [catalytic activity: 2,5-dihydro-5-
FT                   oxofuran-2-acetate = 3,4-dihydro-5-oxofuran-2-acetate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39032"
FT                   /db_xref="GOA:B2HNZ0"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ0"
FT                   /protein_id="ACC39032.1"
FT                   /translation="MEFLVSMTIEVPRGTPAAEIDRARVSENAGWRELGAQGRLLRLWR
FT                   PPCGPGQWCTLGLFAARDEPSLRKLLVTVPVQDWRSDEVAVLGAHPNDPLGAGVTPRPG
FT                   KGPEFLITTTLTVPSGTSARVVDDATEREARRCHELAEAGHLVRFWALPAGPDGPRMLG
FT                   LWRARDPGELMAVVESLPLSGWMTIETTPLRPHPSDPIRLSWARRAGDWRKPNRQC"
FT   gene            667509..669005
FT                   /locus_tag="MMAR_0569"
FT   CDS_pept        667509..669005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0569"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39033"
FT                   /db_xref="GOA:B2HNZ1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ1"
FT                   /protein_id="ACC39033.1"
FT                   /translation="MNGRPWQRARSIKQITRGLGALDRELFEAIADTPTPLLDTVMPPL
FT                   TRAADHSKLWFAMAAGLLASRSQSAQRGAVRGVVTLGAASLFTNQVAKRIRQRPRPLSD
FT                   SVPLARRVRRRPTSNSLPSGHSASAAAFAIGVGLENPPLGLGFSVLAALVGLSRVATGV
FT                   HYPGDVLAGFGIGAGVAVLGGRLVPPIVETALPKTEPLWVQTPQRPDGSGVVLVVNPAS
FT                   GSGTGAQVIDEVRAGLPKARIVELAAGDDPQRVLREAAAQAEVLAVGGGDGTVAAAAAA
FT                   AVDAGLPLAVFPAGTFNHFAKDIGCDSVAQTIDAIRRGSVARVDLVCLNESQMVINTAS
FT                   IGAYPKFVRYREKLEKRIGKPLASMYAMLHTLRKDQPVRIRYDNKTLQTSLLFIGNSVY
FT                   LPAGFAPSRRTRMDDGLIDVRILETGRRLATVRIPTALALGRLQRSPLYHELQVPEFSF
FT                   STVDAPTVLAHDGEVGEQYDQASFTAKYRVLAVFRPGPGR"
FT   gene            complement(668953..670395)
FT                   /locus_tag="MMAR_0570"
FT   CDS_pept        complement(668953..670395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0570"
FT                   /product="carbohydrate kinase"
FT                   /note="phosphorylation of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39034"
FT                   /db_xref="GOA:B2HNZ2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ2"
FT                   /protein_id="ACC39034.1"
FT                   /translation="MTLVAGIDSSTQSCKVLVCDADTGEVARRGQAAHPDGTEIDPAAW
FT                   ESAARAAIAAAGGFDDVEAVAVGAQQHGMVCLDMAGAVVRPALLWNDVRSADAALALID
FT                   ELGGPRAWAQAVGLVPLAAVTVAKLRWLADNEPQHADRTAAVCLPHDWLTWRLRGDTDV
FT                   ATLTTDRSDASGTGYYDAGSDRYRFDLLELAMHGRRPNLPRVLGPSARATRGSKTFGAG
FT                   LGDNAAAALGLGADEGDVMVSIGTSGVVCAVAADPVRDETGLVAGFADGTGRYLPLVCT
FT                   LNGARVLDAAAAMLRVDHDELSRLALSAPPGSAGLVLVPYLEGERTPNRPKATGALHGL
FT                   RLANATPAHLARAAVEGLLCALADGLAQLTEHGVVARRVLLIGGGARSQALREIAPLIF
FT                   GVPVLVPDPAEYVALGAARQAAWALRGSTRPPSWQPPATDEYTGEPSPAVRQRYGQVRE
FT                   LTEGVASVPGPGETPPAPDTSR"
FT   misc_feature    669554..676847
FT                   /note="MURD7; function unknown but locus contains two CDS
FT                   with possible roles in carbohydrate modification
FT                   (phosphorylation and dehydrogenation). Other CDS in this
FT                   locus encode a PE-PGRS protein and membrane-associated
FT                   proteins of unknown function"
FT   gene            complement(670445..671848)
FT                   /locus_tag="MMAR_0571"
FT   CDS_pept        complement(670445..671848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0571"
FT                   /product="mannitol dehydrogenase"
FT                   /note="carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39035"
FT                   /db_xref="GOA:B2HNZ3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ3"
FT                   /protein_id="ACC39035.1"
FT                   /translation="MKLTAANASALDIPVPNYDRSQISIGIAHFGVGGFHRAHQAMYLD
FT                   RLLNAGLARDWGICGIGVLPGDERMRDALRSQDHLYTLILEHPDGTREPRVIGSIVDYR
FT                   YAPDEPESVIELLADPAIRIISLTITEGGYTAPRSAAFELVTEALNRRRQRGHGSPAIV
FT                   SCDNIVENGKVAERAFTSYADMSNPALAQWMRENTRFPNSMVDRITPVTTPELIERLDS
FT                   EFGVRDAWPVAAEPFAMWVLEDDFSHGRPPLEQAGVELVDDVAPYEAMKLRLLNAGHQG
FT                   LCYFAYLAGYRLVHEAAQDPLIADFLCRYFDEEAAPTLTAIGGLTEFKNGLLPRFANAY
FT                   VRDTVARLCAESSDRIPKWLLPVVRDNLRSTGPVRLSAAIVASWARYAEGIDEAGQPIE
FT                   VVDRLADTLGPIARSQRHDARAFLANRAVFGDLIDQPRFVQPYLWALDSLHRVGARATL
FT                   QALLDKDGS"
FT   gene            672368..673837
FT                   /locus_tag="MMAR_0572"
FT   CDS_pept        672368..673837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0572"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39036"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ4"
FT                   /protein_id="ACC39036.1"
FT                   /translation="MSFVVVVPEMLSMAATDLASVGSAVSAANTAAAAPTTSVLAAAGD
FT                   EVSAAVAALFSDHAHNYQALGRQAAAFHDQFVAALSAGGGGYGAAETANVQQSLLNLIN
FT                   GPTQALLGRPLIGNGADGTAPGQAGGAGGLLYGNGGNGAPGANPGVAGGAGGAAGLIGN
FT                   GGAGGSGGAGAAASGSGDGGDGGAGGAGGSGGWLYGTGGAGGSGGAGGVSGMNPGNHGG
FT                   LGGNGGAGGAAGIVGEGGAGGAGGMGGSGFTSAVTTAGGNGGNGGTGGGGGLLAGNAGA
FT                   GGAGGDGGGPVGDLGGNGGIGGDGGAAGLFGNGGAGGAGGGGGAAPVSGAAAAGGAGGG
FT                   GGAGGLLYGDGGLGGAGGAGGEALDGGVGGSGGAGGHGGGGGLLYGNGGSGGAGGKGGV
FT                   AAGIFDRGGTGGTGGNGGVGGLLYGNGGRGGAGGDGANLAGGGNGGNGGDTRLIGNGGD
FT                   GGHGGSGALVGGAGGSGGIGGRLFGQAGAAG"
FT   gene            673937..675019
FT                   /locus_tag="MMAR_0573"
FT   CDS_pept        673937..675019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0573"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="function unknown but may have hydrolytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39037"
FT                   /db_xref="GOA:B2HNZ5"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ5"
FT                   /protein_id="ACC39037.1"
FT                   /translation="MAVRPTMVSLLRVLSVVSVLSAAVWLAAGCGTGVRVNGQTPSPPV
FT                   GLRQIEFVDPHGPDGPRRLAVSLFYPAEQPSPDDRPFAMPFATELSFYPDLPPRAGGSR
FT                   LPLILLSHGRGSNGLFYAWLAQALASKGYLVAALNHYRANTYDSSIVYLANKLWQRPRD
FT                   LSLTADFLVQDRFWGPLIDASRIGVAGHSQGGFTSLWLGGARVNPDRYLDFQRGVQSDP
FT                   AIPAHLRTELPVDAGPALDVADSRIKAVFAMAPGMVRDFGMDADGLHQLRVPTYIIVGA
FT                   HDAQTPPGDNAEFAAANVPGAQLNVLPGKVGHEIFLNECNQLGREQFPEACIDDPSVDR
FT                   HLLHAEISSAATTFFDTQLR"
FT   gene            complement(675134..676234)
FT                   /locus_tag="MMAR_0574"
FT   CDS_pept        complement(675134..676234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39038"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ6"
FT                   /protein_id="ACC39038.1"
FT                   /translation="MTTRDKYTDVPTPYSWEVPSAGDARFTWEYDEGRARLLSLYQKGK
FT                   DKQWDAQSRIDWGQDVDPMNAIALPDEFHPLFGSPMWNAADEARRSEMRQHFQAWQFSQ
FT                   FLHGEQGAMVCAAKIVEVVPDLDAKFYAATQTMDEARHVEAFSRFLQEKIGLVYPINKH
FT                   LTALLDDTLRDSRWDMPYLGMQVLIEGLALAAFGVLRDMAAPESLAKQVLAYVMQDEAR
FT                   HVAFGRISLKDYYSALTEAEREEREEFVVDACYLMRDRFRGEEVFETLGMDVKACAEWV
FT                   DTSPLMIQFRSHLFSRIVPIVKDIGLWGGKVQRAFRDMGVLDMAGSDIEALMKADEDQA
FT                   EALDKAHAEMAERAIEVDQVIAAGAS"
FT   gene            complement(676332..677102)
FT                   /locus_tag="MMAR_0575"
FT   CDS_pept        complement(676332..677102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0575"
FT                   /product="conserved hypothetical hydrolytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39039"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ7"
FT                   /protein_id="ACC39039.1"
FT                   /translation="MWPMAERVTFQSSTGPTLAGTIDVPEAAVRGWGVFAHGFTLNKDS
FT                   PAAARICKQLAADGIGMLRFDALGLGDSEGGWGDGSFTVKVDDIVKACEFMTARGTPAD
FT                   ILVGHSWGGAAVLAAARHSPGVRSVVTVAAPVDPSHVEKHYDAVVDRCLSEGSAEWMVG
FT                   GRTLTLKRAFVQDVRAADLRDKIKSLRLPLLILHSPTDNTVGIGNATEIFRLARHPRSF
FT                   VSLEGSDHLLTARGQAHRAARIIGAWADAYLDEP"
FT   gene            complement(677132..679717)
FT                   /locus_tag="MMAR_0576"
FT   CDS_pept        complement(677132..679717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0576"
FT                   /product="monooxygenase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39040"
FT                   /db_xref="GOA:B2HNZ8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ8"
FT                   /protein_id="ACC39040.1"
FT                   /translation="MSDAHHTDVDVVVAGAGFAGLYAAYRLRRAGHSMRIFEAGDDIGG
FT                   TWYWNRYPGARVDIPSVDYMYSFDPDWSRDWQWSEKYATQPEILRYLNHVADKHDLRRD
FT                   IQFGTRVTHAHWDDDAGRYRVRTDRGDEIICRYLIMATGCLSVPKDLDIDGIENFTGEL
FT                   YFTSRWPHEPVDFTGKRVGVVGTGSSGIQSIPLIAAQAAQVVVFQRTPCFSIPAHNGPI
FT                   SPDKLAQLADDDAYRRAARYSFGGVPMERSLTPTFSVSAEERRQRYERAWQLGELLEAL
FT                   NLYADEMINPLANSEFAEFIRDKIRATVHDPQTAEALCPSGYPVGSKRLCLDSNYYATF
FT                   NLPQVRLVDLRNQPLLGVTKTGIDTVGESFEFDAIVFATGFDAVTGALAAIDIVGRNGL
FT                   ALGDKWAPGPSTYLGLTTEGFPNLFLIAGPNSPSVLSNMAVSIEQHVDFVADALSYLRE
FT                   HGFDRIEPTELAEAGWMQHSDDAASITLFPQANSWYVGANIPGKPRTFMAYTAGVDVYR
FT                   VACEEVVARDYLGFRLSGPNGSQCNDGVVRRLQPDIQMVLEQLEALGLPPLESLPADQA
FT                   RALMNEMNLARPPGPDVGEIVDGTLPGAAGPLAYRLYRPASPGPHPVVVYFHGGGWVLG
FT                   DHTSDDPLCRDLCVLSDTLIVSVDYRHAPEHRFPAALDDGWAAVQWIAEHAGELGGIPG
FT                   QLVVSGWSAGAGIAAVVCHLARDAGAPSIVGQALLTPVTDFDPTRGSYLENADGYGLTA
FT                   PLMQWFFDHYADPDVRTDPRIAPLRAPDLSALPPAIVVAAEFDPLRDEGIEYAEALAAA
FT                   GVPTELVRARGHTHLSLTMVDVVVSGAPIRAQLAGALRGFFAIGAAVPA"
FT   gene            complement(679836..681011)
FT                   /locus_tag="MMAR_0577"
FT   CDS_pept        complement(679836..681011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0577"
FT                   /product="conserved integral membrane transport protein"
FT                   /note="function unknown; belongs to the major facilitator
FT                   superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39041"
FT                   /db_xref="GOA:B2HNZ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HNZ9"
FT                   /protein_id="ACC39041.1"
FT                   /translation="MPESVTAPPELGIRHATPGLLALTIATCLAITTEILPVGLLPAIG
FT                   HTFGVRDAVTGLLVSLYAVLVALLAVPLTVVTARFPRKPLLLTTLLGYAVSNTLVAIAP
FT                   TFAMVAAGRAVGGVTHALFFSLCIGYAPRLVGLADVGRALALVGGGVSAGIVVGVPLLT
FT                   SVGTAVGWRGAFAVLAVLAAVLLLVVAKLLPPVSSESAPPPAGTAKGRRRLAAVVSSNA
FT                   LTYTGQFTLYTFISAVLLAAGARPAFIGPLLLMCGVCSLAGLWYVGATLDRNPRQTTVI
FT                   IIVVVIGALLGLGASFPALLPVVLAAAVWNGAFGGIPSIYQAGAVRAQAATPEMAGAWV
FT                   NATANLGIAAGAAIGAGLLPTIGLAGLPWVAAALIAISLAVTLATGRGPTH"
FT   gene            681544..682746
FT                   /gene="aroB_1"
FT                   /locus_tag="MMAR_0578"
FT   CDS_pept        681544..682746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB_1"
FT                   /locus_tag="MMAR_0578"
FT                   /product="3-dehydroquinate synthase AroB_1"
FT                   /note="3-dehydroquinate (DHQ) synthase catalyses the
FT                   formation of dehydroquinate (DHQ) and orthophosphate from
FT                   3-deoxy-D-arabino heptulosonic 7 phosphate. this reaction
FT                   is part of the shikimate pathway which is involved in the
FT                   biosynthesis of aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39042"
FT                   /db_xref="GOA:B2HP00"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="InterPro:IPR035872"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP00"
FT                   /protein_id="ACC39042.1"
FT                   /translation="MIKNASGQTAWTVEAVKQVRYHVIKSDGLFDLGNNQLFSACSDAP
FT                   LKVGDRRLVIIDGTVDALHGSKVRAFFAHHGVEAEFVVIPIDETLKHWDTVTRIVDAMN
FT                   AFGIDRRREPMLVIGGGVLTDVAGFAASLYRRGTPYIRIPTTLIGLVDAGVGVKTGVNY
FT                   QLGKNRLGTYAPPTVTFLDKSFLRTLDQRHLSNGLAEILKIALIKSGALFDVLETSGRD
FT                   VRDDHFQGSTSALDVATEYILDESIHLMLEELQPNLWESTLERCVDYGHTFSPTIEMHA
FT                   QPALLHGEAVNLDMAVTTAIGELRGYVSEDEANRIYRVMVDLGLPLWDDTLATPELLIE
FT                   ALIDTVRHRDGQQRLPLPVGIGHHRFVNDVTPEEIQCAVAMLRRHHETLTGSVAASSGV
FT                   A"
FT   gene            682746..683504
FT                   /locus_tag="MMAR_0579"
FT   CDS_pept        682746..683504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0579"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39043"
FT                   /db_xref="GOA:B2HP01"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP01"
FT                   /protein_id="ACC39043.1"
FT                   /translation="MTGRTAIVVGGSTGIGRGIADAWAAEGIETHVFSRTKPVGPGADR
FT                   LHWHQLDFRNGEAAKQTLAQELPKRIDFACYSAIYYTLRRENLVDVTEVDWLDQFDINV
FT                   HGLFWTLNAALPALRQSEPGLFLHVSSEVVYNAGPARAGYTATKAASSALINSVAQEIS
FT                   PSEVVFVQTLPAGMVDTPGIRARRAADFDYSDYMVPADFGPLACELARTRGSGYEGDAL
FT                   VVHEDRTWSSVSSGVPISQSRPLAAAQSSS"
FT   gene            683515..684183
FT                   /locus_tag="MMAR_0580"
FT   CDS_pept        683515..684183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0580"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39044"
FT                   /db_xref="GOA:B2HP02"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP02"
FT                   /protein_id="ACC39044.1"
FT                   /translation="MPELHAAALLFDMDGTLVDSTAVVEATWGAFAELHSLDLAEVLAF
FT                   AHGRPTAATVRHFLSHPALVASETRRLVEHEESTTEGVREVPGAAEFIAALPRSAWAVV
FT                   TSASRVLASNRMRAAGIPLPDVLISADDITRGKPDPQGYLLAADALRVNIGSTIVFEDS
FT                   PAGIRAGIASNALTVAIGTLAAFDGHIERFENFHGFEVAGQPPAGGVILSMPAPMNCGV
FT                   "
FT   gene            684190..685191
FT                   /locus_tag="MMAR_0581"
FT   CDS_pept        684190..685191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0581"
FT                   /product="glucose kinase"
FT                   /note="domain homology to NagC, transcriptional
FT                   regulator/sugar kinase [transcription / carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39045"
FT                   /db_xref="GOA:B2HP03"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP03"
FT                   /protein_id="ACC39045.1"
FT                   /translation="MTTLATDIATSTMAADLGGTWLRLRVGGPGTEVKRHMAPSLLNFP
FT                   EQSVAQLRERLVDELCAAAPAGAHAAISCGAALDHRRGILYGSGPLWGAEAAPFDLAEA
FT                   LRLRRPDVTWLLVNDLTAGLADFTARWAGPSTRRIGYLTISSGIALRIADLRTSEIPVD
FT                   EWGLQGEVGHLPTQADPVLRGLMCECGVPDHLAAHASGPGIGRIAGRLGVLPPNTSLLQ
FT                   WFPRALAAGDAAAVSVLQAAVAPIAALIRMLWCVDPHLDLLGIGGGVVEGLGSHYEREL
FT                   REQLRGGSCYADRGFSESWLDERLVFCADSSADIDCLRGAQLMCDERLKATA"
FT   gene            685188..686297
FT                   /locus_tag="MMAR_0582"
FT   CDS_pept        685188..686297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0582"
FT                   /product="dehydrogenase"
FT                   /note="function unknown; similarity to cyclitol
FT                   dehydrogenase from actinoplanes sp. 50/110"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39046"
FT                   /db_xref="GOA:B2HP04"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP04"
FT                   /protein_id="ACC39046.1"
FT                   /translation="MTDNGYRALVRRPAGPDGCSLVDVAVLDTPALEPGDLLLAPLVAG
FT                   ICGTDWQILRGDRPDDSPVLGHEGIARVVVGSKAFAPGDIVTVNPTHPTDPGFLLGHNV
FT                   AGLWAERTRIPASVVNAGLVVSVPSSAANDVLIGALAEPLASAIYGLEIAMAVFEDTPR
FT                   SLVVWGDGIVGQLAAAVWRQAMPETEQLIVGRNRDSHNCIAADDPDLPSRLAALRGPVS
FT                   AVLATPRSATVTALTTLDSHIDHALTVDVHGGLDSGPVSLRSGEVDVAAVRAANCGGLS
FT                   SVPVAKTLQRAGAGPLRLFGHRGVSNAHLRAAIGALTENAATFASLLTQVTDLEGAAEL
FT                   INGVLQSGNRCHDGRRVLKAAIRLEGAAA"
FT   gene            686294..687079
FT                   /locus_tag="MMAR_0583"
FT   CDS_pept        686294..687079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0583"
FT                   /product="epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39047"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP05"
FT                   /protein_id="ACC39047.1"
FT                   /translation="MSRIAVAAPQWRIADCRAAAAAMAIRSGADELQIDFGGAHRGPRL
FT                   DVPAEQAVVARIARSIPVTALAVNHANDLGLIDEHGEPNAEAAALLRVALRCAVELGIG
FT                   VLHVPGFRRSAPDSPQRVAGTAAVLRSICQRAERHGIAVAYESALSGAASAALVEAVGH
FT                   RDLRVVFDIGNLLDFGHRPGEFVSAVGELLHPDLHVKDPAASRVDVVSELRDVLSSPAP
FT                   VRSLLVENDYRAIPGRLAADVAVCRGLIRSHATRMHSRC"
FT   gene            687271..688077
FT                   /locus_tag="MMAR_0584"
FT   CDS_pept        687271..688077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39048"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP06"
FT                   /protein_id="ACC39048.1"
FT                   /translation="MDLYTAPRLQMVEAVLVRHREEPTVPVPELLSVTPMNYGPAEFQA
FT                   ARGWFAAGGLVPGGNGCLSLIDVGAGFGPAGLVFGSQGYRVTAIEMRADIAAVGRRVMA
FT                   ACGLQDFVHFEVADVMAYQPVTPADTLTSILCLLHVSDKHAAMEKLATLLRTGGRGYLA
FT                   DFYARRRLSGPERALLQDQVACPGLLTRQEYVGALTAAGIAAVRFTDVTQEYSSYVHQR
FT                   CADYLGRSESDRHDELAQFFTAIDTLFGNGDAANSALGGCRIYLER"
FT   gene            complement(688162..688371)
FT                   /locus_tag="MMAR_0585"
FT   CDS_pept        complement(688162..688371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39049"
FT                   /db_xref="GOA:B2HP07"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP07"
FT                   /protein_id="ACC39049.1"
FT                   /translation="MYRFLAGLFAGFAITHLGFALFADMNTLQFFGRTWSTGYIWAEFV
FT                   LYSALMLLFAYLGWRTKPSGARRA"
FT   gene            complement(688441..689655)
FT                   /locus_tag="MMAR_0586"
FT   CDS_pept        complement(688441..689655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39050"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP08"
FT                   /protein_id="ACC39050.1"
FT                   /translation="MRPSDAWPRHSAERRPWAQTQRGGTRADRTLRSVTVSLPPYIAKV
FT                   DANIDADIAVKLEDAMSEISRLDSTHGTHLAGLSTLLLRTESVASSKIERVEASVDDYA
FT                   RALHGGRGNSSAVSMVAATTALKEMIASVNRDAPIQMTAILRAHEALMREDPTEGQHAG
FT                   QVRTVQNWIGGSDYSPRNALYVPPPPDTVHAYMDDLIEFANRTDIPVLIQAAIAHAQFE
FT                   SIHPFTDGNGRIGRALINTVLRRRGATTRLVVPLASALVAHRERYFGALNTYRAGDLRP
FT                   LIVTFANSSRTAAAESRITAERLAEIPVEWRNMVGPIRRHSATDKLLLLLPSTPIVSSD
FT                   DVASLIDAPRSSVFAAIKRLHDTGVLRPLTNRKRDQVWGASLVLDELDDLGHRIERASA
FT                   PSVRK"
FT   misc_feature    688611..695966
FT                   /note="bacteriophage phiMmar09; MURD8; Putative prophage,
FT                   harbours recombinases and an integrase (pseudogene) and has
FT                   integrated at a glycine tRNA. Other genes encode
FT                   hypothetical proteins and a dehydrogenase"
FT   gene            690319..691065
FT                   /locus_tag="MMAR_0587"
FT   CDS_pept        690319..691065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0587"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /note="function unknown; probably involved in cellular
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39051"
FT                   /db_xref="GOA:B2HP09"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP09"
FT                   /protein_id="ACC39051.1"
FT                   /translation="MGQLEGKTALVTGGNSGIGLAAAQRLAAEGAHVFLTGRNQATIDA
FT                   AVASIGSRAHGIRADVSNIEDLARVADAIAAAGRGLDVLFANAGGGEFVLLGDITIEHF
FT                   TNGFMTNVAGTLFTVQTMLPLLNSGASIVLTGSTAAYNGSPAFSVYAATKAAIRSFGRT
FT                   WAAELVSRNIRVNTVVPGPVETPGLKGLAPEGQEQQLLEGEAAKVPMGRLGKPAEIAAA
FT                   VLFLASDQSSFMTGSEMFVDGGTEQL"
FT   gene            691118..691279
FT                   /locus_tag="MMAR_0588"
FT   CDS_pept        691118..691279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39052"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP10"
FT                   /protein_id="ACC39052.1"
FT                   /translation="MAATIEKLRTLVLRRGSSVDVAIANGLAAQSQKLNQKYVFVTDHS
FT                   ATYKTMGQ"
FT   gene            691276..691878
FT                   /gene="pinR"
FT                   /locus_tag="MMAR_0589"
FT   CDS_pept        691276..691878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinR"
FT                   /locus_tag="MMAR_0589"
FT                   /product="site-specific recombinase PinR"
FT                   /note="possible phage recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39053"
FT                   /db_xref="GOA:B2HP11"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP11"
FT                   /protein_id="ACC39053.1"
FT                   /translation="MTAPATSGTLLGYARVSTGHQSLDQQLDALSAEGVATERIYQDKL
FT                   SGMSTRDQRPGLAALLDYARPGDTITVVGIDRLGRNAAEVMTTIRDLSQRGIVLRSLRE
FT                   GIDTSNATGRMVAGVLASLAELELELGRERRSAAREARRSRGQSIGRPKALDESKAALA
FT                   RRMHAAGEPVSTIGSALGVSRATVYRVLAETEGEAAV"
FT   gene            691875..692183
FT                   /locus_tag="MMAR_0590"
FT   CDS_pept        691875..692183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39054"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP12"
FT                   /protein_id="ACC39054.1"
FT                   /translation="MSHAEERNRGQRKALLDAEIKICRRCEGMNRPLETESAPGWGNLD
FT                   SPVAIVGQSLCEQCMEPQEPFYEGSGSLLNRTFARLPIAKGPTVHHECGSLSPAQKS"
FT   gene            692125..692571
FT                   /pseudo
FT                   /locus_tag="MMAR_5581"
FT                   /note="Uracil-DNA glycosylase"
FT   gene            692549..693690
FT                   /pseudo
FT                   /locus_tag="MMAR_0591"
FT                   /note="phage integrase; frame shift mutation"
FT   gene            693693..693977
FT                   /pseudo
FT                   /locus_tag="MMAR_0592"
FT                   /note="C-term phage integrase; frame shift mutation"
FT   gene            complement(693949..695250)
FT                   /locus_tag="MMAR_0593"
FT   CDS_pept        complement(693949..695250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39055"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP13"
FT                   /protein_id="ACC39055.1"
FT                   /translation="MNLNDILANELETIQPSDLEAVLRSLGWQPEGGIPNLASQWLKLD
FT                   DPGEPNVLVPLNRAMADYRIRLWEALRELERIHGDQGDMIITNLLLPGLDEVTNEKEES
FT                   TIAGSIPWTVGEKQIVGFREMLTASAKAAEVKERYYGRKRWNIASRFLSQVRMGQTKIG
FT                   SYVVTALSPVGAIPIVDQKGQYDENLGITGRQVIETLAKSLDALKESATEFKSNGNGAV
FT                   FDEAVQSGVSLDLARAVYKNIGSADTALTSIQWTSRIAAPNITSKIAFDQTYLAPIASA
FT                   ITRLTDVVESKHAQITGRVTGLNRDAPGNQGMVVLHVLDGPDDVDYVSLVLGEAYEEAI
FT                   EFHKAGTLVRADGELNREGRNWELTNVTSLELLTSQEIGALRLAIERALASDNQDETEQ
FT                   TNPTVGSSAHIDVPETEPSAESDDAPSERDSESE"
FT   gene            complement(695247..695909)
FT                   /locus_tag="MMAR_0594"
FT   CDS_pept        complement(695247..695909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39056"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP14"
FT                   /protein_id="ACC39056.1"
FT                   /translation="MSLSRRWPCETSPRNPLATTAQVGTWRYPDRTSLFAEVEGPCVTK
FT                   SVGLTGARGEIAVTASMEKLQDAYLGAIAAAAGCELSKPDPDPGLDWTIGHKSKKHSLV
FT                   RTAKIDVGLKSTCQTGPNDRGEFSFTLQNEHLETLAEPLLYYPRLLVVMVLPREVDAWV
FT                   WSRNNWMIMRHSMYWVNLRGKATSGREKTNVRVPYKQRLDALELVRILHLVGSGGTP"
FT   gene            complement(695967..696040)
FT                   /gene="glyU"
FT                   /locus_tag="MMAR_5490"
FT   tRNA            complement(695967..696040)
FT                   /gene="glyU"
FT                   /locus_tag="MMAR_5490"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            complement(696096..696875)
FT                   /locus_tag="MMAR_0595"
FT   CDS_pept        complement(696096..696875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0595"
FT                   /product="transcriptional regulatory protein"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39057"
FT                   /db_xref="GOA:B2HP15"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP15"
FT                   /protein_id="ACC39057.1"
FT                   /translation="MFVSIGPGRFGVSTLTTAAALVAFPVIAGIIGGAVAVVRTPSTAL
FT                   VSGVQHFAAGVVMAAVATEVLPDLRARGPLWLIILGFSAGVALLAGFRQFEDHGPHGED
FT                   EDGHDDVRAGGQVPVGFLAVVAVDLFIDGLLVATGATVSRRTAIIITIALTVEVLFLGV
FT                   SVALRLTRSGVPKARAAALTGGVSLATAVGGVLGALVLANAGGTVLTLVLAFAAAALLW
FT                   LVVEELLVEAHEGEERAWMAIMFFAGFLILYSLGVME"
FT   gene            697088..698422
FT                   /locus_tag="MMAR_0596"
FT   CDS_pept        697088..698422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0596"
FT                   /product="conserved integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39058"
FT                   /db_xref="GOA:B2HP16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP16"
FT                   /protein_id="ACC39058.1"
FT                   /translation="MAVLDTGERSLEARTIRKLGIRIVPFLMALYFVNYLDRTNLGIAR
FT                   ADISAHLQLTATMFGLASGIFFIGYVLVEVPSNLALDRYGARRWLARIAVSWGIVVVAT
FT                   GFAPNATTLLVLRFLLGVAEAGLFPGVIYYLSRWFPRDYRARVVALFMMASPIAAALGT
FT                   PLAAWLIHLGNGVFGLAGWQFMMIAVGVPAIVLGFACWYYLVDRPGDAAWLEPDERQWL
FT                   VDTLAEEQRQVAGDFHFPLRRALTSPRIWALALVYFGIAYGLYALTFFLPSIISGFKKS
FT                   FGIDFSIVQVGLIAAIPYTCAAVAMYLWSRHADATGEQVWHVAVPMLLGGLAIPVALHL
FT                   HTPVLVMVAVAITAMGVFAAIPSFWALPSNFLTGTAAAGAIGLINSVGNLGGFAAPYLT
FT                   GALEQVTGTDKAGMWAVGAMMLMSAFVVVLLRAVPGSPTAAERPN"
FT   gene            698509..698925
FT                   /locus_tag="MMAR_0597"
FT   CDS_pept        698509..698925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39059"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP17"
FT                   /protein_id="ACC39059.1"
FT                   /translation="MHIVPTPQAAEAMVTAMPPGPFVMLNLYRIREVADYSANPELAPP
FT                   APVSGRELFERYAAGMESALAKVGAERVFVADAGGCFIGPPEERWDVIQFVRYPSLEAF
FT                   IALMSSEQVQADLPHRFAMLEDSRVIPMAERPLA"
FT   gene            698949..699617
FT                   /gene="pcp"
FT                   /locus_tag="MMAR_0598"
FT   CDS_pept        698949..699617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="MMAR_0598"
FT                   /product="pyrrolidone-carboxylate peptidase, Pcp"
FT                   /note="removes 5-oxoproline from various penultimate amino
FT                   acid residues except L-proline [catalytic activity: 5-
FT                   oxoprolyl-peptide + H2O = 5-oxoproline + peptide]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39060"
FT                   /db_xref="GOA:B2HP18"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HP18"
FT                   /protein_id="ACC39060.1"
FT                   /translation="MTKVLVTGFGPYGVTPDNPAQFTAEALDGRTIAGATVVSRIVPGA
FT                   YFDSIAAAEQAIAEVDPQLVIMLGEYPGRAMLTVERLAQNINDCGRYGLADTAGKVLVG
FT                   EPTDPDGPVAYHATVPVHEMVLAMRAAGIPADVSDAAGTFVCNHLMYGVLHHIATQNLP
FT                   IRAGWVHLPCLPMVAALDRNLGVPSMSVETAVAGLVAGIEAAVQHSADTREPVPSRLQI
FT                   "
FT   gene            699820..700488
FT                   /locus_tag="MMAR_0599"
FT   CDS_pept        699820..700488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0599"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="may be exported"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39061"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP19"
FT                   /protein_id="ACC39061.1"
FT                   /translation="MGRHELARKRRKPSVLLAAVVAPVAAFFAVAGDIAPSSARDRIDQ
FT                   MAVGDGACCVEIVAATPIELSSKISSGAVGMGFAAGQFAAASRLRVDRSARLLPVGVAP
FT                   ERGLQVKTILAARSISAVFPEIHEIGGVRPDALRWHPNGLALDVMIPNPGSAEGIALGN
FT                   EIVAYVLANAERFGMQDAIWRGVYYTPSGATRSRLGHYDHVHVTTTGGGYPTGKEIYLR
FT                   "
FT   gene            700534..701106
FT                   /gene="dcd"
FT                   /locus_tag="MMAR_0600"
FT   CDS_pept        700534..701106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="MMAR_0600"
FT                   /product="deoxycytidine triphosphate deaminase, Dcd"
FT                   /note="involved in interconversion of dCTP and dUTP
FT                   [catalytic activity: dCTP + H2O = dUTP + NH3]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39062"
FT                   /db_xref="GOA:B2HP20"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2HP20"
FT                   /protein_id="ACC39062.1"
FT                   /translation="MLLSDRDLRAEISAGRLGIDPFDDSLVQPSSVDVRLDCMFRVFNN
FT                   TRYTHIDPAQRQDELTSVVEPTKGDPFVLHPGEFVLGSTLEIFSLPGDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCILKLTSPSEHPYG
FT                   SSGVGSKYQGQRGPTPSRSYQNFIRST"
FT   gene            701196..702881
FT                   /locus_tag="MMAR_0601"
FT   CDS_pept        701196..702881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0601"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39063"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP21"
FT                   /protein_id="ACC39063.1"
FT                   /translation="MFSSAATVVGCKTLGGVLDVVLGVSMAAADVRMALVEGEDGDGVI
FT                   VEEDSFDLDRNPVTSSASDQVVAAILGTREGAADAGLRLSSIGVTWTDPVQAAALRDAL
FT                   AWHKVENVMLVSGFLAAAALGQAVGGALSYARTAVLFIEPDTATLAVVDTADGSVSEVC
FT                   QQLLAEDDDAAVAEVVAMVAAAESLPARPDGVYVVGTGVDVAMIKPALDAATSLTVSVS
FT                   EEQEMALARGAALACGNAPLFAATTAALAYAQDLNDPDPLGESDLGDELSPDQEPAGRR
FT                   SGLLIGSGLAVVATAAVVALEVALAIDIRPTVALQPRPNENHLVAPPPQAAPPPQVAAP
FT                   EPKIELARPRVAPRAASPQLPAPAAPVQRAPEVPVLPAPAVPEPVVAVPPLVPIVVPPV
FT                   RVPSGTDTFLRPSVPKVQAPVPRQQPKAPAPRVEVPASPPPVVSPNPRGRGGLRLPGLG
FT                   RIPNPGRGPAGGSLGPGRRGHFGGGAPGRSGPSGGGHGGQFGGGGHGGRFGGGGHGGGF
FT                   GGGRGGGGHGGGFGGFGGGHGGGGHGGGFGGGHGGGFGGGHGGR"
FT   gene            703037..704563
FT                   /locus_tag="MMAR_0602"
FT   CDS_pept        703037..704563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0602"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39064"
FT                   /db_xref="GOA:B2HP22"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP22"
FT                   /protein_id="ACC39064.1"
FT                   /translation="MVEQVLGELLDTVLGVSVAPTAVRLVLVEGENGDGALVDEDAFDV
FT                   SGDGDAATIGAAEQVISAILGTREGASEGGYQLTSTGVTWRDPAQAAALRDVLARRKIE
FT                   NVVLVSAFLAAAALAHAVGSETNYAQTALLFIEPEAATLAVVDSADGSVTDIHRLSLSD
FT                   DDDTAVGQLTELISQAESLPTRPDAVFLVGSGIDLPLIKPTLEASTTLPVTAAEEPDTA
FT                   LARGAALAAASSPLFASSTAAQAWAQDPGSGVLYSHAPYGLDAAYFDDVSDQLGTGQQA
FT                   LAYSAVPEEQHERRPFALLASIMGSIFIIGVGALAVSLAVSIRSEPGTRPDPGQSVVTH
FT                   LPAPAHAAPAPQPQAPAPQAPAPQAQAPAPQAQVPAPAPAPQAPAPRAPAPQAPAPQAQ
FT                   VPAPKAPAPVPVPVAQAPVPVPQAPAPVPVPIPQAPAPAPEAPVPAPVPIPVPIQIPLP
FT                   QIFGPGGGGGFPGGDDDRGGRGGGRGGRHGGGHGGGHGRGGFNIPFIPGI"
FT   gene            704640..705974
FT                   /gene="udgA"
FT                   /locus_tag="MMAR_0603"
FT   CDS_pept        704640..705974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udgA"
FT                   /locus_tag="MMAR_0603"
FT                   /product="UDP-glucose dehydrogenase UdgA"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39065"
FT                   /db_xref="GOA:B2HP23"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP23"
FT                   /protein_id="ACC39065.1"
FT                   /translation="MRCTVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIP
FT                   FYEPGLRKLLRDNLAAGRLHFTTDYDMAAEFADVHFLGVGTPQKRGEYGADLRHIHAVI
FT                   DTLVPRLTRTSVLIGKSTVPVGTAAELARRAAGLAVAGVGVEIAWNPEFLREGFAVRDT
FT                   LRPDRIVLGVQEDSILAEQFVRELYGPLLEAGVPFLVTDLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAAGADVSLLADALGYDTRIGRQCLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GANQALTFLREVDSINMRRRTRMVELATTACGGSLLGANLAVLGAAFKPESDDVRDSPA
FT                   LNVAGQLQLNGAAVNVYDPKALDNANRLFPTLNYAVSVAEACERADAVLILTEWQEFVD
FT                   LDPDDLADRVRARVIVDGRNCLDVSRWERAGWRVFRLGARIRAAS"
FT   gene            706036..706791
FT                   /locus_tag="MMAR_0604"
FT   CDS_pept        706036..706791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39066"
FT                   /db_xref="GOA:B2HP24"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP24"
FT                   /protein_id="ACC39066.1"
FT                   /translation="MDQVAAYLDQTRAFGELVGNNDQSTPVPSCPGWNLGQLFRHVGRG
FT                   DRWAAQIVRDRLDSFLDPRNVAGGKPPAAVDDAIAWLQDGAQLMVDAVEQAGAETPVWT
FT                   FLGPRPAHWWVRRRLHEVVVHRADAAIALGQQFVLEPEIAADGISEFLERIAVQAGRDG
FT                   APLPIEDGDTVHLHATDPGLGDVGEWTAAVEDGHITWSHEHGKGTVAVRGGAAELLLAM
FT                   TRRVSVPDTGIEVFGDQAVWQKWLERTPL"
FT   gene            706827..707201
FT                   /locus_tag="MMAR_0605"
FT   CDS_pept        706827..707201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0605"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39067"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP25"
FT                   /protein_id="ACC39067.1"
FT                   /translation="MTTSEIATVLAWSDALNAADIDTLVALSSDDIDIGDAHGAAQGHE
FT                   ALRRWASSLQTTAEMGRMYVHDGVVVVEQRIIGRDDPDSVANAASAFRVVRDHVTSVFR
FT                   HDDLASALAATELTEADLVD"
FT   gene            707231..708097
FT                   /gene="rmlA"
FT                   /locus_tag="MMAR_0606"
FT   CDS_pept        707231..708097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="MMAR_0606"
FT                   /product="alpha-D-glucose-1-phosphate
FT                   thymidylyl-transferase, RmlA"
FT                   /note="dTDP-L-rhamnose biosynthesis within the O antigen
FT                   biosynthesis pathway of lipopolysaccharide biosynthesis
FT                   [catalytic activity: dTTP + alpha-D-glucose 1-phosphate =
FT                   diphosphate + dTDP-glucose]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39068"
FT                   /db_xref="GOA:B2HP26"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP26"
FT                   /protein_id="ACC39068.1"
FT                   /translation="MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAG
FT                   IRDIQLITTPHDAAGFHRLLGDGTHFGVNITYATQDQPDGLAQAFVIGADHIGTDSVAL
FT                   VLGDNIFYGPGLGTSLRRFQDISGGTIFAYWVANPTAYGVVEFSADGTALSLEEKPATP
FT                   KSHYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQAYLNHGRLNVEMLARGTAWLD
FT                   TGTFDSLLDAADFVRTLERRQGLKVSVPEEVAWRLGWIDDEQLMRRARSLVKSGYGSYL
FT                   LELLERN"
FT   gene            complement(708134..709567)
FT                   /locus_tag="MMAR_0607"
FT   CDS_pept        complement(708134..709567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0607"
FT                   /product="PE-PGRS family protein, PE_PGRS9_5"
FT                   /note="Ortholog of PE_PGRS9"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39069"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP27"
FT                   /protein_id="ACC39069.1"
FT                   /translation="MAFLFVAPETLTAAAADIAGIGSTLGEAGAAAATPTTAVLAAGAD
FT                   DVSAAVATLFSSYGQAYQSLSAQAAQFHSQFVQAMQAGAGSYATAEASNVAQTALDLIN
FT                   QPVLTLTGRPLIGNGANGAAGTGANGGAAGWLLGDGGAGGSGGLEQQGGTGGAAGLFGN
FT                   GGAGGAGGASTVGTGAAGGAGGAGGLLWGQGGIGGTGGSGIDGGAGGAGGAGGALFGIG
FT                   GAGGQGGIASTGLTGGGAGGDGGAGGLFGNGGIGGTGGLASVGPGGVGGNGGAAGTLLG
FT                   NGGGGGVGGFGATQGGDGGDGGATGIFGGTGGAGGAGGQSTNALADSVGGNGGQGGDGR
FT                   LFGNGGAGGVGGAAYTSNILMNATGGNGGQGGTGGTLFGNGGGGGTGGAGFVGPSSAGD
FT                   GGNGGGGGRAGLIGNGGAGGAGGAPGPNGGFSGGNGGNGGDAVLIGNGGNSGDVGLSGA
FT                   GTPGLPGNGGLLIGTIGNT"
FT   gene            complement(709749..711179)
FT                   /locus_tag="MMAR_0608"
FT   CDS_pept        complement(709749..711179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0608"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39070"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP28"
FT                   /protein_id="ACC39070.1"
FT                   /translation="MSFVITAPEALTAAATDLASLGSTIGAANAAAVAPTTAVLAAGAD
FT                   EVSAAVAALFDAQGQAYQLLSARAATFHEQFLQALSGGGASYAAAEAAAVSPLLDAINA
FT                   PVLAATGRPLIGNGANGAPGTGADGGAAGWLIGNGGAGGSGTPGTASVAGGNGGNGGAG
FT                   GLLFGTGGAGGAGGTASSLVGAIPGGNGGYGGDGGLLFGRGGAGGAGGFGNNTTGGIGG
FT                   LGGAGGLFGAGGDGGVGGFGTFAGNGGDGGTGLFAAGGDGGAGGSGLTQGGDGGIGGAA
FT                   LGLFGAGGAGGTGGEGGLFGGAGGMGGSAGMLFGNGGDGGAGAAATIGNAAGNGGAGGN
FT                   AGMLIGAGGAGGNGGFGFSASDGGAGGAGGNAGFLYGAGGAGGAGGDSVGGADGGDGGN
FT                   GGKAGLVGQGGDGGAGGNNNSGFGTGGSGGKGGDAVLIGNGGNGGNAGSGGVGPGIAGA
FT                   AGIGGLLIGEDGMAGLTP"
FT   gene            711571..714756
FT                   /locus_tag="MMAR_0609"
FT   CDS_pept        711571..714756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0609"
FT                   /product="PE-PGRS family protein"
FT                   /note="function unknown, member of the mycobacterium
FT                   tuberculosis PE family, PGRS subfamily of gly-rich
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39071"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP29"
FT                   /protein_id="ACC39071.1"
FT                   /translation="MSYVVAIPDMLASAAADVAGIGSSVGAANAAAVGATTGVMAAADD
FT                   EVSVAIAALFSGHGQAYRAISAQAAAFHDQFLRALTGAGGAYAAAEAANASPLQAAQQQ
FT                   ALAVINAPTNALLGRPLIGNGTDGLAGTGAAGGAGGLLWGNGGNGGSGAAGQAGGAGGA
FT                   AGLIGTGGAGGMGGAGGGAGGMGGSGGWLLGNGGAGGAGGVGGAGVSGGVGGTGGNAVM
FT                   FGNGGAGGMGGAGADGAVGAAGTAGTSTSAGGVGGVGGDGGNAGNGGAGGNGGLFVGVG
FT                   GAGGQGGAGGAGGTGGAGGAGWDATAAGVLAATGGDGGDSGGGGAGGNGGAGGAGGHGS
FT                   ALFGAAGANGNGGAGGAGGNPGAPGNGGIGGVGPDAATSGGMGGTGGDPGAVGGGGNGG
FT                   AAGGAGAVAGASGAAGTIIAGNGGNGGAGGAGYAADGPAGPAIGNGGDGGRGGAGGFYG
FT                   NGGAGGAGGNSAPGGGNGGNGGTGGDSGAMGSSGGRGGDGGVGTNGGAGGGGGNATSYG
FT                   TANATGGAGGDGGAGSRGTGGTGGAGGGGGAAQILNGASAATATGGAGGAGGDGNDGGN
FT                   AGVGGAASTRGTGNVTGGTGGDGGTGSTGIGGSGGDGGNVEVNNDASTVSFVGGAGGHG
FT                   GDGATDGGAGGDGGRTTIDGAGSRATATGGTGGDGGNGGTGHGGGGGSGGTAINYGAGD
FT                   AFGGAAGKGGTGVVGGNGGSGGAAYNYGTGNATGADGAAGTDGTTGAGGSGGSGGAASV
FT                   LNSASIATATSGSGGAGGDGTDGGNGGSGGFAFTFGTGNIIAGVGGDGGTGSTGVGGIG
FT                   GSGGGADINNGASTVVPQGGAGGHGGDGATDGGAGGAGGFTEIDSSASVLAATGGAGGD
FT                   GGSGGTGRGGTGGVGGVGINNGSGEAIGGAPGAGGTGAVGGDGGQGGAAYSYGTGDATG
FT                   SAGAAGTAGTTGVGGTGGAGGAAYTLNGASTATATGGIGGNGGDGGTANGSNGGNGGAG
FT                   GYASTTGTGTASAGNGGRGGDGTATVATGGTGGVGGNAHAPAGSPVPGVGGKGGNPGPG
FT                   GKPGPNGADGIVV"
FT   gene            complement(714850..716139)
FT                   /gene="aspC"
FT                   /locus_tag="MMAR_0610"
FT   CDS_pept        complement(714850..716139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MMAR_0610"
FT                   /product="aspartate aminotransferase AspC"
FT                   /note="involved in glutamate biosynthesis [catalytic
FT                   activity: l-aspartate + 2-oxoglutarate = oxaloacetate + L-
FT                   glutamate]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39072"
FT                   /db_xref="GOA:B2HP30"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP30"
FT                   /protein_id="ACC39072.1"
FT                   /translation="MDSDETMVDVTTHQLPWHASSHQRQRSFAQSSKLQDVLYEIRGPV
FT                   HQQAARLETEGHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRA
FT                   VVTRYELVDGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTSL
FT                   AGGTPVHYLCDETQDWQPDIADLESKITERTKALVIINPNNPTGAVYSHEILTQMVELA
FT                   RKHELLLLADEIYDKILYDDAKHISVATLAPDMLCLTFNGLSKAYRVAGYRAGWLAITG
FT                   PKEHASSFIEGISLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWS
FT                   KLNEIPGVSCVKPKGALYAFPRLDPEVYDIADDEQLVLDLLLSEKILVTQGTGFNWPEP
FT                   DHLRLVTLPWSRDLAAAIERLGNFLVSYRQ"
FT   gene            complement(716170..719127)
FT                   /locus_tag="MMAR_0611"
FT   CDS_pept        complement(716170..719127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0611"
FT                   /product="iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39073"
FT                   /db_xref="GOA:B2HP31"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP31"
FT                   /protein_id="ACC39073.1"
FT                   /translation="MTTQMLIRLTVGMGMTAVVVVLALRRVWWLYKLIMSGQPASGRTD
FT                   DIGARIWTQIAEVFGQRRLLRWSIPGIAHFFTMWGFFILLTVYIEAYGFLFVENFSIPV
FT                   IGHWDALGFLQDFFATAVFLGIATFAIIRIKRNPREIGRASRFYGSHNSGAWLVLFMIF
FT                   NVIWTYVLVRGSAVNNETLPYGKGAFLSQLFGAILRPLGQPANEIIETTALLAHIAVML
FT                   AFLIIVLHSKHLHIFLAPINVTFKRLPDGLGPLLPVEADGKPVDFENPPDDAIFGRGKI
FT                   EDFTWKGMLDFATCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGEKTA
FT                   DPLEGLDLETAAEEGHHVPESGFGRVPGDGPEQAARPLVGTAEQGGVIDPDVLWSCVSC
FT                   GACVEQCPVDIEHIDHIVDMRRYQVMMESEFPSELSVLFKNLENKGNPWGQNASDRTNW
FT                   IDEVDFDVPVYGEDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAELLATAGVKFMVLG
FT                   AGETCNGDSARRSGNEFLFQQLAQQAIETLDGVFEGVETVDRKVVVTCPHCFNTLGKEY
FT                   RQLGSNYSVLHHTQLLNRLIRDKKLVPVTPVSQDVTYHDPCYLGRHNKVYEAPRELIGA
FT                   AGANLAEMPRHAERSFCCGAGGARMWMEEHIGKRINHERVDEALATNASTIATACPFCR
FT                   VMVTDGVNDRQEEAGRSGVEVLDVAQVLLGSLDREKATLPEKGTAAKEAEKRAKAAPKA
FT                   AAPAAPAPAPAEAPAKAAEAPAAATAASPAAPAKGLGMAGGAKRPGAKKAAPAPAAETA
FT                   AAEAPAAPAKGLGMAAGAKKPGAKKAAAPTGETKPAEAAAPAAPAAPVKGLGMASGAKR
FT                   PGAKKAAPPAAAAPEAAATASAPEAAAAPAEPAAPAAPVKGLGIATGAKRPGAKKAPAR
FT                   AEAPAAAAPAQPEPEATPEPEPASKQDGEPTPPAAPAAPVKGLGMARGARPPGKR"
FT   gene            complement(719257..721710)
FT                   /locus_tag="MMAR_0612"
FT   CDS_pept        complement(719257..721710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0612"
FT                   /product="transcriptional regulatory protein"
FT                   /note="involved in transcriptional mechanism"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39074"
FT                   /db_xref="GOA:B2HP32"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP32"
FT                   /protein_id="ACC39074.1"
FT                   /translation="MSEGHASRDDTSAPPDSAAVPAPARGLIDELASGGATSVKALIGG
FT                   GIGTGKTTVLGTVRDALRRAGVTVRAHPTKDCDPSEVALVVDDAHLLAEDELLRLAEWV
FT                   ADPRATVVVGAQLHQQHHALRALATAIERERPQISLGPLPVADQLRDSTAGVPFLVEAV
FT                   SRGTGSPVPAARFALIERLRRLDEPTLDALLIMSLTQESGTTDVAAALGVSTSDARQLV
FT                   DRVHASGLVEPSHPPAFVQLVHEAVVHIVGNTHHHEVETSLLRSQLDISPMSQDLALRL
FT                   AEHGLHGERLATALAGYASAARGEPAQTARLYRAAVAAGATGLKSQLADALARTGDCAG
FT                   AAELADELLGSADSAQRAAAVRIAASVAAHEGNAGQAAELFGWLGPYPDAVVGSSAAIV
FT                   LAAVGDLQTARAALDVKDTGPPTMAARAARGLADGLLLTMGQPYPVAMAKLGQAIAAEQ
FT                   PITEATPDSPAALVTLAAIHGGDPVRARSVIGRAVRSGTDQVFHQRHLLLSGWIKMQEG
FT                   QLPSASADVAAACSGAPMHRRDALWAAALETAIARRSGDAGALQKHWNAAMEVLGEYSL
FT                   DLFALLPLGELWVAAARNRQVDQLQHTLDQAFSLLNSLGNPVLWSNSLHWAGVHAGILA
FT                   NSPGAVAPHGQALGAAAAGNALAHALSVAGRTWLRVLADQVDVDEVTVAARSLSGVGLT
FT                   SDATRLAGQAALQTADARVSGAMLQLARDLKLASGFDEPTDAEPVAGAAPAPRQPPAGS
FT                   PLSDREREVAELLLLGMPYRDIGAQLFISAKTVEHHVARIRRRLGAGSRSEMLSMLRAM
FT                   LTAPG"
FT   gene            721914..722453
FT                   /locus_tag="MMAR_0613"
FT   CDS_pept        721914..722453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39075"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP33"
FT                   /protein_id="ACC39075.1"
FT                   /translation="MANSLLDFVIALVRDPAAAARYAANPAQAIADAHLTDVTSADVNN
FT                   LIPMVSDSLSMAGPSGAMAGAQPADHGNVWASGAAAAALDSFSPHVAGAVVPQHQPSGG
FT                   VINEPTPVASGDITADPHPVAFEPHQPSVLFTGAETPDPTFDHGVLPAADPAIWDHPVD
FT                   HPHVTEPDHHGFGIHG"
FT   gene            722730..725729
FT                   /gene="iniB"
FT                   /locus_tag="MMAR_0614"
FT   CDS_pept        722730..725729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniB"
FT                   /locus_tag="MMAR_0614"
FT                   /product="conserved hypothetical membrane protein, IniB"
FT                   /note="function unknown function but ortholog in
FT                   M.tuberculosis induced by isoniazid and ethionamide"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39076"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP34"
FT                   /protein_id="ACC39076.1"
FT                   /translation="MKMTSLVDYILSLFRSEDAARSFVASPGQAMTNAGLVNVSPVEIS
FT                   SAAANALPFLNLGAGDPIGGLQQAVADQYGLAPASEVGAASSYVAQDAGAVVAQDAAAV
FT                   VSDAGVAAADAGFAGADIGASVANVVAADIGAGLASGLTSGLGAGLWSQSGLGWQTGVG
FT                   GVVPGLAYTQATGDFGGQVGLASQVGLGFGAGIQAGFGAQASAGLGLGFGAQTGLGAQT
FT                   GLGIGAGFEGGFAGQAGAGLGLGIGAQTGLGVGLGGQTAVGGGLGLGLGGGLGGQAGLG
FT                   LGGGFGGAGEFGLGGGFVSQAGFDAQLGAQAGATVGAGIGGNAGLDVGGALGGQAGLGL
FT                   GGGFVSQAGFDGQLGGQAGVGVGGQAGGAVGGSAGGAIGGGFGGGAGVGGAVGGSAGGA
FT                   IGGGFGGGAGVGGQAGGSAGGAIGGGFGGGAGVGGQAGLGLGGGFVSQAGFEGQLGGQA
FT                   GVGVGAGVGGQAGGAVGGSAGGAIGGGFGGGAGVGGQAGAAVGGSAGGAVGAGAGFGSR
FT                   VVGNGQVGAGGQVGGGIAGQAGGGIAGQAGIASQAGLAGQAGLAGQAGIASQAGLAGQA
FT                   GLAGQAGIASQAGIASQSGLAAGGSAGIASQAGLGIGGQAALGGQAGAAVGGGLAGVGN
FT                   VSGLTGIGGNASLGATGQAGLIASEGAALNGAATPHVSGPLGGVGVGGQAGAAGGAGLG
FT                   LGAGSRGGILSGDSTTLGGHPNPQPAALGAAGGTGIGAHSGAGGGMAAGLGGSAAGGAG
FT                   VGLGGSAAGGAGAEAAGGFGGGTHIGGQAGLGGSAAGGAGTELGGTAGSPGAGMGAGVG
FT                   GGTHAGGQVGLGGGSTAGGQAGLGGGSSAGGSVGHGDILGQEGTTLGGNGGVSGGIPPV
FT                   EHGPTIPTGQGPVIQGGGGAGAGAGGQVSPPSGNGPVIQSPGAGAGHGGANPPVINAPA
FT                   PHVATPTPAHTPPVEHAPVVTPQPHVPAEQPAHHEPPSPSVFGHEPPVTHTPPVHVDPP
FT                   SHGPVDPHGF"
FT   gene            725830..727683
FT                   /gene="iniA"
FT                   /locus_tag="MMAR_0615"
FT   CDS_pept        725830..727683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniA"
FT                   /locus_tag="MMAR_0615"
FT                   /product="conserved hypothetical protein IniA"
FT                   /note="in M. tuberculosis H37Rv this gene is induced by
FT                   isoniazid (INH) or ethionamide treatment) (see wilson et
FT                   al., 1999)"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39077"
FT                   /db_xref="GOA:B2HP35"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP35"
FT                   /protein_id="ACC39077.1"
FT                   /translation="MTQPDDPRRVGVIVELIDHTIAIAELNERNDLVGRLRRARQRITD
FT                   PQIRVVIAGQLKQGKSQLLNALLNLPVARVGDDEATVVVTVVSYSPQPSARIIVAAGPN
FT                   GETTSIDVPVDDINTDLRRAPQAGGREVLRVEIGAPSPLLQGGLAFIDTPGVGGHGQPH
FT                   LSATLGLLPDADAMLMVSDASQEFTEPEMWFLRKAHQLCPAGVVVATKTDLYPHWREIV
FT                   NTNAAHLQRARVPMPIIPVSSLLRSHAVTLNDKELNEESNFPAIVKFLSEKVLSRETDR
FT                   VRDEVLREIRSAAEQLTISVDSELAVINDPALRDRLASDLERRKREANDALQQTALWQQ
FT                   VLNDGFTDLSTDVDHDLRARFRAVTEDAERQIDSCDPTLHWAEIGTDVENAIATAVGDN
FT                   FVWAYQRGEALADDVARSFADAGLDSVLSPELSKRAMGAEFGQLKAPAQLEAKPAGKAQ
FT                   KVVTGLRGSYGGVVMIGMLSSVAGLGLFNPVSVGAGLILGRMAYKEDRENRLLRARAEA
FT                   KTNVRRFVDDVSFVVGKESRDRLKMIQRTLRDHYREIANEITRSLNESLQATVTASHLE
FT                   EAERDNRVRELERQRNILGQVTDNLLKLGPGVSPRANLGRA"
FT   gene            727680..729161
FT                   /gene="iniC"
FT                   /locus_tag="MMAR_0616"
FT   CDS_pept        727680..729161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iniC"
FT                   /locus_tag="MMAR_0616"
FT                   /product="isoniazid inductible protein IniC"
FT                   /note="in M. tuberculosis H37Rv IniC is an isoniazid-
FT                   inducible gene"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39078"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP36"
FT                   /protein_id="ACC39078.1"
FT                   /translation="MSTSDRVRAILGGTIQAYRGEPAYRQRADVFYELDRIGARLSEPI
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTGFRHGPTPRVTANHRGGRRVNV
FT                   PITHRDGLSFDLRRLNPAEIADLDVEWPAEELVNTTIIDTPGTSSLNRDTSERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADIALLKQIGGLVGDSAGALGIIGVASRADEIGAGRIDA
FT                   MSSAQDVAKRFTAELSQTGICQAVVPVSGLLALTARTLRQSEFAALKKLAGADSTELNK
FT                   ALLSVDRFVRPDSPLPVDAGTRAQLLERFGMFGIRISIAGLAAGIADSAGLAAELLERS
FT                   GLVALREVIDQQFAQRSDMLKAHTALVSLRRFVQAHPVMATPYVIADIDPLLADTHAFE
FT                   ELRVLSLLPSQATTLNDEELVSLRRIIGGSGTSPAARLGLDPQHRHDGPRAAFAAAQRW
FT                   RRRADHPLNDPFTTRACRAAVRSAEAMVAEFAARR"
FT   gene            complement(729166..731004)
FT                   /locus_tag="MMAR_0617"
FT   CDS_pept        complement(729166..731004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0617"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39079"
FT                   /db_xref="GOA:B2HP37"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP37"
FT                   /protein_id="ACC39079.1"
FT                   /translation="MSESLGLSIGVANLVATRAGGAPLRRASVLHLFQHQAAEVGLPEE
FT                   NPSLAGAGLVLRGFVERVGDQSPLIAADGTKYLGEALAVQALSALARTVGYGSPVTIAA
FT                   PAYWSGAQLGALRGALLTEPALAPNGVAAAVVSDAAAALAALRPTPGFPASGVVALCDF
FT                   GAGGTSVTLAQVGASLQQIGPTFRYREFSGDEIDQLILSHLLTVTPGIDSTEVSGTATS
FT                   MGSVTLLLGGCRFAKEHLSAAPVATIATGAAGQPGADIRFSRNEFEQLITQPLDRFIGS
FT                   VEDMLQRSGVPRPSLAAVAAVGGGAAIPLIGNRLSERLQVPVFTTAQPIFSAAIGAAML
FT                   GQDQSSAGAPTGAGPAVDMPTNIVGAAGTIGAMTEVSPTAWANQAGSAAASESASDNAK
FT                   SATYRALAWSQDADTGNEPVPYTGPDATGEYGREPATDYAPRYDYPDQDRYAEAAPLPW
FT                   YKRAAVVFSLAAAGLAILVAVVLGLTLGTSNNKPVNTTVPAPLPEPITTTILGPNSSPT
FT                   VTVITPTPPSTTTTSPSATTTTTQPTTTTTTTTTPTTTTTTTTTTTPPTTTTTTQPTTT
FT                   RTTTTQATTTAPPTTTQQPSTTTAAPITPTTEAPGA"
FT   gene            complement(731096..731641)
FT                   /locus_tag="MMAR_0618"
FT   CDS_pept        complement(731096..731641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0618"
FT                   /product="conserved threonine-rich hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39080"
FT                   /db_xref="GOA:B2HP38"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP38"
FT                   /protein_id="ACC39080.1"
FT                   /translation="MARHDPPDYGAGDPTAYGNYGYGDQGGGYGQQPPPEPTPGWRKPL
FT                   ALAGWGVLIAVLIGLIIFGIIQLAHGRPTPASVTKTVTATMTTTTPTTTTTAPTKTTTT
FT                   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTPTTTTTTTTAPTTTTTTTTNPMSPGAMPTF
FT                   PSQLTPSIPTVINLPPGL"
FT   gene            complement(731749..732330)
FT                   /locus_tag="MMAR_0619"
FT   CDS_pept        complement(731749..732330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39081"
FT                   /db_xref="GOA:B2HP39"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP39"
FT                   /protein_id="ACC39081.1"
FT                   /translation="MARYGPPDDFHSQPTQYGGYPAGGRPPAGPPPSRPAGPQSGPPPQ
FT                   APPGPDSLSPSEQFASAEGYDQEKPESEPKPWYRNPVTLTGWALLVMILIALIVYGIIE
FT                   LISDRQGTGNPSTTTPSTTTSTTTAETTTTTPPTTTTTTVAPATTPRVQPPPQQPTHPP
FT                   THRFPHLPPLPSVITIPGVPTTITLPPHLP"
FT   gene            complement(732367..732936)
FT                   /gene="lpqJ"
FT                   /locus_tag="MMAR_0620"
FT   CDS_pept        complement(732367..732936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpqJ"
FT                   /locus_tag="MMAR_0620"
FT                   /product="conserved hypothetical lipoprotein, LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39082"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP40"
FT                   /protein_id="ACC39082.1"
FT                   /translation="MRLPQKTRWGLLALSAAAVLAAGCDATIDGKPIATPGAGPTEPSF
FT                   PTRRPTTSPPPPTSTSPSQPTSPASPTSPAGAIPLPPDDNGYVFIETKSGQTRCQINHD
FT                   SVGCEAPFTNSPIKDGEHANGVHITSAGNVQWVLGNLGAIPTVTIDYKTYDAQGWIITA
FT                   TTDGTRFQNNGTGHGMFVSIDKVETF"
FT   gene            complement(733028..733504)
FT                   /gene="coxS_3"
FT                   /locus_tag="MMAR_0621"
FT   CDS_pept        complement(733028..733504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxS_3"
FT                   /locus_tag="MMAR_0621"
FT                   /product="carbon monoxyde dehydrogenase (small chain),
FT                   CoxS_3"
FT                   /note="probably involved in cellular metabolism [catalytic
FT                   activity: CO + H(2)O + acceptor = CO(2) + reduced
FT                   acceptor]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39083"
FT                   /db_xref="GOA:B2HP41"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP41"
FT                   /protein_id="ACC39083.1"
FT                   /translation="MHERSVQLSVNGNHVAARVEPRMTLADFLRERCGLTGTHLGCEHG
FT                   ACGACTVLVGGDAVRSCLLFAVQADGAEVTTVEGIASADGELSPVQSALRECHGLQCGF
FT                   CTPGFVVSITALLRDNPDPTDEQIREGLSGNFCRCTGYQGIVAATRRASELMSQ"
FT   gene            complement(733497..734384)
FT                   /gene="coxM_3"
FT                   /locus_tag="MMAR_0622"
FT   CDS_pept        complement(733497..734384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxM_3"
FT                   /locus_tag="MMAR_0622"
FT                   /product="aerobic-type carbon monoxide dehydrogenase,
FT                   CoxM_3"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39084"
FT                   /db_xref="GOA:B2HP42"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2HP42"
FT                   /protein_id="ACC39084.1"
FT                   /translation="MKPASFDYHRPDTAEEAVGLLAELGEDAKILAGGQSLVPMLSMRL
FT                   AFFDHLIDISRLAELQGIQLRNDQLWIGAGTPDSKVGTDSQVRQSVPLLTRATPYIGHF
FT                   QIRNRGTLGGSIAHADAAGEYPTVALTLDAVMEVLSPRGYREIPAAEFFTGLWETAMEP
FT                   DEVLTGVRFPTWTGKSGFAVREFSRRHGDFAIAGAAVAVQLDDEHRVSRCAIGLLGLGA
FT                   TPRRATAAEAAVLGKPIDELVPEQIGQSAMSGLADIASDLQGSGSYRAQVGAVMTTRAW
FT                   SRAVQEANAETAHA"
FT   gene            complement(734381..736711)
FT                   /gene="coxL_3"
FT                   /locus_tag="MMAR_0623"
FT   CDS_pept        complement(734381..736711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL_3"
FT                   /locus_tag="MMAR_0623"
FT                   /product="aerobic-type carbon monoxide dehydrogenase,
FT                   CoxL_3"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39085"
FT                   /db_xref="GOA:B2HPQ8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPQ8"
FT                   /protein_id="ACC39085.1"
FT                   /translation="MTQDMQEAPAPRYAGTRVQRVEDGRLLTGHGSFVDDISRPGMLHA
FT                   CFVRSPFAHARINGIDTATALALPGVHAVFTAADLNADVKEAWHAVAGRDVADTPRPPL
FT                   AERDAKFVGDPVALVVAESRYVAEDAIELVDIDYEPLPAITDFTRAQSSDVLVHESYPD
FT                   NVAGGLAGAPPDEQTFATSPCVVTENIYQQMYAPVPIETRGLVAEWAPASEELTLWAST
FT                   QTPHELRAFCARLLGIAAQRVRVIMRDTGGGFGQKVVPMREDMCIMLAARKVPGALKWI
FT                   EDRRENLMSAGQARHVDGTARMAFDTDGNIQAADIDFIMDIGAYPTPYPVLTTAAIGMF
FT                   FPGPYRIPKASFSYKTVFSNTSGLAAYRGPWQYETLAREILLDIAARKMGIDPIELRRR
FT                   NLLRREEMPYVNPNGMPYDHVAPIETLEQAVKILDYEGFRREQREALAHGRYLGLGLSA
FT                   YIEPTGAATGHLATEGATIRMEPTGKVNVYVNGGSSGNSLETTVIQLTADALGADIDDV
FT                   ATIQGDTAITPYGAGTQGSRSGPMTAGAVNEAGKILREKIVALAAHHLEVAESEVELVH
FT                   SKAAVRGDPARQVTFGELAYTAYYSPQQLPSALSTELEGTARFKSPNPIHWANATHACT
FT                   CEVDTQTGKVTLLRYVVSEDVGPMINPAVVEGQIAGGTVQGIGGALMENLAYDDDGNPL
FT                   ATTFVDYLLPTATEVPPIEYGHVEIPGPGPGGYKGAGEGGAIGSAPAVINAINDALAPL
FT                   GVTVTRLPASPASVASLLAGASR"
FT   gene            736871..737419
FT                   /locus_tag="MMAR_0624"
FT   CDS_pept        736871..737419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39086"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPQ9"
FT                   /protein_id="ACC39086.1"
FT                   /translation="MCELTRVVAVLLAAGAGRRYGKPKVLVEGWLETALAALRGGGCAD
FT                   VVVVLGAAPAAVPSGVTAVTAPDWQQGLSASVRAGLVQADRMKADYAVLHVIDTPDVDA
FT                   AVVARVVGRALGSSSGLARAYFGDRPGHPVVIARRHWPEILARMTGDHGAAAYLAARRD
FT                   VENVDCLDLASGRDIDRPV"
FT   gene            complement(737435..737812)
FT                   /locus_tag="MMAR_0625"
FT   CDS_pept        complement(737435..737812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0625"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39087"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR0"
FT                   /protein_id="ACC39087.1"
FT                   /translation="MSFVVATPEMLVGAATQMERIGSALGAANVVAAPAITSVVAAAED
FT                   EVSAAIASLFSECAQAYRVLSIHAADFHGSFVQAVKCAAERYQAAEAEFYALLAARQAE
FT                   RASLPSPQPDPNHASPAGGGG"
FT   gene            complement(737973..739403)
FT                   /gene="ansP1_1"
FT                   /locus_tag="MMAR_0627"
FT   CDS_pept        complement(737973..739403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansP1_1"
FT                   /locus_tag="MMAR_0627"
FT                   /product="L-asparagine permease AnsP1_1"
FT                   /note="involved in L-asparagine transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39088"
FT                   /db_xref="GOA:B2HPR1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR1"
FT                   /protein_id="ACC39088.1"
FT                   /translation="MPPLDTAATARLTREDRGYHKSLKNRQLQMIALGGAIGTGLFLGA
FT                   GGRLASAGPGLFLVYGICGFFVFLILRALGELVLHRPSSGSFVSYAREFFGEKVAFVAG
FT                   WMYFLNWAMTGVVDTTAIAHYCHYWKALQFVPQWTLALVALVSVLLMNLISVKLFGELE
FT                   FWAALIKVIALVIFLIIGSIFLAGRYHVDGQETGLGLWRSHGGFLPTGLVPLVLVTSGV
FT                   VFAYAAIELVGTAAGEAAEPEKIMPRAINSVVFRIGLFYIGSTVLLALLLPYTAYREHV
FT                   SPFVTFFSKVGIEGAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPKFTAPMS
FT                   KNGVPYGGILLTAGIGTLGIVLNAVKPSQAFEIVLHIAATGVIAAWATIVACQLRFHRL
FT                   TISGVLQRPSFRMPWSPYSGWITLAFLASVLILMLFDEVYGRWMLAAILVGVPALIGGW
FT                   YLVRNRVQVAARDTVASE"
FT   misc_feature    739528..752062
FT                   /note="MURD9; Probable potassium transport locus, contains
FT                   genes encoding the KdpFABC complex. Also contains KdpD/E,
FT                   the two-component regulator of the Kdp operon"
FT   gene            complement(739684..740505)
FT                   /locus_tag="MMAR_0628"
FT   CDS_pept        complement(739684..740505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0628"
FT                   /product="monooxygenase"
FT                   /note="function unknown; domain homology with
FT                   alkanesulfonate_monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39089"
FT                   /db_xref="GOA:B2HPR2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR2"
FT                   /protein_id="ACC39089.1"
FT                   /translation="MTNNAAPRIGVHIWPGGAPDYATWRQAVLDAESLGADAIFGYDHF
FT                   HKPFVEIVDGGPRLLPDQPDVNNFEAWTALASWGEITSRPDIGLLVTGIGFRNPDLLAD
FT                   MARTVDHISGGRLILGIGSGWYEKDYLAYGYDYPSIGERMQQLADGLHRIKRRFRQLLP
FT                   PPIREIPLLLGGSGERKTLPLVGQYADIWHSYEPLEEFRRKNDLVRRHADAAQRDEAKI
FT                   ERAMAWTTPADADAYHREGVSLLTTEIQPTTDGYDLGILGEMIAWRDGRSR"
FT   gene            complement(740539..741276)
FT                   /locus_tag="MMAR_0629"
FT   CDS_pept        complement(740539..741276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0629"
FT                   /product="dehydrogenase"
FT                   /note="function unknown; FabG-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39090"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR3"
FT                   /protein_id="ACC39090.1"
FT                   /translation="MAGLTALITGATSGIGRATAHGLAELGATVLVSGRDEARGREVVD
FT                   EVTARGGRGIFLAAELRDVTGVRNLATAAADAGAGKVDILINSAGAFPFGPTADTSPDD
FT                   FDAVFALNVRAPYFLVGALAPTMAKRGRGSIVNVTTMVAEFGAAGTGLYGASKAAIALL
FT                   TKSWAAEYGPSGVRVNAVSPGPTRTEGTVEMGEALDQLAAAAPAGRPADPTEIASTIVY
FT                   LASDAASFIHGAVVPVDGGRAAV"
FT   gene            741480..742088
FT                   /locus_tag="MMAR_0630"
FT   CDS_pept        741480..742088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MMAR_0630"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39091"
FT                   /db_xref="GOA:B2HPR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR4"
FT                   /protein_id="ACC39091.1"
FT                   /translation="MARPRAFDEAVVLSAARDEFRSHGYAATSVDSLAAATGLNRSSLY
FT                   GSFGDKHRLFLRALDGYCEATLHDVREVLRERGVSARQRLINHVHAIVNGIVADTDRRG
FT                   CMMSRSSAELAGADPDVSGIVERSLEAWRRELADCIAEAQLEGAVAGDGSPQALATVML
FT                   SLMQGFEALGKGGVGSAELRAAESAALALLFGAGTDPKP"
FT   gene            742925..744583
FT                   /gene="kdpA"
FT                   /locus_tag="MMAR_0631"
FT   CDS_pept        742925..744583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="MMAR_0631"
FT                   /product="potassium-transporting ATPase a subunit, KdpA"
FT                   /note="part of the K(+)-translocating kdpfabc complex. in
FT                   E. coli the KdpA subunit has been shown to be important for
FT                   potassium binding and transport"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39092"
FT                   /db_xref="GOA:B2HPR5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR5"
FT                   /protein_id="ACC39092.1"
FT                   /translation="MAGILFLASLMVALVAVHVPFGDYMYRVYTSDKHSRVERWIYRAI
FT                   GADPHAEQGWGAYARSVLAFSASGILVLFTFQLMQGKLPLHLNDPATPMNPVLAWNTAV
FT                   SFVTNTNWQAYSGESTQGHLVQMAGLAVQNFVSAAVGMAVAMAVVRGFARRHTGDLGNF
FT                   WVDLVRGTIRILLPVSVVAAIVLVAGGAIQNFHLRDQIVSTLSGAEQTITGGPVASQET
FT                   IKDLGTNGGGFFNVNSAHPFENPTAWTNWVEIFLLLVISFSLPRTFGRMVGSPKQGIAI
FT                   ASVMAVLALISWSTTMSMQLQRHGTVPTAVGAAMEGVEQRFGVANSAVFAASTTLTSTG
FT                   SVDSFHDSYTSLGGLVLLLNMQLGEVAPGGVGSGLFGMLILAVITVFIAGLMVGRTPEY
FT                   LGKKITPREIKLAATYLLISPLIALTGSAVAMAMPGQRAAMLNTGPHGLSEVLYAFTSA
FT                   ANNNGSAFAGISVNTDWYNTALGLAMVFGRFLPIVLVLALAGSLVRQGTTPESIGTLPT
FT                   HRPQFVGLVAGVTLILVALTFLPMLALGPLAEGIH"
FT   gene            744583..746664
FT                   /gene="kdpB"
FT                   /locus_tag="MMAR_0632"
FT   CDS_pept        744583..746664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="MMAR_0632"
FT                   /product="high-affinity K+ transport system, ATPase chain
FT                   B, KdpB"
FT                   /note="catalytic subunit of the Kdp-ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39093"
FT                   /db_xref="GOA:B2HPR6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR6"
FT                   /protein_id="ACC39093.1"
FT                   /translation="MSTTVGSGLLDPTMLWKSLPAAVRKLDPRTLWRNPVMFIVELGAV
FT                   WSTLLAVVDPSWFAGLIVAWLWLTVIFANLAEAVAEGRGKAQADTLRKTKADTMARLLT
FT                   ATGAEEQVTAALLQPGDIVVVDAGQVIPGDGDVVEGIASVDESAITGESAPVIRESGGD
FT                   RSAVTGGTTVLSDRILVKITQKPGESFIDKMIALVEGADRQKTPNEIALNILLASLTII
FT                   FVFTVVTLQPLAIYSKANNPGVADTVALNANGISGIVMVSLLVCLIPTTIGALLSAIGI
FT                   AGMDRLVQRNILAMSGRAVEAAGDVNTLLLDKTGTITLGNRQAGAFVHLPGVSEAELAD
FT                   AAQLSSLADETPEGRSIVVYAKQQYGLRARTPGELAHAQWIEFSATTRMSGVNVDGHLL
FT                   RKGAANAVADWVRTQGGEVPPELKATVEAISAGGGTPLAVAQVLDGTASVLGVIHLKDV
FT                   VKHGMRERFDEMRRMGIRTVMITGDNPLTAKAIAEEAGVDDFLAEATPEDKLALIKREQ
FT                   GGGRLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSDPTKLIEIVEIGK
FT                   QLLITRGALTTFSIANDIAKYFAIIPALFVGLFPGLDLLNIMRLHSPQSAILSAVIFNA
FT                   LVIVALIPLALRGVRYTPSSASKLLSRNLSIYGLGGIVAPFIGIKLIDLIIQFLPGMS"
FT   gene            746667..747557
FT                   /gene="kdpC"
FT                   /locus_tag="MMAR_0633"
FT   CDS_pept        746667..747557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="MMAR_0633"
FT                   /product="potassium-transporting ATPase C chain KdpC"
FT                   /note="one of the components of the high-affinity ATP-
FT                   driven potassium transport (or Kdp) system, which catalyzes
FT                   the hydrolysis of ATP coupled with the exchange of hydrogen
FT                   and potassium ions. the C subunit may be involved in
FT                   assembly of the Kdp complex. [catalytic activity: ATP +
FT                   H(2)O + K(+)(out) = ADP + phosphate + K(+)(in)]"
FT                   /db_xref="EnsemblGenomes-Gn:MMAR_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACC39094"
FT                   /db_xref="GOA:B2HPR7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B2HPR7"
FT                   /protein_id="ACC39094.1"
FT                   /translation="MKFSSFIRMHWAAFRALLVLTVIVGLGYPLLVWLVAQLPGLRDKA
FT                   DGSIVEVDGKPVGSSLIGQAFTDTDGNPLPQYFQSRPSAAGDGYDPLATSASNLGPESI
FT                   VDTPGKPSLLTQVCSRSAAIGQRDGVDGTRPFCTGGGVGAVLSVLGPRDERGAVLRPTK
FT                   VVSVNEPCETTKRPFLDVFQGVRVQCAVTGENYSTGQIVAVRGAAPDTPAVPADAVTAS
FT                   GSGLDPHISPSYADIQVDRVARARGVTPDQVRAVVGEHRDGRLFGFFGEACVNVLALNL
FT