(data stored in ACNUC7421 zone)

EMBL: CP000857

ID   CP000857; SV 1; circular; genomic DNA; STD; PRO; 4833080 BP.
XX
AC   CP000857;
XX
PR   Project:PRJNA20993;
XX
DT   04-MAR-2009 (Rel. 100, Created)
DT   04-JUN-2018 (Rel. 137, Last updated, Version 5)
XX
DE   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594,
DE   complete genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4833080
RX   DOI; 10.1371/journal.pone.0004510.
RX   PUBMED; 19229335.
RA   Liu W.Q., Feng Y., Wang Y., Zou Q.H., Chen F., Guo J.T., Peng Y.H., Jin Y.,
RA   Li Y.G., Hu S.N., Johnston R.N., Liu G.R., Liu S.L.;
RT   "Salmonella paratyphi C: genetic divergence from Salmonella choleraesuis
RT   and pathogenic convergence with Salmonella typhi";
RL   PLoS One 4(2):E4510-E4510(2009).
XX
RN   [2]
RP   1-4833080
RA   Liu G.-R., Feng Y., Liu W.-Q., Liu S.-L., Zou Q.-H., Guo J.-T., Chen F.,
RA   Huang H., Tang J., Wang C.-Z., Zhang Y.-N., Wang Y., He X.-Y., Wang L.,
RA   Peng Y.-H., Li J.-Q., Xu G.-M., Hu S.-N., Li Z.-J., Sanderson K.E.,
RA   Johnston R.N.;
RT   ;
RL   Submitted (12-OCT-2007) to the INSDC.
RL   Microbiology, Peking University Health Science Center, 38 Xueyuan Road,
RL   Beijing, Beijing 100083, China
XX
DR   MD5; 56926eb241ecfd771745f0e34f5090ca.
DR   BioSample; SAMN02603245.
DR   EnsemblGenomes-Gn; EBG00001086485.
DR   EnsemblGenomes-Gn; EBG00001086486.
DR   EnsemblGenomes-Gn; EBG00001086487.
DR   EnsemblGenomes-Gn; EBG00001086488.
DR   EnsemblGenomes-Gn; EBG00001086489.
DR   EnsemblGenomes-Gn; EBG00001086490.
DR   EnsemblGenomes-Gn; EBG00001086491.
DR   EnsemblGenomes-Gn; EBG00001086492.
DR   EnsemblGenomes-Gn; EBG00001086493.
DR   EnsemblGenomes-Gn; EBG00001086494.
DR   EnsemblGenomes-Gn; EBG00001086495.
DR   EnsemblGenomes-Gn; EBG00001086496.
DR   EnsemblGenomes-Gn; EBG00001086497.
DR   EnsemblGenomes-Gn; EBG00001086498.
DR   EnsemblGenomes-Gn; EBG00001086499.
DR   EnsemblGenomes-Gn; EBG00001086500.
DR   EnsemblGenomes-Gn; EBG00001086501.
DR   EnsemblGenomes-Gn; EBG00001086502.
DR   EnsemblGenomes-Gn; EBG00001086503.
DR   EnsemblGenomes-Gn; EBG00001086504.
DR   EnsemblGenomes-Gn; EBG00001086505.
DR   EnsemblGenomes-Gn; EBG00001086506.
DR   EnsemblGenomes-Gn; EBG00001086507.
DR   EnsemblGenomes-Gn; EBG00001086508.
DR   EnsemblGenomes-Gn; EBG00001086509.
DR   EnsemblGenomes-Gn; EBG00001086510.
DR   EnsemblGenomes-Gn; EBG00001086511.
DR   EnsemblGenomes-Gn; EBG00001086512.
DR   EnsemblGenomes-Gn; EBG00001086513.
DR   EnsemblGenomes-Gn; EBG00001086514.
DR   EnsemblGenomes-Gn; EBG00001086515.
DR   EnsemblGenomes-Gn; EBG00001086516.
DR   EnsemblGenomes-Gn; EBG00001086517.
DR   EnsemblGenomes-Gn; EBG00001086518.
DR   EnsemblGenomes-Gn; EBG00001086519.
DR   EnsemblGenomes-Gn; EBG00001086520.
DR   EnsemblGenomes-Gn; EBG00001086521.
DR   EnsemblGenomes-Gn; EBG00001086522.
DR   EnsemblGenomes-Gn; EBG00001086523.
DR   EnsemblGenomes-Gn; EBG00001086524.
DR   EnsemblGenomes-Gn; EBG00001086525.
DR   EnsemblGenomes-Gn; EBG00001086526.
DR   EnsemblGenomes-Gn; EBG00001086527.
DR   EnsemblGenomes-Gn; EBG00001086528.
DR   EnsemblGenomes-Gn; EBG00001086529.
DR   EnsemblGenomes-Gn; EBG00001086530.
DR   EnsemblGenomes-Gn; EBG00001086531.
DR   EnsemblGenomes-Gn; EBG00001086532.
DR   EnsemblGenomes-Gn; EBG00001086533.
DR   EnsemblGenomes-Gn; EBG00001086534.
DR   EnsemblGenomes-Gn; EBG00001086535.
DR   EnsemblGenomes-Gn; EBG00001086536.
DR   EnsemblGenomes-Gn; EBG00001086537.
DR   EnsemblGenomes-Gn; EBG00001086538.
DR   EnsemblGenomes-Gn; EBG00001086539.
DR   EnsemblGenomes-Gn; EBG00001086540.
DR   EnsemblGenomes-Gn; EBG00001086541.
DR   EnsemblGenomes-Gn; EBG00001086542.
DR   EnsemblGenomes-Gn; EBG00001086543.
DR   EnsemblGenomes-Gn; EBG00001086544.
DR   EnsemblGenomes-Gn; EBG00001086545.
DR   EnsemblGenomes-Gn; EBG00001086546.
DR   EnsemblGenomes-Gn; EBG00001086547.
DR   EnsemblGenomes-Gn; EBG00001086548.
DR   EnsemblGenomes-Gn; EBG00001086549.
DR   EnsemblGenomes-Gn; EBG00001086550.
DR   EnsemblGenomes-Gn; EBG00001086551.
DR   EnsemblGenomes-Gn; EBG00001086552.
DR   EnsemblGenomes-Gn; EBG00001086553.
DR   EnsemblGenomes-Gn; EBG00001086554.
DR   EnsemblGenomes-Gn; EBG00001086555.
DR   EnsemblGenomes-Gn; EBG00001086556.
DR   EnsemblGenomes-Gn; EBG00001086557.
DR   EnsemblGenomes-Gn; EBG00001086558.
DR   EnsemblGenomes-Gn; EBG00001086559.
DR   EnsemblGenomes-Gn; EBG00001086560.
DR   EnsemblGenomes-Gn; EBG00001086561.
DR   EnsemblGenomes-Gn; EBG00001086562.
DR   EnsemblGenomes-Gn; EBG00001086563.
DR   EnsemblGenomes-Gn; EBG00001086564.
DR   EnsemblGenomes-Gn; EBG00001086565.
DR   EnsemblGenomes-Gn; EBG00001086566.
DR   EnsemblGenomes-Gn; EBG00001086567.
DR   EnsemblGenomes-Gn; EBG00001086568.
DR   EnsemblGenomes-Gn; EBG00001086569.
DR   EnsemblGenomes-Gn; EBG00001086570.
DR   EnsemblGenomes-Gn; EBG00001086571.
DR   EnsemblGenomes-Gn; EBG00001086572.
DR   EnsemblGenomes-Gn; EBG00001086573.
DR   EnsemblGenomes-Gn; EBG00001086574.
DR   EnsemblGenomes-Gn; EBG00001086575.
DR   EnsemblGenomes-Gn; EBG00001086576.
DR   EnsemblGenomes-Gn; EBG00001086577.
DR   EnsemblGenomes-Gn; EBG00001086578.
DR   EnsemblGenomes-Gn; EBG00001086579.
DR   EnsemblGenomes-Gn; EBG00001086580.
DR   EnsemblGenomes-Gn; EBG00001086581.
DR   EnsemblGenomes-Gn; EBG00001086582.
DR   EnsemblGenomes-Gn; EBG00001086583.
DR   EnsemblGenomes-Gn; EBG00001086584.
DR   EnsemblGenomes-Gn; EBG00001086585.
DR   EnsemblGenomes-Gn; EBG00001086586.
DR   EnsemblGenomes-Gn; EBG00001086587.
DR   EnsemblGenomes-Gn; EBG00001086588.
DR   EnsemblGenomes-Gn; EBG00001086589.
DR   EnsemblGenomes-Gn; EBG00001086590.
DR   EnsemblGenomes-Gn; EBG00001086591.
DR   EnsemblGenomes-Gn; EBG00001086592.
DR   EnsemblGenomes-Gn; EBG00001086593.
DR   EnsemblGenomes-Gn; EBG00001086594.
DR   EnsemblGenomes-Gn; EBG00001086595.
DR   EnsemblGenomes-Gn; EBG00001086596.
DR   EnsemblGenomes-Gn; EBG00001086597.
DR   EnsemblGenomes-Gn; EBG00001086598.
DR   EnsemblGenomes-Gn; EBG00001086599.
DR   EnsemblGenomes-Gn; EBG00001086600.
DR   EnsemblGenomes-Gn; EBG00001086601.
DR   EnsemblGenomes-Gn; EBG00001086602.
DR   EnsemblGenomes-Gn; EBG00001086603.
DR   EnsemblGenomes-Gn; EBG00001086604.
DR   EnsemblGenomes-Gn; EBG00001086605.
DR   EnsemblGenomes-Gn; EBG00001086606.
DR   EnsemblGenomes-Gn; EBG00001086607.
DR   EnsemblGenomes-Gn; EBG00001086608.
DR   EnsemblGenomes-Gn; EBG00001086609.
DR   EnsemblGenomes-Gn; EBG00001086610.
DR   EnsemblGenomes-Gn; EBG00001086611.
DR   EnsemblGenomes-Gn; EBG00001086612.
DR   EnsemblGenomes-Gn; EBG00001086613.
DR   EnsemblGenomes-Gn; EBG00001086614.
DR   EnsemblGenomes-Gn; EBG00001086615.
DR   EnsemblGenomes-Gn; EBG00001086616.
DR   EnsemblGenomes-Gn; EBG00001086617.
DR   EnsemblGenomes-Gn; EBG00001086618.
DR   EnsemblGenomes-Gn; EBG00001086619.
DR   EnsemblGenomes-Gn; EBG00001086620.
DR   EnsemblGenomes-Gn; EBG00001086621.
DR   EnsemblGenomes-Gn; EBG00001086622.
DR   EnsemblGenomes-Gn; EBG00001086623.
DR   EnsemblGenomes-Gn; EBG00001086624.
DR   EnsemblGenomes-Gn; EBG00001086625.
DR   EnsemblGenomes-Gn; EBG00001086626.
DR   EnsemblGenomes-Gn; EBG00001086627.
DR   EnsemblGenomes-Gn; EBG00001086628.
DR   EnsemblGenomes-Gn; EBG00001086629.
DR   EnsemblGenomes-Gn; EBG00001086630.
DR   EnsemblGenomes-Gn; EBG00001086631.
DR   EnsemblGenomes-Gn; EBG00001086632.
DR   EnsemblGenomes-Gn; EBG00001086633.
DR   EnsemblGenomes-Gn; EBG00001086634.
DR   EnsemblGenomes-Gn; EBG00001086635.
DR   EnsemblGenomes-Gn; EBG00001086636.
DR   EnsemblGenomes-Gn; EBG00001086637.
DR   EnsemblGenomes-Gn; EBG00001086638.
DR   EnsemblGenomes-Gn; EBG00001086639.
DR   EnsemblGenomes-Gn; EBG00001086640.
DR   EnsemblGenomes-Gn; EBG00001086641.
DR   EnsemblGenomes-Gn; EBG00001086642.
DR   EnsemblGenomes-Gn; EBG00001086643.
DR   EnsemblGenomes-Gn; EBG00001086644.
DR   EnsemblGenomes-Gn; EBG00001086645.
DR   EnsemblGenomes-Gn; EBG00001086646.
DR   EnsemblGenomes-Gn; EBG00001086647.
DR   EnsemblGenomes-Gn; EBG00001086648.
DR   EnsemblGenomes-Gn; EBG00001086649.
DR   EnsemblGenomes-Gn; EBG00001086650.
DR   EnsemblGenomes-Gn; EBG00001086651.
DR   EnsemblGenomes-Gn; EBG00001086652.
DR   EnsemblGenomes-Gn; EBG00001086653.
DR   EnsemblGenomes-Gn; EBG00001086654.
DR   EnsemblGenomes-Gn; EBG00001086655.
DR   EnsemblGenomes-Gn; EBG00001086656.
DR   EnsemblGenomes-Gn; EBG00001086657.
DR   EnsemblGenomes-Gn; EBG00001086658.
DR   EnsemblGenomes-Gn; EBG00001086659.
DR   EnsemblGenomes-Gn; EBG00001086660.
DR   EnsemblGenomes-Gn; EBG00001086661.
DR   EnsemblGenomes-Gn; EBG00001086662.
DR   EnsemblGenomes-Gn; EBG00001086663.
DR   EnsemblGenomes-Gn; EBG00001086664.
DR   EnsemblGenomes-Gn; EBG00001086665.
DR   EnsemblGenomes-Gn; EBG00001086666.
DR   EnsemblGenomes-Gn; EBG00001086667.
DR   EnsemblGenomes-Gn; EBG00001086668.
DR   EnsemblGenomes-Gn; EBG00001086669.
DR   EnsemblGenomes-Gn; EBG00001086670.
DR   EnsemblGenomes-Gn; EBG00001086671.
DR   EnsemblGenomes-Gn; EBG00001086672.
DR   EnsemblGenomes-Gn; EBG00001086673.
DR   EnsemblGenomes-Gn; EBG00001086674.
DR   EnsemblGenomes-Gn; EBG00001086675.
DR   EnsemblGenomes-Gn; EBG00001086676.
DR   EnsemblGenomes-Gn; EBG00001086677.
DR   EnsemblGenomes-Gn; EBG00001086678.
DR   EnsemblGenomes-Gn; EBG00001086679.
DR   EnsemblGenomes-Gn; EBG00001086680.
DR   EnsemblGenomes-Gn; EBG00001086681.
DR   EnsemblGenomes-Gn; EBG00001086682.
DR   EnsemblGenomes-Gn; EBG00001086683.
DR   EnsemblGenomes-Gn; EBG00001086684.
DR   EnsemblGenomes-Gn; EBG00001086685.
DR   EnsemblGenomes-Gn; EBG00001086686.
DR   EnsemblGenomes-Gn; EBG00001086687.
DR   EnsemblGenomes-Gn; EBG00001086688.
DR   EnsemblGenomes-Gn; EBG00001086689.
DR   EnsemblGenomes-Gn; EBG00001086690.
DR   EnsemblGenomes-Gn; EBG00001086691.
DR   EnsemblGenomes-Gn; EBG00001086692.
DR   EnsemblGenomes-Gn; EBG00001086693.
DR   EnsemblGenomes-Gn; EBG00001086694.
DR   EnsemblGenomes-Gn; EBG00001086695.
DR   EnsemblGenomes-Gn; EBG00001086696.
DR   EnsemblGenomes-Gn; EBG00001086697.
DR   EnsemblGenomes-Gn; EBG00001086698.
DR   EnsemblGenomes-Gn; EBG00001086699.
DR   EnsemblGenomes-Gn; EBG00001086700.
DR   EnsemblGenomes-Gn; EBG00001086701.
DR   EnsemblGenomes-Gn; EBG00001086702.
DR   EnsemblGenomes-Gn; EBG00001086703.
DR   EnsemblGenomes-Gn; EBG00001086704.
DR   EnsemblGenomes-Gn; EBG00001086705.
DR   EnsemblGenomes-Gn; EBG00001086706.
DR   EnsemblGenomes-Gn; EBG00001086707.
DR   EnsemblGenomes-Gn; EBG00001086708.
DR   EnsemblGenomes-Gn; EBG00001086709.
DR   EnsemblGenomes-Gn; EBG00001086710.
DR   EnsemblGenomes-Gn; EBG00001086711.
DR   EnsemblGenomes-Gn; EBG00001086712.
DR   EnsemblGenomes-Gn; EBG00001086713.
DR   EnsemblGenomes-Gn; EBG00001086714.
DR   EnsemblGenomes-Gn; EBG00001086715.
DR   EnsemblGenomes-Gn; EBG00001086716.
DR   EnsemblGenomes-Gn; EBG00001086717.
DR   EnsemblGenomes-Gn; EBG00001086718.
DR   EnsemblGenomes-Gn; EBG00001086719.
DR   EnsemblGenomes-Gn; EBG00001086720.
DR   EnsemblGenomes-Gn; SPC_r001.
DR   EnsemblGenomes-Gn; SPC_r002.
DR   EnsemblGenomes-Gn; SPC_r003.
DR   EnsemblGenomes-Gn; SPC_r004.
DR   EnsemblGenomes-Gn; SPC_r005.
DR   EnsemblGenomes-Gn; SPC_r006.
DR   EnsemblGenomes-Gn; SPC_r007.
DR   EnsemblGenomes-Gn; SPC_r008.
DR   EnsemblGenomes-Gn; SPC_r009.
DR   EnsemblGenomes-Gn; SPC_r010.
DR   EnsemblGenomes-Gn; SPC_r011.
DR   EnsemblGenomes-Gn; SPC_r012.
DR   EnsemblGenomes-Gn; SPC_r013.
DR   EnsemblGenomes-Gn; SPC_r014.
DR   EnsemblGenomes-Gn; SPC_r015.
DR   EnsemblGenomes-Gn; SPC_r016.
DR   EnsemblGenomes-Gn; SPC_r017.
DR   EnsemblGenomes-Gn; SPC_r018.
DR   EnsemblGenomes-Gn; SPC_r019.
DR   EnsemblGenomes-Gn; SPC_r020.
DR   EnsemblGenomes-Gn; SPC_r021.
DR   EnsemblGenomes-Gn; SPC_r022.
DR   EnsemblGenomes-Gn; SPC_t001.
DR   EnsemblGenomes-Gn; SPC_t002.
DR   EnsemblGenomes-Gn; SPC_t003.
DR   EnsemblGenomes-Gn; SPC_t004.
DR   EnsemblGenomes-Gn; SPC_t005.
DR   EnsemblGenomes-Gn; SPC_t006.
DR   EnsemblGenomes-Gn; SPC_t007.
DR   EnsemblGenomes-Gn; SPC_t008.
DR   EnsemblGenomes-Gn; SPC_t009.
DR   EnsemblGenomes-Gn; SPC_t010.
DR   EnsemblGenomes-Gn; SPC_t011.
DR   EnsemblGenomes-Gn; SPC_t012.
DR   EnsemblGenomes-Gn; SPC_t013.
DR   EnsemblGenomes-Gn; SPC_t014.
DR   EnsemblGenomes-Gn; SPC_t015.
DR   EnsemblGenomes-Gn; SPC_t016.
DR   EnsemblGenomes-Gn; SPC_t017.
DR   EnsemblGenomes-Gn; SPC_t018.
DR   EnsemblGenomes-Gn; SPC_t019.
DR   EnsemblGenomes-Gn; SPC_t020.
DR   EnsemblGenomes-Gn; SPC_t021.
DR   EnsemblGenomes-Gn; SPC_t022.
DR   EnsemblGenomes-Gn; SPC_t023.
DR   EnsemblGenomes-Gn; SPC_t024.
DR   EnsemblGenomes-Gn; SPC_t025.
DR   EnsemblGenomes-Gn; SPC_t026.
DR   EnsemblGenomes-Gn; SPC_t027.
DR   EnsemblGenomes-Gn; SPC_t028.
DR   EnsemblGenomes-Gn; SPC_t029.
DR   EnsemblGenomes-Gn; SPC_t030.
DR   EnsemblGenomes-Gn; SPC_t031.
DR   EnsemblGenomes-Gn; SPC_t032.
DR   EnsemblGenomes-Gn; SPC_t033.
DR   EnsemblGenomes-Gn; SPC_t034.
DR   EnsemblGenomes-Gn; SPC_t035.
DR   EnsemblGenomes-Gn; SPC_t036.
DR   EnsemblGenomes-Gn; SPC_t037.
DR   EnsemblGenomes-Gn; SPC_t038.
DR   EnsemblGenomes-Gn; SPC_t039.
DR   EnsemblGenomes-Gn; SPC_t040.
DR   EnsemblGenomes-Gn; SPC_t041.
DR   EnsemblGenomes-Gn; SPC_t042.
DR   EnsemblGenomes-Gn; SPC_t043.
DR   EnsemblGenomes-Gn; SPC_t044.
DR   EnsemblGenomes-Gn; SPC_t045.
DR   EnsemblGenomes-Gn; SPC_t046.
DR   EnsemblGenomes-Gn; SPC_t047.
DR   EnsemblGenomes-Gn; SPC_t048.
DR   EnsemblGenomes-Gn; SPC_t049.
DR   EnsemblGenomes-Gn; SPC_t050.
DR   EnsemblGenomes-Gn; SPC_t051.
DR   EnsemblGenomes-Gn; SPC_t052.
DR   EnsemblGenomes-Gn; SPC_t053.
DR   EnsemblGenomes-Gn; SPC_t054.
DR   EnsemblGenomes-Gn; SPC_t055.
DR   EnsemblGenomes-Gn; SPC_t056.
DR   EnsemblGenomes-Gn; SPC_t057.
DR   EnsemblGenomes-Gn; SPC_t058.
DR   EnsemblGenomes-Gn; SPC_t059.
DR   EnsemblGenomes-Gn; SPC_t060.
DR   EnsemblGenomes-Gn; SPC_t061.
DR   EnsemblGenomes-Gn; SPC_t062.
DR   EnsemblGenomes-Gn; SPC_t063.
DR   EnsemblGenomes-Gn; SPC_t064.
DR   EnsemblGenomes-Gn; SPC_t065.
DR   EnsemblGenomes-Gn; SPC_t066.
DR   EnsemblGenomes-Gn; SPC_t067.
DR   EnsemblGenomes-Gn; SPC_t068.
DR   EnsemblGenomes-Gn; SPC_t069.
DR   EnsemblGenomes-Gn; SPC_t070.
DR   EnsemblGenomes-Gn; SPC_t071.
DR   EnsemblGenomes-Gn; SPC_t072.
DR   EnsemblGenomes-Gn; SPC_t073.
DR   EnsemblGenomes-Gn; SPC_t074.
DR   EnsemblGenomes-Gn; SPC_t075.
DR   EnsemblGenomes-Gn; SPC_t076.
DR   EnsemblGenomes-Gn; SPC_t077.
DR   EnsemblGenomes-Gn; SPC_t078.
DR   EnsemblGenomes-Gn; SPC_t079.
DR   EnsemblGenomes-Gn; SPC_t080.
DR   EnsemblGenomes-Gn; SPC_t081.
DR   EnsemblGenomes-Gn; SPC_t082.
DR   EnsemblGenomes-Tr; EBT00001688773.
DR   EnsemblGenomes-Tr; EBT00001688774.
DR   EnsemblGenomes-Tr; EBT00001688775.
DR   EnsemblGenomes-Tr; EBT00001688776.
DR   EnsemblGenomes-Tr; EBT00001688777.
DR   EnsemblGenomes-Tr; EBT00001688778.
DR   EnsemblGenomes-Tr; EBT00001688779.
DR   EnsemblGenomes-Tr; EBT00001688780.
DR   EnsemblGenomes-Tr; EBT00001688781.
DR   EnsemblGenomes-Tr; EBT00001688782.
DR   EnsemblGenomes-Tr; EBT00001688783.
DR   EnsemblGenomes-Tr; EBT00001688784.
DR   EnsemblGenomes-Tr; EBT00001688785.
DR   EnsemblGenomes-Tr; EBT00001688786.
DR   EnsemblGenomes-Tr; EBT00001688787.
DR   EnsemblGenomes-Tr; EBT00001688788.
DR   EnsemblGenomes-Tr; EBT00001688789.
DR   EnsemblGenomes-Tr; EBT00001688790.
DR   EnsemblGenomes-Tr; EBT00001688791.
DR   EnsemblGenomes-Tr; EBT00001688792.
DR   EnsemblGenomes-Tr; EBT00001688793.
DR   EnsemblGenomes-Tr; EBT00001688794.
DR   EnsemblGenomes-Tr; EBT00001688795.
DR   EnsemblGenomes-Tr; EBT00001688796.
DR   EnsemblGenomes-Tr; EBT00001688797.
DR   EnsemblGenomes-Tr; EBT00001688798.
DR   EnsemblGenomes-Tr; EBT00001688799.
DR   EnsemblGenomes-Tr; EBT00001688800.
DR   EnsemblGenomes-Tr; EBT00001688801.
DR   EnsemblGenomes-Tr; EBT00001688802.
DR   EnsemblGenomes-Tr; EBT00001688803.
DR   EnsemblGenomes-Tr; EBT00001688804.
DR   EnsemblGenomes-Tr; EBT00001688805.
DR   EnsemblGenomes-Tr; EBT00001688806.
DR   EnsemblGenomes-Tr; EBT00001688807.
DR   EnsemblGenomes-Tr; EBT00001688808.
DR   EnsemblGenomes-Tr; EBT00001688809.
DR   EnsemblGenomes-Tr; EBT00001688810.
DR   EnsemblGenomes-Tr; EBT00001688811.
DR   EnsemblGenomes-Tr; EBT00001688812.
DR   EnsemblGenomes-Tr; EBT00001688813.
DR   EnsemblGenomes-Tr; EBT00001688814.
DR   EnsemblGenomes-Tr; EBT00001688815.
DR   EnsemblGenomes-Tr; EBT00001688816.
DR   EnsemblGenomes-Tr; EBT00001688817.
DR   EnsemblGenomes-Tr; EBT00001688818.
DR   EnsemblGenomes-Tr; EBT00001688819.
DR   EnsemblGenomes-Tr; EBT00001688820.
DR   EnsemblGenomes-Tr; EBT00001688821.
DR   EnsemblGenomes-Tr; EBT00001688822.
DR   EnsemblGenomes-Tr; EBT00001688823.
DR   EnsemblGenomes-Tr; EBT00001688824.
DR   EnsemblGenomes-Tr; EBT00001688825.
DR   EnsemblGenomes-Tr; EBT00001688826.
DR   EnsemblGenomes-Tr; EBT00001688827.
DR   EnsemblGenomes-Tr; EBT00001688828.
DR   EnsemblGenomes-Tr; EBT00001688829.
DR   EnsemblGenomes-Tr; EBT00001688830.
DR   EnsemblGenomes-Tr; EBT00001688831.
DR   EnsemblGenomes-Tr; EBT00001688832.
DR   EnsemblGenomes-Tr; EBT00001688833.
DR   EnsemblGenomes-Tr; EBT00001688834.
DR   EnsemblGenomes-Tr; EBT00001688835.
DR   EnsemblGenomes-Tr; EBT00001688836.
DR   EnsemblGenomes-Tr; EBT00001688837.
DR   EnsemblGenomes-Tr; EBT00001688838.
DR   EnsemblGenomes-Tr; EBT00001688839.
DR   EnsemblGenomes-Tr; EBT00001688840.
DR   EnsemblGenomes-Tr; EBT00001688841.
DR   EnsemblGenomes-Tr; EBT00001688842.
DR   EnsemblGenomes-Tr; EBT00001688843.
DR   EnsemblGenomes-Tr; EBT00001688844.
DR   EnsemblGenomes-Tr; EBT00001688845.
DR   EnsemblGenomes-Tr; EBT00001688846.
DR   EnsemblGenomes-Tr; EBT00001688847.
DR   EnsemblGenomes-Tr; EBT00001688848.
DR   EnsemblGenomes-Tr; EBT00001688849.
DR   EnsemblGenomes-Tr; EBT00001688850.
DR   EnsemblGenomes-Tr; EBT00001688851.
DR   EnsemblGenomes-Tr; EBT00001688852.
DR   EnsemblGenomes-Tr; EBT00001688853.
DR   EnsemblGenomes-Tr; EBT00001688854.
DR   EnsemblGenomes-Tr; EBT00001688855.
DR   EnsemblGenomes-Tr; EBT00001688856.
DR   EnsemblGenomes-Tr; EBT00001688857.
DR   EnsemblGenomes-Tr; EBT00001688858.
DR   EnsemblGenomes-Tr; EBT00001688859.
DR   EnsemblGenomes-Tr; EBT00001688860.
DR   EnsemblGenomes-Tr; EBT00001688861.
DR   EnsemblGenomes-Tr; EBT00001688862.
DR   EnsemblGenomes-Tr; EBT00001688863.
DR   EnsemblGenomes-Tr; EBT00001688864.
DR   EnsemblGenomes-Tr; EBT00001688865.
DR   EnsemblGenomes-Tr; EBT00001688866.
DR   EnsemblGenomes-Tr; EBT00001688867.
DR   EnsemblGenomes-Tr; EBT00001688868.
DR   EnsemblGenomes-Tr; EBT00001688869.
DR   EnsemblGenomes-Tr; EBT00001688870.
DR   EnsemblGenomes-Tr; EBT00001688871.
DR   EnsemblGenomes-Tr; EBT00001688872.
DR   EnsemblGenomes-Tr; EBT00001688873.
DR   EnsemblGenomes-Tr; EBT00001688874.
DR   EnsemblGenomes-Tr; EBT00001688876.
DR   EnsemblGenomes-Tr; EBT00001688878.
DR   EnsemblGenomes-Tr; EBT00001688880.
DR   EnsemblGenomes-Tr; EBT00001688881.
DR   EnsemblGenomes-Tr; EBT00001688883.
DR   EnsemblGenomes-Tr; EBT00001688885.
DR   EnsemblGenomes-Tr; EBT00001688887.
DR   EnsemblGenomes-Tr; EBT00001688888.
DR   EnsemblGenomes-Tr; EBT00001688890.
DR   EnsemblGenomes-Tr; EBT00001688892.
DR   EnsemblGenomes-Tr; EBT00001688894.
DR   EnsemblGenomes-Tr; EBT00001688895.
DR   EnsemblGenomes-Tr; EBT00001688897.
DR   EnsemblGenomes-Tr; EBT00001688898.
DR   EnsemblGenomes-Tr; EBT00001688900.
DR   EnsemblGenomes-Tr; EBT00001688901.
DR   EnsemblGenomes-Tr; EBT00001688902.
DR   EnsemblGenomes-Tr; EBT00001688904.
DR   EnsemblGenomes-Tr; EBT00001688906.
DR   EnsemblGenomes-Tr; EBT00001688908.
DR   EnsemblGenomes-Tr; EBT00001688911.
DR   EnsemblGenomes-Tr; EBT00001688913.
DR   EnsemblGenomes-Tr; EBT00001688914.
DR   EnsemblGenomes-Tr; EBT00001688916.
DR   EnsemblGenomes-Tr; EBT00001688918.
DR   EnsemblGenomes-Tr; EBT00001688920.
DR   EnsemblGenomes-Tr; EBT00001688923.
DR   EnsemblGenomes-Tr; EBT00001688925.
DR   EnsemblGenomes-Tr; EBT00001688927.
DR   EnsemblGenomes-Tr; EBT00001688929.
DR   EnsemblGenomes-Tr; EBT00001688931.
DR   EnsemblGenomes-Tr; EBT00001688933.
DR   EnsemblGenomes-Tr; EBT00001688934.
DR   EnsemblGenomes-Tr; EBT00001688935.
DR   EnsemblGenomes-Tr; EBT00001688936.
DR   EnsemblGenomes-Tr; EBT00001688939.
DR   EnsemblGenomes-Tr; EBT00001688941.
DR   EnsemblGenomes-Tr; EBT00001688942.
DR   EnsemblGenomes-Tr; EBT00001688945.
DR   EnsemblGenomes-Tr; EBT00001688948.
DR   EnsemblGenomes-Tr; EBT00001688950.
DR   EnsemblGenomes-Tr; EBT00001688952.
DR   EnsemblGenomes-Tr; EBT00001688954.
DR   EnsemblGenomes-Tr; EBT00001688956.
DR   EnsemblGenomes-Tr; EBT00001688957.
DR   EnsemblGenomes-Tr; EBT00001688958.
DR   EnsemblGenomes-Tr; EBT00001688960.
DR   EnsemblGenomes-Tr; EBT00001688961.
DR   EnsemblGenomes-Tr; EBT00001688962.
DR   EnsemblGenomes-Tr; EBT00001688963.
DR   EnsemblGenomes-Tr; EBT00001688965.
DR   EnsemblGenomes-Tr; EBT00001688966.
DR   EnsemblGenomes-Tr; EBT00001688967.
DR   EnsemblGenomes-Tr; EBT00001688969.
DR   EnsemblGenomes-Tr; EBT00001688972.
DR   EnsemblGenomes-Tr; EBT00001688973.
DR   EnsemblGenomes-Tr; EBT00001688974.
DR   EnsemblGenomes-Tr; EBT00001688977.
DR   EnsemblGenomes-Tr; EBT00001688979.
DR   EnsemblGenomes-Tr; EBT00001688982.
DR   EnsemblGenomes-Tr; EBT00001688985.
DR   EnsemblGenomes-Tr; EBT00001688987.
DR   EnsemblGenomes-Tr; EBT00001688990.
DR   EnsemblGenomes-Tr; EBT00001688992.
DR   EnsemblGenomes-Tr; EBT00001688996.
DR   EnsemblGenomes-Tr; EBT00001688998.
DR   EnsemblGenomes-Tr; EBT00001689001.
DR   EnsemblGenomes-Tr; EBT00001689003.
DR   EnsemblGenomes-Tr; EBT00001689005.
DR   EnsemblGenomes-Tr; EBT00001689006.
DR   EnsemblGenomes-Tr; EBT00001689007.
DR   EnsemblGenomes-Tr; EBT00001689008.
DR   EnsemblGenomes-Tr; EBT00001689009.
DR   EnsemblGenomes-Tr; EBT00001689010.
DR   EnsemblGenomes-Tr; EBT00001689011.
DR   EnsemblGenomes-Tr; EBT00001689012.
DR   EnsemblGenomes-Tr; EBT00001689013.
DR   EnsemblGenomes-Tr; EBT00001689014.
DR   EnsemblGenomes-Tr; EBT00001689015.
DR   EnsemblGenomes-Tr; EBT00001689018.
DR   EnsemblGenomes-Tr; EBT00001689020.
DR   EnsemblGenomes-Tr; EBT00001689021.
DR   EnsemblGenomes-Tr; EBT00001689022.
DR   EnsemblGenomes-Tr; EBT00001689023.
DR   EnsemblGenomes-Tr; EBT00001689024.
DR   EnsemblGenomes-Tr; EBT00001689025.
DR   EnsemblGenomes-Tr; EBT00001689026.
DR   EnsemblGenomes-Tr; EBT00001689027.
DR   EnsemblGenomes-Tr; EBT00001689028.
DR   EnsemblGenomes-Tr; EBT00001689029.
DR   EnsemblGenomes-Tr; EBT00001689030.
DR   EnsemblGenomes-Tr; EBT00001689031.
DR   EnsemblGenomes-Tr; EBT00001689032.
DR   EnsemblGenomes-Tr; EBT00001689033.
DR   EnsemblGenomes-Tr; EBT00001689034.
DR   EnsemblGenomes-Tr; EBT00001689035.
DR   EnsemblGenomes-Tr; EBT00001689036.
DR   EnsemblGenomes-Tr; EBT00001689037.
DR   EnsemblGenomes-Tr; EBT00001689038.
DR   EnsemblGenomes-Tr; EBT00001689039.
DR   EnsemblGenomes-Tr; EBT00001689040.
DR   EnsemblGenomes-Tr; EBT00001689041.
DR   EnsemblGenomes-Tr; EBT00001689042.
DR   EnsemblGenomes-Tr; EBT00001689043.
DR   EnsemblGenomes-Tr; EBT00001689044.
DR   EnsemblGenomes-Tr; EBT00001689045.
DR   EnsemblGenomes-Tr; EBT00001689046.
DR   EnsemblGenomes-Tr; EBT00001689047.
DR   EnsemblGenomes-Tr; EBT00001689048.
DR   EnsemblGenomes-Tr; EBT00001689049.
DR   EnsemblGenomes-Tr; EBT00001689050.
DR   EnsemblGenomes-Tr; EBT00001689051.
DR   EnsemblGenomes-Tr; EBT00001689052.
DR   EnsemblGenomes-Tr; EBT00001689053.
DR   EnsemblGenomes-Tr; EBT00001689054.
DR   EnsemblGenomes-Tr; EBT00001689055.
DR   EnsemblGenomes-Tr; EBT00001689056.
DR   EnsemblGenomes-Tr; EBT00001689057.
DR   EnsemblGenomes-Tr; EBT00001689058.
DR   EnsemblGenomes-Tr; EBT00001689059.
DR   EnsemblGenomes-Tr; EBT00001689060.
DR   EnsemblGenomes-Tr; EBT00001689061.
DR   EnsemblGenomes-Tr; EBT00001689062.
DR   EnsemblGenomes-Tr; EBT00001689063.
DR   EnsemblGenomes-Tr; EBT00001689064.
DR   EnsemblGenomes-Tr; EBT00001689065.
DR   EnsemblGenomes-Tr; EBT00001689066.
DR   EnsemblGenomes-Tr; EBT00001689067.
DR   EnsemblGenomes-Tr; EBT00001689068.
DR   EnsemblGenomes-Tr; EBT00001689069.
DR   EnsemblGenomes-Tr; EBT00001689070.
DR   EnsemblGenomes-Tr; EBT00001689071.
DR   EnsemblGenomes-Tr; EBT00001689072.
DR   EnsemblGenomes-Tr; EBT00001689073.
DR   EnsemblGenomes-Tr; SPC_r001-1.
DR   EnsemblGenomes-Tr; SPC_r002-1.
DR   EnsemblGenomes-Tr; SPC_r003-1.
DR   EnsemblGenomes-Tr; SPC_r004-1.
DR   EnsemblGenomes-Tr; SPC_r005-1.
DR   EnsemblGenomes-Tr; SPC_r006-1.
DR   EnsemblGenomes-Tr; SPC_r007-1.
DR   EnsemblGenomes-Tr; SPC_r008-1.
DR   EnsemblGenomes-Tr; SPC_r009-1.
DR   EnsemblGenomes-Tr; SPC_r010-1.
DR   EnsemblGenomes-Tr; SPC_r011-1.
DR   EnsemblGenomes-Tr; SPC_r012-1.
DR   EnsemblGenomes-Tr; SPC_r013-1.
DR   EnsemblGenomes-Tr; SPC_r014-1.
DR   EnsemblGenomes-Tr; SPC_r015-1.
DR   EnsemblGenomes-Tr; SPC_r016-1.
DR   EnsemblGenomes-Tr; SPC_r017-1.
DR   EnsemblGenomes-Tr; SPC_r018-1.
DR   EnsemblGenomes-Tr; SPC_r019-1.
DR   EnsemblGenomes-Tr; SPC_r020-1.
DR   EnsemblGenomes-Tr; SPC_r021-1.
DR   EnsemblGenomes-Tr; SPC_r022-1.
DR   EnsemblGenomes-Tr; SPC_t001-1.
DR   EnsemblGenomes-Tr; SPC_t002-1.
DR   EnsemblGenomes-Tr; SPC_t003-1.
DR   EnsemblGenomes-Tr; SPC_t004-1.
DR   EnsemblGenomes-Tr; SPC_t005-1.
DR   EnsemblGenomes-Tr; SPC_t006-1.
DR   EnsemblGenomes-Tr; SPC_t007-1.
DR   EnsemblGenomes-Tr; SPC_t008-1.
DR   EnsemblGenomes-Tr; SPC_t009-1.
DR   EnsemblGenomes-Tr; SPC_t010-1.
DR   EnsemblGenomes-Tr; SPC_t011-1.
DR   EnsemblGenomes-Tr; SPC_t012-1.
DR   EnsemblGenomes-Tr; SPC_t013-1.
DR   EnsemblGenomes-Tr; SPC_t014-1.
DR   EnsemblGenomes-Tr; SPC_t015-1.
DR   EnsemblGenomes-Tr; SPC_t016-1.
DR   EnsemblGenomes-Tr; SPC_t017-1.
DR   EnsemblGenomes-Tr; SPC_t018-1.
DR   EnsemblGenomes-Tr; SPC_t019-1.
DR   EnsemblGenomes-Tr; SPC_t020-1.
DR   EnsemblGenomes-Tr; SPC_t021-1.
DR   EnsemblGenomes-Tr; SPC_t022-1.
DR   EnsemblGenomes-Tr; SPC_t023-1.
DR   EnsemblGenomes-Tr; SPC_t024-1.
DR   EnsemblGenomes-Tr; SPC_t025-1.
DR   EnsemblGenomes-Tr; SPC_t026-1.
DR   EnsemblGenomes-Tr; SPC_t027-1.
DR   EnsemblGenomes-Tr; SPC_t028-1.
DR   EnsemblGenomes-Tr; SPC_t029-1.
DR   EnsemblGenomes-Tr; SPC_t030-1.
DR   EnsemblGenomes-Tr; SPC_t031-1.
DR   EnsemblGenomes-Tr; SPC_t032-1.
DR   EnsemblGenomes-Tr; SPC_t033-1.
DR   EnsemblGenomes-Tr; SPC_t034-1.
DR   EnsemblGenomes-Tr; SPC_t035-1.
DR   EnsemblGenomes-Tr; SPC_t036-1.
DR   EnsemblGenomes-Tr; SPC_t037-1.
DR   EnsemblGenomes-Tr; SPC_t038-1.
DR   EnsemblGenomes-Tr; SPC_t039-1.
DR   EnsemblGenomes-Tr; SPC_t040-1.
DR   EnsemblGenomes-Tr; SPC_t041-1.
DR   EnsemblGenomes-Tr; SPC_t042-1.
DR   EnsemblGenomes-Tr; SPC_t043-1.
DR   EnsemblGenomes-Tr; SPC_t044-1.
DR   EnsemblGenomes-Tr; SPC_t045-1.
DR   EnsemblGenomes-Tr; SPC_t046-1.
DR   EnsemblGenomes-Tr; SPC_t047-1.
DR   EnsemblGenomes-Tr; SPC_t048-1.
DR   EnsemblGenomes-Tr; SPC_t049-1.
DR   EnsemblGenomes-Tr; SPC_t050-1.
DR   EnsemblGenomes-Tr; SPC_t051-1.
DR   EnsemblGenomes-Tr; SPC_t052-1.
DR   EnsemblGenomes-Tr; SPC_t053-1.
DR   EnsemblGenomes-Tr; SPC_t054-1.
DR   EnsemblGenomes-Tr; SPC_t055-1.
DR   EnsemblGenomes-Tr; SPC_t056-1.
DR   EnsemblGenomes-Tr; SPC_t057-1.
DR   EnsemblGenomes-Tr; SPC_t058-1.
DR   EnsemblGenomes-Tr; SPC_t059-1.
DR   EnsemblGenomes-Tr; SPC_t060-1.
DR   EnsemblGenomes-Tr; SPC_t061-1.
DR   EnsemblGenomes-Tr; SPC_t062-1.
DR   EnsemblGenomes-Tr; SPC_t063-1.
DR   EnsemblGenomes-Tr; SPC_t064-1.
DR   EnsemblGenomes-Tr; SPC_t065-1.
DR   EnsemblGenomes-Tr; SPC_t066-1.
DR   EnsemblGenomes-Tr; SPC_t067-1.
DR   EnsemblGenomes-Tr; SPC_t068-1.
DR   EnsemblGenomes-Tr; SPC_t069-1.
DR   EnsemblGenomes-Tr; SPC_t070-1.
DR   EnsemblGenomes-Tr; SPC_t071-1.
DR   EnsemblGenomes-Tr; SPC_t072-1.
DR   EnsemblGenomes-Tr; SPC_t073-1.
DR   EnsemblGenomes-Tr; SPC_t074-1.
DR   EnsemblGenomes-Tr; SPC_t075-1.
DR   EnsemblGenomes-Tr; SPC_t076-1.
DR   EnsemblGenomes-Tr; SPC_t077-1.
DR   EnsemblGenomes-Tr; SPC_t078-1.
DR   EnsemblGenomes-Tr; SPC_t079-1.
DR   EnsemblGenomes-Tr; SPC_t080-1.
DR   EnsemblGenomes-Tr; SPC_t081-1.
DR   EnsemblGenomes-Tr; SPC_t082-1.
DR   EuropePMC; PMC2640428; 19229335.
DR   EuropePMC; PMC3022927; 21192789.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC4042001; 24885207.
DR   EuropePMC; PMC5007712; 27605332.
DR   EuropePMC; PMC5320704; 28348832.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01386; isrB.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01389; isrF.
DR   RFAM; RF01390; isrG.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000857.
DR   SILVA-SSU; CP000857.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4833080
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Paratyphi C str. RKS4594"
FT                   /sub_species="enterica"
FT                   /strain="RKS4594"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Paratyphi C"
FT                   /db_xref="taxon:476213"
FT   gene            190..255
FT                   /gene="thrL"
FT                   /locus_tag="SPC_0001"
FT   CDS_pept        190..255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="SPC_0001"
FT                   /product="thr operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44196"
FT                   /db_xref="GOA:C0Q4E1"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4E1"
FT                   /protein_id="ACN44196.1"
FT                   /translation="MNRISTTTITTITITTGNGAG"
FT   gene            337..2799
FT                   /gene="thrA"
FT                   /locus_tag="SPC_0002"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SPC_0002"
FT                   /product="bifunctional aspartokinase I/homoserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44197"
FT                   /db_xref="GOA:C0Q4E2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E2"
FT                   /protein_id="ACN44197.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVSDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPDEFDASGDVTTFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2801..3730
FT                   /gene="thrB"
FT                   /locus_tag="SPC_0003"
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="SPC_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44198"
FT                   /db_xref="GOA:C0Q4E3"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4E3"
FT                   /protein_id="ACN44198.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3734..5020
FT                   /gene="thrC"
FT                   /locus_tag="SPC_0004"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SPC_0004"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44199"
FT                   /db_xref="GOA:C0Q4E4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E4"
FT                   /protein_id="ACN44199.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5114..5887)
FT                   /gene="yaaA"
FT                   /locus_tag="SPC_0005"
FT   CDS_pept        complement(5114..5887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="SPC_0005"
FT                   /product="yaaA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44200"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4E5"
FT                   /protein_id="ACN44200.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
FT   gene            complement(5966..7396)
FT                   /gene="yaaJ"
FT                   /locus_tag="SPC_0006"
FT   CDS_pept        complement(5966..7396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="SPC_0006"
FT                   /product="putative amino-acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44201"
FT                   /db_xref="GOA:C0Q4E6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E6"
FT                   /protein_id="ACN44201.1"
FT                   /translation="MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFGR
FT                   SLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIGMA
FT                   TSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNSVQA
FT                   NAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPIIALLWVAGSVFI
FT                   CLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMGSTPNA
FT                   AAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQLLQHAM
FT                   VSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLATLGMVIA
FT                   GTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGVRPQFDPRRF
FT                   PDIEPQLAPDTWEAASRD"
FT   gene            7665..8618
FT                   /gene="talB"
FT                   /locus_tag="SPC_0007"
FT   CDS_pept        7665..8618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="SPC_0007"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44202"
FT                   /db_xref="GOA:C0Q4E7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E7"
FT                   /protein_id="ACN44202.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8729..9319
FT                   /gene="mogA"
FT                   /locus_tag="SPC_0008"
FT   CDS_pept        8729..9319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="SPC_0008"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44203"
FT                   /db_xref="GOA:C0Q4E8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E8"
FT                   /protein_id="ACN44203.1"
FT                   /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRR
FT                   LIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVVAFRPKSARRENMSS"
FT   gene            complement(9376..9942)
FT                   /gene="yaaH"
FT                   /locus_tag="SPC_0009"
FT   CDS_pept        complement(9376..9942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="SPC_0009"
FT                   /product="yaaH"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44204"
FT                   /db_xref="GOA:C0Q4E9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4E9"
FT                   /protein_id="ACN44204.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   gene            complement(10092..10805)
FT                   /gene="htgA"
FT                   /locus_tag="SPC_0010"
FT   CDS_pept        complement(10092..10805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="SPC_0010"
FT                   /product="htgA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44205"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F0"
FT                   /protein_id="ACN44205.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   gene            complement(10841..11236)
FT                   /gene="yaaI"
FT                   /locus_tag="SPC_0011"
FT   CDS_pept        complement(10841..11236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="SPC_0011"
FT                   /product="yaaI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44206"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F1"
FT                   /protein_id="ACN44206.1"
FT                   /translation="MLTISASLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLKIPV
FT                   CRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNK
FT                   RCVSKITFSGHTVNSSDMARLKVIGDD"
FT   gene            11348..11476
FT                   /locus_tag="SPC_0012"
FT   CDS_pept        11348..11476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44207"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F2"
FT                   /protein_id="ACN44207.1"
FT                   /translation="MNSIRFLIYFMNIYLSGFPSRPLVTKKFFHLPLDDVGYDPIL"
FT   gene            11593..13509
FT                   /gene="dnaK"
FT                   /locus_tag="SPC_0013"
FT   CDS_pept        11593..13509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SPC_0013"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44208"
FT                   /db_xref="GOA:C0Q4F3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4F3"
FT                   /protein_id="ACN44208.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALNALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13595..14734
FT                   /gene="dnaJ"
FT                   /locus_tag="SPC_0014"
FT   CDS_pept        13595..14734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SPC_0014"
FT                   /product="DnaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44209"
FT                   /db_xref="GOA:C0Q4F4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4F4"
FT                   /protein_id="ACN44209.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            14845..14958
FT                   /locus_tag="SPC_0015"
FT   CDS_pept        14845..14958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44210"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F5"
FT                   /protein_id="ACN44210.1"
FT                   /translation="MFLLINKLMLISSFVYAYSLKKRDVMTLMIAFLDAVN"
FT   gene            15014..15961
FT                   /locus_tag="SPC_0016"
FT   CDS_pept        15014..15961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0016"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44211"
FT                   /db_xref="GOA:C0Q4F6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F6"
FT                   /protein_id="ACN44211.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFTVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDE
FT                   LYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPPPELAL
FT                   KSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16088..16432
FT                   /locus_tag="SPC_0017"
FT   CDS_pept        16088..16432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44212"
FT                   /db_xref="GOA:C0Q4F7"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F7"
FT                   /protein_id="ACN44212.1"
FT                   /translation="MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEYN
FT                   SSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRI
FT                   KKIIEGNNSD"
FT   gene            complement(16493..17026)
FT                   /locus_tag="SPC_0018"
FT   CDS_pept        complement(16493..17026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44213"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F8"
FT                   /protein_id="ACN44213.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   gene            complement(17043..17486)
FT                   /locus_tag="SPC_0019"
FT   CDS_pept        complement(17043..17486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44214"
FT                   /db_xref="GOA:C0Q4F9"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4F9"
FT                   /protein_id="ACN44214.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   gene            17861..19966
FT                   /locus_tag="SPC_0020"
FT   CDS_pept        17861..19966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0020"
FT                   /product="putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44215"
FT                   /db_xref="GOA:C0Q4G0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G0"
FT                   /protein_id="ACN44215.1"
FT                   /translation="MKMATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVY
FT                   NKYKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITG
FT                   FRKIDTEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSN
FT                   AKGLLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFK
FT                   QFPMFSEVDIDWEYPNNEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASA
FT                   VTTIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDH
FT                   LLAEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVI
FT                   YSYLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGG
FT                   VFTWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNH
FT                   APKAAIELIVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVS
FT                   EKTAFQFTLFVLDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPA
FT                   EDDTPADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGA
FT                   WTDLGAY"
FT   gene            20058..23054
FT                   /locus_tag="SPC_0021"
FT   CDS_pept        20058..23054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0021"
FT                   /product="putative hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44216"
FT                   /db_xref="GOA:C0Q4G1"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G1"
FT                   /protein_id="ACN44216.1"
FT                   /translation="MTISIHASAFDVNSWYQKITLTFINESGNAVDMNHAAISFTASGH
FT                   IDPWGNSGGTLKGNLPLTLNESSYGTLETNNIIINNSDALLLQPGERGTLSFSLAATQV
FT                   PVKMSAITLTLASSSSEDAESETPSDQETPAIPAADEQPAEPDVPEKDNDLQEHGLTLN
FT                   VSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQAVTLA
FT                   SDGGWPIEKNTITINHDGALMLAAGDTAELQCYLAATQTPVAISDLNATLAHDPARQGK
FT                   VCVHFPAMTQTVALKPVIELLFPAGETRRFVGEWGEVLTIGDLSAGTYRLTVPVLANDE
FT                   MQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTVEIADATQ
FT                   ADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFIAAPIQLTGFIPAAAQVAEVA
FT                   VAYQQSALDTASFVTVDATILGLPDGVAPQRYLFSSGKYQYSLMLESGSDRQTLALRFA
FT                   PGLYDVQTDDIFIDSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGV
FT                   TVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYATLPIHKTVALV
FT                   RQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQCLAAQSYKDETH
FT                   PVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALPAMAGFIVPSLPTF
FT                   SDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTADPVAEGQAIAEFIYE
FT                   LGVYSGEYAPDFIAFDKFERDCFSPDALAHYGWNATCWLNYLAMVKQVTKALLTPAMLW
FT                   QIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVP
FT                   TVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITTIHSNGEDGGWLADKMVE
FT                   YYAAPRYFR"
FT   gene            23335..24039
FT                   /locus_tag="SPC_0022"
FT   CDS_pept        23335..24039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44217"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G2"
FT                   /protein_id="ACN44217.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            24469..25011
FT                   /gene="bcfA"
FT                   /locus_tag="SPC_0023"
FT   CDS_pept        24469..25011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfA"
FT                   /locus_tag="SPC_0023"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44218"
FT                   /db_xref="GOA:C0Q4G3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G3"
FT                   /protein_id="ACN44218.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
FT   gene            25040..25798
FT                   /gene="bcfB"
FT                   /locus_tag="SPC_0024"
FT   CDS_pept        25040..25798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfB"
FT                   /locus_tag="SPC_0024"
FT                   /product="fimbrial chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44219"
FT                   /db_xref="GOA:C0Q4G4"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G4"
FT                   /protein_id="ACN44219.1"
FT                   /translation="MGGEKGALRASLRVTNRRHQDITQMKKNVPIFLRLLLLLSAAGLS
FT                   FAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRSTDFIITPP
FT                   LFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIATQSVIKL
FT                   FIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMVPPKGA
FT                   ITLPATPGQVSLRTVNDFGATTPARVCPAS"
FT   gene            25803..28424
FT                   /pseudo
FT                   /gene="bcfC"
FT                   /locus_tag="SPC_0025"
FT                   /note="stop compared to STM0023 in Salmonella typhimurium
FT                   LT2"
FT   gene            28425..29432
FT                   /gene="bcfD"
FT                   /locus_tag="SPC_0026"
FT   CDS_pept        28425..29432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfD"
FT                   /locus_tag="SPC_0026"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44220"
FT                   /db_xref="GOA:C0Q4G5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G5"
FT                   /protein_id="ACN44220.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAHADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGASTYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLELQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVREKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDVQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            29472..29978
FT                   /gene="bcfE"
FT                   /locus_tag="SPC_0027"
FT   CDS_pept        29472..29978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfE"
FT                   /locus_tag="SPC_0027"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44221"
FT                   /db_xref="GOA:C0Q4G6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G6"
FT                   /protein_id="ACN44221.1"
FT                   /translation="MLCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLGQFA
FT                   VGDFPSTGTTTKFKPFNINLKNCSRGIAGAKIWFTGEPDPDNPALLAITDTGMGSGNML
FT                   ASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAVMYF
FT                   DMQYE"
FT   gene            29994..30512
FT                   /gene="bcfF"
FT                   /locus_tag="SPC_0028"
FT   CDS_pept        29994..30512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfF"
FT                   /locus_tag="SPC_0028"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44222"
FT                   /db_xref="GOA:C0Q4G7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G7"
FT                   /protein_id="ACN44222.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANA
FT                   SATFILAYE"
FT   gene            30544..31209
FT                   /gene="bcfG"
FT                   /locus_tag="SPC_0029"
FT   CDS_pept        30544..31209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfG"
FT                   /locus_tag="SPC_0029"
FT                   /product="fimbrial chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44223"
FT                   /db_xref="GOA:C0Q4G8"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G8"
FT                   /protein_id="ACN44223.1"
FT                   /translation="MLPISWAQAGVVIGGTRFIYHAGAPALSVPVSNHSEASWLIDTHI
FT                   LPGGRWPGTKNEGNIMPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFTLSIAAI
FT                   PSGKPEANRVQMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTL
FT                   FLLRANERAQDNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGQVMTEQTVDLTRIH"
FT   gene            31273..32118
FT                   /gene="bcfH"
FT                   /locus_tag="SPC_0030"
FT   CDS_pept        31273..32118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfH"
FT                   /locus_tag="SPC_0030"
FT                   /product="bcfH"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44224"
FT                   /db_xref="GOA:C0Q4G9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4G9"
FT                   /protein_id="ACN44224.1"
FT                   /translation="MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIV
FT                   SHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSV
FT                   GPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAAR
FT                   VGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSG
FT                   AVHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG
FT                   "
FT   gene            32166..32444
FT                   /locus_tag="SPC_0031"
FT   CDS_pept        32166..32444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44225"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H0"
FT                   /protein_id="ACN44225.1"
FT                   /translation="MRCVIPVILLSFIVHEGTAKPTAQIHFMGSVVEAGCWNDVGTLEI
FT                   QCHNKEGVERYIIVENIITPISSPHATVKRDYLDEDKQLTVLRIVYD"
FT   gene            complement(32544..32993)
FT                   /locus_tag="SPC_0032"
FT   CDS_pept        complement(32544..32993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44226"
FT                   /db_xref="GOA:C0Q4H1"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H1"
FT                   /protein_id="ACN44226.1"
FT                   /translation="MRQHKINNEFIYNESLREITSLRSNAAFKMTFMRAWCLSYLIENA
FT                   HQELIIREGVAYAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKIDE
FT                   RFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
FT   gene            33791..33952
FT                   /locus_tag="SPC_0033"
FT   CDS_pept        33791..33952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0033"
FT                   /product="putative arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44227"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H2"
FT                   /protein_id="ACN44227.1"
FT                   /translation="MNQKIDTDNAMVQNHNAIYQQLLDQIREDNTYTHAVITLNPYGTA
FT                   PLSLYPGV"
FT   gene            33977..34324
FT                   /locus_tag="SPC_0034"
FT   CDS_pept        33977..34324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44228"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H3"
FT                   /protein_id="ACN44228.1"
FT                   /translation="MEFLVFDNGNYRFREDNINLPPPGNDRMRVVLFTDVVNTHGVIRN
FT                   DVIDMFHIISNCLRGLQPFNVFDIFTFREVKSATAFTDKGVSATVLNVLSATCLPLISN
FT                   STIRCPSGFVL"
FT   gene            complement(34455..34574)
FT                   /locus_tag="SPC_0035"
FT   CDS_pept        complement(34455..34574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44229"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H4"
FT                   /protein_id="ACN44229.1"
FT                   /translation="MQLYRCKQYLKTCQHSHHNNGALHHTIIDMTMITCSAMF"
FT   gene            35070..35672
FT                   /locus_tag="SPC_0036"
FT   CDS_pept        35070..35672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44230"
FT                   /db_xref="GOA:C0Q4H5"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H5"
FT                   /protein_id="ACN44230.1"
FT                   /translation="MWKVTADFGVNFKEAEFYSFIESNVLNHAVAGRNHTVSAMTHVRL
FT                   FDSDYTFFGKIYGQWDNSWGDDLDMFYGAGYLGWSGSWGFFKPYIGLHNQSGDYVSQKY
FT                   GQTSGWNGYVIGWTAAYNFNLFGEDFVLSDWNEIELDRNDAYTEQQFGRNGLNGGLTLA
FT                   WKFYPRWKATVTYRYFANKLGYDGYGDQMIYMVGYSF"
FT   gene            35693..37185
FT                   /pseudo
FT                   /locus_tag="SPC_0037"
FT                   /note="frameshift compared to STM0035 in Salmonella
FT                   typhimurium LT2"
FT   gene            37313..38485
FT                   /gene="aslB"
FT                   /locus_tag="SPC_0038"
FT   CDS_pept        37313..38485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aslB"
FT                   /locus_tag="SPC_0038"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44231"
FT                   /db_xref="GOA:C0Q4H6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H6"
FT                   /protein_id="ACN44231.1"
FT                   /translation="MIKPTGSVCNLDCKYCFYLEKEMLYPDRKNHYKMTEETLALFVQQ
FT                   HIAAQDVDEVIFAWQGGEPTLMGLPFYRQAVALQQRYANGKAIVNTFQTNGILIDDEWA
FT                   RFFRAHDFLVGISIDGDAALHDEWRVTRAGQPTHHKVEQAIKCLASHGVEFNTLTVVSQ
FT                   SNMLHPQRVYAYLKSIGSRYMQFIPLVERAANKDGMLAHPQDEQTAVTPWSVDGLQFGK
FT                   FLNAIFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPVCGSAFAMEMNGDVYNCD
FT                   HFVYPQYKLGNINDTPLRQMNNSAQNQQFGLDKSRTMAQECHTCPWQFACYGGCPKHRF
FT                   LPSACGPMKQNYLCAGYQCFFSHTAPMMKAMKTLYVNNLSPAEIRSVFFK"
FT   gene            39013..39756
FT                   /locus_tag="SPC_0039"
FT   CDS_pept        39013..39756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0039"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44232"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H7"
FT                   /protein_id="ACN44232.1"
FT                   /translation="MNYNGGDSSLYVLVTAEEQSGRVVAISSNYSAQPLDKAWQYQSYY
FT                   EERLPPGTLAHMVQRKEAITARRETLFDIDYGPASLYKNDSGMIVKPVLPAYRHFELVR
FT                   MLTDERSLNVQHYLDHECFILGGCMMANMPHVHQGRCHISFVKERGTTPLQKDIPPRLF
FT                   LSGGIRNNVWRTFSTRDYAMAVCNLTGNKKITQQRYATLQGATAFINYLYAHPFLAQLN
FT                   RLSPANVTATLDYLKYEYNQSRKVG"
FT   gene            39956..40281
FT                   /pseudo
FT                   /locus_tag="SPC_0040"
FT                   /note="frameshift compared to STM0038 in Salmonella
FT                   typhimurium LT2"
FT   gene            40444..41610
FT                   /gene="nhaA"
FT                   /locus_tag="SPC_0041"
FT   CDS_pept        40444..41610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="SPC_0041"
FT                   /product="Na(+)/H(+) antiporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44233"
FT                   /db_xref="GOA:C0Q4H8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H8"
FT                   /protein_id="ACN44233.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            41678..42571
FT                   /gene="nhaR"
FT                   /locus_tag="SPC_0042"
FT   CDS_pept        41678..42571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="SPC_0042"
FT                   /product="transcriptional activator protein NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44234"
FT                   /db_xref="GOA:C0Q4H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4H9"
FT                   /protein_id="ACN44234.1"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEER
FT                   LQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   KIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILGEF
FT                   DDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNADYSALFKLQ"
FT   gene            complement(42626..44680)
FT                   /locus_tag="SPC_0043"
FT   CDS_pept        complement(42626..44680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0043"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44235"
FT                   /db_xref="GOA:C0Q4I0"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I0"
FT                   /protein_id="ACN44235.1"
FT                   /translation="MGGTTMPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPV
FT                   MRNEDWALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWR
FT                   LRGEIGEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANL
FT                   DLKGCVLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYW
FT                   ITAGDTPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPIS
FT                   VIVIDFFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRE
FT                   NGWLVQTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPE
FT                   FSVYDYDNYRYYAGPVLEVGNIYPRMYAKTFFDGMKADGEDKVINLLRCAWAGSQKYGA
FT                   LVWSGDIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQW
FT                   GVFSPVMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKL
FT                   KPYIKALMEETHKHNSPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHEGMRERD
FT                   VWLPEGETWTDLATGESYSGGQTLHYATPLNRIPVFIREGGQYRSLLNL"
FT   gene            complement(44705..46078)
FT                   /locus_tag="SPC_0044"
FT   CDS_pept        complement(44705..46078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0044"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44236"
FT                   /db_xref="GOA:C0Q4I1"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I1"
FT                   /protein_id="ACN44236.1"
FT                   /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFGSTYILYF
FT                   YTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAVFS
FT                   ALSFWSPDISMTGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSWRMT
FT                   GGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMDTDKI
FT                   QHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYYLTYNLDRKDLVPLI
FT                   NSLATIQILFIIAIPFFSKYLDKTWIWVGGLLVATFGGVMMWLAADNITFLIAAWILGN
FT                   IGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTAFAAWIMNS
FT                   FGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRHDLETVNS"
FT   gene            complement(46534..46797)
FT                   /gene="rpsT"
FT                   /locus_tag="SPC_0045"
FT   CDS_pept        complement(46534..46797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SPC_0045"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44237"
FT                   /db_xref="GOA:C0Q4I2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4I2"
FT                   /protein_id="ACN44237.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            46903..47118
FT                   /gene="yaaY"
FT                   /locus_tag="SPC_0046"
FT   CDS_pept        46903..47118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="SPC_0046"
FT                   /product="yaaY"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44238"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I3"
FT                   /protein_id="ACN44238.1"
FT                   /translation="MQHSLRSDGAGFYQLACCEYSLSMRKIALSGGFWGGVCRMAMKSI
FT                   FFMFPQGNSRLTLTAVQGILLRFSLF"
FT   gene            47126..48064
FT                   /gene="ribF"
FT                   /locus_tag="SPC_0047"
FT   CDS_pept        47126..48064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="SPC_0047"
FT                   /product="ribF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44239"
FT                   /db_xref="GOA:C0Q4I4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I4"
FT                   /protein_id="ACN44239.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRRR
FT                   GLPVVVMIFEPQPLELFATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQ
FT                   TFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARKFFGLAGQV"
FT   gene            48073..50943
FT                   /gene="ileS"
FT                   /locus_tag="SPC_0048"
FT   CDS_pept        48073..50943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SPC_0048"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44240"
FT                   /db_xref="GOA:C0Q4I5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I5"
FT                   /protein_id="ACN44240.1"
FT                   /translation="MFIKPKYGTENLMSDYKSTLNLPETGFPMRGDLAKREPGMLARWT
FT                   DDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYV
FT                   PGWDCHGLPIELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWS
FT                   HPYLTMDFKTEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSI
FT                   DVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQ
FT                   AVILAKDLVESVMQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAG
FT                   TGAVHTAPGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELL
FT                   KEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPD
FT                   WGQARIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVD
FT                   GIQAWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEG
FT                   SDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLG
FT                   ADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEE
FT                   MVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAK
FT                   ADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGL
FT                   EENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLL
FT                   GEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVG
FT                   KVAEHADICGRCVSNIAGNGEQRKFA"
FT   gene            50943..51443
FT                   /gene="lspA"
FT                   /locus_tag="SPC_0049"
FT   CDS_pept        50943..51443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SPC_0049"
FT                   /product="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44241"
FT                   /db_xref="GOA:C0Q4I6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4I6"
FT                   /protein_id="ACN44241.1"
FT                   /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAK
FT                   EQA"
FT   gene            51457..51588
FT                   /locus_tag="SPC_0050"
FT   CDS_pept        51457..51588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44242"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I7"
FT                   /protein_id="ACN44242.1"
FT                   /translation="MALIRFCRSDKRSAIRQTWCRMAVKTPYPAYGFIVLCASGQNT"
FT   gene            51598..52047
FT                   /gene="fkpB"
FT                   /locus_tag="SPC_0051"
FT   CDS_pept        51598..52047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="SPC_0051"
FT                   /product="putative FkbB-type 16 kD peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44243"
FT                   /db_xref="GOA:C0Q4I8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4I8"
FT                   /protein_id="ACN44243.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            52050..53000
FT                   /gene="lytB"
FT                   /locus_tag="SPC_0052"
FT   CDS_pept        52050..53000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="SPC_0052"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44244"
FT                   /db_xref="GOA:C0Q4I9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4I9"
FT                   /protein_id="ACN44244.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEEAILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            complement(53112..53240)
FT                   /locus_tag="SPC_0053"
FT   CDS_pept        complement(53112..53240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44245"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J0"
FT                   /protein_id="ACN44245.1"
FT                   /translation="MASNVGNPYFILPISLIPVGITTKKPATIVLVFQMNSKKVGH"
FT   gene            53251..54402
FT                   /locus_tag="SPC_0054"
FT   CDS_pept        53251..54402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44246"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J1"
FT                   /protein_id="ACN44246.1"
FT                   /translation="MDATSATVLELPAWERNYTGTIAGKPVNVNITRFGNTLYGYYCYE
FT                   PCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSSEIKGEWTSADKKRHFPVAL
FT                   IYLKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKLYRDGKLIQTLDTASVGT
FT                   CSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLYDPAKQRYVDAPASYQEITSPE
FT                   IDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQPVISKGKMYNCYMTPSY
FT                   ADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVRTVIQAEKPGAEPESLEIQWQENK
FT                   ASPGRFCPLVPFVEGDKLSPRLVTDDDVPDACISRAEYEDIKQ"
FT   gene            54418..55338
FT                   /gene="yaaF"
FT                   /locus_tag="SPC_0055"
FT   CDS_pept        54418..55338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaF"
FT                   /locus_tag="SPC_0055"
FT                   /product="putative nucleoside hydrolase (IUNH family)"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44247"
FT                   /db_xref="GOA:C0Q4J2"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4J2"
FT                   /protein_id="ACN44247.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGEYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFAYAP"
FT   gene            complement(55360..56046)
FT                   /gene="citB"
FT                   /locus_tag="SPC_0056"
FT   CDS_pept        complement(55360..56046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="SPC_0056"
FT                   /product="transcriptional regulatory protein CitB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44248"
FT                   /db_xref="GOA:C0Q4J3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J3"
FT                   /protein_id="ACN44248.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKIFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTCYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   gene            complement(56048..57706)
FT                   /gene="citA"
FT                   /locus_tag="SPC_0057"
FT   CDS_pept        complement(56048..57706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="SPC_0057"
FT                   /product="sensor kinase CitA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44249"
FT                   /db_xref="GOA:C0Q4J4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J4"
FT                   /protein_id="ACN44249.1"
FT                   /translation="MQENTVIKYLNTNMFIREITRWFARRSFQNRIFLLILFTSTIVML
FT                   AITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSD
FT                   ATYITVGNEKGQRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPI
FT                   QDSTGKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLN
FT                   MEPQQLSQLLIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIH
FT                   HVVLPEAFFYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLS
FT                   LQLSQVRQYADNLRTVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISH
FT                   NFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNA
FT                   TLLNREGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLW
FT                   LVHSYVKQANGDIIVDNNNPFGTIFTLYIPFTREE"
FT   gene            complement(57802..59103)
FT                   /gene="oadB"
FT                   /locus_tag="SPC_0058"
FT   CDS_pept        complement(57802..59103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="SPC_0058"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44250"
FT                   /db_xref="GOA:C0PWH5"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:C0PWH5"
FT                   /protein_id="ACN44250.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQGQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGLISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRALTTETERKIRMVQLRTVSKREKILFPVVLLLLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGVIAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   PQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(59119..60894)
FT                   /gene="oadA"
FT                   /locus_tag="SPC_0059"
FT   CDS_pept        complement(59119..60894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="SPC_0059"
FT                   /product="oxaloacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44251"
FT                   /db_xref="GOA:C0PWH4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0PWH4"
FT                   /protein_id="ACN44251.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAYELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTEHDTRLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPL
FT                   PQAEAAQPVAKAEKPAASGIYTVEVEGKAFVVKVSDGGDISQLTTAVPAASSAPVQAAA
FT                   PAGAGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVK
FT                   SGDAVSVGDTLMTLA"
FT   gene            complement(60910..61152)
FT                   /gene="oadG"
FT                   /locus_tag="SPC_0060"
FT   CDS_pept        complement(60910..61152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadG"
FT                   /locus_tag="SPC_0060"
FT                   /product="putative oxaloacetate decarboxylase subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44252"
FT                   /db_xref="GOA:C0Q4J7"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J7"
FT                   /protein_id="ACN44252.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLAFLFLLIFAIRGMSAVITRFFPE
FT                   PVAAPAPRAVPVVDDFTRLKPVIAAAIHHHRRLNP"
FT   gene            complement(61311..62657)
FT                   /gene="citC"
FT                   /locus_tag="SPC_0061"
FT   CDS_pept        complement(61311..62657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="SPC_0061"
FT                   /product="citrate-sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44253"
FT                   /db_xref="GOA:C0Q4J8"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="InterPro:IPR018025"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J8"
FT                   /protein_id="ACN44253.1"
FT                   /translation="MFMTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHF
FT                   YNAIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQK
FT                   EIDAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIV
FT                   IGLCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIAN
FT                   IFAIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCF
FT                   LLAYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLW
FT                   VLMVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGL
FT                   CMANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   gene            62908..63939
FT                   /gene="citC2"
FT                   /locus_tag="SPC_0062"
FT   CDS_pept        62908..63939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC2"
FT                   /locus_tag="SPC_0062"
FT                   /product="[citrate (PRO-3S)-lyase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44254"
FT                   /db_xref="GOA:C0Q4J9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4J9"
FT                   /protein_id="ACN44254.1"
FT                   /translation="MNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCAYWQG
FT                   EIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQNRLLF
FT                   SGAGFWPIAQAGELAVIMENSSERLARFCRQLALYRQPGKTIGAIAMNANPFTLGHRYL
FT                   VEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRATFPG
FT                   YFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHDILHDP
FT                   KRSGPVIEVVELARVEKNGAAISASRVRKLYSERNWSAISALVPAGTLAYLQRHAARHT
FT                   ETI"
FT   gene            63969..64262
FT                   /gene="citD2"
FT                   /locus_tag="SPC_0063"
FT   CDS_pept        63969..64262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD2"
FT                   /locus_tag="SPC_0063"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44255"
FT                   /db_xref="GOA:C0Q4K0"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K0"
FT                   /protein_id="ACN44255.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            64277..65128
FT                   /gene="citE2"
FT                   /locus_tag="SPC_0064"
FT   CDS_pept        64277..65128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE2"
FT                   /locus_tag="SPC_0064"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44256"
FT                   /db_xref="GOA:C0Q4K1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K1"
FT                   /protein_id="ACN44256.1"
FT                   /translation="MLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTARLLVHH
FT                   ALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLELEAQVER
FT                   IERECGREVGSTRLMAAIESAKGVVNAVDIAASSPRMVAIALAAFDYVMDMGTCRGDGT
FT                   ELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVNPRQIEL
FT                   LHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVALSASGI
FT                   RD"
FT   gene            65139..66659
FT                   /gene="citF2"
FT                   /locus_tag="SPC_0065"
FT   CDS_pept        65139..66659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF2"
FT                   /locus_tag="SPC_0065"
FT                   /product="citrate lyase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44257"
FT                   /db_xref="GOA:C0Q4K2"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K2"
FT                   /protein_id="ACN44257.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPASKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            66659..67210
FT                   /gene="citX2"
FT                   /locus_tag="SPC_0066"
FT   CDS_pept        66659..67210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX2"
FT                   /locus_tag="SPC_0066"
FT                   /product="citx protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44258"
FT                   /db_xref="GOA:C0Q4K3"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K3"
FT                   /protein_id="ACN44258.1"
FT                   /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            67161..68096
FT                   /gene="citG"
FT                   /locus_tag="SPC_0067"
FT   CDS_pept        67161..68096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SPC_0067"
FT                   /product="CitG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44259"
FT                   /db_xref="GOA:C0Q4K4"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K4"
FT                   /protein_id="ACN44259.1"
FT                   /translation="MKLHEGLNAMNVSVVTERRTPAYSSLAAGELNGLVARALLTEARL
FT                   TPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPL
FT                   GMACENDMLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIV
FT                   AHELSAKKAGKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLA
FT                   LLQTLLHLMAWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELI
FT                   LRNLSPGGSADLLAVTWFLSHFPAGSLYPE"
FT   gene            68276..69097
FT                   /gene="dapB"
FT                   /locus_tag="SPC_0068"
FT   CDS_pept        68276..69097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="SPC_0068"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44260"
FT                   /db_xref="GOA:C0Q4K5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4K5"
FT                   /protein_id="ACN44260.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGVGKSGVTVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKDLKDCAVYSREGYTGERVAGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            complement(69201..69323)
FT                   /locus_tag="SPC_0069"
FT   CDS_pept        complement(69201..69323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44261"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K6"
FT                   /protein_id="ACN44261.1"
FT                   /translation="MDISLISLVEVPFAYGKPLRLNMSWAKKLSKHEWRKALLI"
FT   gene            complement(69747..69902)
FT                   /locus_tag="SPC_0070"
FT   CDS_pept        complement(69747..69902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44262"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K7"
FT                   /protein_id="ACN44262.1"
FT                   /translation="MKQCKFAYPWISGKRRHSEVKPDKSQLKAGIFYVILHIIRKLFCL
FT                   RGKKIN"
FT   gene            69933..71108
FT                   /gene="carA"
FT                   /locus_tag="SPC_0071"
FT   CDS_pept        69933..71108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SPC_0071"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44263"
FT                   /db_xref="GOA:C0Q4K8"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K8"
FT                   /protein_id="ACN44263.1"
FT                   /translation="MSEYSLEGILIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSM
FT                   TGYQEILTDPSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQSLVIRDLPLIASNFRNT
FT                   EDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLN
FT                   GMDLAKEVTTTETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRG
FT                   CRLTVVPAQTSAEEVLKMNPDGIFLSNGPGDPAPCDYAIEAIKKFLQTDIPVFGICLGH
FT                   QLLALASGAKTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKS
FT                   LFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            71127..74354
FT                   /gene="carB"
FT                   /locus_tag="SPC_0072"
FT   CDS_pept        71127..74354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SPC_0072"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44264"
FT                   /db_xref="GOA:C0Q4K9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4K9"
FT                   /protein_id="ACN44264.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGIREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   gene            74628..75023
FT                   /gene="caiF"
FT                   /locus_tag="SPC_0073"
FT   CDS_pept        74628..75023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="SPC_0073"
FT                   /product="transcriptional activator CaiF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44265"
FT                   /db_xref="GOA:C0Q4L0"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4L0"
FT                   /protein_id="ACN44265.1"
FT                   /translation="MCEKYVERPLYLLIADWMMAENRWITAREISRQFDIEHCKAINTL
FT                   SYILSEVGEIVCEVKMIPNQIAGRGCQCQRLVKVVSIDSQLYRRLNHNLQERKVSVAKA
FT                   PRLSAVPPTELNREQKWQMMLSKSMRR"
FT   gene            complement(75101..75697)
FT                   /gene="caiE"
FT                   /locus_tag="SPC_0074"
FT   CDS_pept        complement(75101..75697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="SPC_0074"
FT                   /product="carnitine operon protein CaiE"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44266"
FT                   /db_xref="GOA:C0Q4L1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4L1"
FT                   /protein_id="ACN44266.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQDLA
FT                   IRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
FT   gene            complement(75807..76592)
FT                   /gene="caiD"
FT                   /locus_tag="SPC_0075"
FT   CDS_pept        complement(75807..76592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="SPC_0075"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44267"
FT                   /db_xref="GOA:C0Q4L2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4L2"
FT                   /protein_id="ACN44267.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
FT   gene            complement(76646..78199)
FT                   /gene="caiC"
FT                   /locus_tag="SPC_0076"
FT   CDS_pept        complement(76646..78199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="SPC_0076"
FT                   /product="crotonobetaine/carnitine-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44268"
FT                   /db_xref="GOA:C0Q4L3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4L3"
FT                   /protein_id="ACN44268.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSVQFYPMYREIHQDNSTPLNHICLIGEQLPADDGVSHFSQLQARQSAT
FT                   LCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRRYQATVTECIPMMIRTLMVQPA
FT                   APTDRQHHLREVMFYLNLSAQEKDAFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAGALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   gene            complement(78262..79533)
FT                   /gene="caiB"
FT                   /locus_tag="SPC_0077"
FT   CDS_pept        complement(78262..79533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="SPC_0077"
FT                   /product="crotonobetainyl-CoA:carnitineCoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44269"
FT                   /db_xref="GOA:C0Q4L4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4L4"
FT                   /protein_id="ACN44269.1"
FT                   /translation="MALCLSGLHTAKNARRKMMNHLPMPTFGPLAGVRVVFSGIEIAGP
FT                   FAGQMFAEWGAEVIWIENVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLM
FT                   ETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQ
FT                   AFSGYLIQNGDVDQPMPAFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVM
FT                   LRMGQYFMMDYFNGGEICPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDI
FT                   GLAHILGTPEVPEGTQLIHRVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKV
FT                   LTIPELEGNPQYVARESITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAI
FT                   LKNIGYSEADIKELVGKGLAKVED"
FT   gene            complement(79591..80733)
FT                   /gene="caiA"
FT                   /locus_tag="SPC_0078"
FT   CDS_pept        complement(79591..80733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="SPC_0078"
FT                   /product="crotonobetainyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44270"
FT                   /db_xref="GOA:C0Q4L5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4L5"
FT                   /protein_id="ACN44270.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(80768..82285)
FT                   /gene="caiT"
FT                   /locus_tag="SPC_0079"
FT   CDS_pept        complement(80768..82285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="SPC_0079"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44271"
FT                   /db_xref="GOA:C0Q4L6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4L6"
FT                   /protein_id="ACN44271.1"
FT                   /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   gene            82513..82698
FT                   /locus_tag="SPC_0080"
FT   CDS_pept        82513..82698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44272"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4L7"
FT                   /protein_id="ACN44272.1"
FT                   /translation="MWFFNFFKYLTFNIVEPANNIENFHIWHISFNIGEVRNTIESYEY
FT                   QCVTFSILVIKVLFPN"
FT   gene            82748..83536
FT                   /gene="fixA"
FT                   /locus_tag="SPC_0081"
FT   CDS_pept        82748..83536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SPC_0081"
FT                   /product="putative electron transfer flavoprotein subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44273"
FT                   /db_xref="GOA:C0Q4L8"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4L8"
FT                   /protein_id="ACN44273.1"
FT                   /translation="MISGDAMKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDL
FT                   NAIEAACQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQ
FT                   HTATALAAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTL
FT                   TVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSV
FT                   PTYSAQQVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            83552..84493
FT                   /gene="fixB"
FT                   /locus_tag="SPC_0082"
FT   CDS_pept        83552..84493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="SPC_0082"
FT                   /product="putative electron transfer flavoprotein subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44274"
FT                   /db_xref="GOA:C0Q4L9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4L9"
FT                   /protein_id="ACN44274.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASEVALQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDASRSG
FT                   KMHTVQWQAPATAVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            84543..85829
FT                   /gene="fixC"
FT                   /locus_tag="SPC_0083"
FT   CDS_pept        84543..85829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="SPC_0083"
FT                   /product="FixC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44275"
FT                   /db_xref="GOA:C0Q4M0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M0"
FT                   /protein_id="ACN44275.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPDFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVSYS
FT                   VLRSKFDAWLMEQAEEEGAQLITGIRVDNVVQRDGKVVSVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMTKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVNIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            85844..86113
FT                   /gene="fixX"
FT                   /locus_tag="SPC_0084"
FT   CDS_pept        85844..86113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="SPC_0084"
FT                   /product="ferredoxin like protein FixX"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44276"
FT                   /db_xref="GOA:C0Q4M1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M1"
FT                   /protein_id="ACN44276.1"
FT                   /translation="MDGKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACPAGLYKKQ
FT                   DDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            86194..87600
FT                   /gene="yaaU"
FT                   /locus_tag="SPC_0085"
FT   CDS_pept        86194..87600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="SPC_0085"
FT                   /product="putative metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44277"
FT                   /db_xref="GOA:C0Q4M2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M2"
FT                   /protein_id="ACN44277.1"
FT                   /translation="MAAETPYPAYRCALPVLKQDITMQQPRNFDDLKFSSIHRRIMLWG
FT                   SGGPFLDGYVLVIIGVALEQLTPLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKVGR
FT                   RKMFLLDIIAIGVISVATMFVSTPLELLVMRVLIGIVIGADYPIATSMITEFSNTRQRA
FT                   FSIGFIAAMWYVGATCANLVGYWLYDMEGGWRWMLGSAFIPCLIILIGRFDLPESPRWL
FT                   LRKGRVKECEQMMIKLFGEPVCFDDEPPQETRFLQLFNRRHFPFVLFVAAIWTCQVIPM
FT                   FAIYTFGPQIVGLLGWEQGRNAALGNVVISLFFMLGCIPAMFWLNSIGRRPLLIGSFAM
FT                   MTIALALLGLVSNLGIILVVVAFAVYAFFSGGPGILQWLYPNELFPTDIRASAVGVIMS
FT                   LSRIGTIVSTWALPIFITRYGINNVMLIGALISLVGLGVSVMFAPETRGLTLTQTGNMT
FT                   LRGTPSDNPR"
FT   gene            87656..87919
FT                   /locus_tag="SPC_0086"
FT   CDS_pept        87656..87919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0086"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44278"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M3"
FT                   /protein_id="ACN44278.1"
FT                   /translation="MLKQLKSRENTMQKRLMTALFTAATLFTVAGCSSNQAVETTDGKT
FT                   IVTDGKPEVDNDTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            88205..88621
FT                   /locus_tag="SPC_0087"
FT   CDS_pept        88205..88621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0087"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44279"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M4"
FT                   /protein_id="ACN44279.1"
FT                   /translation="MKLIPFYLLALFSAASGATEINVCKDLIGTWKTTADNPPYTMTIS
FT                   PPVESCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGTYN
FT                   RQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(88657..88779)
FT                   /locus_tag="SPC_0088"
FT   CDS_pept        complement(88657..88779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44280"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M5"
FT                   /protein_id="ACN44280.1"
FT                   /translation="MLRHNPLRAVWKQMLALFFINSSPGQASRWNVRAQAVSPA"
FT   gene            complement(88844..89134)
FT                   /locus_tag="SPC_0089"
FT   CDS_pept        complement(88844..89134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0089"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44281"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M6"
FT                   /protein_id="ACN44281.1"
FT                   /translation="MKKRIIVAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   gene            89344..89538
FT                   /locus_tag="SPC_0090"
FT   CDS_pept        89344..89538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44282"
FT                   /db_xref="GOA:C0Q4M7"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M7"
FT                   /protein_id="ACN44282.1"
FT                   /translation="MLLGTHSLAAFKQLELFWVITSVDYLKIALFGVTVLYLVIVTSLC
FT                   CCQCKIMHCQLKRNLTTCK"
FT   gene            90032..91921
FT                   /locus_tag="SPC_0091"
FT   CDS_pept        90032..91921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0091"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44283"
FT                   /db_xref="GOA:C0Q4M8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4M8"
FT                   /protein_id="ACN44283.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFSPTFPFPVPGRERLMKTGVTFCNHQN
FT                   TSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAYKGK
FT                   WHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFSDYHGIGDIIGHSKGGYFYDS
FT                   TTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGELDQDDN
FT                   TLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQFPDEDRR
FT                   WRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQMHGKGASV
FT                   YKEQIHVPMIISHPAYHGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALGNRKGVNFS
FT                   GLLKNPEGVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQIKQEISHLHP
FT                   DFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDENHNLAA
FT                   DKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAREPWDLTIEQFNRMAKD"
FT   gene            92475..93005
FT                   /gene="yabF"
FT                   /locus_tag="SPC_0092"
FT   CDS_pept        92475..93005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="SPC_0092"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44284"
FT                   /db_xref="GOA:C0Q4M9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4M9"
FT                   /protein_id="ACN44284.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNID
FT                   VAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGENHFTIGSHPGFDVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQARQY
FT                   KQRLLAWQEVNHG"
FT   gene            92998..94860
FT                   /gene="kefC"
FT                   /locus_tag="SPC_0093"
FT   CDS_pept        92998..94860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="SPC_0093"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44285"
FT                   /db_xref="GOA:C0Q4N0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q4N0"
FT                   /protein_id="ACN44285.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKSHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEAADEPEVKPSI"
FT   gene            95059..95538
FT                   /gene="folA"
FT                   /locus_tag="SPC_0094"
FT   CDS_pept        95059..95538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="SPC_0094"
FT                   /product="dihydrofolate reductase type I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44286"
FT                   /db_xref="GOA:C0Q4N1"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q4N1"
FT                   /protein_id="ACN44286.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(95644..96492)
FT                   /gene="apaH"
FT                   /locus_tag="SPC_0095"
FT   CDS_pept        complement(95644..96492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="SPC_0095"
FT                   /product="diadenosinetetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44287"
FT                   /db_xref="GOA:C0Q5E5"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5E5"
FT                   /protein_id="ACN44287.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLLVDEEKKLIMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(96503..96862)
FT                   /gene="apaG"
FT                   /locus_tag="SPC_0096"
FT   CDS_pept        complement(96503..96862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="SPC_0096"
FT                   /product="apaG"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44288"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5E6"
FT                   /protein_id="ACN44288.1"
FT                   /translation="MCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWL
FT                   ITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFT
FT                   IDIPVFRLAVPTLIH"
FT   gene            complement(96883..97704)
FT                   /gene="ksgA"
FT                   /locus_tag="SPC_0097"
FT   CDS_pept        complement(96883..97704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SPC_0097"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44289"
FT                   /db_xref="GOA:C0Q5E7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5E7"
FT                   /protein_id="ACN44289.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   gene            complement(97701..98690)
FT                   /gene="pdxA"
FT                   /locus_tag="SPC_0098"
FT   CDS_pept        complement(97701..98690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SPC_0098"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44290"
FT                   /db_xref="GOA:C0Q5E8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5E8"
FT                   /protein_id="ACN44290.1"
FT                   /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAIPGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGISFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMNLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(98690..99976)
FT                   /gene="surA"
FT                   /locus_tag="SPC_0099"
FT   CDS_pept        complement(98690..99976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="SPC_0099"
FT                   /product="survival protein SurA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44291"
FT                   /db_xref="GOA:C0Q5E9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5E9"
FT                   /protein_id="ACN44291.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(100030..102390)
FT                   /gene="imp"
FT                   /locus_tag="SPC_0100"
FT   CDS_pept        complement(100030..102390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="SPC_0100"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44292"
FT                   /db_xref="GOA:C0Q5F0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F0"
FT                   /protein_id="ACN44292.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGAGLMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDSYNSDPNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYL
FT                   YVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVER
FT                   FNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLD
FT                   SVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWL
FT                   IADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNA
FT                   IGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
FT   gene            complement(102400..102516)
FT                   /locus_tag="SPC_0101"
FT   CDS_pept        complement(102400..102516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44293"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F1"
FT                   /protein_id="ACN44293.1"
FT                   /translation="MPCLTPQTLNGRINTGAAKMSKLGCDRLSRATLPMMEQ"
FT   gene            102644..103456
FT                   /gene="djlA"
FT                   /locus_tag="SPC_0102"
FT   CDS_pept        102644..103456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="SPC_0102"
FT                   /product="Dna-J like membrane chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44294"
FT                   /db_xref="GOA:C0Q5F2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F2"
FT                   /protein_id="ACN44294.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(103551..104210)
FT                   /gene="rluA"
FT                   /locus_tag="SPC_0103"
FT   CDS_pept        complement(103551..104210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="SPC_0103"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44295"
FT                   /db_xref="GOA:C0Q5F3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F3"
FT                   /protein_id="ACN44295.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGTSMTFKVPADF"
FT   gene            complement(104222..107128)
FT                   /gene="hepA"
FT                   /locus_tag="SPC_0104"
FT   CDS_pept        complement(104222..107128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="SPC_0104"
FT                   /product="ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44296"
FT                   /db_xref="GOA:C0Q5F4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5F4"
FT                   /protein_id="ACN44296.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICTKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
FT   gene            complement(107302..109653)
FT                   /gene="polB"
FT                   /locus_tag="SPC_0105"
FT   CDS_pept        complement(107302..109653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="SPC_0105"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44297"
FT                   /db_xref="GOA:C0Q5F5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F5"
FT                   /protein_id="ACN44297.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAFI
FT                   PTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVY
FT                   EADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHPDYRPPLKWVSLDIETTRHG
FT                   ELYCIGLEGCGQRTVYMLGPANGDDRQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDAL
FT                   KSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVT
FT                   RIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPLAS
FT                   PGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVSQIWHGRDEAKRQGNKPPSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEW
FT                   WAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEGDSHRMVFKGLE
FT                   TVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHE
FT                   YQRNVPPHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYL
FT                   TRQLQPVAEGILPFVEDNFATLLTGQLGLF"
FT   gene            complement(109697..110410)
FT                   /locus_tag="SPC_0106"
FT   CDS_pept        complement(109697..110410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0106"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44298"
FT                   /db_xref="GOA:C0Q5F6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F6"
FT                   /protein_id="ACN44298.1"
FT                   /translation="MINIRQQKYLTLKAILSLKYPLHPSRGTNSFMKYRYIIRIAAGII
FT                   LIMATVFIHNAIAIYQFSQQNQTRIADCAIVAGAGVSGKTPSPVFQARLDHAIWLYQQH
FT                   IVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTRENIRYAKQILRQ
FT                   QQWRTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRSTRYKSWWAQTRFLLRETFYYSGY
FT                   RLLRYMPVQNNSITP"
FT   gene            110835..111254
FT                   /locus_tag="SPC_0107"
FT   CDS_pept        110835..111254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44299"
FT                   /db_xref="InterPro:IPR031855"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F7"
FT                   /protein_id="ACN44299.1"
FT                   /translation="MNVSMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQTHQRAPHGTRF"
FT   gene            complement(111260..112024)
FT                   /gene="araD"
FT                   /locus_tag="SPC_0108"
FT   CDS_pept        complement(111260..112024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SPC_0108"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44300"
FT                   /db_xref="GOA:C0Q5F8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F8"
FT                   /protein_id="ACN44300.1"
FT                   /translation="MSPSGTPSLVGRISEAPSGREKTMLEDLKRQVLEANLALPKHNLV
FT                   TLTWGNVSAVDRERGVLVIKPSGVDYSVMTADDMVVVSLETGEVVEGHKKPSSDTPTHR
FT                   LLYQAFPTIGGIVHTHSRHATIWAQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGE
FT                   YEWETGNVIVETFEKQGIDAAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIF
FT                   CRQLAPQLPDMQQSLLDKHYLRKHGAKAYYGQ"
FT   gene            complement(112096..113598)
FT                   /pseudo
FT                   /gene="araA"
FT                   /locus_tag="SPC_0109"
FT                   /note="stop compared to STM0102 in Salmonella typhimurium
FT                   LT2"
FT   gene            complement(113739..115280)
FT                   /gene="araB"
FT                   /locus_tag="SPC_0110"
FT   CDS_pept        complement(113739..115280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="SPC_0110"
FT                   /product="ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44301"
FT                   /db_xref="GOA:C0Q5F9"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5F9"
FT                   /protein_id="ACN44301.1"
FT                   /translation="MRALAVDCATGDEIATSVEWYPRWQEGRYCDGPNNQFRHHPRDYM
FT                   ESMEAALKAVLAQLSAAQRANIVGIGVDSTGSTPAPIDADGNVLALRPEFAENPNAMFV
FT                   LWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHVTRQDSAVAQAAVS
FT                   WIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPASFFDELDPCINRHLR
FT                   YPLFSETFTADLPVGTLCAEWAQRLGLPESVVISGGAFDCHMGAVGAGAQPNTLVKVIG
FT                   TSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGDIYAWFSRVLSWPL
FT                   EQLAAQHPELKPQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFNGRRTPNANQRLKG
FT                   VITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGIAVNNVMALGGIARKNQVIMQV
FT                   CCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPAAQQSMASAVERTLRPPP"
FT   gene            115660..116505
FT                   /gene="araC"
FT                   /locus_tag="SPC_0111"
FT   CDS_pept        115660..116505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="SPC_0111"
FT                   /product="arabinose operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44302"
FT                   /db_xref="GOA:C0Q5G0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G0"
FT                   /protein_id="ACN44302.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            116624..117391
FT                   /gene="yabI"
FT                   /locus_tag="SPC_0112"
FT   CDS_pept        116624..117391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="SPC_0112"
FT                   /product="DedA-family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44303"
FT                   /db_xref="GOA:C0Q5G1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G1"
FT                   /protein_id="ACN44303.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(117430..118137)
FT                   /gene="yabJ"
FT                   /locus_tag="SPC_0113"
FT   CDS_pept        complement(117430..118137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="SPC_0113"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44304"
FT                   /db_xref="GOA:C0Q5G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G2"
FT                   /protein_id="ACN44304.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGEDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIARQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(118121..119731)
FT                   /gene="thiP"
FT                   /locus_tag="SPC_0114"
FT   CDS_pept        complement(118121..119731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="SPC_0114"
FT                   /product="thiamine ABC transporter membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44305"
FT                   /db_xref="GOA:C0Q5G3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G3"
FT                   /protein_id="ACN44305.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   IWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGINRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRQRQQLFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   gene            complement(119707..120690)
FT                   /gene="tbpA"
FT                   /locus_tag="SPC_0115"
FT   CDS_pept        complement(119707..120690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="SPC_0115"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44306"
FT                   /db_xref="GOA:C0Q5G4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G4"
FT                   /protein_id="ACN44306.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLRNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   gene            complement(120868..122526)
FT                   /gene="yabN"
FT                   /locus_tag="SPC_0116"
FT   CDS_pept        complement(120868..122526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="SPC_0116"
FT                   /product="putative ABC transporter periplasmic solute
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44307"
FT                   /db_xref="GOA:C0Q5G5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G5"
FT                   /protein_id="ACN44307.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVIASLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQDDAAQWRAGEMNLPNWCQQLLANKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            complement(122882..122998)
FT                   /locus_tag="SPC_0117"
FT   CDS_pept        complement(122882..122998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44308"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G6"
FT                   /protein_id="ACN44308.1"
FT                   /translation="MIKIKKSVSVPCKMALVTQHYTSFTRPVITYVTTETAV"
FT   gene            123053..123340
FT                   /locus_tag="SPC_0118"
FT   CDS_pept        123053..123340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44309"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G7"
FT                   /protein_id="ACN44309.1"
FT                   /translation="MIMKKVFLLAALFAMSNSSFAAMAESCQQYFNDIDALVEQAAATS
FT                   EQAKQQFDAMKPQLEASKKQLETVAASDQDAACKQALASMVQIKQALGLK"
FT   gene            complement(123394..123999)
FT                   /gene="leuD"
FT                   /locus_tag="SPC_0119"
FT   CDS_pept        complement(123394..123999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SPC_0119"
FT                   /product="isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44310"
FT                   /db_xref="GOA:C0Q5G8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G8"
FT                   /protein_id="ACN44310.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDAQVDELFALVKANPGIHFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAEYEDKQPEFMR"
FT   gene            complement(124010..125410)
FT                   /gene="leuC"
FT                   /locus_tag="SPC_0120"
FT   CDS_pept        complement(124010..125410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SPC_0120"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44311"
FT                   /db_xref="GOA:C0Q5G9"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5G9"
FT                   /protein_id="ACN44311.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVTLRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(125413..126504)
FT                   /gene="leuB"
FT                   /locus_tag="SPC_0121"
FT   CDS_pept        complement(125413..126504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SPC_0121"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44312"
FT                   /db_xref="GOA:C0Q5H0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H0"
FT                   /protein_id="ACN44312.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSHYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGVRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(126504..128075)
FT                   /gene="leuA"
FT                   /locus_tag="SPC_0122"
FT   CDS_pept        complement(126504..128075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SPC_0122"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44313"
FT                   /db_xref="GOA:C0Q5H1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5H1"
FT                   /protein_id="ACN44313.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMIKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   gene            complement(128163..128249)
FT                   /gene="leuL"
FT                   /locus_tag="SPC_0123"
FT   CDS_pept        complement(128163..128249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="SPC_0123"
FT                   /product="leu operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44314"
FT                   /db_xref="GOA:C0Q5H2"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H2"
FT                   /protein_id="ACN44314.1"
FT                   /translation="MSHIVRFTGLLLLNAFIVRGRPVGGIQH"
FT   gene            128825..129850
FT                   /gene="leuO"
FT                   /locus_tag="SPC_0124"
FT   CDS_pept        128825..129850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="SPC_0124"
FT                   /product="leucine transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44315"
FT                   /db_xref="GOA:C0Q5H3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H3"
FT                   /protein_id="ACN44315.1"
FT                   /translation="MHGKSYFQELFLPSARKRELSVTVELNMPEVKTEKPHLLDMGKPQ
FT                   LRMVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQ
FT                   PTARAFQLFGSVRQALQLVQNELPGSGFEPTRSERVFNLCVCSPLDNILTSQIYNRVEK
FT                   IAPNIHVVFKASLNQNTEHQLRYQETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHP
FT                   RISGPLLEGDVYNEQHAVVSLDRYASFSQPWYDTPDKQSSVAYQGMALISVLNVVSQTH
FT                   LVAIAPRWLAEEFAESLDLQILPLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCK
FT                   R"
FT   gene            130172..131896
FT                   /gene="ilvI"
FT                   /locus_tag="SPC_0125"
FT   CDS_pept        130172..131896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="SPC_0125"
FT                   /product="acetolactate synthase III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44316"
FT                   /db_xref="GOA:C0Q5H4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H4"
FT                   /protein_id="ACN44316.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKMPYAWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAISAAC
FT                   YAPLRHIIETFNLPVVSSLMGLGAFPAAHRQSLGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQMLELLAQDAP
FT                   SQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGLQ
FT                   INHPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            131869..132390
FT                   /gene="ilvH"
FT                   /locus_tag="SPC_0126"
FT   CDS_pept        131869..132390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="SPC_0126"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44317"
FT                   /db_xref="GOA:C0Q5H5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H5"
FT                   /protein_id="ACN44317.1"
FT                   /translation="MVKQNGEDLMMRRILSVLLENESGALSRVIGLFSQRGYNIESLTV
FT                   APTDDPTLSRMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQAS
FT                   GYGREEVKRNTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVV
FT                   GLSRGDKIMR"
FT   gene            132674..133678
FT                   /gene="fruR"
FT                   /locus_tag="SPC_0127"
FT   CDS_pept        132674..133678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="SPC_0127"
FT                   /product="fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44318"
FT                   /db_xref="GOA:C0Q5H6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H6"
FT                   /protein_id="ACN44318.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            134284..134742
FT                   /gene="yabB"
FT                   /locus_tag="SPC_0128"
FT   CDS_pept        134284..134742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="SPC_0128"
FT                   /product="yabB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44319"
FT                   /db_xref="GOA:C0Q5H7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5H7"
FT                   /protein_id="ACN44319.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            134744..135685
FT                   /gene="mraW"
FT                   /locus_tag="SPC_0129"
FT   CDS_pept        134744..135685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SPC_0129"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44320"
FT                   /db_xref="GOA:C0Q5H8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5H8"
FT                   /protein_id="ACN44320.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            135682..136047
FT                   /gene="ftsL"
FT                   /locus_tag="SPC_0130"
FT   CDS_pept        135682..136047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SPC_0130"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44321"
FT                   /db_xref="GOA:C0Q5H9"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5H9"
FT                   /protein_id="ACN44321.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            136063..137829
FT                   /gene="ftsI"
FT                   /locus_tag="SPC_0131"
FT   CDS_pept        136063..137829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="SPC_0131"
FT                   /product="penicillin-binding protein 3 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44322"
FT                   /db_xref="GOA:C0Q5I0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I0"
FT                   /protein_id="ACN44322.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            137888..139303
FT                   /gene="murE"
FT                   /locus_tag="SPC_0132"
FT   CDS_pept        137888..139303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SPC_0132"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44323"
FT                   /db_xref="GOA:C0Q5I1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I1"
FT                   /protein_id="ACN44323.1"
FT                   /translation="MTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKD
FT                   EATDGEIREMHGVPVVYLSQLNERLSALAGRFYHEPSENMRLVAVTGTNGKTTTTQLLA
FT                   QWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHVLASLVAQGATFGAMEVSSH
FT                   GLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYEAAKWMLYSTHHHGQAIVNADDEVG
FT                   RRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEYHDRGATIRFASSWGDGEIESRLMG
FT                   AFNVSNLLLALATLLALGYPLTNLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAHTPDA
FT                   LEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEEPRA
FT                   IINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDNDVVLIAGKGHEDYQIVGTQRLDYS
FT                   DRVTAARLLGVIA"
FT   gene            139300..140658
FT                   /gene="murF"
FT                   /locus_tag="SPC_0133"
FT   CDS_pept        139300..140658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="SPC_0133"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diami
FT                   nopimelate--D-alan alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44324"
FT                   /db_xref="GOA:C0Q5I2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I2"
FT                   /protein_id="ACN44324.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLTAIKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGAESEACHIQVGEAAKAAGIDRVLSTGKLSQAISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            140652..141734
FT                   /gene="mraY"
FT                   /locus_tag="SPC_0134"
FT   CDS_pept        140652..141734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SPC_0134"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44325"
FT                   /db_xref="GOA:C0Q5I3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5I3"
FT                   /protein_id="ACN44325.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPVTQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            141737..143053
FT                   /gene="murD"
FT                   /locus_tag="SPC_0135"
FT   CDS_pept        141737..143053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SPC_0135"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44326"
FT                   /db_xref="GOA:C0Q5I4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I4"
FT                   /protein_id="ACN44326.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   EPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLTRYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            143080..144297
FT                   /gene="ftsW"
FT                   /locus_tag="SPC_0136"
FT   CDS_pept        143080..144297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SPC_0136"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44327"
FT                   /db_xref="GOA:C0Q5I5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I5"
FT                   /protein_id="ACN44327.1"
FT                   /translation="MPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYDRTLLWLTFG
FT                   LAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPMTFWQKYSTT
FT                   MLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANYLVRKVDEVR
FT                   NNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGIS
FT                   AVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGLGNSVQKLEY
FT                   LPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIG
FT                   IWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDYETRLEKAQA
FT                   FTRGSR"
FT   gene            144318..145361
FT                   /gene="murG"
FT                   /locus_tag="SPC_0137"
FT   CDS_pept        144318..145361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SPC_0137"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44328"
FT                   /db_xref="GOA:C0Q5I6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I6"
FT                   /protein_id="ACN44328.1"
FT                   /translation="MVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKH
FT                   GIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGL
FT                   AAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVRTDVLALPL
FT                   PQERLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGAQHTVEQAY
FT                   AGVGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPFQHKDRQQY
FT                   WNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPDATERVASE
FT                   VSRVART"
FT   gene            145480..146955
FT                   /gene="murC"
FT                   /locus_tag="SPC_0138"
FT   CDS_pept        145480..146955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SPC_0138"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44329"
FT                   /db_xref="GOA:C0Q5I7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5I7"
FT                   /protein_id="ACN44329.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIDDDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKKLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            146948..147868
FT                   /gene="ddl"
FT                   /locus_tag="SPC_0139"
FT   CDS_pept        146948..147868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="SPC_0139"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44330"
FT                   /db_xref="GOA:C0Q5I8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I8"
FT                   /protein_id="ACN44330.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEV
FT                   DVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSLSQLVVRILELAD"
FT   gene            147870..148700
FT                   /gene="ftsQ"
FT                   /locus_tag="SPC_0140"
FT   CDS_pept        147870..148700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SPC_0140"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44331"
FT                   /db_xref="GOA:C0Q5I9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5I9"
FT                   /protein_id="ACN44331.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIAHWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            148697..149959
FT                   /gene="ftsA"
FT                   /locus_tag="SPC_0141"
FT   CDS_pept        148697..149959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SPC_0141"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44332"
FT                   /db_xref="GOA:C0Q5J0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J0"
FT                   /protein_id="ACN44332.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            150020..151171
FT                   /gene="ftsZ"
FT                   /locus_tag="SPC_0142"
FT   CDS_pept        150020..151171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SPC_0142"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44333"
FT                   /db_xref="GOA:C0Q5J1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J1"
FT                   /protein_id="ACN44333.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
FT   gene            151272..152189
FT                   /gene="lpxC"
FT                   /locus_tag="SPC_0143"
FT   CDS_pept        151272..152189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="SPC_0143"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44334"
FT                   /db_xref="GOA:C0Q5J2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5J2"
FT                   /protein_id="ACN44334.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            152537..152965
FT                   /gene="yacA"
FT                   /locus_tag="SPC_0144"
FT   CDS_pept        152537..152965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="SPC_0144"
FT                   /product="SecA regulator SecM"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44335"
FT                   /db_xref="GOA:C0Q5J3"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J3"
FT                   /protein_id="ACN44335.1"
FT                   /translation="MVAASFGLPALSNAAETNTPARTTASTASKVNFSHLALLEASNRR
FT                   PNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADAPSPLQAHHIALLNTLSAMLTQEGTP
FT                   PAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAGPQRLS"
FT   gene            153027..155732
FT                   /gene="secA"
FT                   /locus_tag="SPC_0145"
FT   CDS_pept        153027..155732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SPC_0145"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44336"
FT                   /db_xref="GOA:C0Q5J4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5J4"
FT                   /protein_id="ACN44336.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            155884..156279
FT                   /gene="mutT"
FT                   /locus_tag="SPC_0146"
FT   CDS_pept        155884..156279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SPC_0146"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44337"
FT                   /db_xref="GOA:C0Q5J5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J5"
FT                   /protein_id="ACN44337.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITRRAADAHMANKLEFPGGKIEAGET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWDGEPWGKEGQPGRW
FT                   IAQNALSTDDFPPANEPIIRKLRQFAL"
FT   gene            complement(156313..157302)
FT                   /locus_tag="SPC_0147"
FT   CDS_pept        complement(156313..157302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0147"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44338"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J6"
FT                   /protein_id="ACN44338.1"
FT                   /translation="MQYRTLGANGPRVSAIGLGCMGMSAFYGAHDDSTSIKTLHYALDQ
FT                   GVTLLDTADMYGPYTNERLVGRAIADRRDRVFLATKFGIVLDPANPMARGVNGRPEYVR
FT                   RSCEQSLQRLGVDHIDLYYQHRVDPSVPIEETVGAMADLVREGKVRYLGLSEASTQTLE
FT                   RAHNVHPITALQSEYSLWSREAEISALSTCERLGIGFVAYSPLGRGFLTGTIKTPEDFA
FT                   ANDFRRTNPRFMGENFSRNLRLAEAIKQMAREKECTPAQLALAWLLARNRHIVPIPGTR
FT                   HCARVDENLGALSLTLSPQELAAIETVFPHDAAAGPRYWPEIMSTLNR"
FT   gene            157388..158329
FT                   /locus_tag="SPC_0148"
FT   CDS_pept        157388..158329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0148"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44339"
FT                   /db_xref="GOA:C0Q5J7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J7"
FT                   /protein_id="ACN44339.1"
FT                   /translation="MKAGLIMRHDVMSILHAFCMIAENHSFTRAAAQLHISTSALSQNM
FT                   RQLEDELGVKLLNRTTRRVGLTEAGHAFLASIRPALNHIDEAMEHARQSRDIPGGTLRL
FT                   TVPRTAATLLLQPNLAGFMRDYPDIRLDIDVNDGFVDLINERFDAGIRFGDAVQLDMNV
FT                   VPLGDVLRPAIVASPAYLARFGTPLHPQELINHRCLCHRFTRESGLYRWEFVHGAQRLE
FT                   ITPEAALMVNDKALRLSAARDGAGLTYVFEQDVHEDLQDGRLCSVLEEWLPAADRFYLY
FT                   YPGRAHMAPKLRVFIDYFCHKAILPSQQSHHR"
FT   gene            complement(158326..158517)
FT                   /gene="yacG"
FT                   /locus_tag="SPC_0149"
FT   CDS_pept        complement(158326..158517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="SPC_0149"
FT                   /product="zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44340"
FT                   /db_xref="GOA:C0Q5J8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5J8"
FT                   /protein_id="ACN44340.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   gene            complement(158527..159201)
FT                   /gene="yacF"
FT                   /locus_tag="SPC_0150"
FT   CDS_pept        complement(158527..159201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="SPC_0150"
FT                   /product="yacF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44341"
FT                   /db_xref="GOA:C0Q5J9"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5J9"
FT                   /protein_id="ACN44341.1"
FT                   /translation="MIQQLSINLPIADHAGALHFFRNISDLLDVFERGEVRTELLKELE
FT                   RQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLISAPRIGQQLREDRLIALVRQRLSI
FT                   PGGCCSFDLPTLHIWLHLQQAQRDAQIETWLASLNPLTQALTLVLDLIRNSAPFRKQTS
FT                   LNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRFAIRFMPLDSENGLVPERLDFELA
FT                   CC"
FT   gene            complement(159270..159776)
FT                   /locus_tag="SPC_0151"
FT   CDS_pept        complement(159270..159776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0151"
FT                   /product="Dephospho-CoA kinase (Dephosphocoenzyme A
FT                   kinase)"
FT                   /note="similar to ref|YP_215126.1| dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44342"
FT                   /db_xref="GOA:C0Q5K0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K0"
FT                   /protein_id="ACN44342.1"
FT                   /translation="MVEPGQPTLNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAW
FT                   LNALLHPLIQQETQRQFQQATSPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTM
FT                   QRDDVTREHVEHILAAQATREARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFV
FT                   SQEKP"
FT   gene            160116..161159
FT                   /gene="guaC"
FT                   /locus_tag="SPC_0152"
FT   CDS_pept        160116..161159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="SPC_0152"
FT                   /product="guanosine 5'-monophosphate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44343"
FT                   /db_xref="GOA:C0Q5K1"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5K1"
FT                   /protein_id="ACN44343.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKYSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(161190..162392)
FT                   /gene="hofC"
FT                   /locus_tag="SPC_0153"
FT   CDS_pept        complement(161190..162392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="SPC_0153"
FT                   /product="protein transport protein HofC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44344"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K2"
FT                   /protein_id="ACN44344.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWVDNRLALIITLQHQRIMPLRI
FT                   KRIGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPVIILAMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(162382..163767)
FT                   /gene="hofB"
FT                   /locus_tag="SPC_0154"
FT   CDS_pept        complement(162382..163767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="SPC_0154"
FT                   /product="protein transport protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44345"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K3"
FT                   /protein_id="ACN44345.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSTNAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLAGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILRVLGMP
FT                   HER"
FT   gene            complement(163777..164214)
FT                   /gene="ppdD"
FT                   /locus_tag="SPC_0155"
FT   CDS_pept        complement(163777..164214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="SPC_0155"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44346"
FT                   /db_xref="GOA:C0Q5K4"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K4"
FT                   /protein_id="ACN44346.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRHVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDAN"
FT   gene            complement(164436..165329)
FT                   /gene="nadC"
FT                   /locus_tag="SPC_0156"
FT   CDS_pept        complement(164436..165329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SPC_0156"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44347"
FT                   /db_xref="GOA:C0Q5K5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K5"
FT                   /protein_id="ACN44347.1"
FT                   /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGNDI
FT                   TAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQTV
FT                   FELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLRTAL
FT                   KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVENLDEL
FT                   DDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETLREFAETGVDFISVG
FT                   ALTKHVRALDLSMRFC"
FT   gene            165438..165980
FT                   /gene="ampD"
FT                   /locus_tag="SPC_0157"
FT   CDS_pept        165438..165980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="SPC_0157"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44348"
FT                   /db_xref="GOA:C0Q5K6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K6"
FT                   /protein_id="ACN44348.1"
FT                   /translation="MVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGGPWIDALF
FT                   TGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQGRERCNDF
FT                   SIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPDRKTDPGPAFD
FT                   WPRFRALVALSSHKEMT"
FT   gene            165977..166831
FT                   /gene="ampE"
FT                   /locus_tag="SPC_0158"
FT   CDS_pept        165977..166831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="SPC_0158"
FT                   /product="AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44349"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K7"
FT                   /protein_id="ACN44349.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKARVHYHAWLKAASRNDPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(166923..167873)
FT                   /locus_tag="SPC_0159"
FT   CDS_pept        complement(166923..167873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0159"
FT                   /product="putative glycosysl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44350"
FT                   /db_xref="GOA:C0Q5K8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K8"
FT                   /protein_id="ACN44350.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSLE
FT                   GLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTIKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGNKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGEDILVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(167873..169279)
FT                   /locus_tag="SPC_0160"
FT   CDS_pept        complement(167873..169279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0160"
FT                   /product="putative symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44351"
FT                   /db_xref="GOA:C0Q5K9"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5K9"
FT                   /protein_id="ACN44351.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLRVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LNAAESVRKA"
FT   gene            complement(169477..170817)
FT                   /locus_tag="SPC_0161"
FT   CDS_pept        complement(169477..170817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0161"
FT                   /product="APC family, aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44352"
FT                   /db_xref="GOA:C0Q5L0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L0"
FT                   /protein_id="ACN44352.1"
FT                   /translation="MMDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAVAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VIAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVS
FT                   AVVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGRENPLPG
FT                   PVLSVRQRSLPAVYGGGIDHYADDARYGDLRVADSGMAAYPGRRLSV"
FT   gene            171380..172144
FT                   /gene="pdhR"
FT                   /locus_tag="SPC_0162"
FT   CDS_pept        171380..172144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="SPC_0162"
FT                   /product="transcriptional regulator of pyruvate
FT                   dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44353"
FT                   /db_xref="GOA:C0Q5L1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L1"
FT                   /protein_id="ACN44353.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            172304..174967
FT                   /gene="aceE"
FT                   /locus_tag="SPC_0163"
FT   CDS_pept        172304..174967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="SPC_0163"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44354"
FT                   /db_xref="GOA:C0Q5L2"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L2"
FT                   /protein_id="ACN44354.1"
FT                   /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAIPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            174982..176874
FT                   /gene="aceF"
FT                   /locus_tag="SPC_0164"
FT   CDS_pept        174982..176874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="SPC_0164"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44355"
FT                   /db_xref="GOA:C0Q5L3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L3"
FT                   /protein_id="ACN44355.1"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGAAPAAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEV
FT                   TEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEV
FT                   EGAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGE
FT                   VEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   SVTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   gene            177073..178501
FT                   /pseudo
FT                   /gene="lpdA"
FT                   /locus_tag="SPC_0165"
FT                   /note="frameshift compared to STM0154 in Salmonella
FT                   typhimurium LT2"
FT   gene            178588..178707
FT                   /locus_tag="SPC_0166"
FT   CDS_pept        178588..178707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44356"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L4"
FT                   /protein_id="ACN44356.1"
FT                   /translation="MMAKDNETAKFIVSAAVRFSKLMPSVVPLSVIFDQLIVS"
FT   gene            178790..179074
FT                   /locus_tag="SPC_0167"
FT   CDS_pept        178790..179074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0167"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44357"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L5"
FT                   /protein_id="ACN44357.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(179112..179903)
FT                   /locus_tag="SPC_0168"
FT   CDS_pept        complement(179112..179903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0168"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44358"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L6"
FT                   /protein_id="ACN44358.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   gene            complement(179973..181535)
FT                   /gene="yacH"
FT                   /locus_tag="SPC_0169"
FT   CDS_pept        complement(179973..181535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="SPC_0169"
FT                   /product="yacH"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44359"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L7"
FT                   /protein_id="ACN44359.1"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAATPAPEQ
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPKLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWRN
FT                   GVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMTQFQQRSHTANASLPAPGT
FT                   RDAQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQQH
FT                   PVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGSH
FT                   LNT"
FT   gene            182002..184521
FT                   /gene="acnB"
FT                   /locus_tag="SPC_0170"
FT   CDS_pept        182002..184521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="SPC_0170"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44360"
FT                   /db_xref="GOA:C0Q5L8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L8"
FT                   /protein_id="ACN44360.1"
FT                   /translation="MAALVELLKTPPVGEEEFLLDLLINRIPPGVDEAAYVKAGFLAAV
FT                   AKGDTTSPLVSPEKAIELLGTMQGGYNIHPLIDALDDAKLAPIAAKALSHTLLMFDNFY
FT                   DVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLAEKITVTVFKVTGETNTDDLSPAPDAW
FT                   SRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQIEALQKKGYPLAYVGDVVGTGSSRKS
FT                   ATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDVSNLNMGDVI
FT                   DVYPYKGEVRNHETGELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREALGLPHS
FT                   DVFRQAKDVAESSRGFSLAQKMVGRACGVKGIRPGAYCEPKMTSVGSQDTTGPMTRDEL
FT                   KDLACLGFSADLVMQSFCHTAAYPKPVDVTTHHTLPDFIMNRGGVSLRPGDGVIHSWLN
FT                   RMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPG
FT                   ITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSGRILEIEGLPDLKVEQAFELTDASAER
FT                   SAAGCTIKLNKEPIIEYLTSNIVLLKWMIAEGYGDRRTLERRIQGMEKWLADPQLLEAD
FT                   ADAEYAAVIDIDLADIKEPILCAPNDPDDARLLSDVQGEKIDEVFIGSCMTNIGHFRAA
FT                   GKLLDSHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGARIEIPGCSLCMGNQARV
FT                   ADGATVVSTSTRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAV
FT                   DTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            complement(184561..185025)
FT                   /locus_tag="SPC_0171"
FT   CDS_pept        complement(184561..185025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44361"
FT                   /db_xref="GOA:C0Q5L9"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5L9"
FT                   /protein_id="ACN44361.1"
FT                   /translation="MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFLPAIIGGPDSFLF
FT                   YFCRTIPELVIITGWIYSLLPAWLTGVACALIPLKLYQKIINRMILCAIAGGLITTLFN
FT                   FARYGFDISILPLIYGEVLIMLIPAIVAGAIMGGVITYLPGLREVKRNNK"
FT   gene            complement(185435..185701)
FT                   /locus_tag="SPC_0172"
FT   CDS_pept        complement(185435..185701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0172"
FT                   /product="conserved hypothetical protein-putative
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44362"
FT                   /db_xref="InterPro:IPR016919"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M0"
FT                   /protein_id="ACN44362.1"
FT                   /translation="MFRRYPGLSVRSAGTSRNAKKSVSCGLLQWADVICVMEQKHKDRL
FT                   MAEYRRIIENKPLHVLDIPDDYRYMDPELVRQLEELVPEVLGI"
FT   gene            185936..186391
FT                   /locus_tag="SPC_0173"
FT   CDS_pept        185936..186391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44363"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M1"
FT                   /protein_id="ACN44363.1"
FT                   /translation="MRPAVFLSPCCDNYLKAQCGIGALPGQRKTIMDYEFLRDVTGGVK
FT                   VRMSMGHEVVGHWFNEEVKDNLSLLDEVEQAARTVKGSERSWQRAGHEYTIWMDGEEVM
FT                   IRANQLDFSGDEMEEGMSYYDEESLSLCGMEDFLRVVAAYREFVSKA"
FT   gene            186626..187579
FT                   /gene="kdgT"
FT                   /locus_tag="SPC_0174"
FT   CDS_pept        186626..187579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="SPC_0174"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44364"
FT                   /db_xref="GOA:C0Q5M2"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M2"
FT                   /protein_id="ACN44364.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLSVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            187576..188847
FT                   /locus_tag="SPC_0175"
FT   CDS_pept        187576..188847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44365"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M3"
FT                   /protein_id="ACN44365.1"
FT                   /translation="MKMMVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLV
FT                   INTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRK
FT                   LAVIAAAIPAAGRTTLEGKCLVNGVPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYE
FT                   VFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLA
FT                   NALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQE
FT                   IASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKSAMSRQQLGERLSQRLGVVTL
FT                   NIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYYIEEMYCGD"
FT   gene            188837..189820
FT                   /locus_tag="SPC_0176"
FT   CDS_pept        188837..189820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0176"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44366"
FT                   /db_xref="GOA:C0Q5M4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M4"
FT                   /protein_id="ACN44366.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTARVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            189830..190597
FT                   /locus_tag="SPC_0177"
FT   CDS_pept        189830..190597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0177"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44367"
FT                   /db_xref="GOA:C0Q5M5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M5"
FT                   /protein_id="ACN44367.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLSEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(190627..191421)
FT                   /gene="speD"
FT                   /locus_tag="SPC_0178"
FT   CDS_pept        complement(190627..191421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="SPC_0178"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44368"
FT                   /db_xref="GOA:C0Q5M6"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5M6"
FT                   /protein_id="ACN44368.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
FT   gene            complement(191442..192302)
FT                   /gene="speE"
FT                   /locus_tag="SPC_0179"
FT   CDS_pept        complement(191442..192302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SPC_0179"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44369"
FT                   /db_xref="GOA:C0Q5M7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5M7"
FT                   /protein_id="ACN44369.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   gene            complement(192409..192735)
FT                   /gene="yacC"
FT                   /locus_tag="SPC_0180"
FT   CDS_pept        complement(192409..192735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="SPC_0180"
FT                   /product="yacC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44370"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M8"
FT                   /protein_id="ACN44370.1"
FT                   /translation="MLFGSLMALCANSYALTESEAEDMADLTAVFVFLKNDCGYQNLPN
FT                   SQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALARDSLSLL
FT                   AYVK"
FT   gene            192952..194568
FT                   /gene="yacK"
FT                   /locus_tag="SPC_0181"
FT   CDS_pept        192952..194568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacK"
FT                   /locus_tag="SPC_0181"
FT                   /product="putative multicopper oxidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44371"
FT                   /db_xref="GOA:C0Q5M9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5M9"
FT                   /protein_id="ACN44371.1"
FT                   /translation="MIMLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTAD
FT                   ASNRMQLIVKAGQSTFAGKNAATWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHW
FT                   HGLEIPGIVDGGPQGIIPAGGTRTVTFTPEQRAATCWIHPHKHGKTGRQVAMGLAGLVL
FT                   IEDDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAI
FT                   YPQHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGE
FT                   RFEVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMP
FT                   ALPLLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGE
FT                   MDHGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISG
FT                   VGDMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHA
FT                   YMAHCHLLEHEDTGMMLGFTV"
FT   gene            complement(194646..197036)
FT                   /gene="gcd"
FT                   /locus_tag="SPC_0182"
FT   CDS_pept        complement(194646..197036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="SPC_0182"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44372"
FT                   /db_xref="GOA:C0Q5N0"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N0"
FT                   /protein_id="ACN44372.1"
FT                   /translation="MAENNARSPRLLVTLTALFAALCGLYLLIGGVWLVAIGGSWYYPI
FT                   ACLVMLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRANATPAATSSSI
FT                   ADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYHEAKADTASPE
FT                   VIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTPGLYEPTSPPI
FT                   ITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLMWAFDPGAKDPNAIPADEHAFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQLRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSRLIPRGPGNPMEPPKDAKGT
FT                   GTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVWKKRIGTPRDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            197230..197778
FT                   /gene="hpt"
FT                   /locus_tag="SPC_0183"
FT   CDS_pept        197230..197778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SPC_0183"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44373"
FT                   /db_xref="GOA:C0Q5N1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N1"
FT                   /protein_id="ACN44373.1"
FT                   /translation="MVINMKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGL
FT                   LRGSFMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVED
FT                   IIDSGNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGID
FT                   YAQRYRHLPYVGKVVLLDE"
FT   gene            complement(197836..198498)
FT                   /gene="yadF"
FT                   /locus_tag="SPC_0184"
FT   CDS_pept        complement(197836..198498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadF"
FT                   /locus_tag="SPC_0184"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44374"
FT                   /db_xref="GOA:C0Q5N2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N2"
FT                   /protein_id="ACN44374.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVIATNRETLENGYHKGISALSLKYIPHQ"
FT   gene            198607..199533
FT                   /gene="yadG"
FT                   /locus_tag="SPC_0185"
FT   CDS_pept        198607..199533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="SPC_0185"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44375"
FT                   /db_xref="GOA:C0Q5N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N3"
FT                   /protein_id="ACN44375.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVEHKEAVLRSEKYLKQLDLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKN
FT                   LLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   gene            199530..200300
FT                   /gene="yadH"
FT                   /locus_tag="SPC_0186"
FT   CDS_pept        199530..200300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="SPC_0186"
FT                   /product="ABC transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44376"
FT                   /db_xref="GOA:C0Q5N4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N4"
FT                   /protein_id="ACN44376.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
FT   gene            complement(200417..201496)
FT                   /gene="stiH"
FT                   /locus_tag="SPC_0187"
FT   CDS_pept        complement(200417..201496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiH"
FT                   /locus_tag="SPC_0187"
FT                   /product="putative fimbriae"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44377"
FT                   /db_xref="GOA:C0Q5N5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N5"
FT                   /protein_id="ACN44377.1"
FT                   /translation="MKNLWMLLALSLFSGHALADGTMGNGSGWCQPTSGTHNFFFPLDQ
FT                   TITDTDENQAGKIVKESWSVGGEYSARCDCDNKDYQGVNYFTATTGDLTQKGTYSEAGS
FT                   NGQQMDFYVLVAGKLEIGTETYIVGNLKQYIPVPFSAISNQDPTAGGCTGADINKMSAG
FT                   NKGNVRIYITHPLVGEITIPETTIMNLYLSKTPGSSGDNIPPSVPPMAHVTMSGTITVP
FT                   QSCSINAGQVIEVRLPDIEGKDIRNLGDSPQNSHVTTQVNFTCSNVADGTNLSMSLNGA
FT                   TDPHNPDYLKTDNENLGIRISDKYDKTIVPGGSAELPIEDYTDGKGSTEFTAAPVNTTG
FT                   HVPHTGEYQATATLEIQIR"
FT   gene            complement(201505..204006)
FT                   /gene="stiC"
FT                   /locus_tag="SPC_0188"
FT   CDS_pept        complement(201505..204006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiC"
FT                   /locus_tag="SPC_0188"
FT                   /product="putative fimbrial usher"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44378"
FT                   /db_xref="GOA:C0Q5N6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N6"
FT                   /protein_id="ACN44378.1"
FT                   /translation="MCIALGSTFTHVAWARDYFNPAFIENHGQANRTSVDLSTFDNDKS
FT                   QLPGTYYVTININKTEIGTRNVDFQLATLSDGQQALQGCLRLQELKDNGVKTDLFPTLE
FT                   SEKGCVDLNVIPGASQRFDFQRQALSVSIPQLYIANNARGYVPPEKWQEGITALMLNYS
FT                   FSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNWSSNNGESGSWNSVYNYLQR
FT                   DIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQPNSQRGYAPTIRGIARSNAQV
FT                   IVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVKEADGSEQHFIVPYSSLPILQR
FT                   TGRAKYSVTVGKYRDYNNHTLDDFGQATLLYGLPWGITLYGGSQIAGDKYQSVAFGVGQ
FT                   NMQMLGAISLDSIWSHAKFDDGRKEIGQSWRVRYSKGVVSTGTTFSLAGYRYASENYNS
FT                   LSEVINPDDDFYDNYGKRHNRFEASVNQQISNTLGSLTLSWVKEDYWHSAQQMESLSAS
FT                   YNNSWGPVSYTLSYSYNKNTYQYRSDNDDDDNDDDRYNQNDRLFTLSLHVPFTVFDSRL
FT                   YASYMLNTRKHDATVNSTTLSGTALRDRNLNWSLQQSHSTQDGDSGGVNASYKGTYANL
FT                   NAGYNQSPDSQQVSYGISGGILAHENGITLSQPITGAAILIKAPGASGVSVENQTGVAT
FT                   DFRGYTVIPNVTPYYRYDISLDSSTFADNVDIPLNNQTVYPTRNAVVRAAYDTHKGYRV
FT                   LLTLTRSNGEPVPFGATASVDGQDANLASIVGDKGQVFLSGLPEEGLLLVNWGSASCRA
FT                   DYRLDISKNMNGIVMANAVCQ"
FT   gene            complement(204078..204761)
FT                   /gene="stiB"
FT                   /locus_tag="SPC_0189"
FT   CDS_pept        complement(204078..204761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiB"
FT                   /locus_tag="SPC_0189"
FT                   /product="putative fimbrial chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44379"
FT                   /db_xref="GOA:C0Q5N7"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N7"
FT                   /protein_id="ACN44379.1"
FT                   /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDASISIS
FT                   NNDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGSNLPEDRES
FT                   LYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLT
FT                   VKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGPIAWSIINDFGGTGPE
FT                   HKQTP"
FT   gene            complement(204809..205348)
FT                   /gene="stiA"
FT                   /locus_tag="SPC_0190"
FT   CDS_pept        complement(204809..205348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stiA"
FT                   /locus_tag="SPC_0190"
FT                   /product="putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44380"
FT                   /db_xref="GOA:C0Q5N8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N8"
FT                   /protein_id="ACN44380.1"
FT                   /translation="MKLSLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTVK
FT                   TDSVEVTLQEEFASLFTAAGQTAGDTDFTIELENCDANIYSSVQARFEGTLDGTDATIL
FT                   KNEDDAENIGVQILDKTSTPMTFNDLQAWSAAVALPTAEGVTELSMPFTVRYIATAVPV
FT                   KSGTVDATATFYLQYN"
FT   gene            complement(205563..205676)
FT                   /locus_tag="SPC_0191"
FT   CDS_pept        complement(205563..205676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44381"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5N9"
FT                   /protein_id="ACN44381.1"
FT                   /translation="MFFWPTTHYDHDHFLFKKICIIFKIVSSLHRIWPIKG"
FT   gene            205718..206158
FT                   /gene="yadI"
FT                   /locus_tag="SPC_0192"
FT   CDS_pept        205718..206158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="SPC_0192"
FT                   /product="putative PTS enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44382"
FT                   /db_xref="GOA:C0Q5P0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P0"
FT                   /protein_id="ACN44382.1"
FT                   /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMITWR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
FT   gene            206226..207449
FT                   /gene="yadE"
FT                   /locus_tag="SPC_0193"
FT   CDS_pept        206226..207449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="SPC_0193"
FT                   /product="yadE"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44383"
FT                   /db_xref="GOA:C0Q5P1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P1"
FT                   /protein_id="ACN44383.1"
FT                   /translation="MRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTVGN
FT                   IRAGQILSVTPVAADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSNQNLV
FT                   TWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLKGRLHQTWYQIRIGDRLAYVSAMDAQ
FT                   EDNGIPILTYHHILRDEENTRFRHTSTTISVRAFSNQMTWLRDRGYATLTMYQLEDYIY
FT                   NRANFPARAVAITFDDGLKSVSRYAYPVLKQYDMKATAFIISSRIKRHPQKWNPRSLQF
FT                   MSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALAQFTPHV
FT                   FYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETMSR
FT                   LISNQPQG"
FT   gene            complement(207456..207836)
FT                   /gene="panD"
FT                   /locus_tag="SPC_0194"
FT   CDS_pept        complement(207456..207836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="SPC_0194"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44384"
FT                   /db_xref="GOA:C0Q5P2"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5P2"
FT                   /protein_id="ACN44384.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            complement(207931..208785)
FT                   /gene="panC"
FT                   /locus_tag="SPC_0195"
FT   CDS_pept        complement(207931..208785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SPC_0195"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44385"
FT                   /db_xref="GOA:C0Q5P3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5P3"
FT                   /protein_id="ACN44385.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQGLE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLQELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   gene            complement(208911..209702)
FT                   /gene="panB"
FT                   /locus_tag="SPC_0196"
FT   CDS_pept        complement(208911..209702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SPC_0196"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44386"
FT                   /db_xref="GOA:C0Q5P4"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5P4"
FT                   /protein_id="ACN44386.1"
FT                   /translation="MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGD
FT                   SLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAIVM
FT                   RAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQVLL
FT                   DDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLAEAGDMRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(209823..210302)
FT                   /gene="folK"
FT                   /locus_tag="SPC_0197"
FT   CDS_pept        complement(209823..210302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SPC_0197"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44387"
FT                   /db_xref="GOA:C0Q5P5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P5"
FT                   /protein_id="ACN44387.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW"
FT   gene            complement(210299..211717)
FT                   /gene="pcnB"
FT                   /locus_tag="SPC_0198"
FT   CDS_pept        complement(210299..211717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="SPC_0198"
FT                   /product="polyA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44388"
FT                   /db_xref="GOA:C0Q5P6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P6"
FT                   /protein_id="ACN44388.1"
FT                   /translation="MTLPRCAIFTRVANFCRKVLSREESEAEQAVARPHMTIIPREQHA
FT                   ISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFR
FT                   NCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGSESDRTTSQRGQNGMLLRDNIFGSIEE
FT                   DAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLRAVRF
FT                   AAKLNMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGNGYETYQQLREYHLFQP
FT                   LFPTITRYFTENGDSAMERIIAQVLKNTDNRIRNEMRVNPAFLFAAMFWYPLLEMAQKI
FT                   AQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLM
FT                   EHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQASAPPEQKGMLNELDDDPAPRRRR
FT                   SRPRKRAPRREGTV"
FT   gene            complement(211858..212799)
FT                   /gene="yadB"
FT                   /locus_tag="SPC_0199"
FT   CDS_pept        complement(211858..212799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="SPC_0199"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44389"
FT                   /db_xref="GOA:C0Q5P7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P7"
FT                   /protein_id="ACN44389.1"
FT                   /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGSY
FT                   LQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYCEAL
FT                   AWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMHFHDALRG
FT                   DIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQ
FT                   FGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVAWQEMS
FT                   VEELLRFAVAHWRLTAVPTSANVNPAFSNASR"
FT   gene            complement(212823..213278)
FT                   /gene="dksA"
FT                   /locus_tag="SPC_0200"
FT   CDS_pept        complement(212823..213278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="SPC_0200"
FT                   /product="dosage-dependent dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44390"
FT                   /db_xref="GOA:C0Q5P8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P8"
FT                   /protein_id="ACN44390.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(213455..214165)
FT                   /gene="sfsA"
FT                   /locus_tag="SPC_0201"
FT   CDS_pept        complement(213455..214165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="SPC_0201"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44391"
FT                   /db_xref="GOA:C0Q5P9"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5P9"
FT                   /protein_id="ACN44391.1"
FT                   /translation="MSMLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTG
FT                   CATPGDTVWYSTSENTKRKYPHTWELTETQFGAFICVNTLRANQLTKEAIQENRLPALA
FT                   GYNILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHL
FT                   RELMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELS
FT                   AQKMELNEPVPITL"
FT   gene            complement(214176..214706)
FT                   /gene="ligT"
FT                   /locus_tag="SPC_0202"
FT   CDS_pept        complement(214176..214706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="SPC_0202"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44392"
FT                   /db_xref="GOA:C0Q5Q0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q0"
FT                   /protein_id="ACN44392.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSNDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            214734..217208
FT                   /gene="hrpB"
FT                   /locus_tag="SPC_0203"
FT   CDS_pept        214734..217208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="SPC_0203"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44393"
FT                   /db_xref="GOA:C0Q5Q1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q1"
FT                   /protein_id="ACN44393.1"
FT                   /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKTAPQVLLSAPTG
FT                   AGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSC
FT                   VGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRD
FT                   DLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAEL
FT                   LRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMR
FT                   KVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAG
FT                   RLAPGICLHLLAKEQAERAGAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEV
FT                   NLQAARRLLLMLGALEGERLSARGRKMAATGNDPRLAAMLVNAGEGDSAATAAMLAAIL
FT                   EDPPRGGGTDLSVVFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIAR
FT                   RRGQEGRYQLANGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQ
FT                   ACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKG
FT                   LSVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLK
FT                   SLNVTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEA
FT                   KTPTIAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            217349..219871
FT                   /gene="mrcB"
FT                   /locus_tag="SPC_0204"
FT   CDS_pept        217349..219871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SPC_0204"
FT                   /product="penicillin-binding protein 1b"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44394"
FT                   /db_xref="GOA:C0Q5Q2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q2"
FT                   /protein_id="ACN44394.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIVEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCSGGMRTLPVWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            complement(220010..220150)
FT                   /locus_tag="SPC_0205"
FT   CDS_pept        complement(220010..220150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44395"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q3"
FT                   /protein_id="ACN44395.1"
FT                   /translation="MKVNDNVNDNYYYNRSMIGEISSQWQAIRGPTKTKGLRNNQMKRK
FT                   G"
FT   gene            220164..222353
FT                   /gene="fhuA"
FT                   /locus_tag="SPC_0206"
FT   CDS_pept        220164..222353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SPC_0206"
FT                   /product="outer membrane ferrichrome receptor protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44396"
FT                   /db_xref="GOA:C0Q5Q4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q4"
FT                   /protein_id="ACN44396.1"
FT                   /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAAQESAWGPAPTIAAKRSATTTKTDTPIEKTPQSVSVVTNEEMQMHQFQSVKEALG
FT                   YTPGVTVSSRGASNTYDFVIIRGFSSVGLSQNNYLDGLKLQGNFYNDAVIDPYMLERVE
FT                   LMRGPTSVLYGKSNPGGIISMVSKRPTTEPLKEIQFKMGTDNLFQTGFDFSDSLDDNGE
FT                   FSYRLTGLARSTNEQQKSAESQRYAIAPSFTWRPDEKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGASNNTYSRNEKMVGYSFEHGFNDTFTVRQNLRFVEMKT
FT                   AQKSVYGTGIAADGHTLNRGTIVDNERLQNFSVDTQLESKFATGDIDHTLLTGVDFMRM
FT                   RNDINATFGSAPSIDLYNNYHPEYFAFGGAEPYQMNESKQTGLYVQDQAEWNKWVFTLG
FT                   GRYDWSKQAATVRQNSTTPTEGYIERNDHQFTWRGGVNYVFDNGISPYFSYSQSFEPSA
FT                   FDLWSTPRVSYKPSKGEQYEAGVKYVPKDMPVVVTGAVYQLTKTNNLTADPTNPLAQVP
FT                   AGEIRARGVELEAKAALTANINMTASYTYTDAEYTKDTNLKGNTPEQVPEHMASLWGDY
FT                   TFNDGPLSGLTLGTGGRFIGSSYGDPANSFKVGSAAVMDAVVKYDLARFGMAGSSIAVN
FT                   VNNLLDREYVASCFQTYGCFWGAERQVVATATFRF"
FT   gene            222402..223199
FT                   /gene="fhuC"
FT                   /locus_tag="SPC_0207"
FT   CDS_pept        222402..223199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SPC_0207"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44397"
FT                   /db_xref="GOA:C0Q5Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q5"
FT                   /protein_id="ACN44397.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQLPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            223199..224089
FT                   /gene="fhuD"
FT                   /locus_tag="SPC_0208"
FT   CDS_pept        223199..224089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SPC_0208"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44398"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q6"
FT                   /protein_id="ACN44398.1"
FT                   /translation="MRDLYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGHGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SIDRLAMYKEADVICFDHGNSTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILDNVLGGKA"
FT   gene            224086..226143
FT                   /gene="fhuB"
FT                   /locus_tag="SPC_0209"
FT   CDS_pept        224086..226143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SPC_0209"
FT                   /product="ferrichrome transport protein FhuB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44399"
FT                   /db_xref="GOA:C0Q5Q7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q7"
FT                   /protein_id="ACN44399.1"
FT                   /translation="MSRKREMPDGGAKSALSDLRFGRFVGRIRRSRHPALLLLALFVAT
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGALLLLATWGALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNAMASPEVLGISSGAAF
FT                   GVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMMLQASGVPRMAEVLTWIAGSTYNATDGQVTRTAIVMVILLALVPLCRRWLTILPLG
FT                   GDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSQ"
FT   gene            226180..226386
FT                   /locus_tag="SPC_0210"
FT   CDS_pept        226180..226386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44400"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q8"
FT                   /protein_id="ACN44400.1"
FT                   /translation="MLNPTYKLHNINMLWQYFVDLKIAERYQVRELSCHVLSREFCFYF
FT                   QQEAGVISVSISHVLFQWRAAVS"
FT   gene            227082..227642
FT                   /gene="stfA"
FT                   /locus_tag="SPC_0211"
FT   CDS_pept        227082..227642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfA"
FT                   /locus_tag="SPC_0211"
FT                   /product="putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44401"
FT                   /db_xref="GOA:C0Q5Q9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5Q9"
FT                   /protein_id="ACN44401.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSSASTIDTGEFSSTVNFTISYL"
FT   gene            227728..230385
FT                   /gene="stfC"
FT                   /locus_tag="SPC_0212"
FT   CDS_pept        227728..230385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfC"
FT                   /locus_tag="SPC_0212"
FT                   /product="putative fimbrial outer membrane usher"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44402"
FT                   /db_xref="GOA:C0Q5R0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R0"
FT                   /protein_id="ACN44402.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIAQDNIITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGSFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERMDDRNNYQINAGRADNGATLDG
FT                   YYRHQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSVNGGSRLMVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNLVKIDITQLPEDAEATLSIAQATLTEG
FT                   AIGYRRMEVLSGKKAMASIRLRDGGTPPFGAEVYNSRQQQLGIVGEDGSVYLIGINPGE
FT                   RLQVTWEGKTQCEAALPDPLPGDLFSGLLLPCIGDASSPEATQPEEKPLLQLHTQRRTS
FT                   STQPEALSSRYPTH"
FT   gene            230403..231155
FT                   /pseudo
FT                   /gene="stfD"
FT                   /locus_tag="SPC_0213"
FT                   /note="stop compared to STM0197 in Salmonella typhimurium
FT                   LT2"
FT   gene            231219..231686
FT                   /gene="stfE"
FT                   /locus_tag="SPC_0214"
FT   CDS_pept        231219..231686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfE"
FT                   /locus_tag="SPC_0214"
FT                   /product="putative minor fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44403"
FT                   /db_xref="GOA:C0Q5R1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R1"
FT                   /protein_id="ACN44403.1"
FT                   /translation="MLSAVSMPLAAGSKTVNMTLTIVVNAAPPCTVTGGEVEFGNVLTT
FT                   KVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQTDVDGLGIRLQTATDG
FT                   ALVSPGNTQWLSFQYSGGSGPAIEAIPVKDNGVTLTGGAFNAGATLVVDYQ"
FT   gene            231683..232159
FT                   /gene="stfF"
FT                   /locus_tag="SPC_0215"
FT   CDS_pept        231683..232159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfF"
FT                   /locus_tag="SPC_0215"
FT                   /product="putative minor fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44404"
FT                   /db_xref="GOA:C0Q5R2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R2"
FT                   /protein_id="ACN44404.1"
FT                   /translation="MKKMALMVLISSSFAAQSAENLKFHGTLISPPNCTISHNQTIEVK
FT                   FGNMLISKIDGTRYAQNVPYEITCDSAVRDDTMTMTLTLSGSVTDFNQAAINTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSAPVLKAIPVKKSGASLTEGDFDATATLQVDYQ"
FT   gene            232159..232689
FT                   /gene="stfG"
FT                   /locus_tag="SPC_0216"
FT   CDS_pept        232159..232689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfG"
FT                   /locus_tag="SPC_0216"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44405"
FT                   /db_xref="GOA:C0Q5R3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R3"
FT                   /protein_id="ACN44405.1"
FT                   /translation="MVKKQTLLHGVVFILWGTLILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GADIAEVDFSSLDASDFIPGGQSARKPLVFELTDCDSALSNGVQVIFTGTEATGMRGIL
FT                   AIDSYSGASGIGIGIETLSGVPVGINNESGAVFTLVTGKNTLSLNAWVQRLPGEDLIPG
FT                   RFSASALATFEYL"
FT   gene            232689..233534
FT                   /locus_tag="SPC_0217"
FT   CDS_pept        232689..233534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44406"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R4"
FT                   /protein_id="ACN44406.1"
FT                   /translation="MKIIRTLFLLLIAVYGGSVSARPMLKATFGSTTLYYGIGPSYADR
FT                   AVILNSTVTTPDGVYYGSWKFSGMARKGATATLLSWTGPDPAPTIVLRDFDNSISKSNC
FT                   KNLPSSWNGCGYYTVDITVQSDNYGCPWLAATHSTAEDLVSGETYSAPDTRSSVCPKIP
FT                   VDTFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVS
FT                   SGITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL
FT                   "
FT   gene            complement(233642..234922)
FT                   /gene="hemL"
FT                   /locus_tag="SPC_0218"
FT   CDS_pept        complement(233642..234922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="SPC_0218"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44407"
FT                   /db_xref="GOA:C0Q5R5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5R5"
FT                   /protein_id="ACN44407.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQ
FT                   EVGIPLVVNHVGGMFGIFFTDAETVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSEEDINNTIDAARRVFAKQ"
FT   gene            235092..236513
FT                   /gene="yadQ"
FT                   /locus_tag="SPC_0219"
FT   CDS_pept        235092..236513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="SPC_0219"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44408"
FT                   /db_xref="GOA:C0Q5R6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5R6"
FT                   /protein_id="ACN44408.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLLFIFITR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAAKNQNASAGENT"
FT   gene            236583..236939
FT                   /gene="yadR"
FT                   /locus_tag="SPC_0220"
FT   CDS_pept        236583..236939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="SPC_0220"
FT                   /product="yadR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44409"
FT                   /db_xref="GOA:C0Q5R7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R7"
FT                   /protein_id="ACN44409.1"
FT                   /translation="MEQNMSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGG
FT                   CSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNP
FT                   NAKSTCGCGSSFSI"
FT   gene            complement(237040..237663)
FT                   /gene="yadS"
FT                   /locus_tag="SPC_0221"
FT   CDS_pept        complement(237040..237663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="SPC_0221"
FT                   /product="yadS"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44410"
FT                   /db_xref="GOA:C0Q5R8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R8"
FT                   /protein_id="ACN44410.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(237700..238488)
FT                   /gene="btuF"
FT                   /locus_tag="SPC_0222"
FT   CDS_pept        complement(237700..238488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="SPC_0222"
FT                   /product="vitamin B12-transporter protein BtuF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44411"
FT                   /db_xref="GOA:C0Q5R9"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5R9"
FT                   /protein_id="ACN44411.1"
FT                   /translation="MFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPVGVSS
FT                   YSDYPPEAQKIEQVSTWQGMNLERIVAMKPDLVVAWRGGNAERQVNQLTSLGIKVMWVD
FT                   AVSIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFGMNPL
FT                   FTSSKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEILKIEQ
FT                   YWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(238493..239191)
FT                   /gene="mtn"
FT                   /locus_tag="SPC_0223"
FT   CDS_pept        complement(238493..239191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="SPC_0223"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44412"
FT                   /db_xref="GOA:C0Q5S0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5S0"
FT                   /protein_id="ACN44412.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   gene            239234..240793
FT                   /gene="dgt"
FT                   /locus_tag="SPC_0224"
FT   CDS_pept        239234..240793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="SPC_0224"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44413"
FT                   /db_xref="GOA:C0Q5S1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S1"
FT                   /protein_id="ACN44413.1"
FT                   /translation="MRLWGSAFLRRGEDMASIDFRNKINWHRRYRSPQGVKTEHEILRI
FT                   FESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKE
FT                   QNRLEEYGLDALTGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQP
FT                   LTHDRCVVSSLRLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGG
FT                   ILKYTRPAWWRGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAA
FT                   DDISYCVADLEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSR
FT                   STEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNV
FT                   AVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLF
FT                   QKLSTRHRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAV
FT                   EQ"
FT   gene            240923..242350
FT                   /gene="htrA"
FT                   /locus_tag="SPC_0225"
FT   CDS_pept        240923..242350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="SPC_0225"
FT                   /product="protease DO precursor"
FT                   /note="heat shock protein HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44414"
FT                   /db_xref="GOA:C0Q5S2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S2"
FT                   /protein_id="ACN44414.1"
FT                   /translation="MKKTTLAMSALALSLGLTLSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
FT   gene            242479..243660
FT                   /gene="yaeG"
FT                   /locus_tag="SPC_0226"
FT   CDS_pept        242479..243660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeG"
FT                   /locus_tag="SPC_0226"
FT                   /product="yaeG"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44415"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S3"
FT                   /protein_id="ACN44415.1"
FT                   /translation="MLCSLEGFMAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIG
FT                   SGDRERIGELHEGELLVLSQGRVVDIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTG
FT                   EPEHLRKYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQR
FT                   LGIDLNQPRVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKP
FT                   ALNSFGRWDAEDHRKRVEQLISRMKDNGQLRFRVALGNYFTGPGSIARSYRTARTTMMV
FT                   GKQRMPESRSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFR
FT                   HNVQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVVLQLDEQR"
FT   gene            complement(243749..244153)
FT                   /gene="yaeH"
FT                   /locus_tag="SPC_0227"
FT   CDS_pept        complement(243749..244153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="SPC_0227"
FT                   /product="yaeH"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44416"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S4"
FT                   /protein_id="ACN44416.1"
FT                   /translation="MMKDTAMYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRG
FT                   EFFAKSVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKR
FT                   KILDDLRHLESVVANKISEIEADLDKLTRK"
FT   gene            244381..245682
FT                   /locus_tag="SPC_0228"
FT   CDS_pept        244381..245682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0228"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44417"
FT                   /db_xref="GOA:C0Q5S5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S5"
FT                   /protein_id="ACN44417.1"
FT                   /translation="MSGTYNATIRRVVISAWIGNSIEYYDFLLYGLASALVFGPLFFPG
FT                   ASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGCLP
FT                   SYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGLTGQ
FT                   LLATGVFIVVTQLPKEALLSWGWRIPFLLSALLVLPRLYMRHRLDETPVFRAFKKQQAI
FT                   NHRQQREERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIASLTIL
FT                   YIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSLILMTMG
FT                   YVLLINIGHNSLNAVQPSFFAGLFHPPVRYSGSSIGAQLGAVVAGGFTPFIAKALSAVY
FT                   DNSWTLVAGYVVLTALASAFAAKIAPETVLPHSP"
FT   gene            complement(245719..246543)
FT                   /gene="dapD"
FT                   /locus_tag="SPC_0229"
FT   CDS_pept        complement(245719..246543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="SPC_0229"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44418"
FT                   /db_xref="GOA:C0Q5S6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q5S6"
FT                   /protein_id="ACN44418.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAVKQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(246573..249254)
FT                   /gene="glnD"
FT                   /locus_tag="SPC_0230"
FT   CDS_pept        complement(246573..249254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SPC_0230"
FT                   /product="PII uridylyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44419"
FT                   /db_xref="GOA:C0Q5S7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S7"
FT                   /protein_id="ACN44419.1"
FT                   /translation="MAHMNTHPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDI
FT                   FQHWLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELH
FT                   PLSDIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVAT
FT                   NLIETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDI
FT                   KSSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHL
FT                   VVSRYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEA
FT                   ILALPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTT
FT                   LRHLRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIV
FT                   GQMQFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFH
FT                   DIAKGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEV
FT                   IKQFAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNT
FT                   PDMRERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHD
FT                   LRQPLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMD
FT                   TFIVLEPDGSPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPT
FT                   HTDRKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRAL
FT                   NNVLQLEVQQRLTAALNPNDKG"
FT   gene            complement(249358..250152)
FT                   /gene="map"
FT                   /locus_tag="SPC_0231"
FT   CDS_pept        complement(249358..250152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="SPC_0231"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44420"
FT                   /db_xref="GOA:C0Q5S8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S8"
FT                   /protein_id="ACN44420.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   gene            250618..251328
FT                   /gene="rpsB"
FT                   /locus_tag="SPC_0232"
FT   CDS_pept        250618..251328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="SPC_0232"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44421"
FT                   /db_xref="GOA:C0Q5S9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q5S9"
FT                   /protein_id="ACN44421.1"
FT                   /translation="MRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMF
FT                   NEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNWKTVRQ
FT                   SIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADH
FT                   EHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVREGRSQ
FT                   DLASQAEESFVEAE"
FT   gene            251541..252437
FT                   /gene="tsf"
FT                   /locus_tag="SPC_0233"
FT   CDS_pept        251541..252437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="SPC_0233"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44422"
FT                   /db_xref="GOA:C0Q6J3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J3"
FT                   /protein_id="ACN44422.1"
FT                   /translation="MRFDAGQIKSFEDFRMAEITASLVKELRERTGAGMMDCKKALTEA
FT                   NGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGF
FT                   QAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQH
FT                   GARIGVLVAAKGADEELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGK
FT                   PKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIE
FT                   KVETDFAAEVAAMSKQS"
FT   gene            252582..253307
FT                   /gene="pyrH"
FT                   /locus_tag="SPC_0234"
FT   CDS_pept        252582..253307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SPC_0234"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44423"
FT                   /db_xref="GOA:C0Q6J4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J4"
FT                   /protein_id="ACN44423.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            253454..254011
FT                   /gene="frr"
FT                   /locus_tag="SPC_0235"
FT   CDS_pept        253454..254011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SPC_0235"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44424"
FT                   /db_xref="GOA:C0Q6J5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6J5"
FT                   /protein_id="ACN44424.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            254063..255349
FT                   /gene="dxr"
FT                   /locus_tag="SPC_0236"
FT   CDS_pept        254063..255349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="SPC_0236"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44425"
FT                   /db_xref="GOA:C0Q6J6"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J6"
FT                   /protein_id="ACN44425.1"
FT                   /translation="MVYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGC
FT                   STLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGS
FT                   RTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGR
FT                   LFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRE
FT                   TPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIH
FT                   PQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAP
FT                   DYQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDL
FT                   QEPASVEDVLQVDAIAREVARKQVIRLSR"
FT   gene            255662..256420
FT                   /gene="uppS"
FT                   /locus_tag="SPC_0237"
FT   CDS_pept        255662..256420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SPC_0237"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44426"
FT                   /db_xref="GOA:C0Q6J7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J7"
FT                   /protein_id="ACN44426.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            256433..257290
FT                   /gene="cdsA"
FT                   /locus_tag="SPC_0238"
FT   CDS_pept        256433..257290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SPC_0238"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44427"
FT                   /db_xref="GOA:C0Q6J8"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J8"
FT                   /protein_id="ACN44427.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            257302..258654
FT                   /gene="yaeL"
FT                   /locus_tag="SPC_0239"
FT   CDS_pept        257302..258654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="SPC_0239"
FT                   /product="yaeL"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44428"
FT                   /db_xref="GOA:C0Q6J9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6J9"
FT                   /protein_id="ACN44428.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQEGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEVERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            258686..261103
FT                   /gene="yaeT"
FT                   /locus_tag="SPC_0240"
FT   CDS_pept        258686..261103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="SPC_0240"
FT                   /product="outer membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44429"
FT                   /db_xref="GOA:C0Q6K0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K0"
FT                   /protein_id="ACN44429.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIEKLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNK
FT                   LDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGD
FT                   GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYGYGAHTDPNDNNDDYEACTQSSGC
FT                   KSDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVP
FT                   DYSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            261226..261711
FT                   /gene="ompH"
FT                   /locus_tag="SPC_0241"
FT   CDS_pept        261226..261711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompH"
FT                   /locus_tag="SPC_0241"
FT                   /product="outer membrane protein OmpH precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44430"
FT                   /db_xref="GOA:C0Q6K1"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6K1"
FT                   /protein_id="ACN44430.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQHQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            261715..262740
FT                   /gene="lpxD"
FT                   /locus_tag="SPC_0242"
FT   CDS_pept        261715..262740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="SPC_0242"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44431"
FT                   /db_xref="GOA:C0Q6K2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6K2"
FT                   /protein_id="ACN44431.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            262846..263301
FT                   /gene="fabZ"
FT                   /locus_tag="SPC_0243"
FT   CDS_pept        262846..263301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SPC_0243"
FT                   /product="(3R)-hydroxymyristoyl ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44432"
FT                   /db_xref="GOA:C0Q6K3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K3"
FT                   /protein_id="ACN44432.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            263305..264093
FT                   /gene="lpxA"
FT                   /locus_tag="SPC_0244"
FT   CDS_pept        263305..264093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="SPC_0244"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44433"
FT                   /db_xref="GOA:C0Q6K4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K4"
FT                   /protein_id="ACN44433.1"
FT                   /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            264093..265241
FT                   /gene="lpxB"
FT                   /locus_tag="SPC_0245"
FT   CDS_pept        264093..265241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="SPC_0245"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44434"
FT                   /db_xref="GOA:C0Q6K5"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K5"
FT                   /protein_id="ACN44434.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   gene            265238..265834
FT                   /gene="rnhB"
FT                   /locus_tag="SPC_0246"
FT   CDS_pept        265238..265834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="SPC_0246"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44435"
FT                   /db_xref="GOA:C0Q6K6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K6"
FT                   /protein_id="ACN44435.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPALPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            265906..269340
FT                   /gene="dnaE"
FT                   /locus_tag="SPC_0247"
FT   CDS_pept        265906..269340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SPC_0247"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44436"
FT                   /db_xref="GOA:C0Q6K7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6K7"
FT                   /protein_id="ACN44436.1"
FT                   /translation="MIDGLAKTGPLVKKAASLGMPALAITDFTNLCGLVKFYGAGHGAG
FT                   IKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIERDW
FT                   LVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYETHFPDRYFLELIRTGRQDEE
FT                   TYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQ
FT                   YMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQFPTGDMTTEDYLVKKSK
FT                   EGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGYFLIVMEFIQWSKDNGV
FT                   PVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVI
FT                   EHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLAKA
FT                   FEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEE
FT                   GKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRREKNGEPPLDIAAIPLD
FT                   DKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNF
FT                   IDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRR
FT                   AMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSY
FT                   QTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDE
FT                   GEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDTKKLNRRVLEKLIMSGA
FT                   FDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPE
FT                   QVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTERGKVTTAAGLVIAARV
FT                   MVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLK
FT                   MTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRAD
FT                   ARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            269353..270312
FT                   /gene="accA"
FT                   /locus_tag="SPC_0248"
FT   CDS_pept        269353..270312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SPC_0248"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44437"
FT                   /db_xref="GOA:C0Q6K8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6K8"
FT                   /protein_id="ACN44437.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPKRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            270493..272256
FT                   /locus_tag="SPC_0249"
FT   CDS_pept        270493..272256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0249"
FT                   /product="putative secreted chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44438"
FT                   /db_xref="GOA:C0Q6K9"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6K9"
FT                   /protein_id="ACN44438.1"
FT                   /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAAK
FT                   EKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRA
FT                   PEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEW
FT                   RQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNY
FT                   NYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPND
FT                   RDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGC
FT                   KKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQH
FT                   YFNVNVVDDNGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSQVSLSAEGSTDAN
FT                   GDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSSTAVYTLNVK
FT                   AKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGV
FT                   GIAWADAWNAL"
FT   gene            272332..274473
FT                   /gene="ldcC"
FT                   /locus_tag="SPC_0250"
FT   CDS_pept        272332..274473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="SPC_0250"
FT                   /product="lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44439"
FT                   /db_xref="GOA:C0Q6L0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L0"
FT                   /protein_id="ACN44439.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPKREFT
FT                   RDSIARKVAETAQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFADADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            274529..274918
FT                   /gene="yaeR"
FT                   /locus_tag="SPC_0251"
FT   CDS_pept        274529..274918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="SPC_0251"
FT                   /product="yaeR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44440"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L1"
FT                   /protein_id="ACN44440.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEAWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            274981..276272
FT                   /pseudo
FT                   /gene="mesJ"
FT                   /locus_tag="SPC_0252"
FT                   /note="frameshift compared to STM0236 in Salmonella
FT                   typhimurium LT2"
FT   gene            complement(276356..276550)
FT                   /locus_tag="SPC_0253"
FT   CDS_pept        complement(276356..276550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0253"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44441"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L2"
FT                   /protein_id="ACN44441.1"
FT                   /translation="MHHLILMLTLKDGEVLQAKANDLILRKNVEYLLAEVSGESCELRL
FT                   DKIASFSHPEIGTVVVSES"
FT   gene            complement(276603..276821)
FT                   /gene="yaeP"
FT                   /locus_tag="SPC_0254"
FT   CDS_pept        complement(276603..276821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="SPC_0254"
FT                   /product="yaeP"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44442"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L3"
FT                   /protein_id="ACN44442.1"
FT                   /translation="MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
FT   gene            277001..277546
FT                   /gene="yaeQ"
FT                   /locus_tag="SPC_0255"
FT   CDS_pept        277001..277546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="SPC_0255"
FT                   /product="yaeQ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44443"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L4"
FT                   /protein_id="ACN44443.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            277543..277965
FT                   /gene="yaeJ"
FT                   /locus_tag="SPC_0256"
FT   CDS_pept        277543..277965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="SPC_0256"
FT                   /product="yaeJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44444"
FT                   /db_xref="GOA:C0Q6L5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L5"
FT                   /protein_id="ACN44444.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
FT   gene            277997..278698
FT                   /gene="cutF"
FT                   /locus_tag="SPC_0257"
FT   CDS_pept        277997..278698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="SPC_0257"
FT                   /product="copper homeostasis protein CutF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44445"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L6"
FT                   /protein_id="ACN44445.1"
FT                   /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSN
FT                   GEKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFT
FT                   DCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVLAANPDTGEPVKTLIADKN
FT                   VKFAPGKDCTH"
FT   gene            complement(278772..280490)
FT                   /gene="proS"
FT                   /locus_tag="SPC_0258"
FT   CDS_pept        complement(278772..280490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SPC_0258"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44446"
FT                   /db_xref="GOA:C0Q6L7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6L7"
FT                   /protein_id="ACN44446.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAAKDSKSTLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   EGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGKKSLIKTGDIVDYLVKAIKG"
FT   gene            complement(280601..281308)
FT                   /gene="yaeB"
FT                   /locus_tag="SPC_0259"
FT   CDS_pept        complement(280601..281308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="SPC_0259"
FT                   /product="yaeB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44447"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L8"
FT                   /protein_id="ACN44447.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQA
FT                   DAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VALKSIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPV
FT                   SFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   VNTGFEVFALEPR"
FT   gene            complement(281305..281709)
FT                   /gene="rcsF"
FT                   /locus_tag="SPC_0260"
FT   CDS_pept        complement(281305..281709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="SPC_0260"
FT                   /product="RcsF protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44448"
FT                   /db_xref="GOA:C0Q6L9"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6L9"
FT                   /protein_id="ACN44448.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   gene            complement(281828..282643)
FT                   /gene="yaeC"
FT                   /locus_tag="SPC_0261"
FT   CDS_pept        complement(281828..282643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeC"
FT                   /locus_tag="SPC_0261"
FT                   /product="putative lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44449"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M0"
FT                   /protein_id="ACN44449.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(282682..283320)
FT                   /gene="yaeE"
FT                   /locus_tag="SPC_0262"
FT   CDS_pept        complement(282682..283320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="SPC_0262"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44450"
FT                   /db_xref="GOA:C0Q6M1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M1"
FT                   /protein_id="ACN44450.1"
FT                   /translation="MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENA
FT                   RLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFIARMVE
FT                   NALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAMGGAVG
FT                   AGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(283328..284359)
FT                   /gene="abc"
FT                   /locus_tag="SPC_0263"
FT   CDS_pept        complement(283328..284359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abc"
FT                   /locus_tag="SPC_0263"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44451"
FT                   /db_xref="GOA:C0Q6M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M2"
FT                   /protein_id="ACN44451.1"
FT                   /translation="MIKLSNITKVFQQGARTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   gene            284549..285115
FT                   /gene="yaeD"
FT                   /locus_tag="SPC_0264"
FT   CDS_pept        284549..285115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeD"
FT                   /locus_tag="SPC_0264"
FT                   /product="yaeD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44452"
FT                   /db_xref="GOA:C0Q6M3"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M3"
FT                   /protein_id="ACN44452.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            285489..287030
FT                   /locus_tag="SPC_r001"
FT   rRNA            285489..287030
FT                   /locus_tag="SPC_r001"
FT                   /product="16S ribosomal RNA"
FT   gene            287100..287176
FT                   /locus_tag="SPC_t001"
FT   tRNA            287100..287176
FT                   /locus_tag="SPC_t001"
FT                   /product="tRNA-Ile"
FT   gene            287286..287361
FT                   /locus_tag="SPC_t002"
FT   tRNA            287286..287361
FT                   /locus_tag="SPC_t002"
FT                   /product="tRNA-Ala"
FT   gene            287542..290449
FT                   /locus_tag="SPC_r002"
FT   rRNA            287542..290449
FT                   /locus_tag="SPC_r002"
FT                   /product="23S ribosomal RNA"
FT   gene            290541..290660
FT                   /locus_tag="SPC_r003"
FT   rRNA            290541..290660
FT                   /locus_tag="SPC_r003"
FT                   /product="5S ribosomal RNA"
FT   gene            290850..290926
FT                   /locus_tag="SPC_t003"
FT   tRNA            290850..290926
FT                   /locus_tag="SPC_t003"
FT                   /product="tRNA-Asp"
FT   gene            291091..291894
FT                   /gene="yafB"
FT                   /locus_tag="SPC_0265"
FT   CDS_pept        291091..291894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafB"
FT                   /locus_tag="SPC_0265"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44453"
FT                   /db_xref="GOA:C0Q6M4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M4"
FT                   /protein_id="ACN44453.1"
FT                   /translation="MTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAV
FT                   GQAIAESGVPRNELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGDA
FT                   VSVEEFMQALLEAKKQGLTREIGISNFTIPLMKKAIAAVGADHIATNQIELSPYLQNRK
FT                   VVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TRRENLASNLLALELHLDAEDRAAIEALDCNDRLVSPEGLAPEWD"
FT   gene            complement(291916..292830)
FT                   /gene="yafC"
FT                   /locus_tag="SPC_0266"
FT   CDS_pept        complement(291916..292830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="SPC_0266"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44454"
FT                   /db_xref="GOA:C0Q6M5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M5"
FT                   /protein_id="ACN44454.1"
FT                   /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVM
FT                   LHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSY
FT                   RKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIECGISSNS
FT                   GETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEYIRTAPAGAVKEG"
FT   gene            292935..294110
FT                   /locus_tag="SPC_0267"
FT   CDS_pept        292935..294110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0267"
FT                   /product="putative drug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44455"
FT                   /db_xref="GOA:C0Q6M6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M6"
FT                   /protein_id="ACN44455.1"
FT                   /translation="MPLALFALTISAFAIGTTEFVIIGLVPTIAQQLAISLPSAGMLVS
FT                   IYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTGLA
FT                   HGVFFSIGSTIATRLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAV
FT                   SLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFTAFTF
FT                   LAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAVLFVLLM
FT                   VFQVTASTQYVALATILVMGVFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLNIAAFNI
FT                   GIALGSVIGGQTVAHYGLAQTPWIGALIVLVAFLLVGVSGRLDKPVRIALE"
FT   gene            294242..295042
FT                   /gene="yafD"
FT                   /locus_tag="SPC_0268"
FT   CDS_pept        294242..295042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="SPC_0268"
FT                   /product="yafD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44456"
FT                   /db_xref="GOA:C0Q6M7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6M7"
FT                   /protein_id="ACN44456.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPAGEPLSSEERIR
FT                   ILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNTWSRPRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
FT   gene            295120..295890
FT                   /gene="yafE"
FT                   /locus_tag="SPC_0269"
FT   CDS_pept        295120..295890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="SPC_0269"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44457"
FT                   /db_xref="GOA:C0Q6M8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M8"
FT                   /protein_id="ACN44457.1"
FT                   /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFSH
FT                   ASVLDMGCEAGHASFVAAQHVNSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAEKL
FT                   PFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLIIMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRL
FT                   YQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
FT   gene            complement(295946..297313)
FT                   /gene="mltD"
FT                   /locus_tag="SPC_0270"
FT   CDS_pept        complement(295946..297313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="SPC_0270"
FT                   /product="membrane-bound lytic murein transglycosylase d
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44458"
FT                   /db_xref="GOA:C0Q6M9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6M9"
FT                   /protein_id="ACN44458.1"
FT                   /translation="MKAKAILLASVLLVGCQTSQNTGNVQQHAQSLSAAGQGEAGKFTS
FT                   QARWMDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYLHDVTLRAEPY
FT                   MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNY
FT                   DARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAIKANKARGKPTDFW
FT                   SLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVRLNSPVEMAQVADMA
FT                   GMSISKLKTFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASGEIDAVQSQLIADNTP
FT                   LNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQSLTVGAGSSAQRLANN
FT                   SDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGDQLTLFVKDNSTPDS"
FT   gene            complement(297385..298140)
FT                   /gene="gloB"
FT                   /locus_tag="SPC_0271"
FT   CDS_pept        complement(297385..298140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="SPC_0271"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44459"
FT                   /db_xref="GOA:C0Q6N0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6N0"
FT                   /protein_id="ACN44459.1"
FT                   /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWM
FT                   PEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTL
FT                   FATPGHTLGHVFYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICC
FT                   AHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTENI
FT                   DLINEINKETILQQPEARFAWLRSKKDTF"
FT   gene            298229..298897
FT                   /gene="yafS"
FT                   /locus_tag="SPC_0272"
FT   CDS_pept        298229..298897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="SPC_0272"
FT                   /product="yafS"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44460"
FT                   /db_xref="GOA:C0Q6N1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N1"
FT                   /protein_id="ACN44460.1"
FT                   /translation="MPWGNYYREALEQQLNPWFAKMYGFHLLKIGNLSAEINSEACAVS
FT                   HQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGW
FT                   LVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPW
FT                   KKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKTPIRQTVGATRQYRKPDG
FT                   "
FT   gene            complement(298894..299361)
FT                   /gene="rnhA"
FT                   /locus_tag="SPC_0273"
FT   CDS_pept        complement(298894..299361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="SPC_0273"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44461"
FT                   /db_xref="GOA:C0Q6N2"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6N2"
FT                   /protein_id="ACN44461.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTNN
FT                   RMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   KRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMHPTQEDSGYQAEA"
FT   gene            299416..300156
FT                   /gene="dnaQ"
FT                   /locus_tag="SPC_0274"
FT   CDS_pept        299416..300156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="SPC_0274"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44462"
FT                   /db_xref="GOA:C0Q6N3"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N3"
FT                   /protein_id="ACN44462.1"
FT                   /translation="MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNAS
FT                   FDIGFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFATE
FT                   EELAAHESRLDLVQKKGGSCLWRA"
FT   gene            300290..300366
FT                   /locus_tag="SPC_t004"
FT   tRNA            300290..300366
FT                   /locus_tag="SPC_t004"
FT                   /product="tRNA-Asp"
FT   gene            complement(300684..301742)
FT                   /locus_tag="SPC_0275"
FT   CDS_pept        complement(300684..301742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0275"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44463"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N4"
FT                   /protein_id="ACN44463.1"
FT                   /translation="MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVS
FT                   TPEAVNWPEIERDARRLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSD
FT                   ALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVMADIRGITLSNSAALRLQVRDV
FT                   ERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAP
FT                   DFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGIS
FT                   LPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIP
FT                   VELLEKWDALER"
FT   gene            complement(301753..302748)
FT                   /locus_tag="SPC_0276"
FT   CDS_pept        complement(301753..302748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44464"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N5"
FT                   /protein_id="ACN44464.1"
FT                   /translation="MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFR
FT                   LGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPT
FT                   LVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLS
FT                   DHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQS
FT                   SVLGNGALIGQAVPDMQYKFRLIIGPLTLKDYLRFLPGGNNLPVLTELVRTFIGFEYCW
FT                   EIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRQVTGMIFEPEHGLTH"
FT   gene            complement(302745..304628)
FT                   /locus_tag="SPC_0277"
FT   CDS_pept        complement(302745..304628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44465"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N6"
FT                   /protein_id="ACN44465.1"
FT                   /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPY
FT                   VERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDL
FT                   AKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLP
FT                   PNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGE
FT                   PGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGL
FT                   SAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSV
FT                   TEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRRE
FT                   PRRSSENARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRN
FT                   GRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQ
FT                   ALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGF
FT                   SGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV"
FT   gene            complement(304644..305138)
FT                   /locus_tag="SPC_0278"
FT   CDS_pept        complement(304644..305138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44466"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N7"
FT                   /protein_id="ACN44466.1"
FT                   /translation="MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIR
FT                   RDLSFLLNTISHEGDIDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIR
FT                   FEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITF
FT                   F"
FT   gene            complement(305135..305959)
FT                   /locus_tag="SPC_0279"
FT   CDS_pept        complement(305135..305959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44467"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N8"
FT                   /protein_id="ACN44467.1"
FT                   /translation="MKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLF
FT                   QLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQ
FT                   PVWVESLLAALACHDDIGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPVLEL
FT                   VTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSESASD
FT                   ALRLCRETAWQDGPGETTVRTLGQKVWMTSHGDISLLDMAHCTFHAQENDGA"
FT   gene            complement(305946..306836)
FT                   /locus_tag="SPC_0280"
FT   CDS_pept        complement(305946..306836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44468"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6N9"
FT                   /protein_id="ACN44468.1"
FT                   /translation="MWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGKDDIA
FT                   LSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTNDESR
FT                   PDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADSTLHQL
FT                   YQEYQQALRPSGQEKPLRDKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPGIDAI
FT                   LDTLDTTGEGEMHWLAMESMPDILQLLSPEQAGKTAHSEILPDLTRREHRIIGIDSHYR
FT                   ITPTQKNGNTAHEKN"
FT   gene            complement(306857..306928)
FT                   /locus_tag="SPC_0281"
FT   CDS_pept        complement(306857..306928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44469"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P0"
FT                   /protein_id="ACN44469.1"
FT                   /translation="MNSVKIIYELKLPKRFLQKNKYI"
FT   gene            307216..309855
FT                   /locus_tag="SPC_0282"
FT   CDS_pept        307216..309855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0282"
FT                   /product="ClpB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44470"
FT                   /db_xref="GOA:C0Q6P1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P1"
FT                   /protein_id="ACN44470.1"
FT                   /translation="METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQ
FT                   LTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLA
FT                   SVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQE
FT                   RPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRT
FT                   MTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAG
FT                   ASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGT
FT                   LRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLIL
FT                   DEAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEME
FT                   RSLLQKQEKMGIQSDERRDALTARIFSLNNELTASESRWQRELELVHTLQELRVAESDA
FT                   DDKTTLQQAETALREWQGDAPVVFPEVSVAVVAAIVADWTGIPAGRMVKDEASQVLELP
FT                   ARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAI
FT                   YGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEK
FT                   AHHDVHKLFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATG
FT                   LKEALMPELRKHFPAAFLGRVTVIPYLPLDETSRGVIAHLHLDRLVARMSEQHGVTLTY
FT                   SEELVAHIVACCPMHETGARLLIGYIEQHILPQLSRYWLQAMTEKAAIRQIDIGVNGDE
FT                   QIVFEIVC"
FT   gene            309955..310497
FT                   /locus_tag="SPC_0283"
FT   CDS_pept        309955..310497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44471"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P2"
FT                   /protein_id="ACN44471.1"
FT                   /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLAD
FT                   LAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENM
FT                   DDFSPAQIARKVDALNQLLEARTQLENLQTYMDGKAGAENLVNKLLQDPTLLKTLANAP
FT                   KPAATQQGVSADNESAE"
FT   gene            310521..312029
FT                   /locus_tag="SPC_0284"
FT   CDS_pept        310521..312029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0284"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44472"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P3"
FT                   /protein_id="ACN44472.1"
FT                   /translation="MANSNMQATDAVAQDTVSASGEFDALLNQAFRPKTTQAAKAVEAA
FT                   VQTLAQQALANTITVSDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEH
FT                   LVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGC
FT                   IIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVT
FT                   QNLEYAPWNSLRASEDFRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVW
FT                   SNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAIS
FT                   DRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFAC
FT                   SRFAHFLKCIVRDKIGSFKEREDMQCWLNEWIMNYVDADPVNSSQETKARRPLAAAEVV
FT                   VEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLPSVKQGNA"
FT   gene            312303..312482
FT                   /locus_tag="SPC_0285"
FT   CDS_pept        312303..312482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44473"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P4"
FT                   /protein_id="ACN44473.1"
FT                   /translation="MHKHAAFYLEQDSNYIYVMDQWKKKKKISSRSLSRKGGIRSVGTY
FT                   PDASNNAEAFYIIE"
FT   gene            312660..312941
FT                   /locus_tag="SPC_0286"
FT   CDS_pept        312660..312941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0286"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44474"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P5"
FT                   /protein_id="ACN44474.1"
FT                   /translation="MSRLWLSSIGVTQGKPENLMDLKPETKKVNGENWSVWETERVSDK
FT                   ETDRYWGSCIYGHEQIWLAQPIPASSTRCKTRDFEGAPEDQSVSFICN"
FT   gene            313193..313678
FT                   /locus_tag="SPC_0287"
FT   CDS_pept        313193..313678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44475"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P6"
FT                   /protein_id="ACN44475.1"
FT                   /translation="MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSG
FT                   LGSGKVSVTNLEFEHYIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDL
FT                   IVAVVSPSGNREGEIASRERIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI"
FT   gene            313790..314281
FT                   /locus_tag="SPC_0288"
FT   CDS_pept        313790..314281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0288"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44476"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P7"
FT                   /protein_id="ACN44476.1"
FT                   /translation="MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
FT                   IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTT
FT                   AIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
FT                   "
FT   gene            314285..315628
FT                   /locus_tag="SPC_0289"
FT   CDS_pept        314285..315628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44477"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P8"
FT                   /protein_id="ACN44477.1"
FT                   /translation="MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGF
FT                   SHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPV
FT                   RAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAW
FT                   IGLPLTRIIGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLT
FT                   GSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQ
FT                   TRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSD
FT                   LADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQI
FT                   PFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK"
FT   gene            315625..316929
FT                   /locus_tag="SPC_0290"
FT   CDS_pept        315625..316929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44478"
FT                   /db_xref="GOA:C0Q6P9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6P9"
FT                   /protein_id="ACN44478.1"
FT                   /translation="MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVE
FT                   DGPDSKLRLAEISAAANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTL
FT                   CDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKLFQI
FT                   IGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVM
FT                   PALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMYVQTVTVQQHIDAI
FT                   GIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAI
FT                   RPVINKAAREIARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPA
FT                   GRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE"
FT   gene            316934..317707
FT                   /locus_tag="SPC_0291"
FT   CDS_pept        316934..317707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44479"
FT                   /db_xref="GOA:C0Q6Q0"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q0"
FT                   /protein_id="ACN44479.1"
FT                   /translation="MIKKSTYDVSHHSAICGVTGDYYRISATYHITRSVRVFLIILCCL
FT                   LSGGAFAGSSINAGFISPDNVNLSTRDFLKFYATDNVQKKDNALMYMLGVEDATEGKAW
FT                   CGYGQVDSITINHTVLTWFEQHAVKKPDVRASILIEEALVKNFPCQRTDSSIKIASRSS
FT                   PILSLTPDALNLSGNDFFKFWVSGNQRDKLRAGVYLLGVEDATENKLWCGYALFKTLTL
FT                   NELVYVSLKNKTNEELNSRAAELIINKLIEYPCNI"
FT   gene            318119..318340
FT                   /locus_tag="SPC_0292"
FT   CDS_pept        318119..318340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0292"
FT                   /product="putative shiga-like toxin A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44480"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q1"
FT                   /protein_id="ACN44480.1"
FT                   /translation="MDYEKDKTKNKLAILDKKSYFDSYYENQVKSIVAKYTYINKDKEK
FT                   DIFIASSFMNADECSVRFNGYITLSREF"
FT   gene            318373..321999
FT                   /locus_tag="SPC_0293"
FT   CDS_pept        318373..321999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0293"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44481"
FT                   /db_xref="GOA:C0Q6Q2"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q2"
FT                   /protein_id="ACN44481.1"
FT                   /translation="MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVG
FT                   SRVVTIALLLMLLVLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLI
FT                   GFILLVYALYGLYRLWRALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIR
FT                   QLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTS
FT                   RILTMPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKH
FT                   RPGAPLNGVILTLNVADLTAQSPAERLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREFA
FT                   ALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIK
FT                   TARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWCYRLLRLGGHLLV
FT                   LVLAFLLWQGMQTSQQTNGDYLNEISARATRLDGEVKAYTGKPAMAPVPALLDSARELS
FT                   AWPELDPDAPPLTWRYGLYSVPPVTDSVASLYNRLLDQLLLPPLVKRMEYVLADAIARQ
FT                   DSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDSVAGFGGRAAVLTHIEA
FT                   LFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAVGA
FT                   DAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKL
FT                   TDSLRSQIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVL
FT                   RTLASPDSPLMRLGKAVVEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHP
FT                   EERLEKTLVDDRFAALREVIAGRTDGGQSGGGTMQIASLLTMLNEYYTQLTIADSALAA
FT                   GTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKINAGTGDVLNTQMEAMMGDDC
FT                   RDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGN
FT                   MTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRY
FT                   AHGPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVR
FT                   GRQLVEYDFDGRRVVLEITAGRDFNPVSRELLQNFSCPARAL"
FT   gene            322032..322787
FT                   /locus_tag="SPC_0294"
FT   CDS_pept        322032..322787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44482"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q3"
FT                   /protein_id="ACN44482.1"
FT                   /translation="MFGRLPDQSDYVRWRVGAEEGRIWQDWLNRQTWVGSGRHIVLPEG
FT                   QTTDEERDGWMHLSPRGEHDMPAPEHHPLPWSFVMSPGFLPMGGTTDWLTGVLMASRDS
FT                   VGRPWPLVIYQRCGREWLDESLQETQGWLYWLARLAAQHITPDTMRRGRLTEQVDQLWA
FT                   MWQPGPWWAQWLRGLRRTSQRIRELTGLPDEAPVVELPGVRYLPWPGWPGKTLGQATPG
FT                   QGWFWQQNSEGRYVDALRLVDEKNRGQML"
FT   gene            322784..323200
FT                   /locus_tag="SPC_0295"
FT   CDS_pept        322784..323200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0295"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44483"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q4"
FT                   /protein_id="ACN44483.1"
FT                   /translation="MKKYAVEVLFMSACAGMFLPVFAWGGTDVNIDNPLAECVDIHPVH
FT                   RQEMDNLTILKTTVTLKKSTGECGCFSALISYTSLLAQDVEGYGRGSAYSLQEGNISLA
FT                   KMQGRYPFSFVLSVDNQSVRDQKLALMIRCTPPL"
FT   gene            323224..323745
FT                   /locus_tag="SPC_0296"
FT   CDS_pept        323224..323745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0296"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44484"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q5"
FT                   /protein_id="ACN44484.1"
FT                   /translation="MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
FT                   GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESAD
FT                   EKTRKACGGRRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVS
FT                   GQQTNGGTKQ"
FT   gene            323886..324095
FT                   /locus_tag="SPC_0297"
FT   CDS_pept        323886..324095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44485"
FT                   /db_xref="GOA:C0Q6Q6"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q6"
FT                   /protein_id="ACN44485.1"
FT                   /translation="MQCESGKRNKNKIIILLYSFPYLCNSVFMLCANFCVFIFMALVSN
FT                   IPCSSGKYLNITGWLHYKVRGTVS"
FT   gene            324141..326375
FT                   /locus_tag="SPC_0298"
FT   CDS_pept        324141..326375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0298"
FT                   /product="Rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44486"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q7"
FT                   /protein_id="ACN44486.1"
FT                   /translation="MSFVSTNNKSGMRGLTTTTPPITGESGGVTADSVAGSVADAAEAA
FT                   VEQAAGSLFGALPEPSGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSG
FT                   SAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVN
FT                   IELDGGGKRQISGLVTAARVVGHEGRSVTYELHMEPWLKLLTHTSDYKAFQNKTVVDIL
FT                   DEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLV
FT                   LADAISAHKACPDSPLVEWHQEGLKLDKAFIHTITANESLRTGQWVLDDFDFTKPRSLL
FT                   ANTVANPRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMT
FT                   GYTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQR
FT                   TVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAG
FT                   KGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGAATQSGIYSHTIG
FT                   GGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIATIGAV
FT                   RDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNI
FT                   TATDADGQINTIKGQLDLNMNKREPKVGTFGESEKTAMAAVIKETFPPKE"
FT   gene            326435..326893
FT                   /locus_tag="SPC_0299"
FT   CDS_pept        326435..326893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44487"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q8"
FT                   /protein_id="ACN44487.1"
FT                   /translation="MTNYYINEAILSFSGNISQDSTLNMIRLSDPDAALIISRGKMQDG
FT                   DELASQVEQQMKKLEKQVKELRYTPAQVVRLGIDGKMEGLEIQSQFIRGNEHVYQYQAV
FT                   FVLQSSRVMMALTYARSTALTEADRGRWADIKKNLRFRLDPENTATGQ"
FT   gene            326909..331690
FT                   /gene="rhs"
FT                   /locus_tag="SPC_0300"
FT   CDS_pept        326909..331690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhs"
FT                   /locus_tag="SPC_0300"
FT                   /product="Rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44488"
FT                   /db_xref="GOA:C0Q6Q9"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR025479"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6Q9"
FT                   /protein_id="ACN44488.1"
FT                   /translation="MGEAFWAAREGDALLHTSFLADLVGSALEFAINAVIDFAALAVVA
FT                   LATGATVATLGCSAVLLVGTVVGATMLLSGAGEKISKACEDIANSLFPPKIEGYILTGS
FT                   GDTRINSKRAARAAATALSRHDVETLDAQAQAEAEEEKRRQDAKSMWDVAGEYLDAVKG
FT                   RAENMAKGVVSVVSRIGSAEGWASLGNDALAEAGDMLSDTGHFISEMWQPTVATAYPGS
FT                   DPKQDDKIDCHKHPSSFTQFMAQKLQALTDDPVGTVLGAMNTFDVLEAGFQAASALIGS
FT                   VSNLFKGDDEPPAAEYIAEGTRDVRINSQPAARSGVRCTCEAKVVDEPENGVHVSGDVR
FT                   IGGPLLVVRDIKSGKSQITLVTTIALTFMQPGRASAKSACFMMGLGINMMVQKAGSALN
FT                   RPVNAATGAKYLAGDDDVDFSLPGHFPLEWQRTYSSRDERTEGMFGRGWSVLYEVCLER
FT                   TPDNPDENCMTYVSPMGRRIDLQAVEPGSGFYSPGEGLAVRRSEQGHWLISSDDGVYRL
FT                   FEADPLSPQRRRLKMLGDRNSNCQHLTYDNHGRLVEISGDRQRPCIRLHYELAAHPQRV
FT                   TRIFRHYPEGEPELLRRYRYDEAGRLNGVVDNAGQYQREFAYDDNDCMTMHREPGGERY
FT                   YYSWAWFEGPDDAAWRVTGHHTDSGEQYRLDWNLAERSLCVTDSLGRMRCHWWDAQGLV
FT                   TAYRDEAGQMTTFRWSDEERLLLGMTDAQGGKWRYVYDRLGHLTETHDPLGRVEQTQWH
FT                   PVWHQPETEVDAAGAAWRYEYDERGNLQAVSDPLHQRTVYGYDRHGQVVRITDARGGDK
FT                   YLQWNEDGQLMRHTDCSGSQTAWFYDERTRLERVTDAESNSTRYSYDGNGHLTEVMFAD
FT                   GRTERYQPDAAGRLVKYTSPAGQITRWQRDGQGRVRRQTDATGRRTAYEYDAYGRLTTL
FT                   TNENGESYRFRYDVLDRVTEQTDPGGSRRAYGYNALNAVTAVIYGGERGGEIRHGLERD
FT                   AAGRLTAKITPETRTEYRYDAADRLLEIRRRRHDAAEGGEPEVIRFSYDSAGNLLSEET
FT                   AQGVLQHRYDVQGNRTETQMPDGRTLRYLYYGSGHLQQINLGRDVISEFTRDHLHREVQ
FT                   WSQGRLDTRRMYDRTGRLTRKLTCKGMRGVVPETFIDREYAYSGQDELLKKRHSRQGVT
FT                   DYFYDMTGRITACRNEAYLDSWQYDAAANLLDRRQGETAQAGAGSVVPFNRITSYRGLH
FT                   YRYDEYGRVVEKWGRNGTQHYRWDAEHRLTEVAVIRGSTVRRYGYVYDAPGRRVEKHEL
FT                   DAEGKPYNRTTFLWDGMRLAQECRLGRSSSLYIYSDQGSHEPLARVDRAAPGEADEVLY
FT                   YHTDVNGAPEEMTDGGGNIVWEAGYQVWGNLTHEKETRPVQQNLRFQGQYLDRETGLHY
FT                   NLYRFYDPDIGKFISGDPISLRGGINLYAYAPNPISWIDPLGLRKSCSGFSSADDAARS
FT                   ALSKYNPMSIFKNREYGGIIFRAKDGSYGYTRGRLGTGRTAPTFKDSAGGLPKGSTPVG
FT                   QYHTHGDYSDSGFNRTNKAGDYHNSDQFSSKDIFIHNQANGSYPGYTDALGTPSGGFWK
FT                   IFGRVSGPDDAIPL"
FT   gene            331709..332017
FT                   /locus_tag="SPC_0301"
FT   CDS_pept        331709..332017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44489"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R0"
FT                   /protein_id="ACN44489.1"
FT                   /translation="MNRKNRCVLEIDKELTPFLFNAIIAIKNSEWSKLYDVENFYLIFN
FT                   PIIRKIENVEFYTITFLSEEITQDNWMDIGSGGIEVKEINVNINVKTKEVISIYGGR"
FT   gene            complement(332076..332333)
FT                   /locus_tag="SPC_0302"
FT   CDS_pept        complement(332076..332333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44490"
FT                   /db_xref="GOA:C0Q6R1"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R1"
FT                   /protein_id="ACN44490.1"
FT                   /translation="MNASGVSVRHINSETCITTCYSQIPSLHLKGDWLEEAGFKTGRGV
FT                   TVKISQGCIVLMADSNEEQKLREQLYKAEQVVKGMRDVIV"
FT   gene            332957..333097
FT                   /locus_tag="SPC_0303"
FT   CDS_pept        332957..333097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0303"
FT                   /product="rhs core protein with extension"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44491"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R2"
FT                   /protein_id="ACN44491.1"
FT                   /translation="MPHSEQFDDPDELSISDVCKEKFHNMMDSPMNFIKKIGTLMFDEY
FT                   D"
FT   gene            333806..334237
FT                   /locus_tag="SPC_0304"
FT   CDS_pept        333806..334237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44492"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R3"
FT                   /protein_id="ACN44492.1"
FT                   /translation="MVLIVLFVILFFTWLGRENIKNDSAIREVAKEEVDKLFSLYNKGE
FT                   YAEIYDLSCDSFKNATARKDFLTVMGTKMKILGEFKGRKIQYSNVINSKSVELYYRVDY
FT                   INYSLIEEFNYIKNDGQKICLQAMFTDDAGKHGEVIKLH"
FT   gene            334555..334833
FT                   /locus_tag="SPC_0305"
FT   CDS_pept        334555..334833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0305"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44493"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R4"
FT                   /protein_id="ACN44493.1"
FT                   /translation="MLTNVKEIKAIDVFTTGISMVNDKDTAILISDLMLRFGKELDESV
FT                   AVVQSRCDEDEFKVYREAVGFIMGEMLIKIMNPLYEKHPEIKPKGLK"
FT   gene            complement(334900..335142)
FT                   /locus_tag="SPC_0306"
FT   CDS_pept        complement(334900..335142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0306"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44494"
FT                   /db_xref="GOA:C0Q6R5"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R5"
FT                   /protein_id="ACN44494.1"
FT                   /translation="MPQAGFINGMPVKVRVMRDCIVITPQHTRGLFVCIEGMGVTRINK
FT                   RSAEQWLKKLLGALNNTGDIPVIKRKRTEQELMSN"
FT   gene            335267..335464
FT                   /locus_tag="SPC_0307"
FT   CDS_pept        335267..335464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44495"
FT                   /db_xref="GOA:C0Q6R6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R6"
FT                   /protein_id="ACN44495.1"
FT                   /translation="MRKARFTAHQIIAVIRSVESGRTVKDVYREAGISEATRDNWKSGY
FT                   GGRDTRGITKGSTVFTVCSS"
FT   gene            335690..335971
FT                   /locus_tag="SPC_0308"
FT   CDS_pept        335690..335971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44496"
FT                   /db_xref="GOA:C0Q6R7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R7"
FT                   /protein_id="ACN44496.1"
FT                   /translation="MLRMDKGPEFISLALAEWAKKHAVKLAFIQPGKPKKNVFIERFNR
FT                   TYRTEILNSYLFRTLNEVREITDKGLSEYNCERPHESRNNMIPEEYRQ"
FT   gene            336721..337233
FT                   /gene="safA"
FT                   /locus_tag="SPC_0309"
FT   CDS_pept        336721..337233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safA"
FT                   /locus_tag="SPC_0309"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44497"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR018569"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R8"
FT                   /protein_id="ACN44497.1"
FT                   /translation="MVIQMKSIKKLIIASALSMMAASCYAGSFLPNSEQQKSVDIVFSS
FT                   PQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGIANNVVDRTGTAWRVAG
FT                   KNTGKEIGVGLSSDSIRRSDSTEKWNGAEWMTFNSNDTLDIVLTGPAQNVTADTYPITL
FT                   DVVGYQP"
FT   gene            337257..338054
FT                   /gene="safB"
FT                   /locus_tag="SPC_0310"
FT   CDS_pept        337257..338054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safB"
FT                   /locus_tag="SPC_0310"
FT                   /product="periplasmic fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44498"
FT                   /db_xref="GOA:C0Q6R9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6R9"
FT                   /protein_id="ACN44498.1"
FT                   /translation="MPCLRRNTHQIIYFSFTIFDMKIVNFAVMAVALFATNSMVSVYAV
FT                   NQQLNSATKLFSVKLGATRVIYHAGTAGATLSVSNPQNYPILVQSSVKAADKSSPAPFL
FT                   VMPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPHENEPSDTQAKGATLDLN
FT                   LSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPIT
FT                   GLEYVPPFADKTLNMPGSAHGDIEWRVITDFGGESHPFHYVLK"
FT   gene            338078..340587
FT                   /pseudo
FT                   /gene="safC"
FT                   /locus_tag="SPC_0311"
FT                   /note="frameshift compared to STM0301 in Salmonella
FT                   typhimurium LT2"
FT   gene            340609..341079
FT                   /gene="safD"
FT                   /locus_tag="SPC_0312"
FT   CDS_pept        340609..341079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safD"
FT                   /locus_tag="SPC_0312"
FT                   /product="putative fimbriae subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44499"
FT                   /db_xref="InterPro:IPR008394"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S0"
FT                   /protein_id="ACN44499.1"
FT                   /translation="MWMKIQRVKMVIYSVSLLVTVSSLMPIANAAEKLQTTLRVGAYFR
FT                   AGHVPDGMVLAQGWVTYHGSHSGFRVWSDEQKAGNTPTVLLLSGQQDPRHHIQVRLEGE
FT                   GWQPDTVNGRGAILRTAADNASFSVVVDGNQEVPADTWTLDFKACALAQEDT"
FT   gene            341415..342308
FT                   /locus_tag="SPC_0313"
FT   CDS_pept        341415..342308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44500"
FT                   /db_xref="GOA:C0Q6S1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S1"
FT                   /protein_id="ACN44500.1"
FT                   /translation="MFRGLFLVPSGVKIIYFLYKGIKHMSYARHLPVLMYHHVSDKPGQ
FT                   ITLSPRTFRAQMKWLAESGWKTVTAAEVEAFYHGARLPRKSVMLTFDGGWLDNWLQVFP
FT                   VLQEFNLHAHLFLVTSLISDGPVRIPAGEPVYSHDECQMLVKQGRAGEVMLRWSEVREM
FT                   HLSGLVEFHSHTHTHRRWDQKPVSRNPSDLLRVDILLSRKRMREMLGYCSQHLCWPEGW
FT                   YCSDYIHVAEELGFTYLYTTERRMNNPVIGSQRIGRINTKERKNVGWLKRRLFYHTTPG
FT                   FSSLLARHKRPRRIAD"
FT   gene            342791..342922
FT                   /locus_tag="SPC_0314"
FT   CDS_pept        342791..342922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44501"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S2"
FT                   /protein_id="ACN44501.1"
FT                   /translation="MNDAINVLQTASQKRRMPLQNGCMTMNHFIIEIWFGDNLDDRF"
FT   gene            343125..344072
FT                   /gene="sinR"
FT                   /locus_tag="SPC_0315"
FT   CDS_pept        343125..344072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sinR"
FT                   /locus_tag="SPC_0315"
FT                   /product="LysR-family transcriptional regulator SinR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44502"
FT                   /db_xref="GOA:C0Q6S3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S3"
FT                   /protein_id="ACN44502.1"
FT                   /translation="MMELINNRGMRNWMIFIKVAEVGNLSRAARELDISISAVSKSLSR
FT                   LENSIEVTLLRRDSHHLELTGAGQTAYASMKRITSSFQSLLDELRNPDKIIRGSIKFSA
FT                   PAIVCEFLANKWIWEFTASYPDTKIYLDSRERSDFFSKSLEFDELVFKSGIIESEDLVY
FT                   RKISPLKLVLCASPKYIRKYGRISHPGDLENHIIVGLHNHGLSGPLTLFRQDESYTISG
FT                   AVNVHLSSNNLLSVLNLVLEGKGINLMTPAWLATKYLKNNELEIILPEWRVPDLPIYLV
FT                   WRHRQYYSPLFQRFLSFIEDKWNNRPQIDFLNDD"
FT   gene            344192..344407
FT                   /locus_tag="SPC_0316"
FT   CDS_pept        344192..344407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0316"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44503"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S4"
FT                   /protein_id="ACN44503.1"
FT                   /translation="MMPTDGNDNTRKQDGTVFGQPEVKPIPETLQCTEKWRQVAPVQRF
FT                   SEGAGVFITDILHCAFGNPQDQLFYQ"
FT   gene            complement(344411..345130)
FT                   /locus_tag="SPC_0317"
FT   CDS_pept        complement(344411..345130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0317"
FT                   /product="putative outer membrane adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44504"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S5"
FT                   /protein_id="ACN44504.1"
FT                   /translation="MKNFFAVCIIPLVVAWSATASAKEGIYITGKAGTSVVNVYGINST
FT                   FSQDEIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQDI
FT                   IAFGDPVHINVKNQIRMTTYMVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPVGFG
FT                   INETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVSISKNHYAGDEHTAYDA
FT                   DTKAASNDFMLGITYAF"
FT   gene            complement(345476..345883)
FT                   /locus_tag="SPC_0318"
FT   CDS_pept        complement(345476..345883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0318"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44505"
FT                   /db_xref="GOA:C0Q6S6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S6"
FT                   /protein_id="ACN44505.1"
FT                   /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLTN
FT                   DQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQAR
FT                   YYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
FT   gene            complement(346193..346951)
FT                   /gene="yafV"
FT                   /locus_tag="SPC_0319"
FT   CDS_pept        complement(346193..346951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="SPC_0319"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44506"
FT                   /db_xref="GOA:C0Q6S7"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S7"
FT                   /protein_id="ACN44506.1"
FT                   /translation="MKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFTTGF
FT                   AMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHLYDK
FT                   RHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVANWP
FT                   APRSLHWQTLLTARAIENQAYVAGCNRVGSDGNGLHYRGDSRIINPQGDIIATAEPHQA
FT                   TRIDADLSLVALQDYREKFPAWRDADPFTL"
FT   gene            complement(347069..349513)
FT                   /gene="fadE"
FT                   /locus_tag="SPC_0320"
FT   CDS_pept        complement(347069..349513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="SPC_0320"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44507"
FT                   /db_xref="GOA:C0Q6S8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S8"
FT                   /protein_id="ACN44507.1"
FT                   /translation="MMILSIIATVVLLGALFYHRVSLFLSSLILLAWTAALGVAGLWSI
FT                   WLLVPLAIILVPFNLTPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPQLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLDFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTEEQK
FT                   NHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGVVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPDRLLGGEEELGITCALIPTSTPGVEIGRRHFPLNVPFQNGPT
FT                   RGNDIFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGESNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMAAAQNNDVNAFDKLLFKHIGHVGSNTVRSFWLGLTRGLTSHTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDVLSQLYLASAVLKRYDDEGRHE
FT                   ADLPLVHWGVQDALYRAEQAMDDLLQNFPNRVVAGLLTAMIFPTGRHYLAPSDKLDHAV
FT                   AKILQVPNATRSRIGRGQYLTPAEHNPVGLLEEALRDVIAADPIHQRICKELGKNLPFT
FT                   RLDELARNALAKGLIDKDEAAILAKAEESRLRSINVDDFEPEALATKPVKLPEKVRKVE
FT                   AA"
FT   gene            349735..350331
FT                   /gene="ghmA"
FT                   /locus_tag="SPC_0321"
FT   CDS_pept        349735..350331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ghmA"
FT                   /locus_tag="SPC_0321"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44508"
FT                   /db_xref="GOA:C0Q6S9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6S9"
FT                   /protein_id="ACN44508.1"
FT                   /translation="MLKDILMYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLAD
FT                   SFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYD
FT                   YIFSRYVEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTAD
FT                   IEIRVPHFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            350544..351311
FT                   /gene="yafJ"
FT                   /locus_tag="SPC_0322"
FT   CDS_pept        350544..351311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="SPC_0322"
FT                   /product="yafJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44509"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T0"
FT                   /protein_id="ACN44509.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVLRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIATLA
FT                   TVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWALFCLGERII"
FT   gene            complement(351282..352019)
FT                   /gene="yafK"
FT                   /locus_tag="SPC_0323"
FT   CDS_pept        complement(351282..352019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="SPC_0323"
FT                   /product="yafK"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44510"
FT                   /db_xref="GOA:C0Q6T1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T1"
FT                   /protein_id="ACN44510.1"
FT                   /translation="MRKIAFFLAMLLMPCVSFAGLLSSSPVTPVSKEYKQQLMGSPVYI
FT                   QIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKP
FT                   DSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALVF
FT                   GQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVV
FT                   SKPLSHEVVQPQLASNYTLSEAK"
FT   gene            352269..353324
FT                   /gene="dinP"
FT                   /locus_tag="SPC_0324"
FT   CDS_pept        352269..353324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="SPC_0324"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44511"
FT                   /db_xref="GOA:C0Q6T2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T2"
FT                   /protein_id="ACN44511.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARQFGVRSAMPTAMALKLCPHLTLLPGRFVAYKEASRHVRDIFSRYTSLIEPLSLDE
FT                   AWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYV
FT                   ITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLLKRFGKFGRVL
FT                   WERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDL
FT                   LIARQGVKLKFNDFQQTTQEHVWPQLNKEDLIITARKTWNERRGERGVRLVGLHVTLLD
FT                   PQLERQLVLGL"
FT   gene            353531..354682
FT                   /locus_tag="SPC_0325"
FT   CDS_pept        353531..354682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44512"
FT                   /db_xref="GOA:C0Q6T3"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T3"
FT                   /protein_id="ACN44512.1"
FT                   /translation="MEWYMGNYIRPLSDVVFSIASDNLWIEDSAIQQLYTTAKLTGMKR
FT                   VIGMPDLHPGRGYPIGAAFFSRGRFYPALVGNDIGCGMALWQTDILGRKYNADKLEKRL
FT                   ASLPDVADAQWLEENVPAAMQHHSWRSALGSIGGGNHFAELQQVDRIVDADSFALSGLQ
FT                   KAQLLLLVHSGSRGLGQAILRRHVEAFSHNGLPEDSDDARHYLAEHDDALAFARSNRAL
FT                   IARRILQQLRAEGEPRLDVAHNFVEPCTVAGEAGWLHRKGATPDGQGLVIIPGSRGDYS
FT                   WLVKPVVSEESLFSLAHGAGRKWMRTECKDRLSAKFTPRQLCRTGMGSRVICRDRQLIY
FT                   EEAPQAYKSIDSVVDCLADAGLITPVACLRPVLTLKTSGEKSA"
FT   gene            354679..355293
FT                   /gene="prfH"
FT                   /locus_tag="SPC_0326"
FT   CDS_pept        354679..355293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="SPC_0326"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44513"
FT                   /db_xref="GOA:C0Q6T4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T4"
FT                   /protein_id="ACN44513.1"
FT                   /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPG
FT                   RLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADEHI
FT                   QSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   RLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
FT   gene            complement(355449..356906)
FT                   /gene="pepD"
FT                   /locus_tag="SPC_0327"
FT   CDS_pept        complement(355449..356906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SPC_0327"
FT                   /product="aminoacyl-histidine dipeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44514"
FT                   /db_xref="GOA:C0Q6T5"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T5"
FT                   /protein_id="ACN44514.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKGL
FT                   YVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGGEIHL
FT                   GLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVAADNVDALKTLVN
FT                   AYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGSYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKAIPAK"
FT   gene            357155..357613
FT                   /gene="gpt"
FT                   /locus_tag="SPC_0328"
FT   CDS_pept        357155..357613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="SPC_0328"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44515"
FT                   /db_xref="GOA:C0Q6T6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6T6"
FT                   /protein_id="ACN44515.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
FT   gene            357702..358946
FT                   /gene="yafA"
FT                   /locus_tag="SPC_0329"
FT   CDS_pept        357702..358946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="SPC_0329"
FT                   /product="yafA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44516"
FT                   /db_xref="GOA:C0Q6T7"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6T7"
FT                   /protein_id="ACN44516.1"
FT                   /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQ
FT                   AMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFD
FT                   RALQEITDWINHRLC"
FT   gene            359004..359405
FT                   /gene="crl"
FT                   /locus_tag="SPC_0330"
FT   CDS_pept        359004..359405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="SPC_0330"
FT                   /product="curlin genes transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44517"
FT                   /db_xref="GOA:C0Q6T8"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6T8"
FT                   /protein_id="ACN44517.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVK
FT                   PAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTAVPINETEVVERLEYTLREFH
FT                   EKLRDLLISMELALEPSDDFNDEPVKLSA"
FT   gene            complement(359456..360514)
FT                   /gene="phoE"
FT                   /locus_tag="SPC_0331"
FT   CDS_pept        complement(359456..360514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="SPC_0331"
FT                   /product="outer membrane pore protein E precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44518"
FT                   /db_xref="GOA:C0Q6T9"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6T9"
FT                   /protein_id="ACN44518.1"
FT                   /translation="MEMNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYM
FT                   SDYDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLK
FT                   LKDIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGI
FT                   VDGLDLTLQYQGKNEDRDVKKQNGNGFGTSVSYDFGGSDFAVSGAYTLSDRTRKQNLQR
FT                   RGTGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGL
FT                   RPSLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTLGIND
FT                   DDIVAIGLTYQF"
FT   gene            complement(360522..360701)
FT                   /locus_tag="SPC_0332"
FT   CDS_pept        complement(360522..360701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44519"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U0"
FT                   /protein_id="ACN44519.1"
FT                   /translation="MKFCCAGSASVAAEFDHFITATIKHIFLKNSHFVINLSLPNVKNL
FT                   PVFYRVSRQIIARN"
FT   gene            360754..361893
FT                   /gene="proB"
FT                   /locus_tag="SPC_0333"
FT   CDS_pept        360754..361893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SPC_0333"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44520"
FT                   /db_xref="GOA:C0Q6U1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U1"
FT                   /protein_id="ACN44520.1"
FT                   /translation="MVFISYFERQRIMSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVR
FT                   QCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFS
FT                   IYGIHIGQMLLTRADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDN
FT                   LSALAAILAGADKLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLG
FT                   TGGMSTKLQAADVACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWI
FT                   FGAPPAGEITVDEGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVS
FT                   RYNSDALRRIAGHHSQQIDAILGYEYGPVAVHRDDMITR"
FT   gene            361905..363155
FT                   /gene="proA"
FT                   /locus_tag="SPC_0334"
FT   CDS_pept        361905..363155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SPC_0334"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44521"
FT                   /db_xref="GOA:C0Q6U2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q6U2"
FT                   /protein_id="ACN44521.1"
FT                   /translation="MLEQMGIAAKAASYKLALLSSGEKNRVLEKIADELEAQMESILSA
FT                   NVQDVEQARANGLSEAMLDRLALTPARLKAIADDVRQVCNLADPVGQVIDGGLLDSGLR
FT                   LERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVRVIQKAL
FT                   KACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQMAESG
FT                   VTLHGDETVMQALHGPAKLVPLKPEELDNEFLSLDLNVVVVENMDGAIAHIREHGTQHS
FT                   DAILTSDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLE
FT                   ALTTYKWIGFGDGTIRA"
FT   gene            363271..363346
FT                   /locus_tag="SPC_t005"
FT   tRNA            363271..363346
FT                   /locus_tag="SPC_t005"
FT                   /product="tRNA-Thr"
FT   gene            complement(363782..364405)
FT                   /locus_tag="SPC_0335"
FT   CDS_pept        complement(363782..364405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0335"
FT                   /product="putative IS3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44522"
FT                   /db_xref="GOA:C0Q6U3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U3"
FT                   /protein_id="ACN44522.1"
FT                   /translation="MKTVAASLRRQGLRAKASRRFRPVSYRKHGLPVSENLLKQDFYAS
FT                   GPNQKWVGDITYLRTGEGWLYLAVVIDLWSRSVIGWSMSSRMTAQLACDALQMALWRRK
FT                   CPENVIVHTDRGGQYCSTDYQSLLKRHNLRGSMSARGCCYDNACAESFFHTLKVECIHG
FT                   EDFVSREIMRTAVFNYIECDYNRWRRHSACGGLSPEQFENQSLA"
FT   gene            364572..365277
FT                   /pseudo
FT                   /locus_tag="SPC_0336"
FT                   /note="similar to pseudogene STM0326 of Salmonella
FT                   typhimurium LT2"
FT   gene            365483..365710
FT                   /locus_tag="SPC_0338"
FT   CDS_pept        365483..365710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0338"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44523"
FT                   /db_xref="InterPro:IPR015079"
FT                   /db_xref="InterPro:IPR037210"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U4"
FT                   /protein_id="ACN44523.1"
FT                   /translation="MDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGW
FT                   AEKVASGNRILIKNPEYFSTYMQEQLKELV"
FT   gene            366057..367289
FT                   /locus_tag="SPC_0339"
FT   CDS_pept        366057..367289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0339"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44524"
FT                   /db_xref="GOA:C0Q6U5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U5"
FT                   /protein_id="ACN44524.1"
FT                   /translation="MKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEVYN
FT                   IPLNQVGMILSAEVGFLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSWPM
FT                   LVVYRALLGIAVSGITAAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATLMME
FT                   HVSIDTIFFIFGGVLIAMALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVSLC
FT                   FVIGFILFGSFTSIFNFLAFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARVALNIG
FT                   SMNALSMLIICMMVGAFLTLIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNAKG
FT                   QATSFYLLCYYSGGAVMGYLNGYLFSWQGWNAIAASCLMMLGIGLFICRFIFAKYEKQP
FT                   QIKKQSVQESF"
FT   gene            367421..368839
FT                   /locus_tag="SPC_0340"
FT   CDS_pept        367421..368839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0340"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44525"
FT                   /db_xref="GOA:C0Q6U6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U6"
FT                   /protein_id="ACN44525.1"
FT                   /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFSG
FT                   LRERGRAVRHPDTFLLNIDHVNPTRSQRDVLMTDPGGQLQVDYFRENAADFGITLFDVL
FT                   DPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVY
FT                   RKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEGRMTL
FT                   CNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVFDKTVA
FT                   INCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAGMLLKDI
FT                   RISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEEGLAKIFI
FT                   AAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSPAMVAAAVA
FT                   GHLVDVRSLLQAGE"
FT   gene            368841..369467
FT                   /locus_tag="SPC_0341"
FT   CDS_pept        368841..369467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0341"
FT                   /product="putative 3-isopropylmalate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44526"
FT                   /db_xref="GOA:C0Q6U7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U7"
FT                   /protein_id="ACN44526.1"
FT                   /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD
FT                   RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFA
FT                   GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE
FT                   LKRAMLAVGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPLG"
FT   gene            369482..370360
FT                   /locus_tag="SPC_0342"
FT   CDS_pept        369482..370360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0342"
FT                   /product="putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44527"
FT                   /db_xref="GOA:C0Q6U8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U8"
FT                   /protein_id="ACN44527.1"
FT                   /translation="MKLVQYLVNGGKRYGIMQETGIIDLSQRLGDKYPTLKSLLCANAL
FT                   TDAALWCDEPADYYYQEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRFAD
FT                   SQTGHNGLLLKPENTNEFDYEGELAVVIGRPCSRVSAEDALDYVAGYSCYMDGSVRDWQ
FT                   HSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPIASLI
FT                   AYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRYL
FT                   TSSVSWHDGRK"
FT   gene            370360..371145
FT                   /locus_tag="SPC_0343"
FT   CDS_pept        370360..371145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0343"
FT                   /product="putative hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44528"
FT                   /db_xref="GOA:C0Q6U9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6U9"
FT                   /protein_id="ACN44528.1"
FT                   /translation="MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHG
FT                   HPQNHTTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVMLMDA
FT                   LGFSRFAFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYALTDKSFATRYFWWF
FT                   FLIQPFPLPETMIAHDPAFFLRKHISGQLKIEGATSQEAFNEYLRCYQNPEMIHAICED
FT                   YRAAATIDLDDDAARRYVGAYPVSVTVAVGRAGNGRATI"
FT   gene            371312..372277
FT                   /locus_tag="SPC_0344"
FT   CDS_pept        371312..372277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0344"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44529"
FT                   /db_xref="GOA:C0Q6V0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V0"
FT                   /protein_id="ACN44529.1"
FT                   /translation="MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGLS
FT                   PSYISKRIAILEKCLNARLFFRNNRVMRLTPEGENALCGAMQVVSEMDGFVSRLDNQRG
FT                   VLAGNITINCSFGFGHKYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIRVGD
FT                   DINELYIARQLATNRRILCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNWILTD
FT                   GKQQTHCRLNGFHSSNSGSVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQWYQEA
FT                   NIWAVYTRRSSSSDRIKICIDFLTEHLAQCLPGGKAPGVL"
FT   gene            complement(372222..372494)
FT                   /locus_tag="SPC_0345"
FT   CDS_pept        complement(372222..372494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0345"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44530"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V1"
FT                   /protein_id="ACN44530.1"
FT                   /translation="MTLKPGEKSGNNGGIYVEVGPRGGIKDNFATIAETKPRHQRNALK
FT                   ATGCWQKEHLTVNVSQSIWRHDSWRRLITVRPVLYRLASIVQDAP"
FT   gene            373185..373583
FT                   /locus_tag="SPC_0346"
FT   CDS_pept        373185..373583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0346"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44531"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V2"
FT                   /protein_id="ACN44531.1"
FT                   /translation="MKLIIILLLALFPLCSSASNHYALVFENNTILLVLNLKCSPCDLN
FT                   CANIQYQLFNKETESVISGVAKPVTTGIENNFRGYMMRNNNTSYTLIESDNKNVWDMSV
FT                   EEKGTQQNKDTVQKVKYQLNAIFDNGTC"
FT   gene            complement(373630..374331)
FT                   /gene="stbE"
FT                   /locus_tag="SPC_0347"
FT   CDS_pept        complement(373630..374331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /locus_tag="SPC_0347"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44532"
FT                   /db_xref="GOA:C0Q6V3"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V3"
FT                   /protein_id="ACN44532.1"
FT                   /translation="MTGWYGPAQAAVNIDRTRIIFASDEVAQSLTLSNDNTTPMLLQVW
FT                   TDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLLSSHQQLATDRESLFWLNIYQI
FT                   PPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEAEEKKLRFIAKENTIRIVNPTSW
FT                   YMSLTLTMDNKKSIGDIMVAPKTALDVPLTRSPTPGASINYAVINDSGNWRQYTAILEK
FT                   YISENDFTPEF"
FT   gene            complement(374354..375655)
FT                   /gene="stbD"
FT                   /locus_tag="SPC_0348"
FT   CDS_pept        complement(374354..375655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbD"
FT                   /locus_tag="SPC_0348"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44533"
FT                   /db_xref="GOA:C0Q6V4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V4"
FT                   /protein_id="ACN44533.1"
FT                   /translation="MFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTAQNWIGATDT
FT                   NTGNIGLPTVISVSNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLYRCDSADAGKL
FT                   YEMYSINGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRFWKERQLTADSW
FT                   FQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGYIAFKGPGLITER
FT                   IKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKIKDYPAIVKIPPVAVGILAAGG
FT                   NSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAARRLGLTTSAGGLSWL
FT                   LDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWYGYKDLTTRVSSGSVE
FT                   TYSGDFTASLEAIGGQTVTAGSVNAQLQAVVSFQ"
FT   gene            complement(375684..378245)
FT                   /gene="stbC"
FT                   /locus_tag="SPC_0349"
FT   CDS_pept        complement(375684..378245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="SPC_0349"
FT                   /product="outer membrane fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44534"
FT                   /db_xref="GOA:C0Q6V5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V5"
FT                   /protein_id="ACN44534.1"
FT                   /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQNI
FT                   ARFNEQQTPSGDYLADVYVNGTLVTSSTNIRFNAVKEGQQTEPCLPLSVMKAAQIKSLP
FT                   ATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGALALF
FT                   LRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAWRYNS
FT                   VRTWVQRPVASINSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAPEVRGV
FT                   AASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSRFTVPYS
FT                   SVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIAQRYQAWL
FT                   AGGVWATGMGAFGLNATWSNARAEHNERQQGWRAELSYSKTFTTGTNLVLAAYRYSTNG
FT                   FRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSASTADYYNNQS
FT                   RITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQKYTETTMSFNV
FT                   SIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGYERYRNSNSDSS
FT                   APTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLTAGPYTSDTFALI
FT                   HADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRSDAELTGGSQQIVP
FT                   YAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIGMVGQSGQIYARIAH
FT                   PSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
FT   gene            complement(378229..378990)
FT                   /gene="stbB"
FT                   /locus_tag="SPC_0350"
FT   CDS_pept        complement(378229..378990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="SPC_0350"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44535"
FT                   /db_xref="GOA:C0Q6V6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V6"
FT                   /protein_id="ACN44535.1"
FT                   /translation="MKMDTRHSALYYLIVFLFLALPATASWASVTILGSRIIYPSTASS
FT                   VDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPFIATPPVFRIQPKAGQVVRVIYNN
FT                   TKKLPQDRESVFWFNVLQVPPTNIGSDSGQNKMLVMLRSRIKLFYRPDGLGKPDSLAKK
FT                   LQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNLDADMIAPFSSQTWWLPGK
FT                   RSLKSFSGTVTVTLVNDLGARISESYDVPHH"
FT   gene            complement(379052..379588)
FT                   /gene="stbA"
FT                   /locus_tag="SPC_0351"
FT   CDS_pept        complement(379052..379588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="SPC_0351"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44536"
FT                   /db_xref="GOA:C0Q6V7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V7"
FT                   /protein_id="ACN44536.1"
FT                   /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVING
FT                   NQAKPVVLLPTVSTKDLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNG
FT                   NLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAE
FT                   AGTVAATLQYAVSYK"
FT   gene            380252..380986
FT                   /locus_tag="SPC_0352"
FT   CDS_pept        380252..380986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0352"
FT                   /product="putative transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44537"
FT                   /db_xref="GOA:C0Q6V8"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V8"
FT                   /protein_id="ACN44537.1"
FT                   /translation="MNASIFLLDKRVVFDSTKMTLSHGNEIIRVSEAETHLLLAFWHGL
FT                   YKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQSSDIVTRPRVGVSLSVTIE
FT                   PIKKITSLKVSDENVKGTTTRENIFYKIKRHSVFVVLTGAILLALLYGVFTIYKAPVRN
FT                   SPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHLYYIREPNMNI
FT                   FLQCLNPVEMAVPKCITVKERY"
FT   gene            380959..381459
FT                   /locus_tag="SPC_0353"
FT   CDS_pept        380959..381459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0353"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44538"
FT                   /db_xref="GOA:C0Q6V9"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6V9"
FT                   /protein_id="ACN44538.1"
FT                   /translation="MYYSKRTLLIIFVIFIAIVAIGSIIALEWVNRDSYRTNNLICTTK
FT                   SEAYIAPRKLYMDGGLVLDLKSGRITLHYDVTTDTKEKRLFFRDICISKLRRTGMKTFT
FT                   FKVNSVKTFESDTAGDLFSWLRLLQPGTINELKMVKIGKNTYMFSLNRHLYNVCTTSSN
FT                   VEL"
FT   gene            381759..383333
FT                   /locus_tag="SPC_0354"
FT   CDS_pept        381759..383333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0354"
FT                   /product="putative rtn protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44539"
FT                   /db_xref="GOA:C0Q6W0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W0"
FT                   /protein_id="ACN44539.1"
FT                   /translation="MKVRKLFLMLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRF
FT                   SADISAASWQVAGKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGT
FT                   ERYHFSRLAGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAADKAAFVIVDSQYVQ
FT                   ELMEILAAERASAFSLTFGAGEAITSAATLRGKAFLTQRFTSTDHTIQLMVRTPFSTLS
FT                   AYWLQNLFIFIPLSLCLSVGMMLFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVK
FT                   HGSCGGVEALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIVHDVINWTVPDD
FT                   FYISVNISPAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREK
FT                   GVLIAIDDFGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPALDTIITLSQRLGL
FT                   NVVAEGVSTQHQLRYILSHGVGFVQGFLYARPMGTNDFMSWLGKSAQRQNGLLKGESGS
FT                   ASDLVAE"
FT   gene            383397..384176
FT                   /locus_tag="SPC_0355"
FT   CDS_pept        383397..384176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0355"
FT                   /product="putative transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44540"
FT                   /db_xref="GOA:C0Q6W1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W1"
FT                   /protein_id="ACN44540.1"
FT                   /translation="MKKRDSTGADIFMSQNNYLIDKRVILDCERMTLSCAGESITISES
FT                   ERSLLIAFYEGLFKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGASVVTR
FT                   PRVGVLLSVSIEPLSDEAQDMPLPAVAETELSTVEVRHDDTIIPPIPGAVNRKDWLYFC
FT                   LAALLMFFMIYKVKGENIDYFTLNGSYDGYTFYSVGHDKTHLTDIVEAYSEMSNEIHKQ
FT                   NGKIIYYIRVSNTNIFVQCLNQLDIAEPKCISIKERY"
FT   gene            384149..384637
FT                   /locus_tag="SPC_0356"
FT   CDS_pept        384149..384637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0356"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44541"
FT                   /db_xref="GOA:C0Q6W2"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W2"
FT                   /protein_id="ACN44541.1"
FT                   /translation="MHFHKRTLLSVATLGMLAVSVVLMVVWVRNSNHSSINTSEFLCTT
FT                   RTVTTIQPKDIHADGSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPGVY
FT                   TFEVSQVKVFATDTAGELLSHLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCTAQ"
FT   gene            385038..385561
FT                   /pseudo
FT                   /locus_tag="SPC_0357"
FT                   /note="frameshift compared to STM0346 in Salmonella
FT                   typhimurium LT2"
FT   gene            385705..386346
FT                   /locus_tag="SPC_0358"
FT   CDS_pept        385705..386346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0358"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44542"
FT                   /db_xref="GOA:C0Q6W3"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W3"
FT                   /protein_id="ACN44542.1"
FT                   /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNGE
FT                   YNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGCDR
FT                   DPDIDPDLAKPVFIEHFIKYACANDVAVGELAPLTKKEEELLWHFLYKKSMSQIASSYG
FT                   MSRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
FT   gene            386402..386581
FT                   /locus_tag="SPC_0359"
FT   CDS_pept        386402..386581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0359"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44543"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W4"
FT                   /protein_id="ACN44543.1"
FT                   /translation="MLLAIKILISALDEKTKIRLREHIEKTEQEIASSIHDSIMTETFL
FT                   QQMKDIRYILNIVP"
FT   gene            386639..386998
FT                   /locus_tag="SPC_0360"
FT   CDS_pept        386639..386998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0360"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44544"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W5"
FT                   /protein_id="ACN44544.1"
FT                   /translation="MKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDI
FT                   TGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSK
FT                   QTNVTLSGNVYRCPR"
FT   gene            complement(387068..388525)
FT                   /locus_tag="SPC_0361"
FT   CDS_pept        complement(387068..388525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0361"
FT                   /product="outer membrane efflux-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44545"
FT                   /db_xref="GOA:C0Q6W6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W6"
FT                   /protein_id="ACN44545.1"
FT                   /translation="MKITFTGYRQTATLATLAFVTTLAGCTMAPKHERPASPTAMVYPY
FT                   ATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRKAGLNVEAARALYRIQRAE
FT                   MLPTLGIATAMDAGRTPADLSVTDEPEINRRYEMAGATTAWELDLWGRVRSLSDQALAA
FT                   YMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLAAQKSSYTLTTQLARTGNA
FT                   TQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNEAVTLTEGA
FT                   IPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAFFPTISLTGTAGTASASLS
FT                   GLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEIARYENVIQQAFRDVADGL
FT                   AGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTLLDTHRMLYGAQQRLVRTR
FT                   LMQQLNIINLYKALGGGWREYSEKKQG"
FT   gene            complement(388542..391709)
FT                   /locus_tag="SPC_0362"
FT   CDS_pept        complement(388542..391709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0362"
FT                   /product="putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44546"
FT                   /db_xref="GOA:C0Q6W7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W7"
FT                   /protein_id="ACN44546.1"
FT                   /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTV
FT                   QVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDM
FT                   AQIQVQNRVSRALPRLPEEVQRIGVVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQ
FT                   VRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSV
FT                   GQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRS
FT                   LLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRSSLQ
FT                   SVAITLLEALVLVVLVVVLFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFG
FT                   LVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSA
FT                   FLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGAV
FT                   TGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQ
FT                   DKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSAL
FT                   MFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIE
FT                   DRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTD
FT                   IFETLQINLGSLYVNDFNRFGRTWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPLSAF
FT                   VTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDL
FT                   VYQEKQAGNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGG
FT                   DNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAVLEASRLRLRPILMTSFA
FT                   FIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRMALKRENRV
FT                   DSHDQQA"
FT   gene            complement(391706..392911)
FT                   /locus_tag="SPC_0363"
FT   CDS_pept        complement(391706..392911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0363"
FT                   /product="putative cation efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44547"
FT                   /db_xref="GOA:C0Q6W8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W8"
FT                   /protein_id="ACN44547.1"
FT                   /translation="MLIAGVIAASGGVIYMAGEALWDKDNAVGPPASAPPPPSVPVAKA
FT                   LSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAVSVPEGRLVSRGQLLFQIDPRPFEVA
FT                   LDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNARQAQMQSAKAA
FT                   VAAARLELSWTRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVSHNPMYVYFDID
FT                   EATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGNQMNRSTGTIRARAVIPDP
FT                   NGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKENQVEYRPVELGQMV
FT                   DGLRVVTQGVQPGEKIILKGLVRPGMTVAPRLVPMRQNVTDKQTATLTKADGDSAPKAV
FT                   RQ"
FT   gene            393209..395497
FT                   /locus_tag="SPC_0364"
FT   CDS_pept        393209..395497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0364"
FT                   /product="putative cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44548"
FT                   /db_xref="GOA:C0Q6W9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q6W9"
FT                   /protein_id="ACN44548.1"
FT                   /translation="MSQSENRHDTISLLVEGMTCASCVARVEKGIKAVPGVTDATVNLA
FT                   TERATVRGTASAEAVIAAIEKTGYEARPIETAGQGEDDSEEKKEAERVRLKRDLILASV
FT                   LALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFPALA
FT                   RLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEAR
FT                   AKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEG
FT                   RSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIRLVEQAQ
FT                   GSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCA
FT                   MGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVA
FT                   SGFERREVLAKVAAVESRSEHPIARAIVVSAEEEGSALPGMNGFESVTGMGVYATVDGT
FT                   RVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQLAAIIAVADPIKPSTPA
FT                   AINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVA
FT                   FVGDGINDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIH
FT                   QNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPM
FT                   ATPSDTSTT"
FT   gene            395509..395973
FT                   /locus_tag="SPC_0365"
FT   CDS_pept        395509..395973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0365"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44549"
FT                   /db_xref="GOA:C0Q7M9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7M9"
FT                   /protein_id="ACN44549.1"
FT                   /translation="MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADVN
FT                   QLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMAQT
FT                   LKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL"
FT   gene            396051..396245
FT                   /locus_tag="SPC_0366"
FT   CDS_pept        396051..396245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0366"
FT                   /product="putative copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44550"
FT                   /db_xref="GOA:C0Q7N0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N0"
FT                   /protein_id="ACN44550.1"
FT                   /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSL
FT                   SAEQIAAALQKAGFPPRER"
FT   gene            396537..397790
FT                   /locus_tag="SPC_0367"
FT   CDS_pept        396537..397790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0367"
FT                   /product="putative metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44551"
FT                   /db_xref="GOA:C0Q7N1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N1"
FT                   /protein_id="ACN44551.1"
FT                   /translation="MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFHA
FT                   SVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAF
FT                   LIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSM
FT                   VGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLV
FT                   MAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKK
FT                   AIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVL
FT                   PGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVV
FT                   ISGTDSDALPESAISHRT"
FT   gene            397979..399937
FT                   /gene="mod"
FT                   /locus_tag="SPC_0368"
FT   CDS_pept        397979..399937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="SPC_0368"
FT                   /product="Type III restriction-modification system StyLTI
FT                   enzyme mod"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44552"
FT                   /db_xref="GOA:C0Q7N2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041405"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N2"
FT                   /protein_id="ACN44552.1"
FT                   /translation="MLKDNQKHNESVAPNSAFLSELQRALPEFFTADRYNEQGELIAKG
FT                   GFDLARFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKN
FT                   SHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFG
FT                   LNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMD
FT                   EIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSY
FT                   KEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNL
FT                   VYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTAL
FT                   LKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQALSNNTIAKK
FT                   AGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGH
FT                   FINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTI
FT                   DFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIREL
FT                   EIGLKQLDQKVNLVKRY"
FT   gene            399944..402919
FT                   /gene="res"
FT                   /locus_tag="SPC_0369"
FT   CDS_pept        399944..402919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="res"
FT                   /locus_tag="SPC_0369"
FT                   /product="DNA restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44553"
FT                   /db_xref="GOA:C0Q7N3"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N3"
FT                   /protein_id="ACN44553.1"
FT                   /translation="MMMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKER
FT                   YDDKANIDVKMETGTGKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYA
FT                   RQHFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQM
FT                   LNSASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMI
FT                   VRFGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQA
FT                   NNRYIVDSVTAKKLILRRGSKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAG
FT                   MALVPGTFGASYQELIIQDAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSY
FT                   RDDEGWLKLKFECLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGY
FT                   FGEDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFV
FT                   IAKLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDE
FT                   INRDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELHLLEDLDDKKLINRSNEFKPSVT
FT                   LNRETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSR
FT                   RYMLQFERSGASLEQIAAEVLRDPSLYIRQKPSQVQQRLVSNEDNGRFEVAQREGELAA
FT                   SEFMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLHGDSRYLSEISLDNMTRALQ
FT                   TRINAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVDENAIDDPRSLYQI
FT                   PPLRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTTPDFVYRIERQDADS
FT                   VYLLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFAEATSAPAVFSTINGLIEGK
FT                   AN"
FT   gene            403414..404817
FT                   /locus_tag="SPC_0370"
FT   CDS_pept        403414..404817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0370"
FT                   /product="putative terminal oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44554"
FT                   /db_xref="GOA:C0Q7N4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N4"
FT                   /protein_id="ACN44554.1"
FT                   /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTR
FT                   NPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMA
FT                   LWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAER
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGL
FT                   ASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVG
FT                   ESLEQEKRE"
FT   gene            404814..405824
FT                   /locus_tag="SPC_0371"
FT   CDS_pept        404814..405824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0371"
FT                   /product="putative terminal oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44555"
FT                   /db_xref="GOA:C0Q7N5"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N5"
FT                   /protein_id="ACN44555.1"
FT                   /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFR
FT                   FKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFC
FT                   GVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAE
FT                   RWFTLPNLYYFLPVPVLVLAFSIWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWP
FT                   NIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
FT   gene            405841..406065
FT                   /locus_tag="SPC_0372"
FT   CDS_pept        405841..406065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44556"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N6"
FT                   /protein_id="ACN44556.1"
FT                   /translation="MVAASRMDGRDMVRQRASAGGRRNVVQTAHDLRRISLLTDTPGRA
FT                   FVAGESAFLSTDRRLSITFARLISPLNSG"
FT   gene            406161..407165
FT                   /locus_tag="SPC_0373"
FT   CDS_pept        406161..407165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0373"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44557"
FT                   /db_xref="GOA:C0Q7N7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N7"
FT                   /protein_id="ACN44557.1"
FT                   /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQS
FT                   SPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTF
FT                   LLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSAAS
FT                   ARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTG
FT                   EYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLAR
FT                   ARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA"
FT   gene            407329..409419
FT                   /gene="foxA"
FT                   /locus_tag="SPC_0374"
FT   CDS_pept        407329..409419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="foxA"
FT                   /locus_tag="SPC_0374"
FT                   /product="ferrioxamine B receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44558"
FT                   /db_xref="GOA:C0Q7N8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N8"
FT                   /protein_id="ACN44558.1"
FT                   /translation="MFATTRMALLIGGAIGGATFPLSAQETTKNDTVIVTSPVQSGATK
FT                   LATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDYIVLRGFSD
FT                   GSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPGGIVALTSRK
FT                   PAFDAGGEVKLFAGNHNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQFIPLKEERYA
FT                   LMPSLTWRITDRTRLDLMAYLHRDPEGGSHSGLPYQGTVVPYNGRKISNTFFEGEDDYD
FT                   KYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNETALNRGYSGSGE
FT                   KMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPPIDAFNPVYGAQPD
FT                   YITLYSREKHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNIDKLHDSRSDLDKNNV
FT                   STRAALLYLFDNGVAPYLSYSTAFTPTSFADENGNVLEPMKGKQWEAGGKYEPLGGNSQ
FT                   FSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLSDSVRLQAAYTYTDIRY
FT                   KKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEGLTLGSGIRYVNGVTSDRLNTHTLP
FT                   SYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNSLSYCYFGAERSIVGSVSW
FT                   AF"
FT   gene            complement(409460..410092)
FT                   /gene="yahN"
FT                   /locus_tag="SPC_0375"
FT   CDS_pept        complement(409460..410092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="SPC_0375"
FT                   /product="RhtC-like transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44559"
FT                   /db_xref="GOA:C0Q7N9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7N9"
FT                   /protein_id="ACN44559.1"
FT                   /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGL
FT                   GVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQ
FT                   TPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIW
FT                   RIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR"
FT   gene            410345..410599
FT                   /gene="yahO"
FT                   /locus_tag="SPC_0376"
FT   CDS_pept        410345..410599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="SPC_0376"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44560"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P0"
FT                   /protein_id="ACN44560.1"
FT                   /translation="MLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTISTTGEMSPL
FT                   DAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
FT   gene            complement(410735..412360)
FT                   /gene="prpR"
FT                   /locus_tag="SPC_0377"
FT   CDS_pept        complement(410735..412360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="SPC_0377"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44561"
FT                   /db_xref="GOA:C0Q7P1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P1"
FT                   /protein_id="ACN44561.1"
FT                   /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPI
FT                   QLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAG
FT                   KLTSSIGIVTYQESIPALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVVGAG
FT                   LITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYSSGKGLQTRYELGDIR
FT                   GQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPF
FT                   VAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLLLDEIGEMPLPLQT
FT                   RLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLP
FT                   PLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMM
FT                   ERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDANALQDVLARFKGDKSAAA
FT                   RYLGISRTTLWRRLKAGAKDQSDN"
FT   gene            412626..413513
FT                   /gene="prpB"
FT                   /locus_tag="SPC_0378"
FT   CDS_pept        412626..413513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="SPC_0378"
FT                   /product="putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44562"
FT                   /db_xref="GOA:C0Q7P2"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P2"
FT                   /protein_id="ACN44562.1"
FT                   /translation="MSLHSPGQAFRAALSKENPLQIVGAINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVKSI
FT                   AKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTDALA
FT                   VEGVEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYESINYYQ
FT                   FEEKLDALYRNKKS"
FT   gene            413636..414805
FT                   /gene="prpC"
FT                   /locus_tag="SPC_0379"
FT   CDS_pept        413636..414805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="SPC_0379"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44563"
FT                   /db_xref="GOA:C0Q7P3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P3"
FT                   /protein_id="ACN44563.1"
FT                   /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSEKGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRVFVPIEKRC"
FT   gene            414843..416294
FT                   /gene="prpD"
FT                   /locus_tag="SPC_0380"
FT   CDS_pept        414843..416294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="SPC_0380"
FT                   /product="2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44564"
FT                   /db_xref="GOA:C0Q7P4"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P4"
FT                   /protein_id="ACN44564.1"
FT                   /translation="MSAHISNVRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILAIADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAARLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDKKGPLNN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFTADYHDPE
FT                   KRAIGNAITVEFTDGSRFGEVVVEYPIGHARRRADGIPKLIEKFKINLARQFPTRQQQR
FT                   ILDVSLDRARLEQMPVNEYLDLYVI"
FT   gene            416335..418221
FT                   /pseudo
FT                   /gene="prpE"
FT                   /locus_tag="SPC_0381"
FT                   /note="stop compared to STM0371 in Salmonella typhimurium
FT                   LT2"
FT   gene            complement(418328..419302)
FT                   /gene="hemB"
FT                   /locus_tag="SPC_0382"
FT   CDS_pept        complement(418328..419302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="SPC_0382"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44565"
FT                   /db_xref="GOA:C0Q7P5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P5"
FT                   /protein_id="ACN44565.1"
FT                   /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYK
FT                   AIDAMPGVMRIPEKQLAREIERVANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKF
FT                   AAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
FT   gene            419815..422700
FT                   /locus_tag="SPC_0383"
FT   CDS_pept        419815..422700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0383"
FT                   /product="putative autotransporter/virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44566"
FT                   /db_xref="GOA:C0Q7P6"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P6"
FT                   /protein_id="ACN44566.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANATTYDTFGYHDDAATVFGW
FT                   DDTNDHDYLTYGGYVYNTPASDSGYFDTKFTGDTVNGVISTYYLNHDYANDTANTLDVT
FT                   NSTIHGMITSYQMGYGQYVWTNGSDYTTHDWVDDDTFNLNISNSTIDDDFEAFYFTDTY
FT                   LDSDGKTVKTDYDKLVTAGLGTAITLDVESNINITNNSHVAGIALYQNDLGNSTYTTEA
FT                   HQWDNTINVANSTVTSGSWSEDEEQGHFGNSSEPSDYNGNGWNKDDVALAFVDDPYSNY
FT                   RMVNNVTFTDSQLLGDVVLESSWNYNFYSNGRLVDDSTTVYTNGGWADDDQNVDHLTLT
FT                   LNNTKWVGAAVNYSQSMDPVQFYDVDANSLDPDSTNYDAWGRVNSAASFQSGIFDVSLN
FT                   NGSEWDTTKTSVIDTLAVNSGSQVDVANGSNLTADTITLNGGSAMNIGEGGYVDTDHLT
FT                   VDTFSTVTLADDVSSAWSDDALYANTITVTHGGMLDIQTNNTNADSVIDTDTLELTSSN
FT                   VADNNGNVYAGVFNIHSNDYTLNADLVNDRTWDTTQANYGYGVVAMNSDGHLTINGNGD
FT                   INNGDEADASSTTDNVVAATGNYKVRIDNATGAGSVADYKGNELIYVNDINTDATFSAA
FT                   NKADLGAYTYQAKQEGNTVVLEQMELTDYANMALSIPSANTNIWNLEQDTVGTRLTNAR
FT                   HGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKVDGNNAKWIVGAAAGFAK
FT                   GDLSDRTGQVDQDSQSAYIYSSARFANNIFVEGNLSYSHFNNDLSANMSDGTYVDGNTS
FT                   SDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMKVDGQSYDSMRYELG
FT                   VDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADVNGDSIDNGVEGSAVRVGLGTQFSFT
FT                   KNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   gene            422780..423409
FT                   /gene="yaiV"
FT                   /locus_tag="SPC_0384"
FT   CDS_pept        422780..423409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="SPC_0384"
FT                   /product="yaiV"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44567"
FT                   /db_xref="GOA:C0Q7P7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P7"
FT                   /protein_id="ACN44567.1"
FT                   /translation="MHMLSLSKPLQEFYRLDKCLSKHGTRFEFVNDKEIICSPDESNTH
FT                   TFVILEGVVSLVRGDKVLIGIVQAPFIFGLADGVAKKEAQYKLIAESGCIGYRLSSSQT
FT                   LAIIEQNQLWREAFCWIVWKSQVLELRDKQLIGNNSYDQIRATLMTMIEWDEELRSRIG
FT                   VMNYIHQRTRVSRSVVAEVLAALRKGNYIEMNKGKLISINRLPSEY"
FT   gene            complement(423454..424611)
FT                   /gene="ampH"
FT                   /locus_tag="SPC_0385"
FT   CDS_pept        complement(423454..424611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="SPC_0385"
FT                   /product="penicillin-binding protein AmpH"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44568"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P8"
FT                   /protein_id="ACN44568.1"
FT                   /translation="MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYG
FT                   SGATGMALVVIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGAHVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWSWLSTATLKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTF
FT                   TPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQAD
FT                   RMQTLIYQRTQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAM
FT                   IPQYNIGAFVVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
FT   gene            424955..426178
FT                   /gene="sbmA"
FT                   /locus_tag="SPC_0386"
FT   CDS_pept        424955..426178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="SPC_0386"
FT                   /product="putative ABC-transporter inner membrane protein
FT                   SbmA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44569"
FT                   /db_xref="GOA:C0Q7P9"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7P9"
FT                   /protein_id="ACN44569.1"
FT                   /translation="MMFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWMARLVGASDE
FT                   VPISAARFWSLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLVE
FT                   VGVAVNAWYAPFYDLIQTALSSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVSHY
FT                   VFRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLP
FT                   VLVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYR
FT                   KELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFGLFLLF
FT                   PSIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQLDGQPV
FT                   QEVTHSFS"
FT   gene            426193..427287
FT                   /gene="yaiW"
FT                   /locus_tag="SPC_0387"
FT   CDS_pept        426193..427287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="SPC_0387"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44570"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q0"
FT                   /protein_id="ACN44570.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAFAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVYTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGSYNPVHTGGPMQVSIAFAEQHAKGYPWKMAGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
FT   gene            complement(427325..427633)
FT                   /gene="yaiY"
FT                   /locus_tag="SPC_0388"
FT   CDS_pept        complement(427325..427633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="SPC_0388"
FT                   /product="yaiY"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44571"
FT                   /db_xref="GOA:C0Q7Q1"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q1"
FT                   /protein_id="ACN44571.1"
FT                   /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNLL
FT                   VHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ"
FT   gene            427901..428116
FT                   /gene="yaiZ"
FT                   /locus_tag="SPC_0389"
FT   CDS_pept        427901..428116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="SPC_0389"
FT                   /product="yaiZ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44572"
FT                   /db_xref="GOA:C0Q7Q2"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q2"
FT                   /protein_id="ACN44572.1"
FT                   /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGL
FT                   VTWIISFWLAGFIIRRREEDEVKDAR"
FT   gene            complement(428142..429254)
FT                   /gene="ddl"
FT                   /locus_tag="SPC_0390"
FT   CDS_pept        complement(428142..429254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="SPC_0390"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44573"
FT                   /db_xref="GOA:C0Q7Q3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q3"
FT                   /protein_id="ACN44573.1"
FT                   /translation="MEWVFKMAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVV
FT                   LLGIDKAGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPT
FT                   VDVIFPIVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAP
FT                   FITLTRTNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDH
FT                   KVVVEQGIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIP
FT                   SEVNDKIRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQA
FT                   SGLGYTDLISRLIELALERHAANNALKTTM"
FT   gene            429314..430027
FT                   /locus_tag="SPC_0391"
FT   CDS_pept        429314..430027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44574"
FT                   /db_xref="GOA:C0Q7Q4"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q4"
FT                   /protein_id="ACN44574.1"
FT                   /translation="MFMGCENGGRVRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQL
FT                   ADPPGWITTFKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLFHVMRVRDFGQV
FT                   KLSSSFLASCPLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRS
FT                   EHASAEALDVSGFQLSDGRKITVLRGWGRQETGPWLRAMLNASCHYYGNGLGPDYNAAH
FT                   ANHFHLGMRGYGVCR"
FT   gene            430196..431407
FT                   /locus_tag="SPC_0392"
FT   CDS_pept        430196..431407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0392"
FT                   /product="putative efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44575"
FT                   /db_xref="GOA:C0Q7Q5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q5"
FT                   /protein_id="ACN44575.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFVSLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
FT   gene            431698..431964
FT                   /gene="yaiB"
FT                   /locus_tag="SPC_0393"
FT   CDS_pept        431698..431964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="SPC_0393"
FT                   /product="yaiB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44576"
FT                   /db_xref="GOA:C0Q7Q6"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q6"
FT                   /protein_id="ACN44576.1"
FT                   /translation="MVMKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQN
FT                   EQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
FT   gene            432312..432632
FT                   /gene="psiF"
FT                   /locus_tag="SPC_0394"
FT   CDS_pept        432312..432632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="SPC_0394"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44577"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q7"
FT                   /protein_id="ACN44577.1"
FT                   /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQAL
FT                   KGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKK
FT                   AA"
FT   gene            432724..433836
FT                   /gene="adrA"
FT                   /locus_tag="SPC_0395"
FT   CDS_pept        432724..433836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adrA"
FT                   /locus_tag="SPC_0395"
FT                   /product="adrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44578"
FT                   /db_xref="GOA:C0Q7Q8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q8"
FT                   /protein_id="ACN44578.1"
FT                   /translation="MFPKIMNDENFYRKAVEQAVAPPDPLDDRQRSGLRFARRIRLPRA
FT                   VGLGGMFLPVAAVLVSQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVD
FT                   AILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLTGLP
FT                   VAMRSSSLEVTLSLPVIMLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRH
FT                   WEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGS
FT                   DIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQ
FT                   IGHYREWLKSADMALYKAKNAGRNRTEVAA"
FT   gene            complement(433851..434660)
FT                   /gene="proC"
FT                   /locus_tag="SPC_0396"
FT   CDS_pept        complement(433851..434660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SPC_0396"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44579"
FT                   /db_xref="GOA:C0Q7Q9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Q9"
FT                   /protein_id="ACN44579.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPSLVNVGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHP
FT                   GELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
FT   gene            434800..435255
FT                   /gene="yaiI"
FT                   /locus_tag="SPC_0397"
FT   CDS_pept        434800..435255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="SPC_0397"
FT                   /product="yaiI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44580"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7R0"
FT                   /protein_id="ACN44580.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATIRE
FT                   RLTMCDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
FT   gene            435440..435985
FT                   /gene="aroL"
FT                   /locus_tag="SPC_0398"
FT   CDS_pept        435440..435985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="SPC_0398"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44581"
FT                   /db_xref="GOA:C0Q7R1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7R1"
FT                   /protein_id="ACN44581.1"
FT                   /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSV
FT                   ADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTDYNRRYMHRVGVVIYLCAPV
FT                   STLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQVVSE
FT                   IIAALPPSTQRLQGDVYT"
FT   gene            436012..436203
FT                   /gene="yaiA"
FT                   /locus_tag="SPC_0399"
FT   CDS_pept        436012..436203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="SPC_0399"
FT                   /product="yaiA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44582"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R2"
FT                   /protein_id="ACN44582.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKKRYEDPDKS"
FT   gene            436454..437131
FT                   /gene="aroM"
FT                   /locus_tag="SPC_0400"
FT   CDS_pept        436454..437131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="SPC_0400"
FT                   /product="protein of aro operon, regulated by aroR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44583"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R3"
FT                   /protein_id="ACN44583.1"
FT                   /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSREDV
FT                   MADYAVEPGDDPLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAIKS
FT                   MAARNSILLEPLRIIPPLVASIVDGHQVGVIVPVAELLAAQEKKWQVLQMPPVYSLANP
FT                   VHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIARLASE
FT                   LLV"
FT   gene            437202..437486
FT                   /gene="yaiE"
FT                   /locus_tag="SPC_0401"
FT   CDS_pept        437202..437486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="SPC_0401"
FT                   /product="yaiE"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44584"
FT                   /db_xref="GOA:C0Q7R4"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7R4"
FT                   /protein_id="ACN44584.1"
FT                   /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEM
FT                   TVVSGALKVLLPGTVEWKVYTAGEVFNVPVHSEFHLQVAEPTSYLCRYL"
FT   gene            complement(437524..438447)
FT                   /gene="rdgC"
FT                   /locus_tag="SPC_0402"
FT   CDS_pept        complement(437524..438447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="SPC_0402"
FT                   /product="recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44585"
FT                   /db_xref="GOA:C0Q7R5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R5"
FT                   /protein_id="ACN44585.1"
FT                   /translation="MEIIMLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMA
FT                   KMGWVPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLK
FT                   KTEKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLG
FT                   SLPVVPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDE
FT                   IAVHIEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDA
FT                   DFILMTGELAALIQSLVEGLGGEAQR"
FT   gene            438561..439469
FT                   /gene="yajF"
FT                   /locus_tag="SPC_0403"
FT   CDS_pept        438561..439469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="SPC_0403"
FT                   /product="putative ROK-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44586"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R6"
FT                   /protein_id="ACN44586.1"
FT                   /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIAT
FT                   LVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKRAVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRTHIGGNGTAGEWGHNPLPWM
FT                   DDDELRYREEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQDAVAE
FT                   LALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPV
FT                   RKARHGDSSGVRGAAWLWPLA"
FT   gene            complement(439489..440715)
FT                   /gene="araJ"
FT                   /locus_tag="SPC_0404"
FT   CDS_pept        complement(439489..440715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="SPC_0404"
FT                   /product="MFS family, arabinose polymer transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44587"
FT                   /db_xref="GOA:C0Q7R7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R7"
FT                   /protein_id="ACN44587.1"
FT                   /translation="MTIHSHSAQHAPLFSAGGMKKVIFSLALGTFGLGMAEFGIMGVLT
FT                   ELARDVGITIPAAGHMISFYAFGVVLGAPVMALFSSRFSLKHILLFLVTLCVMGNAIFT
FT                   FSSSYLMLAVGRLVSGFPHGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIP
FT                   VGTYLSQEFSWRYTFLLIAVFNIAVLTAIFFWVPDIRDKAQGSLREQFHFLRSPAPWLI
FT                   FAATMFGNAGVFAWFSYIKPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYT
FT                   PLRIAVVTDLVIVLSLMALFFFSGYKTASLTFAFICCAGLFALSAPLQILLLQNAKGGE
FT                   LLGAAGGQIAFNLGSAIGAWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHK
FT                   QPSVTPVAG"
FT   gene            complement(440834..443974)
FT                   /gene="sbcC"
FT                   /locus_tag="SPC_0405"
FT   CDS_pept        complement(440834..443974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="SPC_0405"
FT                   /product="exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44588"
FT                   /db_xref="GOA:C0Q7R8"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R8"
FT                   /protein_id="ACN44588.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRARNQ
FT                   PDGNLQSPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLE
FT                   ASLQALTDEEKRLLADQQGQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLA
FT                   ALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACAHRQFTQ
FT                   LNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDTRQRDAL
FT                   PPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIARHHQEQAQ
FT                   YTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAI
FT                   AAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESEAQSLLQEEQA
FT                   LTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQIAAHTEQVERF
FT                   TAQIAQRQASLTADLAQYTLSLPAPEDEAAWLNERADEAKIWQQRQTEFADLQTQIDRL
FT                   APLLETLPQTDTADSDDDVPLDNWRQAHDECVSLQSQLQTLQEQTTQEQQRAAEAIAHF
FT                   DAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKALSAQSAQALADHQQQ
FT                   PPAGLDPTCTAEQLAQRLTQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMAEMKQT
FT                   SQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDAL
FT                   ELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDS
FT                   ETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLDKAFAVE"
FT   gene            complement(443971..445173)
FT                   /gene="sbcD"
FT                   /locus_tag="SPC_0406"
FT   CDS_pept        complement(443971..445173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="SPC_0406"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44589"
FT                   /db_xref="GOA:C0Q7R9"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7R9"
FT                   /protein_id="ACN44589.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNTTV
FT                   IASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADYYQQ
FT                   QYQEACLLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGH
FT                   IHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFDQGKWQSTESLAIPVTQPLAV
FT                   LKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHDIQRRIQTLTESLPVEVLLVRR
FT                   SREQRERSLANERRETLSELSVEEVFARRLALEALDPPQRERLNQLFSSTLYALNEEHE
FT                   A"
FT   gene            complement(445215..445346)
FT                   /locus_tag="SPC_0407"
FT   CDS_pept        complement(445215..445346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44590"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S0"
FT                   /protein_id="ACN44590.1"
FT                   /translation="MRQIYDRFMKKKGGIDSMLMIYDTGETVHYRVPAVNCAQKWRG"
FT   gene            445388..446077
FT                   /gene="phoB"
FT                   /locus_tag="SPC_0408"
FT   CDS_pept        445388..446077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="SPC_0408"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44591"
FT                   /db_xref="GOA:C0Q7S1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S1"
FT                   /protein_id="ACN44591.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEP
FT                   WPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGDSPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            446147..447442
FT                   /gene="phoR"
FT                   /locus_tag="SPC_0409"
FT   CDS_pept        446147..447442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="SPC_0409"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44592"
FT                   /db_xref="GOA:C0Q7S2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S2"
FT                   /protein_id="ACN44592.1"
FT                   /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLVW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRDFTR
FT                   PLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEAAPALLLNEKVDVP
FT                   MMLRVVEREAQTLSQQKHTFTFEVDDSLSVLGNEEQLRSAISNLVYNAVNHTPAGTHIT
FT                   VSWRRVAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
FT   gene            447851..449170
FT                   /gene="brnQ"
FT                   /locus_tag="SPC_0410"
FT   CDS_pept        447851..449170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SPC_0410"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44593"
FT                   /db_xref="GOA:C0Q7S3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S3"
FT                   /protein_id="ACN44593.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAW
FT                   SQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
FT   gene            449185..450615
FT                   /gene="proY"
FT                   /locus_tag="SPC_0411"
FT   CDS_pept        449185..450615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="SPC_0411"
FT                   /product="proline-specific permease ProY"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44594"
FT                   /db_xref="GOA:C0Q7S4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S4"
FT                   /protein_id="ACN44594.1"
FT                   /translation="MYTTGLNAPWFFIVLIGQKLMESNNKLKRGLSTRHIRFMALGSAI
FT                   GTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLG
FT                   PLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLMSVK
FT                   VFGELEFWFSFFKVATIIIMIVAGIGIIVWGVGNGGQPTGIHNLWSNGGFFSNGWLGMI
FT                   MSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWN
FT                   QVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPK
FT                   VFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQ
FT                   IAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIALIGYHPDTRISLYVGFAWIVL
FT                   LLIGWIFKRRRDRQLAQA"
FT   gene            450777..452594
FT                   /gene="malZ"
FT                   /locus_tag="SPC_0412"
FT   CDS_pept        450777..452594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="SPC_0412"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44595"
FT                   /db_xref="GOA:C0Q7S5"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S5"
FT                   /protein_id="ACN44595.1"
FT                   /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNEE
FT                   ISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQLWFTPQGFNRFPPAR
FT                   LEQFAVDVPDSGPQWVADQIFYQIFPDRFARSATCEADQDRVYHHHAAGQEIVLRDWDD
FT                   PLTLQAGGSTFYGGCLNGICEKLPYLKTLGVTALYLNPVFTAPSVHKYDTEDYRHVDPQ
FT                   FGGDRALLRLRRETQAQGMRLVLDGVFNHSGDSHAWFDRHNRSTGGACHHPDSPWRDWY
FT                   SFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   LWGFLANTDIAYEPQHIDARTCITWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGK
FT                   DAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDGNLLALYQRM
FT                   AKLRQRSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVALEALPLLNVA
FT                   GWQCKTGSGDIREGRLSLPAISATVWMNR"
FT   gene            complement(452666..453268)
FT                   /locus_tag="SPC_0413"
FT   CDS_pept        complement(452666..453268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0413"
FT                   /product="putative peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44596"
FT                   /db_xref="GOA:C0Q7S6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7S6"
FT                   /protein_id="ACN44596.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVA
FT                   DVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
FT   gene            complement(453478..454059)
FT                   /gene="yajB"
FT                   /locus_tag="SPC_0414"
FT   CDS_pept        complement(453478..454059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="SPC_0414"
FT                   /product="yajB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44597"
FT                   /db_xref="GOA:C0Q7S7"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7S7"
FT                   /protein_id="ACN44597.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYMH
FT                   RRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFVGY
FT                   AHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALRDSW
FT                   YDLDAHYDALEERFWHFYPRMMAQAARKAL"
FT   gene            454153..455217
FT                   /gene="queA"
FT                   /locus_tag="SPC_0415"
FT   CDS_pept        454153..455217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SPC_0415"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44598"
FT                   /db_xref="GOA:C0Q7S8"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7S8"
FT                   /protein_id="ACN44598.1"
FT                   /translation="MRVTDFSFELPDSLIAHYPQPERSRCRLLSLEGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   TELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPFFGDTQ
FT                   IFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYGDA
FT                   MFITYNPQAISERP"
FT   gene            455414..456541
FT                   /gene="tgt"
FT                   /locus_tag="SPC_0416"
FT   CDS_pept        455414..456541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SPC_0416"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44599"
FT                   /db_xref="GOA:C0Q7S9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7S9"
FT                   /protein_id="ACN44599.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTKFYQRQGRPVPPLNVD"
FT   gene            456564..456896
FT                   /gene="yajC"
FT                   /locus_tag="SPC_0417"
FT   CDS_pept        456564..456896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SPC_0417"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44600"
FT                   /db_xref="GOA:C0Q7T0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T0"
FT                   /protein_id="ACN44600.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            456957..458771
FT                   /gene="secD"
FT                   /locus_tag="SPC_0418"
FT   CDS_pept        456957..458771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SPC_0418"
FT                   /product="protein export protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44601"
FT                   /db_xref="GOA:C0Q7T1"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T1"
FT                   /protein_id="ACN44601.1"
FT                   /translation="MLVVVIIVGLLYALPNLYGEDPAVQITGVRGVAASEQTLIQVQKT
FT                   LQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVALNLAPATPRWLAA
FT                   IHADPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNY
FT                   GLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDARLSEAREYAVQQNINI
FT                   LRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAA
FT                   AAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITG
FT                   ISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACLAGLVVSILFMI
FT                   FFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVA
FT                   TSMFTAIIGTRAIVNLLYGGKRVTKLSI"
FT   gene            458782..459753
FT                   /gene="secF"
FT                   /locus_tag="SPC_0419"
FT   CDS_pept        458782..459753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SPC_0419"
FT                   /product="protein export protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44602"
FT                   /db_xref="GOA:C0Q7T2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T2"
FT                   /protein_id="ACN44602.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTEGE
FT                   TGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            459898..460263
FT                   /locus_tag="SPC_0420"
FT   CDS_pept        459898..460263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44603"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T3"
FT                   /protein_id="ACN44603.1"
FT                   /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFPY
FT                   AEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIGTI
FT                   ALFIDSEGNRIGLHQPA"
FT   gene            460289..460981
FT                   /locus_tag="SPC_0421"
FT   CDS_pept        460289..460981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0421"
FT                   /product="putative DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44604"
FT                   /db_xref="GOA:C0Q7T4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T4"
FT                   /protein_id="ACN44604.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDLS
FT                   LSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESAQE
FT                   KVLAILPEESRRKAEQTRIYAPDLGTSPHSRSAFDLIHQAVSAQQVLALHYRDEAGHLS
FT                   SRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLRDFLR
FT                   KVEHEKMP"
FT   gene            461151..461498
FT                   /gene="yajD"
FT                   /locus_tag="SPC_0422"
FT   CDS_pept        461151..461498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="SPC_0422"
FT                   /product="yajD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44605"
FT                   /db_xref="GOA:C0Q7T5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T5"
FT                   /protein_id="ACN44605.1"
FT                   /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYNPF
FT                   ADLKAMMNKKK"
FT   gene            461892..462044
FT                   /locus_tag="SPC_0423"
FT   CDS_pept        461892..462044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44606"
FT                   /db_xref="GOA:C0Q7T6"
FT                   /db_xref="InterPro:IPR025253"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T6"
FT                   /protein_id="ACN44606.1"
FT                   /translation="MRIAANRCHCNKGGNMTLTELSITIWHDLAAPTLVGIATGLFLGW
FT                   WHRRK"
FT   gene            complement(462128..462991)
FT                   /gene="tsx"
FT                   /locus_tag="SPC_0424"
FT   CDS_pept        complement(462128..462991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="SPC_0424"
FT                   /product="nucleoside-specific channel-forming protein tsx
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44607"
FT                   /db_xref="GOA:C0Q7T7"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T7"
FT                   /protein_id="ACN44607.1"
FT                   /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSY
FT                   HTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDSSPLFMEIE
FT                   PRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLS
FT                   LNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDP
FT                   NRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYL
FT                   VVGYNF"
FT   gene            complement(463291..463788)
FT                   /gene="yajI"
FT                   /locus_tag="SPC_0425"
FT   CDS_pept        complement(463291..463788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="SPC_0425"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44608"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T8"
FT                   /protein_id="ACN44608.1"
FT                   /translation="MSLTACAPQSEVRQMHQSISTLNKEMTQLNQETVKITQQNKLNAE
FT                   STRGVYLLPGANTPARLESQIGTLRMTLLEITPVADGAHATLHIQGESRDPLPAFSATV
FT                   EYGQLQGTTENYQEVNAQSLLVNAPASLLAPSDVNISLPLKGITPAQLGFIRIHDIQPV
FT                   NQ"
FT   gene            463863..464009
FT                   /locus_tag="SPC_0426"
FT   CDS_pept        463863..464009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44609"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7T9"
FT                   /protein_id="ACN44609.1"
FT                   /translation="MVVRYTHKGTDPLSQKRSAFVVAPVQGKIAFPKSSGQDAVCIAHF
FT                   VSP"
FT   gene            464054..464431
FT                   /locus_tag="SPC_0427"
FT   CDS_pept        464054..464431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0427"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44610"
FT                   /db_xref="GOA:C0Q7U0"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U0"
FT                   /protein_id="ACN44610.1"
FT                   /translation="MRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREPFNEDKLRSG
FT                   MLRALEKRPVSADDVEMALNHIKSQLRATGEREVPSKMIGNLVMEQLKKLDKVAYIRFA
FT                   SVYRSFEDIKDFGEEIARLQD"
FT   gene            464435..465538
FT                   /gene="ribD"
FT                   /locus_tag="SPC_0428"
FT   CDS_pept        464435..465538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SPC_0428"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44611"
FT                   /db_xref="GOA:C0Q7U1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U1"
FT                   /protein_id="ACN44611.1"
FT                   /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHHR
FT                   AGEPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQASYPQE
FT                   NLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSRAWPDAVRTISVPAHNGHLDL
FT                   VVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLCELPGLE
FT                   KLADAPQFTFSEIRHVGPDVCLHMVSA"
FT   gene            465627..466097
FT                   /gene="ribH"
FT                   /locus_tag="SPC_0429"
FT   CDS_pept        465627..466097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SPC_0429"
FT                   /product="riboflavin synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44612"
FT                   /db_xref="GOA:C0Q7U2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7U2"
FT                   /protein_id="ACN44612.1"
FT                   /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQVK
FT                   DDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASV
FT                   AQDSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            466118..466537
FT                   /gene="nusB"
FT                   /locus_tag="SPC_0430"
FT   CDS_pept        466118..466537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SPC_0430"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44613"
FT                   /db_xref="GOA:C0Q7U3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7U3"
FT                   /protein_id="ACN44613.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            466616..467596
FT                   /gene="thiL"
FT                   /locus_tag="SPC_0431"
FT   CDS_pept        466616..467596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SPC_0431"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44614"
FT                   /db_xref="GOA:C0Q7U4"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U4"
FT                   /protein_id="ACN44614.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGIHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLAAFS
FT                   DSLFEQLDYYDMQLIGGDTTRGPLSMTLGIHGLVPAGRALKRSGAKPGDWIYVTGTLGD
FT                   SAAGLAILRGDFRVGSWGDADYLVKRHLRPTPRILQGQALRDLASSAIDLSDGLISDLG
FT                   HILQASNCGARIDLEALPDSEELWGHANDPEQKLRWMLSGGEDYELCFTVPELNRGALD
FT                   VALGHLGVPFTCIGQMTADIEGIAFVRDGEPVTFDWKGYDHFATP"
FT   gene            467574..468089
FT                   /gene="pgpA"
FT                   /locus_tag="SPC_0432"
FT   CDS_pept        467574..468089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="SPC_0432"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44615"
FT                   /db_xref="GOA:C0Q7U5"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U5"
FT                   /protein_id="ACN44615.1"
FT                   /translation="MTILPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTTDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGII"
FT   gene            complement(468193..469167)
FT                   /gene="yajO"
FT                   /locus_tag="SPC_0433"
FT   CDS_pept        complement(468193..469167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="SPC_0433"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44616"
FT                   /db_xref="GOA:C0Q7U6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U6"
FT                   /protein_id="ACN44616.1"
FT                   /translation="MQYNTLGNTDLQVSRLCLGCMTFGEPSRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLTRLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALAWLLSKRGVAA
FT                   PIIGTSREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
FT   gene            complement(469224..471086)
FT                   /gene="dxs"
FT                   /locus_tag="SPC_0434"
FT   CDS_pept        complement(469224..471086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SPC_0434"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44617"
FT                   /db_xref="GOA:C0Q7U7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7U7"
FT                   /protein_id="ACN44617.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECR
FT                   QMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAILNFGTLMPE
FT                   AAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWLA"
FT   gene            complement(471110..472009)
FT                   /gene="ispA"
FT                   /locus_tag="SPC_0435"
FT   CDS_pept        complement(471110..472009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="SPC_0435"
FT                   /product="geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44618"
FT                   /db_xref="GOA:C0Q7U8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7U8"
FT                   /protein_id="ACN44618.1"
FT                   /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGGK
FT                   RLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIK
FT                   FGEANAILAGDALQTLAFAIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQALDLA
FT                   AEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQLAAQS
FT                   LDTSALEALANYIIQRDK"
FT   gene            complement(472010..472252)
FT                   /gene="xseB"
FT                   /locus_tag="SPC_0436"
FT   CDS_pept        complement(472010..472252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SPC_0436"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44619"
FT                   /db_xref="GOA:C0Q7U9"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7U9"
FT                   /protein_id="ACN44619.1"
FT                   /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
FT   gene            472462..473910
FT                   /gene="thiI"
FT                   /locus_tag="SPC_0437"
FT   CDS_pept        472462..473910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="SPC_0437"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44620"
FT                   /db_xref="GOA:C0Q7V0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7V0"
FT                   /protein_id="ACN44620.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAVHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQQEVVEVE
FT                   TVSGFGPNDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFANVKVYRP"
FT   gene            complement(473954..474751)
FT                   /gene="phnV"
FT                   /locus_tag="SPC_0438"
FT   CDS_pept        complement(473954..474751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="SPC_0438"
FT                   /product="putative membrane component of
FT                   2-aminoethylphosphonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44621"
FT                   /db_xref="GOA:C0Q7V1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V1"
FT                   /protein_id="ACN44621.1"
FT                   /translation="MPIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILP
FT                   SGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMV
FT                   FYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISA
FT                   DIENVASSLGASPWYRLRHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLP
FT                   VAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLGQK"
FT   gene            complement(474754..475614)
FT                   /gene="phnU"
FT                   /locus_tag="SPC_0439"
FT   CDS_pept        complement(474754..475614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnU"
FT                   /locus_tag="SPC_0439"
FT                   /product="putative membrane component of
FT                   2-aminoethylphosphonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44622"
FT                   /db_xref="GOA:C0Q7V2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017636"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V2"
FT                   /protein_id="ACN44622.1"
FT                   /translation="MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRG
FT                   ANGEIGLETFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELI
FT                   GRVVDTFIALPTFLITLAFTFIYGSAGLLNGTLMSLFAFELPPVDFLYSMQGVILAEIT
FT                   VFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLT
FT                   TNEFGIVLFIGAKGVNTLPMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASR
FT                   TGVRS"
FT   gene            complement(475617..476714)
FT                   /pseudo
FT                   /locus_tag="SPC_0440"
FT                   /note="degenerate compared to STM0428 in Salmonella
FT                   typhimurium LT2"
FT   gene            complement(476750..477763)
FT                   /gene="phnS"
FT                   /locus_tag="SPC_0441"
FT   CDS_pept        complement(476750..477763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnS"
FT                   /locus_tag="SPC_0441"
FT                   /product="putative periplasmic binding component of
FT                   2-aminoethylphosphonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44623"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V3"
FT                   /protein_id="ACN44623.1"
FT                   /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQF
FT                   DAFTKATGITVRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTD
FT                   AASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDAKFKNKLQYSTPGQAADG
FT                   TAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLA
FT                   QMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSE
FT                   LSWGMPVRSDVTPSDEHYKAATAALEGVQSWQPNWDDVAVSLSADISRWHKVTESE"
FT   gene            complement(477961..478680)
FT                   /gene="phnR"
FT                   /locus_tag="SPC_0442"
FT   CDS_pept        complement(477961..478680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnR"
FT                   /locus_tag="SPC_0442"
FT                   /product="putative regulator of 2-aminoethylphosphonate
FT                   uptake and metabolism operon"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44624"
FT                   /db_xref="GOA:C0Q7V4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR017722"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V4"
FT                   /protein_id="ACN44624.1"
FT                   /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKRGDKLPSERELCAIFNT
FT                   TRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALL
FT                   SGVLTTVPVEVMESLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNG
FT                   SLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDL
FT                   DIEYWRHDSLRIEVDTH"
FT   gene            478820..479923
FT                   /gene="phnW"
FT                   /locus_tag="SPC_0443"
FT   CDS_pept        478820..479923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="SPC_0443"
FT                   /product="2-aminoethylphosphonate:pyruvate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44625"
FT                   /db_xref="GOA:C0Q7V5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7V5"
FT                   /protein_id="ACN44625.1"
FT                   /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQ
FT                   QLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMG
FT                   IAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAQRYDK
FT                   TYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSL
FT                   SLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAEEGGVAARHQRYQQNQRSLVA
FT                   GMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFR
FT                   IGNIGEVYAADITALLTAIRTAMYWTK"
FT   gene            479930..480742
FT                   /gene="phnX"
FT                   /locus_tag="SPC_0444"
FT   CDS_pept        479930..480742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="SPC_0444"
FT                   /product="phosphonoacetaldehyde phosphonohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44626"
FT                   /db_xref="GOA:C0Q7V6"
FT                   /db_xref="InterPro:IPR006323"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7V6"
FT                   /protein_id="ACN44626.1"
FT                   /translation="MMNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEA
FT                   RVPMGLGKWQHIEALGKLPAVDARWQAKFSRSMSAADIDAIYAAFMPLQIAKVVDFSSP
FT                   IAGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAGHGYCPDHWVATDDLAAGGRPG
FT                   PWMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAYQTM
FT                   SKEDVAVRREHAASKLYAAGAHYVVDSLADLPEVIAHINARLAQGERP"
FT   gene            complement(480839..481429)
FT                   /gene="thiJ"
FT                   /locus_tag="SPC_0445"
FT   CDS_pept        complement(480839..481429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="SPC_0445"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44627"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V7"
FT                   /protein_id="ACN44627.1"
FT                   /translation="MSAQALVCLASGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTI
FT                   VCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(481392..482303)
FT                   /gene="apbA"
FT                   /locus_tag="SPC_0446"
FT   CDS_pept        complement(481392..482303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="SPC_0446"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44628"
FT                   /db_xref="GOA:C0Q7V8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V8"
FT                   /protein_id="ACN44628.1"
FT                   /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDTD
FT                   GSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIE
FT                   ELQNIQQPMLMGTITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVLPDV
FT                   AWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIEREGYHT
FT                   SADDLRYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKLARVHGLAVPENSRL
FT                   FEMVKRKESEYERSGTGMPRLW"
FT   gene            482411..482920
FT                   /gene="yajQ"
FT                   /locus_tag="SPC_0447"
FT   CDS_pept        482411..482920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="SPC_0447"
FT                   /product="yajQ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44629"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7V9"
FT                   /protein_id="ACN44629.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATI
FT                   ELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPDEFVHSGKTWYVEAKL
FT                   KQGIESAVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQ
FT                   FKNFRD"
FT   gene            complement(482967..484331)
FT                   /gene="yajR"
FT                   /locus_tag="SPC_0448"
FT   CDS_pept        complement(482967..484331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="SPC_0448"
FT                   /product="putative major facilitator family transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44630"
FT                   /db_xref="GOA:C0Q7W0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W0"
FT                   /protein_id="ACN44630.1"
FT                   /translation="MNDYKMTPRELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTHSLG
FT                   LNALFWMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMVFAFAAVVPFIIYAEVKRRMKQVF
FT                   LFCVGLIVVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPPYVSSLRV
FT                   EIPADIVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQLISKG"
FT   gene            complement(484559..484693)
FT                   /locus_tag="SPC_0449"
FT   CDS_pept        complement(484559..484693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0449"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44631"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W1"
FT                   /protein_id="ACN44631.1"
FT                   /translation="MAKQKFKITHRPATLRQRGSLTVWLDEFCYCNMEQQRTPPEGRG"
FT   gene            484868..486379
FT                   /locus_tag="SPC_0450"
FT   CDS_pept        484868..486379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0450"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44632"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W2"
FT                   /protein_id="ACN44632.1"
FT                   /translation="MKIKFLSLCILAGVLFANQVNASENNSKDDVKYAALTQKDLDALP
FT                   VEKRASVLDELGFIHEYGLSVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAK
FT                   DSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNR
FT                   PESDALFFSRIGFNQEKTFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYKARPA
FT                   SLKWFRAAAEKGVVEAQSLLGGIYSGGEGDEWGIKPDIQEAQKWYGQAAEQGDSDAQIA
FT                   LGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYY
FT                   KKASRYVGKKVEEKIFLSKCAADIQSRKNNADALPKVTLKKESIFSRGITAKPKECALI
FT                   FQIGTDKIRNMANLHITLELKNDDGVATEETLMIPPFDLNTLGIDMQNHDVDPLVTPYD
FT                   LPLYTQDFCHGIDDIHFTLKSATATINDKNVDLLKADSVRFLDKE"
FT   gene            486391..487860
FT                   /locus_tag="SPC_0451"
FT   CDS_pept        486391..487860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44633"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W3"
FT                   /protein_id="ACN44633.1"
FT                   /translation="MIKRKWNILFLLGLSFASVCQAGDDIDALYSRIAQKDIQALNELK
FT                   ALAKDNNAQALAELGFIYEYGVAVPIDMIQAIKYYEQACHVEEPYGCYNARYFYLHGLG
FT                   VMQDDVLAKELADKTSKADTDTDAQTVTRLIADEIDTAKQAAESDITQRSRFIETLRQY
FT                   ASGGSAMAALITRLGYSKEDILHLAELWAQERDPELNFIVGSLYDSGFVEVDDKEARSL
FT                   QWFRKAAELGQADAQNILGYFYLNGKRGIKRDLQKGVQWYELAAAQGNADALINLGEIY
FT                   YSGTQVPLDYARAFEFFERAAKMGKFRALNYLAWMYTNGQFVDTDCRKAAELFAQGRTS
FT                   FADDPHFQVTCEKDRQARAEAVAMREKNLPKLTFNRDRVFGASQGSGYACELEFVVKTD
FT                   RISSIENLRVSLALKNKAGAMSQQVIAFEPFGLNTQNRNLQGYKSDTLRESTLQPVYQP
FT                   EFCDVDSYSVTAVTGMVNGKEMDMLKAGVFL"
FT   gene            complement(487908..488798)
FT                   /gene="cyoE"
FT                   /locus_tag="SPC_0452"
FT   CDS_pept        complement(487908..488798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="SPC_0452"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44634"
FT                   /db_xref="GOA:C0Q7W4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W4"
FT                   /protein_id="ACN44634.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSV
FT                   DFMVPNSQNLLTYVW"
FT   gene            complement(488810..489139)
FT                   /gene="cyoD"
FT                   /locus_tag="SPC_0453"
FT   CDS_pept        complement(488810..489139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="SPC_0453"
FT                   /product="cytochrome o ubiquinol oxidase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44635"
FT                   /db_xref="GOA:C0Q7W5"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W5"
FT                   /protein_id="ACN44635.1"
FT                   /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAV
FT                   ILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(489139..489654)
FT                   /gene="cyoC"
FT                   /locus_tag="SPC_0454"
FT   CDS_pept        complement(489139..489654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="SPC_0454"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44636"
FT                   /db_xref="GOA:C0Q7W6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W6"
FT                   /protein_id="ACN44636.1"
FT                   /translation="MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLF
FT                   SSITYGMAAIAMHKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLS
FT                   AFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFT
FT                   VVYLMGAM"
FT   gene            complement(489743..491734)
FT                   /gene="cyoB"
FT                   /locus_tag="SPC_0455"
FT   CDS_pept        complement(489743..491734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="SPC_0455"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44637"
FT                   /db_xref="GOA:C0Q7W7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W7"
FT                   /protein_id="ACN44637.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALGILCQLIQIF
FT                   VSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYQQ
FT                   PGQYEAIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIISWIVKSFDEDVD
FT                   YYVPVPEVEKLENQHFDEITKAGLKNGN"
FT   gene            complement(491745..492701)
FT                   /gene="cyoA"
FT                   /locus_tag="SPC_0456"
FT   CDS_pept        complement(491745..492701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="SPC_0456"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44638"
FT                   /db_xref="GOA:C0Q7W8"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W8"
FT                   /protein_id="ACN44638.1"
FT                   /translation="MRLRKYNKSLGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATKDRAEFDQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKDVINKF
FT                   MDHGKSMDMTQPEGEHSSHEGMEGMDMSHAESANSKG"
FT   gene            complement(492948..493070)
FT                   /locus_tag="SPC_0457"
FT   CDS_pept        complement(492948..493070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44639"
FT                   /db_xref="GOA:C0Q7W9"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7W9"
FT                   /protein_id="ACN44639.1"
FT                   /translation="MRNRILEIIGNFYATYFLYTIQPIKFKFLPLIVLLLIINC"
FT   gene            complement(493154..494629)
FT                   /gene="ampG"
FT                   /locus_tag="SPC_0458"
FT   CDS_pept        complement(493154..494629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="SPC_0458"
FT                   /product="AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44640"
FT                   /db_xref="GOA:C0Q7X0"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X0"
FT                   /protein_id="ACN44640.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLATQLLLLAAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADRWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPSPKSLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKNMFSMGAAVFFENLCGGMGTAAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWPTFYLFSVVAAVPGLLLL
FT                   LVCRQTLEYSWQNERFIPRTQYRGAYNFALSILLAGVALLAVWVLLLTMNALDYTNFSF
FT                   LSGLLETAVAVAVCGIVFGGLLDYLALRKTRLL"
FT   gene            complement(494673..495305)
FT                   /gene="yajG"
FT                   /locus_tag="SPC_0459"
FT   CDS_pept        complement(494673..495305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="SPC_0459"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44641"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X1"
FT                   /protein_id="ACN44641.1"
FT                   /translation="MMAGIFTYHVLSVIESLNMLKKLLFPLVALFMLAGCATPPTTIDV
FT                   APKITLPQQDPSLMGVTVSITGADQRQDQALAKVTRNNQLVTLTASRDLRFLLQEVLEK
FT                   QMTARGYMIGPNGAVNLQIIVNQLYADVSQGSVRYNIATKADIAIIATAANGNKMTKNY
FT                   RANYSIEGAFQASNQNIADAVNSVLTDTIADMSQDTSIHDFIKQNAR"
FT   gene            495555..495873
FT                   /pseudo
FT                   /locus_tag="SPC_0460"
FT                   /note="frameshift compared to STM0446 in Salmonella
FT                   typhimurium LT2"
FT   gene            496220..497518
FT                   /gene="tig"
FT                   /locus_tag="SPC_0461"
FT   CDS_pept        496220..497518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SPC_0461"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44642"
FT                   /db_xref="GOA:C0Q7X2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7X2"
FT                   /protein_id="ACN44642.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEYKVGEDFT
FT                   YSVEFEVYPEVELTGLESIEVEKPVVEVTDADVDVMLDTLRKQQATWKEKDGAADAEDR
FT                   VTIDFTGSVDGEEFEGGKATDFVLAMGQGRMIPGFEDGVKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFVINLKKVEERGLPELTEEFIKRFGVEDGSVAGLRAEVRKNMERELKGA
FT                   VRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
FT   gene            497657..498388
FT                   /gene="clpP"
FT                   /locus_tag="SPC_0462"
FT   CDS_pept        497657..498388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SPC_0462"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44643"
FT                   /db_xref="GOA:C0Q7X3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X3"
FT                   /protein_id="ACN44643.1"
FT                   /translation="MNYGDAVPITEGLADNPSIRLQSVQQVFSIFIQETEMSYSGERDN
FT                   LAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAEN
FT                   PEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFC
FT                   LPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDR
FT                   FLSAPEAVEYGLVDSILTHRN"
FT   gene            498640..499911
FT                   /gene="clpX"
FT                   /locus_tag="SPC_0463"
FT   CDS_pept        498640..499911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="SPC_0463"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44644"
FT                   /db_xref="GOA:C0Q7X4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7X4"
FT                   /protein_id="ACN44644.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRTHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIANRVETGSGIGFGATVKAKSDKA
FT                   SEGELLSQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIAGQSKPLLIYGKPEAQASGE"
FT   gene            500097..502451
FT                   /gene="lon"
FT                   /locus_tag="SPC_0464"
FT   CDS_pept        500097..502451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="SPC_0464"
FT                   /product="Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44645"
FT                   /db_xref="GOA:C0Q7X5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X5"
FT                   /protein_id="ACN44645.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYIRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            502660..502932
FT                   /gene="hupB"
FT                   /locus_tag="SPC_0465"
FT   CDS_pept        502660..502932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="SPC_0465"
FT                   /product="DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44646"
FT                   /db_xref="GOA:C0Q7X6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X6"
FT                   /protein_id="ACN44646.1"
FT                   /translation="MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            503223..505094
FT                   /gene="ppiD"
FT                   /locus_tag="SPC_0466"
FT   CDS_pept        503223..505094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="SPC_0466"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44647"
FT                   /db_xref="GOA:C0Q7X7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X7"
FT                   /protein_id="ACN44647.1"
FT                   /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKV
FT                   NGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQY
FT                   SRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYYDQNK
FT                   VRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDD
FT                   AKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISG
FT                   VIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLAGAEQVAGVKAVETGWFSRDTLPEELNFKPVADAIFNGGLVGENGTPGPNSDIITV
FT                   DGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAE
FT                   AMKAAGLSFGEPKTLNRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVK
FT                   AGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            505244..505618
FT                   /gene="ybaV"
FT                   /locus_tag="SPC_0467"
FT   CDS_pept        505244..505618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="SPC_0467"
FT                   /product="ybaV"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44648"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X8"
FT                   /protein_id="ACN44648.1"
FT                   /translation="MKHGIKALLITLFLTCAGMAHSALAATPVAKNAAVETKADTPSSS
FT                   SAKAALPAKASDDEGTRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDL
FT                   KQVPGMGSALVERNLAVLTL"
FT   gene            505722..506120
FT                   /gene="ybaW"
FT                   /locus_tag="SPC_0468"
FT   CDS_pept        505722..506120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="SPC_0468"
FT                   /product="ybaW"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44649"
FT                   /db_xref="GOA:C0Q7X9"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7X9"
FT                   /protein_id="ACN44649.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   ARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALI
FT                   TFVCIDLKTQKALPLEGELREKLEQMVQ"
FT   gene            complement(506226..506921)
FT                   /gene="ybaX"
FT                   /locus_tag="SPC_0469"
FT   CDS_pept        complement(506226..506921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="SPC_0469"
FT                   /product="ybaX"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44650"
FT                   /db_xref="GOA:C0Q7Y0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7Y0"
FT                   /protein_id="ACN44650.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPLMWI
FT                   DKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKAAVMA
FT                   AMKQKTGLR"
FT   gene            complement(506986..508686)
FT                   /gene="ybaE"
FT                   /locus_tag="SPC_0470"
FT   CDS_pept        complement(506986..508686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="SPC_0470"
FT                   /product="putative solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44651"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y1"
FT                   /protein_id="ACN44651.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGETQHVTVSELAERCFCSERHLRTLLR
FT                   QAQQAGWLRWEAQSGRGKRGRLQFLVTPESLRTAMMEQALEKGQQLNVLELAQLAPGEL
FT                   RAMLQPFMGGQWQNDTPTLRIPYYRPLDPLQPGFLPGRAEQHLAGQVFSGLTRFDRDSQ
FT                   YPCGDLAHHWEVSADGLRWDFYIRSTLHWHNGDAVDTAQLHERLERLLTLPALSKLFIS
FT                   VARIEVTHPQCLTFLLHRPDYWLAHRLASYCSGLAHPDLPLIGTGPFRLALFTPELVRL
FT                   ESHDHYHLSHPLLKAIEFWITPQLFAQDLGTSCRHPVQIAIGKPEELATLSQVSSGISL
FT                   GFCYLTLKKGSRLNVQQARRLIHIIHHTSLLKTLPVDENLIMPSQGLLPGWTIPQWQDV
FT                   DETPLPKKLTLAYHLPVELHTMAEQLRHYLATLGCELTLIFHNAKNWDNCPALTQADLM
FT                   MGDRLIGEAPEYTLEQWLRCDQIWPHVLDAPAFSHLQATLDALQIQPNEKDRRAALQQV
FT                   FANLMDDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFSEAWLPPPSP"
FT   gene            508775..509605
FT                   /gene="cof"
FT                   /locus_tag="SPC_0471"
FT   CDS_pept        508775..509605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="SPC_0471"
FT                   /product="cof"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44652"
FT                   /db_xref="GOA:C0Q7Y2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y2"
FT                   /protein_id="ACN44652.1"
FT                   /translation="MEKEMARLAAFDMDGTLLMPDHHLGRETIATLSRLRERDITLTFA
FT                   TGRHVLEMRHILGTLSLDAYLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRA
FT                   SMHVFNDNGWFTGQEIPALLQAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLR
FT                   IQLNEALEERAHLCFSAVDCLEVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDRE
FT                   MLGSVGRGLIMGNAMPQLIAALPHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE"
FT   gene            complement(509655..510737)
FT                   /locus_tag="SPC_0472"
FT   CDS_pept        complement(509655..510737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0472"
FT                   /product="putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44653"
FT                   /db_xref="GOA:C0Q7Y3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y3"
FT                   /protein_id="ACN44653.1"
FT                   /translation="MAQNDKWILMMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPG
FT                   IQLYLKDESTHPTGSLKHRLARSLFLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLL
FT                   GLPFIAVMPACTAKRKIEQIQFYGGHCHFVESACEIYAASERLAHELNGHYMDQFTYAE
FT                   RATDWRGNNNIADSIFRQMRNEPHPVPRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVV
FT                   DPENSVFLPYWQDRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATAH
FT                   WLETQLGRKVGASTGTNMWGALQLAARMREAGETGAIVTLLCDSGDRYLDTYYHPSWVS
FT                   DHIGDLTPWSAAIAKLLTGD"
FT   gene            510823..511273
FT                   /pseudo
FT                   /gene="ybaO"
FT                   /locus_tag="SPC_0473"
FT                   /note="frameshift compared to STM0459 in Salmonella
FT                   typhimurium LT2"
FT   gene            511314..513086
FT                   /gene="mdlA"
FT                   /locus_tag="SPC_0474"
FT   CDS_pept        511314..513086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="SPC_0474"
FT                   /product="putative ABC transporter ATP-binding membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44654"
FT                   /db_xref="GOA:C0Q7Y4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y4"
FT                   /protein_id="ACN44654.1"
FT                   /translation="MRLFAQLSWYFCREWSRYLGAVALLMLIAMLQLIPPKVVGIVVDG
FT                   VTAQHFTPGRIAMWIGTIALIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYQRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQLTLL
FT                   ALLPMPVMALMIKRYGDRLHDYFKLAQVAFSSLNDRTQESLTSIRMIKAFGLEDRQSSL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAISGGSWMVVNGSLTLGELTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVKDGEEPVPAGRGELTAAIR
FT                   EFCYPQTTHPALENVNFRLKPGQMLGICGPTGAGKSTILSLIQRHFDVTQGEIRFHDMP
FT                   LTHLQLDSWRSRLAVVSQTPFLFSDSIANNIALGRPEATQEEIERVARLASVHEDILRL
FT                   PQGYDTQVGERGVMLSGGQKQRISIARALLLNAEILLLDDALSAVDGRTEHQILHNLRQ
FT                   WGEGRTVIISAHRLSALTDANEIIVMQHGHVVQRGDHNQLAQQIGWYRDMYRYQQLEAA
FT                   LDDAPERGEEAANA"
FT   gene            513079..514860
FT                   /gene="mdlB"
FT                   /locus_tag="SPC_0475"
FT   CDS_pept        513079..514860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="SPC_0475"
FT                   /product="putative ABC transporter ATP-binding membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44655"
FT                   /db_xref="GOA:C0Q7Y5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y5"
FT                   /protein_id="ACN44655.1"
FT                   /translation="MRSFGQLWPTLKRLLAYGSPWRKPLSVAVMMLWIAAAAEVSGPLL
FT                   ISYFIDNMVARHHLPLGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRTDV
FT                   MDAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSL
FT                   DWRMALVAILIFPAVLTVMIIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSAGTIEV
FT                   GVLYAFISYLSRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDRPLQSGA
FT                   IDIDHLSFAYRDDNLVLQDITLSVPSRSFVALVGHTGSGKSTLASLLMGYYPLTQGEIR
FT                   LDGREIASLNHRVLRQGVAMVQQDPVVMADTFLANVTLGRDVSEAQVWQALETVQLADL
FT                   ARGLSDGLHTHLGEQGNTLSVGQKQLLALARVLVDAPQILILDEATASIDSGTEQAIQQ
FT                   ALAAIRERTTLVVIAHRLSTIVEADTILVLHRGQAVERGTHQQLLAAQGRYWQMYQLQL
FT                   VGEELAASVHEESGPAA"
FT   gene            514894..515022
FT                   /locus_tag="SPC_0476"
FT   CDS_pept        514894..515022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44656"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y6"
FT                   /protein_id="ACN44656.1"
FT                   /translation="MHRHGAFFFPCFDFGARQYKDAPLTALFLARQLLAHPLQYPS"
FT   gene            515073..515411
FT                   /gene="glnK"
FT                   /locus_tag="SPC_0477"
FT   CDS_pept        515073..515411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="SPC_0477"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44657"
FT                   /db_xref="GOA:C0Q7Y7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y7"
FT                   /protein_id="ACN44657.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRIRT
FT                   GEADEAAL"
FT   gene            515443..516747
FT                   /gene="amtB"
FT                   /locus_tag="SPC_0478"
FT   CDS_pept        515443..516747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="SPC_0478"
FT                   /product="putative ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44658"
FT                   /db_xref="GOA:C0Q7Y8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y8"
FT                   /protein_id="ACN44658.1"
FT                   /translation="MKIAMIKTTLASLASLASLALLPGLTIAAPAVADKADSAFMMICT
FT                   ALVLFMTIPGIALFYGGLIRAKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNHFFG
FT                   NADGAMLKNIALTAVTGTIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVW
FT                   FTLSYIPIAHMVWGGGLLAAHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFK
FT                   PHNLPMVFTGTAILYIGWFGFNAGSAGSANEIAALAFVNTVVATAAAILGWIIGEWTLR
FT                   GKPSLLGACSGAIAGLVGVTPACGYVGVGGALVIGVIAGLAGLWGVTMLKRLLRVDDPC
FT                   DVFGVHGVCGIVGCILTGVFAASSLGGVGFVDGVTMGHQVMVQLESIAITVVWSGVVAF
FT                   VGYKLADILVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(516847..517707)
FT                   /gene="tesB"
FT                   /locus_tag="SPC_0479"
FT   CDS_pept        complement(516847..517707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="SPC_0479"
FT                   /product="acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44659"
FT                   /db_xref="GOA:C0Q7Y9"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Y9"
FT                   /protein_id="ACN44659.1"
FT                   /translation="MSQTLNNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEARLVHSFHSYFLRPGDSQKPIIYDVEVLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEPGFEHQKTMPTAVGPEGLPSETEIAQSLAHLLPPILKEKFLCDRPLEIRPV
FT                   EFHNPLKGHVAAPVRQVWIRANGTVPDDIRVHQYLLGYASDLNFLPVALQPHGIGFLEK
FT                   GIQIATIDHSMWFHRPFNFNEWLLYSVESTSASSARGFVRGEFYTQDGALVASTVQEGV
FT                   MRNHN"
FT   gene            517931..518491
FT                   /gene="ybaY"
FT                   /locus_tag="SPC_0480"
FT   CDS_pept        517931..518491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="SPC_0480"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44660"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z0"
FT                   /protein_id="ACN44660.1"
FT                   /translation="MHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTIQQPN
FT                   VSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVLPFNPS
FT                   DIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQASGGAT
FT                   TTVPSTSPTQVNPSSAVPAPTQY"
FT   gene            complement(518524..518913)
FT                   /gene="ybaZ"
FT                   /locus_tag="SPC_0481"
FT   CDS_pept        complement(518524..518913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="SPC_0481"
FT                   /product="putative methylated-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44661"
FT                   /db_xref="GOA:C0Q7Z1"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z1"
FT                   /protein_id="ACN44661.1"
FT                   /translation="MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIP
FT                   EGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQR
FT                   QALLAEGVVVSGSGQIDLQRYRWVY"
FT   gene            complement(519144..520694)
FT                   /gene="ylaB"
FT                   /locus_tag="SPC_0482"
FT   CDS_pept        complement(519144..520694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="SPC_0482"
FT                   /product="putative 58.9 kDa protein in tesb-hha intergenic
FT                   region"
FT                   /note="Contains probable N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44662"
FT                   /db_xref="GOA:C0Q7Z2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z2"
FT                   /protein_id="ACN44662.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPIDVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQCAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIID
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRNQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHAIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETTRQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
FT   gene            520919..521179
FT                   /gene="rpmE2"
FT                   /locus_tag="SPC_0483"
FT   CDS_pept        520919..521179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="SPC_0483"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44663"
FT                   /db_xref="GOA:C0Q7Z3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7Z3"
FT                   /protein_id="ACN44663.1"
FT                   /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
FT   gene            521185..521325
FT                   /gene="rpmJ2"
FT                   /locus_tag="SPC_0484"
FT   CDS_pept        521185..521325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="SPC_0484"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44664"
FT                   /db_xref="GOA:C0Q7Z4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q7Z4"
FT                   /protein_id="ACN44664.1"
FT                   /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKR
FT                   R"
FT   gene            complement(521381..521851)
FT                   /gene="ylaC"
FT                   /locus_tag="SPC_0485"
FT   CDS_pept        complement(521381..521851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="SPC_0485"
FT                   /product="ylaC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44665"
FT                   /db_xref="GOA:C0Q7Z5"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z5"
FT                   /protein_id="ACN44665.1"
FT                   /translation="MTEIQRLLSETIDDLNVREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
FT   gene            complement(521969..522520)
FT                   /gene="maa"
FT                   /locus_tag="SPC_0486"
FT   CDS_pept        complement(521969..522520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="SPC_0486"
FT                   /product="maltose o-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44666"
FT                   /db_xref="GOA:C0Q7Z6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z6"
FT                   /protein_id="ACN44666.1"
FT                   /translation="MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEINK
FT                   RQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCMLAP
FT                   GVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGAVVT
FT                   KNVPPDVVVGGNPARIIKKL"
FT   gene            complement(522699..522917)
FT                   /gene="hha"
FT                   /locus_tag="SPC_0487"
FT   CDS_pept        complement(522699..522917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="SPC_0487"
FT                   /product="hemolysin expression modulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44667"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z7"
FT                   /protein_id="ACN44667.1"
FT                   /translation="MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(522945..523319)
FT                   /gene="ybaJ"
FT                   /locus_tag="SPC_0488"
FT   CDS_pept        complement(522945..523319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="SPC_0488"
FT                   /product="ybaJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44668"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z8"
FT                   /protein_id="ACN44668.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRKSG
FT                   NRLFRCFVNATRANPVSLSC"
FT   gene            complement(523815..526964)
FT                   /gene="acrB"
FT                   /locus_tag="SPC_0489"
FT   CDS_pept        complement(523815..526964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="SPC_0489"
FT                   /product="acriflavin resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44669"
FT                   /db_xref="GOA:C0Q7Z9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q7Z9"
FT                   /protein_id="ACN44669.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SATYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DPISRTSGVGDVQLFGSQYAMRIWMNPTELTKYQLTPVDVINAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTDEFGKILLKVNQDGSQVRLRDVAKIELGGENYDVIAKF
FT                   NGQPASGLGIKLATGANALDTATAIRAELKKMEPFFPPGMKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMTEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPVAKGDHGEGKKGFFGWFN
FT                   RLFDKSTHHYTDSVGNILRSTGRYLLLYLIIVVGMAYLFVRLPSSFLPDEDQGIFLTMV
FT                   QLPAGATQERTQKVLDEVTDYYLNKEKANVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEKNKVEAITQRATAAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLFGEVAKYPDLLVGVRPNGLEDTPQFKIDIDQEKAQALGVSISDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDINDWYVRGSDGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMAMMEELASKLPSGIGYDWTGMSYQERLSGN
FT                   QAPALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLVEATLEAVRMRLRPILMTSLAFMLGVMPL
FT                   VISSGAGSGAQNAVGTGVLGGMVTATVLAIFFVPVFFVVVRRRFSRKSEDIEHSHSTEH
FT                   R"
FT   gene            complement(526987..528180)
FT                   /gene="acrA"
FT                   /locus_tag="SPC_0490"
FT   CDS_pept        complement(526987..528180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SPC_0490"
FT                   /product="acriflavin resistance protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44670"
FT                   /db_xref="GOA:C0Q800"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q800"
FT                   /protein_id="ACN44670.1"
FT                   /translation="MNKNRGLTPLAVVLMLTGSLALTGCDDKQDQQGGQQMPEVGVVTL
FT                   KTEPLQITTELPGRTIAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGSLKQENGKAKVDLVTSDSIKFPQSGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLQEGTKPTALLVPQQGVTRTPRGDATVLVVGADNKVETRQIVAS
FT                   QAIGDKWLVTDGLKAGDRVVVSGLQKVRPGAQVKVQEITADNKQQAASGDQPAQPRS"
FT   gene            528322..528975
FT                   /gene="acrR"
FT                   /locus_tag="SPC_0491"
FT   CDS_pept        528322..528975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="SPC_0491"
FT                   /product="putative acrAB operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44671"
FT                   /db_xref="GOA:C0Q801"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q801"
FT                   /protein_id="ACN44671.1"
FT                   /translation="MARKTKQQALETRQHILDVALRLFSQQGVSATSLAEIANAAGVTR
FT                   GAIYWHFKNKSDLFSEIWELSESNIGELEIEYQAKFPDDPLSVLREILVHILEATVTEE
FT                   RRRLLMEIIFHKCEFVGEMVVVQQAQRSLCLESYDRIEQTLKHCINAKMLPENLLTRRA
FT                   AILMRSFISGLMENWLFAPQSFDLKKEARAYVTILLEMYQLCPTLRASTFNGSP"
FT   gene            529100..532456
FT                   /gene="aefA"
FT                   /locus_tag="SPC_0492"
FT   CDS_pept        529100..532456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="SPC_0492"
FT                   /product="integral membrane protein AefA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44672"
FT                   /db_xref="GOA:C0Q802"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q802"
FT                   /protein_id="ACN44672.1"
FT                   /translation="MLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKADV
FT                   QNQLDTLNKQKDLSAQDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKMRQAT
FT                   AALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQTQP
FT                   ERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSLEG
FT                   NTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARIQA
FT                   NPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLKGS
FT                   LLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEGHT
FT                   SEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAILTQ
FT                   QIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIAGL
FT                   IRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLIILALGLILLTMQ
FT                   LNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISLAL
FT                   LPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRESWRDKESHGIRLVTV
FT                   TILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRIAW
FT                   RRALARRQNLVKEGAEGAEPQEEPAIALEQINQQTLRITMLLMLALFGVMFWAIWSDLI
FT                   TVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVAWALIRNLPGLLEVLVLS
FT                   RLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEIFG
FT                   NFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTITDFDRKEVIIPNKAFVTERL
FT                   INWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHPKVMHDPEPAVFFTTFGASTL
FT                   DHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAFNQLEVHLHNAKGDEVTEVKRD
FT                   LNGGDLAPTTS"
FT   gene            complement(532498..533421)
FT                   /locus_tag="SPC_0493"
FT   CDS_pept        complement(532498..533421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44673"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q803"
FT                   /protein_id="ACN44673.1"
FT                   /translation="MERLPTTPHDAVFRQMLMQKEVARDFLAIHLPEAFLAICDLDSLK
FT                   LESGSFVEDNLRSRYSDILYSLHTQHGPGYVYALIEHQSKSDRLMAFRLMRYAIAAMQR
FT                   HLDAGHDTLPLVVPILFYHGPESPWPYSLNWHNMFVKPDMAKALYSRDFALVDLTIMPD
FT                   NQLLQHRRIAMLELLQKHIRQRDLSELLDPLITLLTQDHLTDTQLSVLINYMLKAGNAA
FT                   EPGALIRQLAQGAPQYKEQLMTIAEWLEEKGRTEGLQKGLEQGLAQGREAEARAIARKM
FT                   LANGLEPGLIASVTGITPEELSTLSH"
FT   gene            complement(533491..533658)
FT                   /gene="ybaM"
FT                   /locus_tag="SPC_0494"
FT   CDS_pept        complement(533491..533658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="SPC_0494"
FT                   /product="ybaM"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44674"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q804"
FT                   /protein_id="ACN44674.1"
FT                   /translation="MSLENAPDEIKLAVDLIMLLEENRLPARTVLRALEIVMRDYENKL
FT                   KSTEDDSQTE"
FT   gene            complement(533672..534187)
FT                   /gene="priC"
FT                   /locus_tag="SPC_0495"
FT   CDS_pept        complement(533672..534187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="SPC_0495"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44675"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q805"
FT                   /protein_id="ACN44675.1"
FT                   /translation="MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGY
FT                   LEEADANLAALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDTAAPGLGRW
FT                   QRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIE
FT                   NVLARLTR"
FT   gene            534268..534645
FT                   /gene="ybaN"
FT                   /locus_tag="SPC_0496"
FT   CDS_pept        534268..534645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="SPC_0496"
FT                   /product="ybaN"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44676"
FT                   /db_xref="GOA:C0Q806"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q806"
FT                   /protein_id="ACN44676.1"
FT                   /translation="MQRTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGGYLRHWQHYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLLVI
FT                   LACLLIFMWRIPVIDEKQQKR"
FT   gene            534798..535349
FT                   /gene="apt"
FT                   /locus_tag="SPC_0497"
FT   CDS_pept        534798..535349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="SPC_0497"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44677"
FT                   /db_xref="GOA:C0Q807"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q807"
FT                   /protein_id="ACN44677.1"
FT                   /translation="MTATAQQLEFLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   ELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
FT                   GTDQLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGG
FT                   EQRLEKQGITCYSLVPFPGH"
FT   gene            535463..537391
FT                   /gene="dnaX"
FT                   /locus_tag="SPC_0498"
FT   CDS_pept        535463..537391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SPC_0498"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44678"
FT                   /db_xref="GOA:C0Q808"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q808"
FT                   /protein_id="ACN44678.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQVQQPSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
FT   gene            537437..537766
FT                   /gene="ybaB"
FT                   /locus_tag="SPC_0499"
FT   CDS_pept        537437..537766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="SPC_0499"
FT                   /product="ybaB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44679"
FT                   /db_xref="GOA:C0Q809"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q809"
FT                   /protein_id="ACN44679.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            537766..538371
FT                   /gene="recR"
FT                   /locus_tag="SPC_0500"
FT   CDS_pept        537766..538371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SPC_0500"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44680"
FT                   /db_xref="GOA:C0Q810"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q810"
FT                   /protein_id="ACN44680.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAE
FT                   AGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
FT   gene            538458..540356
FT                   /gene="htpG"
FT                   /locus_tag="SPC_0501"
FT   CDS_pept        538458..540356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="SPC_0501"
FT                   /product="heat shock protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44681"
FT                   /db_xref="GOA:C0Q811"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q811"
FT                   /protein_id="ACN44681.1"
FT                   /translation="MALLRSIHMKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELIS
FT                   NASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGT
FT                   IAKSGTKSFLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWE
FT                   SAGEGEYTVADITKNDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKRE
FT                   EKDGETVISWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQE
FT                   YTSLLYIPSQAPWDLWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPL
FT                   NVSREILQDSTVTRNLRSALTKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHA
FT                   NQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELL
FT                   RKKGIEVLLLSDRIDEWMMNYLTEFDGKAFQSVAKADESIEKLADEVDENAKEAEKVLE
FT                   PFVERVKTLLGDRVKDVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKYIF
FT                   ELNPDHVLVKRTADTKDEAQFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS"
FT   gene            540598..541242
FT                   /gene="adk"
FT                   /locus_tag="SPC_0502"
FT   CDS_pept        540598..541242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SPC_0502"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44682"
FT                   /db_xref="GOA:C0Q812"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Q812"
FT                   /protein_id="ACN44682.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIVVD
FT                   YVLEFDVPDELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYQKEAEAGNTKYAKVDGTQAVADVRAALEKILG"
FT   gene            541255..541461
FT                   /locus_tag="SPC_0503"
FT   CDS_pept        541255..541461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44683"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE0"
FT                   /protein_id="ACN44683.1"
FT                   /translation="MKHLSGLLLSRKPDKRNAIRQSVPDGGLNALSGLLASLAPFGKFS
FT                   SYLSQQLVLLYHFSATIINNLNR"
FT   gene            541471..542433
FT                   /gene="hemH"
FT                   /locus_tag="SPC_0504"
FT   CDS_pept        541471..542433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SPC_0504"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44684"
FT                   /db_xref="GOA:C0PVE1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVE1"
FT                   /protein_id="ACN44684.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTPRLLW
FT                   WPLLRGVILPLRSPRVAKLYQSIWMDGGSPLMVYSREQQQALAARLPDTPVALGMSYGS
FT                   PSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRILARKRRIPGISFIRDYA
FT                   DDGAYIDALAKSARESFARHGEPDVLLLSYHGIPQRYADEGDDYPQRCRDTTRELVSAL
FT                   GLPPEKVMMTFQSRFGREPWLTPYTDETLKMLGEKGTGHIQVMCPGFAADCLETLEEIA
FT                   EQNREIFLEAGGKKYAYIPALNATPEHIDMMLKLTAPYR"
FT   gene            complement(542430..543428)
FT                   /gene="aes"
FT                   /locus_tag="SPC_0505"
FT   CDS_pept        complement(542430..543428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="SPC_0505"
FT                   /product="acetyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44685"
FT                   /db_xref="GOA:C0PVE2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE2"
FT                   /protein_id="ACN44685.1"
FT                   /translation="MVHFHKERFMKPENKIPVLTRLSDEMKAVVNFQQPGLPPWPADGD
FT                   IETQRQYYLLERRFWNADAPSMTTRTCAVPTPYGDVTTRLYSPQPTSQAALYYLHGGGF
FT                   ILGNLDTHDRIMRLLARYTGCTVIGIDYSLSPQARYPQAIEETVAVCSYFSQHADEYSL
FT                   NVEKIGFAGDSAGAMLALASALWLRDKHIRCGNLIAILLWYGLYGLQDSVSRRLFGGAW
FT                   DGLTREDLDMYEKAYLRNDEDRESPWYCLFNNDLTRDVPPCFIASAEFDPLIDDSRLLH
FT                   QTLQAHQQPCEYKMYPGTLHAFLHYSRMMTIADDALQDGARFFMARMKTPR"
FT   gene            543554..544858
FT                   /gene="gsk"
FT                   /locus_tag="SPC_0506"
FT   CDS_pept        543554..544858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="SPC_0506"
FT                   /product="inosine-guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44686"
FT                   /db_xref="GOA:C0PVE3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE3"
FT                   /protein_id="ACN44686.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLVD
FT                   IEAKVDDDFITRYGLSAGHSLVIEDEVAEKLYQELTRENLITHQFAGGTIGNTMHNYSV
FT                   LADDCSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHNVP
FT                   VVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALDWVDLV
FT                   LCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCINPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(544907..546583)
FT                   /gene="ybaL"
FT                   /locus_tag="SPC_0507"
FT   CDS_pept        complement(544907..546583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="SPC_0507"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44687"
FT                   /db_xref="GOA:C0PVE4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE4"
FT                   /protein_id="ACN44687.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMVEKGDVGIASLTVDMGITIGKVVAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRMFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSRTRVDELRE
FT                   RGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASAREKSPDIEIIARAHY
FT                   DDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
FT   gene            complement(546798..548018)
FT                   /gene="fsr"
FT                   /locus_tag="SPC_0508"
FT   CDS_pept        complement(546798..548018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="SPC_0508"
FT                   /product="fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44688"
FT                   /db_xref="GOA:C0PVE5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE5"
FT                   /protein_id="ACN44688.1"
FT                   /translation="MAMSEPTQPLAGAPAAAAKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQAEFSLTFVQIGLITLTFQLASSLLQPVVGYWTDKYPMPWSLPVGMCFTLSGL
FT                   VLLAMAGSFGGVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYAAQHRIAKGKPKAIIANPLPR
FT                   NKVVLAVSVLLLLIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLVLPYATLYWTGILTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIYLVYKICAFLPLLGILTIFL
FT                   PDNRHKA"
FT   gene            548191..549843
FT                   /gene="ushA"
FT                   /locus_tag="SPC_0509"
FT   CDS_pept        548191..549843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="SPC_0509"
FT                   /product="UDP-sugar hydrolase 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44689"
FT                   /db_xref="GOA:C0PVE6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE6"
FT                   /protein_id="ACN44689.1"
FT                   /translation="MKFLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHGH
FT                   FWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLSANIYQKSTGERLFKPWAIFTRQDI
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHMGHYD
FT                   NGDHGSNALGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKKQVNYVPGTPCAPDKQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWDNGKSERVLYTPEIA
FT                   ENPQMLSLLTPFQNKGKAQLEVKIGSVNGLLEGDRSKVRFVQTNMGRVILAAQIARTGA
FT                   DFGVMSGGGIRDSIEAGDITYKSVLKVQPFGNIVVYADMSGKEVVDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKEGKLTDLKIKGEPVDPAKTYRMATLSFNATGGDGYPRIDNKPGYVN
FT                   TGFIDAEVLKEFIQQNSPLDAAAFTPNGEVSWL"
FT   gene            complement(549960..550439)
FT                   /gene="ybaK"
FT                   /locus_tag="SPC_0510"
FT   CDS_pept        complement(549960..550439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="SPC_0510"
FT                   /product="ybaK"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44690"
FT                   /db_xref="GOA:C0PVE7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE7"
FT                   /protein_id="ACN44690.1"
FT                   /translation="MTPAVKLLEKNKIPFNIHTYDHDPNETNFGDEVVRKLGLNADQVY
FT                   KTLLVAVNGDMKQLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGGIS
FT                   PLGQKKRLPTLIDAPARTFATIYVSGGKRGLDIELAADDLAAILGAKFADIARRD"
FT   gene            complement(550641..551435)
FT                   /gene="ybaP"
FT                   /locus_tag="SPC_0511"
FT   CDS_pept        complement(550641..551435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="SPC_0511"
FT                   /product="ybaP"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44691"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE8"
FT                   /protein_id="ACN44691.1"
FT                   /translation="MELLNQLKRLWRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGTR
FT                   DMAPLPAKLVKKLRQADALVVEADISGNETPFSNLPKCPPLVERLSAGQLSALEKRVSE
FT                   LGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEGAKH
FT                   QLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSVGASLPRTFSQPLYD
FT                   VLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
FT   gene            complement(551521..552348)
FT                   /locus_tag="SPC_0512"
FT   CDS_pept        complement(551521..552348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0512"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44692"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVE9"
FT                   /protein_id="ACN44692.1"
FT                   /translation="MFRKAVPLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYN
FT                   EALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQPENANLRTCSATV
FT                   AMSIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTPVQK
FT                   IDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWKSLPASARTAL
FT                   KQEQRVWVTQKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDGSE"
FT   gene            complement(552502..555003)
FT                   /gene="ybaR"
FT                   /locus_tag="SPC_0513"
FT   CDS_pept        complement(552502..555003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="SPC_0513"
FT                   /product="copper-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44693"
FT                   /db_xref="GOA:C0PVF0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF0"
FT                   /protein_id="ACN44693.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTG
FT                   TASADALIETIKQAGYGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQLLL
FT                   SGMSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGAEAI
FT                   EDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRNLWLAIG
FT                   LITLAVMVFAGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEAR
FT                   HLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADV
FT                   QPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVL
FT                   FRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFG
FT                   PAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFSVLVRDADALQRASTLD
FT                   TLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSSHPLAHAILEKAGDDKL
FT                   PQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLA
FT                   IDGKAAALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAG
FT                   VLPDGKADAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMR
FT                   HSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAM
FT                   ALSSITVVSNANRLLRFKPKA"
FT   gene            555113..555529
FT                   /gene="cueR"
FT                   /locus_tag="SPC_0514"
FT   CDS_pept        555113..555529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="SPC_0514"
FT                   /product="copper efflux regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44694"
FT                   /db_xref="GOA:C0PVF1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF1"
FT                   /protein_id="ACN44694.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLN
FT                   ELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQ
FT                   LLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR"
FT   gene            complement(555530..555982)
FT                   /gene="ybbJ"
FT                   /locus_tag="SPC_0515"
FT   CDS_pept        complement(555530..555982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="SPC_0515"
FT                   /product="ybbJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44695"
FT                   /db_xref="GOA:C0PVF2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF2"
FT                   /protein_id="ACN44695.1"
FT                   /translation="MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLT
FT                   VWLLPLGWEWQGVLFAALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLD
FT                   AALVNGRGHMRVGDSSWPVCADEDLRAGTHVEVIAVEGITLRIRAV"
FT   gene            complement(555979..556896)
FT                   /locus_tag="SPC_0516"
FT   CDS_pept        complement(555979..556896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44696"
FT                   /db_xref="GOA:C0PVF3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF3"
FT                   /protein_id="ACN44696.1"
FT                   /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSEAIAAGDIQAINYFVAQKYTEALQQIGSANNSKVVMMPLDA
FT                   SSLMGAIAGISELVKDSASERKKA"
FT   gene            557058..557720
FT                   /gene="ybbL"
FT                   /locus_tag="SPC_0517"
FT   CDS_pept        557058..557720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="SPC_0517"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44697"
FT                   /db_xref="GOA:C0PVF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF4"
FT                   /protein_id="ACN44697.1"
FT                   /translation="MLLELKQVGYRTATTKIVNNISFTLQRGEFKLITGPSGCGKSTLL
FT                   KMVASLISPDIGVILFEGQDITTLSPEAYRQQVSYCAQTPALFGDTVYDNLIFPWQIRH
FT                   QRPQPTAFADDLARFELPETILQKPIAALSGGEKQRIALIRNLQFLPKILLLDEITSAL
FT                   DEHNKRNVNDIIHRYVRDKQVAVLWVTHDKDEIQHADKVITLTPSAGEMQEARYERA"
FT   gene            557707..558486
FT                   /gene="ybbM"
FT                   /locus_tag="SPC_0518"
FT   CDS_pept        557707..558486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="SPC_0518"
FT                   /product="ybbM"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44698"
FT                   /db_xref="GOA:C0PVF5"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF5"
FT                   /protein_id="ACN44698.1"
FT                   /translation="MNEHNITNTSLALSMLLVVVAMLISHKEKLALEKDILWSVCRAVI
FT                   QLIIVGYVLKYIFGVNHAALTLLMVLFICFNAAWNAQKRSKYIDKAFLSSFIAITVGAG
FT                   LTLTVLVLTGSIEFAPMQVIPIAGMVAGNAMVAVGLCYNQLGLRFHSEQQQIQEKLSLG
FT                   ATPKMASAGLIRDSIRASLIPTIDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVMPLKKS"
FT   gene            complement(558572..559453)
FT                   /gene="ybbN"
FT                   /locus_tag="SPC_0519"
FT   CDS_pept        complement(558572..559453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="SPC_0519"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44699"
FT                   /db_xref="GOA:C0PVF6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF6"
FT                   /protein_id="ACN44699.1"
FT                   /translation="MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQ
FT                   HCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQG
FT                   PQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNCEIGLLL
FT                   AEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNP
FT                   QDAALATQLALQLHQVGRNEEALELLFSHLRKDLTAAEGQTRKTFQEILAALGTGDALA
FT                   SKYRRQLYALLY"
FT   gene            complement(559486..560256)
FT                   /gene="ybbO"
FT                   /locus_tag="SPC_0520"
FT   CDS_pept        complement(559486..560256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="SPC_0520"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44700"
FT                   /db_xref="GOA:C0PVF7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF7"
FT                   /protein_id="ACN44700.1"
FT                   /translation="MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNSM
FT                   GFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQFSS
FT                   NFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRME
FT                   LRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRHAFAS
FT                   DKPRLRYPVTLVTWAVMALKRILPGRMLDKILQS"
FT   gene            complement(560411..561025)
FT                   /gene="tesA"
FT                   /locus_tag="SPC_0521"
FT   CDS_pept        complement(560411..561025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="SPC_0521"
FT                   /product="acyl-coA thioesterase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44701"
FT                   /db_xref="GOA:C0PVF8"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF8"
FT                   /protein_id="ACN44701.1"
FT                   /translation="MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAAS
FT                   AAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGF
FT                   APAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLP
FT                   FFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS"
FT   gene            560996..561682
FT                   /gene="ybbA"
FT                   /locus_tag="SPC_0522"
FT   CDS_pept        560996..561682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="SPC_0522"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44702"
FT                   /db_xref="GOA:C0PVF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVF9"
FT                   /protein_id="ACN44702.1"
FT                   /translation="MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAARCDRRLRLVNG
FT                   QLQEEA"
FT   gene            561679..564093
FT                   /gene="ybbP"
FT                   /locus_tag="SPC_0523"
FT   CDS_pept        561679..564093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="SPC_0523"
FT                   /product="ybbP"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44703"
FT                   /db_xref="GOA:C0PVG0"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG0"
FT                   /protein_id="ACN44703.1"
FT                   /translation="MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLSQ
FT                   QSREFMAGDRTLQSSREVPKAWLEEARKRGLNVGEQLTFATMTFAGDTPQLASVKAVDS
FT                   VYPMYGELQTRPDGVKPQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQEPDS
FT                   GFNPFQMAPRLMMNMADVEKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLKPEHR
FT                   WYGLEEDDGALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIIGQWLMVLGLSAVTGGAIGLLFENILLVLLKPVLPADLPPASLWPWLWA
FT                   LGAMTVISLLVGLRPYRLLLATQPLRVLRRDVVARVWPLKIYLPVACAVVVALLAGLMG
FT                   GSMLLWAVLAGAVILALLCGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVIPQ
FT                   TFYPLVRARLTRINGNPTEGQQDESLNRELNLTWQDTRPAHNPLVAGHWPPKPGEVSME
FT                   EGLAKRLNVKLGDSVTFMGDTQAFSAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNREFPTVSLLDIGAILKQVGQVLEQVSRALEVMVVLVTLCGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGLVAGLVAAIGAETALAI
FT                   LQINVFDFPWEPDWRLWVALPFCGALLLSVCGGWLGVRLLKGKALFRQFNG"
FT   gene            564279..565412
FT                   /locus_tag="SPC_0524"
FT   CDS_pept        564279..565412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0524"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44704"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG1"
FT                   /protein_id="ACN44704.1"
FT                   /translation="MTIKITALAASIGAAVAFMPFATQAEITVLKQDPQASNPLSRLNF
FT                   TVGGSIRPQFQNMTGNDGANGYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNIPA
FT                   VFDWDNHYAKGATDTTRRMLYTGFKSATWGTLTFGQQNSIYYDVVGVKTDIWDYDMIGQ
FT                   APGNGINGDYDGSYRTRKSLKYKKSIGNVDLYASYLFSDDYNANNGLNYKRKGGGSLGA
FT                   DYHLTDDLTWGTAWNYTRAEMRGNGNKTYDQNIVGTALSWTPENWTIAAGGGWYQNFMT
FT                   TKKVSVNDYFAGDAWGLEYFVGYAFPIGQYAVKAIQPYFMGDRIEYVNGRDYLRTDNGV
FT                   GITFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            565669..566499
FT                   /gene="sfbA"
FT                   /locus_tag="SPC_0525"
FT   CDS_pept        565669..566499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfbA"
FT                   /locus_tag="SPC_0525"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44705"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG2"
FT                   /protein_id="ACN44705.1"
FT                   /translation="MGLRQSLRIAASTLLLACGLQFAHADSSPQTIVFGVAPGPYGDMV
FT                   KQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKLSK
FT                   LIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKDNIDPT
FT                   KASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQEHLDE
FT                   NLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP"
FT   gene            566530..567552
FT                   /gene="sfbB"
FT                   /locus_tag="SPC_0526"
FT   CDS_pept        566530..567552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfbB"
FT                   /locus_tag="SPC_0526"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44706"
FT                   /db_xref="GOA:C0PVG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG3"
FT                   /protein_id="ACN44706.1"
FT                   /translation="MNMIEIEKVCVDFTAGRGTSTRAVDDVSLHIAAGEIFGIVGTSGA
FT                   GKSTLLRTLNALTRPSQGRVNVNGVEISALDGKALRQARQRIGIIFQHFNLMHTRTVAQ
FT                   NVAFSLKAAGWERSKIAPRVAEILTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPD
FT                   VLLCDEPTSALDLETSATILALLRQINAQLGITIVLITHEMNVIKSICDRVAVMSGGKV
FT                   VESGEVFDVFAHPQHAFTQQLVSHTLNLTLPERLREHLPGQLLKILFIGDSAEQPVLSE
FT                   VAIKFGVAVNILHGKIEYIGERALGILVVQLTAPHNPTAVAAAVEHIRQRTAQVEVIRG
FT                   "
FT   gene            567545..568204
FT                   /gene="sfbC"
FT                   /locus_tag="SPC_0527"
FT   CDS_pept        567545..568204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfbC"
FT                   /locus_tag="SPC_0527"
FT                   /product="ABC transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44707"
FT                   /db_xref="GOA:C0PVG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG4"
FT                   /protein_id="ACN44707.1"
FT                   /translation="MDDLLPDLTLAFNETFQMLSISTVLAILGGLPLGFLIFVTDRHLF
FT                   WQNRFIYLVASVLVNIIRSVPFVILLVLLLPLTQLLLGNTIGPIAASVPLSVAAIAFYA
FT                   RLVDSALREVDKGIIEAALAFGASPMRIICTVLLPEASAGLLRGLTITLVSLIGYSAMA
FT                   GIVGGGGVGDLAIRYGYYRYETEVMVVTVVALIVLVQVVQMLGDWLAKRADKRDRH"
FT   gene            complement(568243..569337)
FT                   /gene="ybbB"
FT                   /locus_tag="SPC_0528"
FT   CDS_pept        complement(568243..569337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="SPC_0528"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44708"
FT                   /db_xref="GOA:C0PVG5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVG5"
FT                   /protein_id="ACN44708.1"
FT                   /translation="MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMD
FT                   DERAAVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRS
FT                   HIVQRWLQETGIDCPLIEGGYKALRQTAIQATWQLAQKPILLIGGCTGSGKTQLVRQQP
FT                   NGVDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINARQTLKRWVLEDEGRTIG
FT                   ANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYGDEAGWQAYSEY
FT                   LHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMAWLVPLLNEYYDPMYRYQ
FT                   LEKKAANIVFRGPWQDVANWLKAQ"
FT   gene            complement(569407..570333)
FT                   /gene="ybbS"
FT                   /locus_tag="SPC_0529"
FT   CDS_pept        complement(569407..570333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbS"
FT                   /locus_tag="SPC_0529"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44709"
FT                   /db_xref="GOA:C0PVG6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG6"
FT                   /protein_id="ACN44709.1"
FT                   /translation="MFDPETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VGLFFRTTRSVSLTAAGSHLLSQAKDWLAWLDSMPDELRQVNDGVERQVNIVVNNLLYS
FT                   PQAVASLLSWLNARYPFTQFHFSRQIYMGVWDSLLYEGFSLAIGVTGTEPLANTFMLDP
FT                   LGSVQWRFLMSADHPLAHVSGPLTEAQLRRFPAINIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFVPQPLCQTLIDKNELVSCTIPTMRPPSPLSLAWHKFGGGKA
FT                   VEDIVKLFTQRQPEIAGFLSIFNTVRC"
FT   gene            570560..571042
FT                   /gene="allA"
FT                   /locus_tag="SPC_0530"
FT   CDS_pept        570560..571042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="SPC_0530"
FT                   /product="ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44710"
FT                   /db_xref="GOA:C0PVG7"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG7"
FT                   /protein_id="ACN44710.1"
FT                   /translation="MKLEVLPLDQKTFSAYGDVIETQERDFFHINNKLVERYHDLAKVE
FT                   VLEQDCTLISINRAQPAAMPIVVHELERHPLGTQAFVPMNGEAFVVIIALGDDKPDLST
FT                   LRAFISNGRQGVNYHRNVWHHPLFAWQTVTDFLTVDRGGSDNCDVESIPTHELCFA"
FT   gene            571121..571939
FT                   /gene="allR"
FT                   /locus_tag="SPC_0531"
FT   CDS_pept        571121..571939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="SPC_0531"
FT                   /product="negative regulator of allantoin and glyoxylate
FT                   utilization operons"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44711"
FT                   /db_xref="GOA:C0PVG8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG8"
FT                   /protein_id="ACN44711.1"
FT                   /translation="MTEVRRRGRPGQAEPTAQKGAQALERGIAILQYLERSGGSSSVSD
FT                   ISGSLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGSAYIHNRDVLSVAGP
FT                   FMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAI
FT                   YDDAGSVVAAISISGPASRLTEDRFISQGELVRDTAKDISTALGLKPPVA"
FT   gene            572024..573805
FT                   /gene="gcl"
FT                   /locus_tag="SPC_0532"
FT   CDS_pept        572024..573805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="SPC_0532"
FT                   /product="glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44712"
FT                   /db_xref="GOA:C0PVG9"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVG9"
FT                   /protein_id="ACN44712.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRAAAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRVQIEKALEMLIQSERPVIVAGGGVINADAAPL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHPLMAGMVGLQTAHLYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTQGRKIIHIDIEPTQIGRVLCPDLGIVSDAKAALTLLIDVAQEMQKAG
FT                   RLPCRKTWVDECQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPQRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVTEFEEV
FT                   ADSAKDAPTETCFMKYE"
FT   gene            573818..574594
FT                   /locus_tag="SPC_0533"
FT   CDS_pept        573818..574594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0533"
FT                   /product="glyoxylate-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44713"
FT                   /db_xref="GOA:C0PVH0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH0"
FT                   /protein_id="ACN44713.1"
FT                   /translation="MLRFSANLSMLFTEYDFLERFDKAALSGFRGVEFMFPYDNDIEVL
FT                   KRKLRDNNLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINC
FT                   LVGKTPSGFSATEIHDTLVENLRYAANMLAKEDILLLIEPINHFDMPGFHLTGTQQALA
FT                   LIKDIGSDNIKIQYDIYHMQRMEGELTQTMTAWADKIGHLQIADNPRRGEPGTGEINYD
FT                   FIFNVIKQSGYDGWVGCEYKPLTTTEAGLSWINQYR"
FT   gene            574695..575573
FT                   /gene="garR"
FT                   /locus_tag="SPC_0534"
FT   CDS_pept        574695..575573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="SPC_0534"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44714"
FT                   /db_xref="GOA:C0PVH1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH1"
FT                   /protein_id="ACN44714.1"
FT                   /translation="MKLGFIGLGIMGSPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VETARQVTEFADIIFIMVPDTPQVEDVLFGEHGCAKTSLQGKTIVDMSSISPIETKRFA
FT                   QRVNEMGADYLDAPVSGGEIGAREGTLSIMVGGEQKVFDRVKPLFDILGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   NRTFEPGFKIALHQKDLNLALQSSKALALNLPNTATCQELFNTCAANGGSQLDHSAMVQ
FT                   ALELMANHKLS"
FT   gene            575630..576886
FT                   /locus_tag="SPC_0535"
FT   CDS_pept        575630..576886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0535"
FT                   /product="putative metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44715"
FT                   /db_xref="GOA:C0PVH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH2"
FT                   /protein_id="ACN44715.1"
FT                   /translation="MKNMSETKKSGIDYWKQIVVVMSLGWVAIWIYRTVLTPIYPEIQA
FT                   SLDNVSNAEIGAIASFYFFAYCSMQIPCGILVDKFGQKIMLMAGFTLFIIGTLCIAKAN
FT                   GLAMIYTGSLMAGGGCASFFSSAYSLSSANVPQARRALANAIINSGSAIGMGIGLIGSS
FT                   ILVKNMSMAWQNVLYIVAAILVIMLCVFTLVIRGKAKSDSAQAEKQTQTVTEDEKRAPL
FT                   FSGLLCSVYFLYFCTCYGYYLIVTWLPSYLQTERGFDGGAIGLASALVAVVGVPGALFF
FT                   SHLSDKFRNSKVKVILGLEIVAAAMLAFTVLSPNTTMLMVSLTLYGLLGKMAVDPILIS
FT                   FVSEQASAKSLGRAFSLFNFFGMSSAVVAPTLTGFISDVTGSKEISFVISACLVVTGTL
FT                   IFAVVTLYKKKATQRIASA"
FT   gene            576982..578436
FT                   /gene="allP"
FT                   /locus_tag="SPC_0536"
FT   CDS_pept        576982..578436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allP"
FT                   /locus_tag="SPC_0536"
FT                   /product="putative allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44716"
FT                   /db_xref="GOA:C0PVH3"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH3"
FT                   /protein_id="ACN44716.1"
FT                   /translation="MEHQRELYQQRGYSEDLLPKTETQRNWKAFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFNIMLAIIISALFIAAAMVMNGAAGSKYGVPFAMILRGSYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLAFLILIGKIWPGFLTLGGDFKLLGLSLPGLITFL
FT                   IFWIINVSIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLIGIGPILDYLPSGVQKA
FT                   EHSGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFRAQALGQTLGLIVAYILFAVASVC
FT                   IIAGASIHYGMDTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAL
FT                   APTKLNYKNGVMIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMLAHYFVVM
FT                   RGKINLDELYTASGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPFMEPLSRVSWFVGV
FT                   IVAFVAYALLKKRTGFENTGEQKLVG"
FT   gene            578464..579876
FT                   /gene="allB"
FT                   /locus_tag="SPC_0537"
FT   CDS_pept        578464..579876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="SPC_0537"
FT                   /product="allantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44717"
FT                   /db_xref="GOA:C0PVH4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH4"
FT                   /protein_id="ACN44717.1"
FT                   /translation="MKCALFKNYLYPYKEFVMSFDLIIKNGTVILENEARVIDIAVQGG
FT                   KIAAIGENLEEAKNVLDATGLMVSPGMVDAHTHISEPGRTHWEGYETGTRAAAKGGITT
FT                   MIEMPLNQLPATVDRETIELKFDAAKGKLTIDAAQLGGLVSYNLDRLHELDEVGVVGFK
FT                   CFVATCGDRGIDNDFRDVNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGR
FT                   VTAHDYVASRPVFTEVEAIRRVLYLAKAAGCRLHVCHISSPEGVEEVTRARQEGQDVTC
FT                   ESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDHSPCPPEM
FT                   KAGNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAP
FT                   GKDADLVFIQPDSSYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPV
FT                   PPKGQFILKHQQ"
FT   gene            579929..581233
FT                   /gene="ybbY"
FT                   /locus_tag="SPC_0538"
FT   CDS_pept        579929..581233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="SPC_0538"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44718"
FT                   /db_xref="GOA:C0PVH5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH5"
FT                   /protein_id="ACN44718.1"
FT                   /translation="MDMLPVINRESVLSGFQWFFFIFCNTVVVPPTLLSAFHLPADNLL
FT                   MLTQYAFLTTALACLVQAFCGHRRAIMEGPTGLWWGAILTITLGEASRGTPLNDIASSL
FT                   SVGIAISAMVTIFIGISGLGHRLARLFTPAVMVFFMLLLGAQLTSIFFKGMLGLPFGIA
FT                   DTSARIKLAPFGLAVAVMCFILAMIIFLQQRISRYALLAGTVVGWGLWRLCFPSSHLPP
FT                   GELSWRWFPLGSHGTLMPGIIVTAVMTGLVNISNTYGAIRGTDIFYPHQGSGSSRYRRS
FT                   FMISGLMTLVTVPFAVVPFSPFVSSIGLLTQTGDSSRKSFICGSALCLLVAIITPLTRL
FT                   FCAIPLAISSAVMLVSYLPLLYSGLVFSQQITFTARNIYRLALPLFVGIFLMGLPPVYL
FT                   QDLPLMIRPLLSNGLLVGILLAVLMENLIPWERIK"
FT   gene            581256..582404
FT                   /gene="glxK"
FT                   /locus_tag="SPC_0539"
FT   CDS_pept        581256..582404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="SPC_0539"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44719"
FT                   /db_xref="GOA:C0PVH6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH6"
FT                   /protein_id="ACN44719.1"
FT                   /translation="MKIVIAPDSFKESLSADKCCQAIKAGFSTVFPDARYVCLPIADGG
FT                   EGTVDAMVAATGGKRVSVDVSGPMGEKVNGFYGLTGDGKTAIIEMAAASGLMLVAPEAR
FT                   NPLLASSFGTGELIRHALDAGIRHIILGIGGSATVDGGMGVAQALGVRFLDAQGTPLGA
FT                   GGGNLSRLASIDLQGCDPRISECRIEVACDVDNPLVGPRGAAAVFGPQKGATPEMVETL
FT                   ENGLRNYARVLHALTGRDMSQIPGGGAAGGMGIAAIVFLEAEMKPGIEIVMQAVKLEEA
FT                   VKEASLVITGEGRIDSQTAGGKAPIGVASVAKRHHVPVIGIAGVLGDGVEVVHRHGIDA
FT                   VFSILPRLAPLPEVLANGEQNLYHSACNIARVIKLGQDIGTR"
FT   gene            complement(582484..583269)
FT                   /gene="ylbA"
FT                   /locus_tag="SPC_0540"
FT   CDS_pept        complement(582484..583269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="SPC_0540"
FT                   /product="ylbA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44720"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH7"
FT                   /protein_id="ACN44720.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFENC
FT                   DVTILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVITGNIEAKAEGKTFSLT
FT                   QGGYLYCPPGEMMTFSNAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYEGME
FT                   DVILLDFLPKELGFDMNMHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNNWVPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSHIYSKDCNRDVMI"
FT   gene            complement(583280..584515)
FT                   /gene="allC"
FT                   /locus_tag="SPC_0541"
FT   CDS_pept        complement(583280..584515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="SPC_0541"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44721"
FT                   /db_xref="GOA:C0PVH8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH8"
FT                   /protein_id="ACN44721.1"
FT                   /translation="MIKHFRHAIEETLPWLSSIGADPTGGMTRLLYSPEWLETQQQFKK
FT                   RMAESGLETRFDDVGNLYGRLCGTQFPEQVILSGSHIDTVVNGGNLDGQFGALAAWLAI
FT                   DWLKATYGAPLRTVEVVSMAEEEGSRFPYVFWGSKNIFGLANPEEVRHIQDAKGTGFVD
FT                   AMQACGFTLPAAPLAARTDIRAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVHAFSRICSQSIEKAKQHGDPLVLTFGKVEPQPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLREFTEQLENDMRAICDEMDISIDIDLWMDEAPVPMNAELVAALTR
FT                   LCETEQLNYRIMHSGAGHDAQIFAPRVPTCMIFVPSINGISHNPAERTNINDLAEGVKT
FT                   LALMLHQLAWQK"
FT   gene            complement(584537..585586)
FT                   /gene="allD"
FT                   /locus_tag="SPC_0542"
FT   CDS_pept        complement(584537..585586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="SPC_0542"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44722"
FT                   /db_xref="GOA:C0PVH9"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVH9"
FT                   /protein_id="ACN44722.1"
FT                   /translation="MKISRETLHQLIENKLYKAGLKREHAATVADVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPTFRIENTGPCTAILHADNAAGQVAAKMGMEHAIEIAQKN
FT                   GVAVVGISRMGHSGAISYFVRQAAREGLIGLSICQSDPMVVPFGGADIYYGTNPLAFAA
FT                   PGEGDDIITFDMATTVQAWGKVLDARSRNESIPESWAVDKNGAPTHDPFAVNALLPAAG
FT                   PKGYGLMMMIDILSGILLGLPFGRQVSSMYEDLHAGRNLGQLHLVINPAFFSSCELFRK
FT                   HISQTMQELNAVKPAPGFKQVYYPGQDQDIKQKNADMNGIDIVDDIYQYLISDTLYLKS
FT                   YETKNPFAQ"
FT   gene            585902..587566
FT                   /gene="fdrA"
FT                   /locus_tag="SPC_0543"
FT   CDS_pept        585902..587566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="SPC_0543"
FT                   /product="succinyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44723"
FT                   /db_xref="GOA:C0PVI0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI0"
FT                   /protein_id="ACN44723.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKSL
FT                   LETTGFWHDDFHGATPNDICVAIRTEAVDDGITQVIVQQLEEALQQLAQGSSGSQSLIQ
FT                   VRRWESACQKLPEANLALVSVAGEYAAELAEQALDRSLNVMIFSDNVTLDDEIRLKRRA
FT                   RDKGLLVMGPDCGTAMIANTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSAEVGGISALTALDILSADEKSQVLAFVSKPPADAVRQHIIAAMKATGKP
FT                   VVALFLGFSSPVAREDNVWFASTLDEAARLACLLSRVTSQRKEMVSTGGVIRGLYTGGT
FT                   LAAEAAGLLAGYLGVATDTEHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQL
FT                   IAGLGAQPQVRVLLVDVVIGFGATADPAASLIQAWQKACAARASDQPLFAIATVTGTER
FT                   DPQCRSQQIAALEDAGITVVDSLPEATLLAAELIRPTLSSTHPSAPRLLEAVAVINAGL
FT                   RSFALDLQAAGMPVVHYQWAPVAGGNKKLARLLERLQ"
FT   gene            587588..588835
FT                   /gene="ylbE"
FT                   /locus_tag="SPC_0544"
FT   CDS_pept        587588..588835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="SPC_0544"
FT                   /product="ylbE"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44724"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI1"
FT                   /protein_id="ACN44724.1"
FT                   /translation="MAQANAAVIEQIRRARPHWLDVKPASSLISVLNQGKTLLHAGPPM
FT                   RWQEMTGPMKGACIGACLFEGWAKDEMSALALLEQGKVNFIPCHHVNAVGPMGGITSAS
FT                   MPMLVVENITDGNRAYCNLNEGIGKVMRFGAYGEDVQQRLRWMRDVLMPVLSAALGRLE
FT                   RGLDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPHIARLEHDKQQIAEVMDFLSVTD
FT                   QFFLNLAMAYCKAAMDAGAQIRAGSIVTAMTRNGDMFGIRVSGLGDRWFTAPVNTPQGL
FT                   FFTGFSQDQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAAKSVSEEMAEIY
FT                   LERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVRAPLA
FT                   CFEQALEALAESMGVS"
FT   gene            588847..589656
FT                   /gene="ylbF"
FT                   /locus_tag="SPC_0545"
FT   CDS_pept        588847..589656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="SPC_0545"
FT                   /product="ylbF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44725"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI2"
FT                   /protein_id="ACN44725.1"
FT                   /translation="MKRIHPLMASRQSADYRQPWQMSGVWRRSINFVAKSGELLTLHRR
FT                   GSGFSPGGWILRGGDFDALRDVLTDGEKPQSTAAGIQIGEFLLCEPERRCSLRVPRYLA
FT                   SPRLNATYMQRSEEAGLFGPLTVAAAQPLCPELRQFCHCFQSALAGAATDWRLWLGKGP
FT                   GLTPSHDDTLTGMLLAAWYFGAIDERAGRNFFAQSGSLDRATTLVSVSYLRYAAMGYFA
FT                   SPLLHFIHALRRDARTETAIDGLLALGHTSGADTLLGFWLGQQIVKG"
FT   gene            589660..590553
FT                   /gene="arcC"
FT                   /locus_tag="SPC_0546"
FT   CDS_pept        589660..590553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SPC_0546"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44726"
FT                   /db_xref="GOA:C0PVI3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI3"
FT                   /protein_id="ACN44726.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIADAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKAVEPYPLDVLVAESQGMIGYMLAQRLALEPDMPPVTTV
FT                   LTRIKVSADDPAFLEPEKFIGPVYSPEEQMALEATYGWHMKRDGKYLRRVVASPAPRQI
FT                   IESAAIELLLKEGHVVICSGGGGVPVAGEGEGVEAVIDKDLAAALLAEQIAADGLIILT
FT                   DADAVYEHWGTPQQRAIRQASPDELAPFAKADGAMGPKVTAVSGYVKRCGKPAWIGALS
FT                   RIDDTLAGRAGTCIRL"
FT   gene            complement(590594..591661)
FT                   /gene="purK"
FT                   /locus_tag="SPC_0547"
FT   CDS_pept        complement(590594..591661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SPC_0547"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44727"
FT                   /db_xref="GOA:C0PVI4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI4"
FT                   /protein_id="ACN44727.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPTAVPVQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLSSAD
FT                   EWSGIFGRLGELAIIKRRVGGYDGRGQWRLRADETGQLPDDCYGACIVERGIHFSGEVS
FT                   LVGARAHDGSTVFYPLTHNLHQDGILRTSVAFPQANAEQQAQAESMLSAIMQALNYVGV
FT                   MAMECFITPEGLLINELAPRVHNSGHWTQNGASISQFELHLRAITGLPLPAPVINAPSV
FT                   MINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEALSPLLP
FT                   GEYASGIIWAQSKLK"
FT   gene            complement(591658..592167)
FT                   /gene="purE"
FT                   /locus_tag="SPC_0548"
FT   CDS_pept        complement(591658..592167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SPC_0548"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44728"
FT                   /db_xref="GOA:C0PVI5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI5"
FT                   /protein_id="ACN44728.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILDVPHHVEVVSAH
FT                   RTPDKLFSFAETAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILAQHDAELHQRIADWRKAQTDEVLENP
FT                   DPRGTL"
FT   gene            complement(592285..593007)
FT                   /gene="lpxH"
FT                   /locus_tag="SPC_0549"
FT   CDS_pept        complement(592285..593007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="SPC_0549"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44729"
FT                   /db_xref="GOA:C0PVI6"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVI6"
FT                   /protein_id="ACN44729.1"
FT                   /translation="MATLFIADLHLQTEEPAIVAGFLRFLAVEARQADALYILGDLFEA
FT                   WIGDDDPNPLHREMAVAIKSLVDSGVPCFFIHGNRDFLIGKRFARESGMILLPQEKVLD
FT                   LYGRNVLIMHGDTLCTDDAGYQAFRAKVHNPWVQRLFLTLPLFIRRRIAARMRAGSKAA
FT                   NSSKSLDIMDVNAQTVVAEMEKHRVQWLVHGHTHRPAVHELSVNDQPAFRVVLGAWHHE
FT                   GSMVKVTPDNVELIAFPL"
FT   gene            complement(593010..593522)
FT                   /gene="ppiB"
FT                   /locus_tag="SPC_0550"
FT   CDS_pept        complement(593010..593522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="SPC_0550"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44730"
FT                   /db_xref="GOA:C0PVI7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI7"
FT                   /protein_id="ACN44730.1"
FT                   /translation="MEQDAKMVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNT
FT                   IFHRVINGFMIQGGGFEPGMKQKATKEAIKNEANNGLKNTRGTLAMARTQAPHSATAQF
FT                   FINVADNDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVII
FT                   ENVTVSE"
FT   gene            593677..595062
FT                   /gene="cysS"
FT                   /locus_tag="SPC_0551"
FT   CDS_pept        593677..595062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SPC_0551"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44731"
FT                   /db_xref="GOA:C0PVI8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVI8"
FT                   /protein_id="ACN44731.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHQDFDALN
FT                   ILRPDSEPRATHHIQEIIELTRTLIEKGHAYVADNGDVMFDVPTDPTYGQLSRQDLEQL
FT                   QAGARVDVVDVKRNPMDFVLWKMSKEGEPSWPSPWGEGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDKSAAPAGGEAFEA
FT                   RFVEAMNDDFNTPEAYSVLFDMAREVNRLKGEDMTAANAMASHLRKISGVLGLLEQEPD
FT                   VFLQSGAQADDGEVAEIEALIQQRLDARKAKDWAAADAARDRLAEMGIILEDGPQGTTW
FT                   RRK"
FT   gene            complement(595106..595819)
FT                   /locus_tag="SPC_0552"
FT   CDS_pept        complement(595106..595819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0552"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44732"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVI9"
FT                   /protein_id="ACN44732.1"
FT                   /translation="MDQALQLKQQLNSQPDPVVILVRQGQDMSSRHLTWSHAGYAMRQP
FT                   NGDWRVYHNLNTCGTAESALYIQGLYEFLADDLVNQSIAVLRPRSDIATALQTLLHSAI
FT                   KLNLFHSPRYNLIAWPFSGPYQNSNGWLLEVFARANDAQVWSRNDARRWLQLQGYQPSI
FT                   VSAGTFERLGAKLFTPNVFTDDQPAELLRKGNVGLNSGDSVIRFIAHYSRAIPGCEHQN
FT                   LGESVCVYLSPGAKK"
FT   gene            complement(595927..596364)
FT                   /locus_tag="SPC_0553"
FT   CDS_pept        complement(595927..596364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0553"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44733"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ0"
FT                   /protein_id="ACN44733.1"
FT                   /translation="MNKMTFAAAVICFSFSHASYSEEMSATGWYAASSAVVSVGSSALV
FT                   SGIILSPVLLPLNLSIGSVVENKKQKTALLTTKSPDNKDIKMQVPLNVVKEGNLKAGDK
FT                   VTLEKTQEGTGAYLKKEGKVLAHMVNQDDAGLSSNQTVPAK"
FT   gene            complement(596357..596902)
FT                   /gene="ybcI"
FT                   /locus_tag="SPC_0554"
FT   CDS_pept        complement(596357..596902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="SPC_0554"
FT                   /product="ybcI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44734"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ1"
FT                   /protein_id="ACN44734.1"
FT                   /translation="MPTVITHAAVPLCLGAGLGLKVIPPRLLFAGVVLAMLPDADVLAF
FT                   KFGVAYGNVFGHRGFTHSLLFAFVLPLLCVLAGRRWFRAGQVRCWLFLTVSLLSHSLLD
FT                   SITTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSSYITPYGHQVILSELLWVWLPGSI
FT                   LVLFLWVLKTHIKRNQYE"
FT   gene            complement(597029..597241)
FT                   /gene="ybcJ"
FT                   /locus_tag="SPC_0555"
FT   CDS_pept        complement(597029..597241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="SPC_0555"
FT                   /product="ybcJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44735"
FT                   /db_xref="GOA:C0PVJ2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ2"
FT                   /protein_id="ACN44735.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGVV
FT                   ETRKRCKIVAGQTVSFEGQSVNVVA"
FT   gene            complement(597243..598109)
FT                   /gene="folD"
FT                   /locus_tag="SPC_0556"
FT   CDS_pept        complement(597243..598109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SPC_0556"
FT                   /product="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44736"
FT                   /db_xref="GOA:C0PVJ3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVJ3"
FT                   /protein_id="ACN44736.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARVAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACDEVGFVSRSYDLPETTSEAELLALIDTLNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIAPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPGEWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFDEAAARASYITPVPGGVGPMTVATLIENTLQACIE
FT                   YHDPQGK"
FT   gene            598656..599210
FT                   /gene="fimA"
FT                   /locus_tag="SPC_0557"
FT   CDS_pept        598656..599210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimA"
FT                   /locus_tag="SPC_0557"
FT                   /product="type-1 fimbrial protein, a chain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44737"
FT                   /db_xref="GOA:C0PVJ4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ4"
FT                   /protein_id="ACN44737.1"
FT                   /translation="MKHKLMTSTIASLMFVAGAAVAADPTPVSVSGGTIHFEGKLVNAA
FT                   CAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADN
FT                   TNPNLLAVSSADNSTTATGVGIEILDNTSSPLKPDGATFSAKQALVEGTNTLRFTARYK
FT                   ATAATTPGQANADATFIMKYE"
FT   gene            599286..599819
FT                   /gene="fimI"
FT                   /locus_tag="SPC_0558"
FT   CDS_pept        599286..599819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimI"
FT                   /locus_tag="SPC_0558"
FT                   /product="fimI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44738"
FT                   /db_xref="GOA:C0PVJ5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ5"
FT                   /protein_id="ACN44738.1"
FT                   /translation="MIRKGAALAGLVLMSPVIAQPVMVESGRVHLRGQLVNGGCAVATE
FT                   SQNLRVLMGQYRTNAFTGPGSFAPVSVPFSLRLISCSAEVWRHVGIAFAGVTPAEDPHV
FT                   FLASGEGIGNTGIGLALFDDQQRQIIPNTLPLHYAPILTSEMTLHFTARYRAISENMTP
FT                   GRIHSEVWFTLVYP"
FT   gene            599842..600555
FT                   /gene="fimC"
FT                   /locus_tag="SPC_0559"
FT   CDS_pept        599842..600555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimC"
FT                   /locus_tag="SPC_0559"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44739"
FT                   /db_xref="GOA:C0PVJ6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ6"
FT                   /protein_id="ACN44739.1"
FT                   /translation="MQKVFFTMLNSIKVGFIVLLTLFTSLNVQAAGGIALGATRVIYPS
FT                   AAKQTSLAISNSDTQERYLVNSWIENNAGQKEKTFIVTPPLFVSEPKSENTLRIIYAGQ
FT                   PLPGDRESLFWMNVKAIPSVDKSHIEGKNVLQLAILSRIKLFVRPANLPQTPEDAPTLL
FT                   KFSRVGNHLKITNPSAYYLTLVNISVGAKKIDNVMIAPKSDMQIPLPTGAQGNVTFQSV
FT                   NDYGALTSATTASLG"
FT   gene            600586..603198
FT                   /gene="fimD"
FT                   /locus_tag="SPC_0560"
FT   CDS_pept        600586..603198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimD"
FT                   /locus_tag="SPC_0560"
FT                   /product="outer membrane usher protein FimD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44740"
FT                   /db_xref="GOA:C0PVJ7"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ7"
FT                   /protein_id="ACN44740.1"
FT                   /translation="MKKTTWFAGRFPGYVSPLSSVALSVLVALCPLTSRGESYFNPAFL
FT                   SADTASVADLSRFEKGNHQPPGIYRVDIWRNDEFVATQDIRFEAGAVGTGDKSGGLMPC
FT                   FTPEWIKRLGVNTAAFPVSDKGVDTTCIHLPEKIPGAEVAFDFASMRLNISLPQASLLN
FT                   SARGYIPPEEWDEGIPAALINYSFTGSRGTDSDSYFLSLLSGLNYGPWRLRNNGAWNYS
FT                   KGDGYHSQRWNNIGTWVQRAIIPLKSELVMGDSNTGNDVFDSVGFRGARLYSSDNMYPD
FT                   SLQGYAPTVRGIARTAAKLTIRQNGYVIYQSYVSPGAFAITDLNPTSSSGDLEVTVDEK
FT                   DGSQQRYTVPYSTVPLLQREGRVKYDLVAGDFRSGNSQQSSPFFFQGTVIAGLPAGLTA
FT                   YGGTQLADRYRAVVVGAGRNLGDWGAVSVDVTHARSQLADDSTHQGQSLRFLYAKSLNN
FT                   YGTNFQLLGYRYSTRGFYTLDDVAYRSMEGYDYEYDSDGRRHKVPVAQSYHNLRYSKKG
FT                   RFQVNISQNLGDYGSLYLSGSQQNYWNTADTNTWYQLGYASGWQGISYSLSWSWNESVG
FT                   ISGADRILAFNMSVPFSVLTGRRYARDTLLDRTYATFNANRNCDGDNSWQTGVGGTLLE
FT                   GRNLSYSVTQGRSSTNSYSGSASASWQATYGTLGVGYNYDRDQHDYNWQLSGGVVGHAD
FT                   GITFSQPLGDTNVLIKAPGAKGVRIENQTGVKTDWRGYAVMPYATVYRYNRVALDTNTM
FT                   DNHTDVENNVSSVVPTEGALVWAAFDTRIGVRAIITARLGGRPLPFGAIVRETASGITS
FT                   MVGDDGQIYLSGLPLKGELFIQWGEGKNARCIAPYALAEDSLKQAITIASATCIRPSS"
FT   gene            603213..604220
FT                   /gene="fimH"
FT                   /locus_tag="SPC_0561"
FT   CDS_pept        603213..604220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimH"
FT                   /locus_tag="SPC_0561"
FT                   /product="FimH protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44741"
FT                   /db_xref="GOA:C0PVJ8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ8"
FT                   /protein_id="ACN44741.1"
FT                   /translation="MKIYSALLLAGTALFFTHPALATVCRNSNGTATDIFYDLSDVFTS
FT                   GNNQPGQVVTLPEKSGWVGVNATCPAGTTVNYTYRSYVSELPVRSTEGNFKYLKLNDYL
FT                   LGAMSITDSVAGVFYPPRNYIRMGVDSNVSQQKPFGVQDSKLVFKLKVIRPFINMVTIP
FT                   RQTMFTVYVTTSTGDALSTPVYTISYSGKVEVPQNCEVNAGQVVEFDFGDIGASLFSQA
FT                   GAGNRPQGVTPQTKTIAIKCTNVAAQAYLSMWLEAEKASGQAMVSDNPDLGFVVANSNG
FT                   TPLTPNNLSSKIPFHLDDNAAARVGIRAWPISVTGNKPAEGPFTARGYLRVDYD"
FT   gene            604230..604748
FT                   /gene="fimF"
FT                   /locus_tag="SPC_0562"
FT   CDS_pept        604230..604748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimF"
FT                   /locus_tag="SPC_0562"
FT                   /product="fimbria-like protein FimF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44742"
FT                   /db_xref="GOA:C0PVJ9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVJ9"
FT                   /protein_id="ACN44742.1"
FT                   /translation="MIFRRVFIAIGCVLFSPLSQANSSLGEVNIELRGNVVDFTCAVVA
FT                   GDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPPGSASITFSGTPAPGTALLALA
FT                   DTAMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANA
FT                   DATFLINYN"
FT   gene            complement(604794..605426)
FT                   /pseudo
FT                   /gene="fimZ"
FT                   /locus_tag="SPC_0563"
FT                   /note="stop compared to STM0549 in Salmonella typhimurium
FT                   LT2"
FT   gene            complement(606030..606752)
FT                   /gene="fimY"
FT                   /locus_tag="SPC_0564"
FT   CDS_pept        complement(606030..606752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimY"
FT                   /locus_tag="SPC_0564"
FT                   /product="fimbriae Y protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44743"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK0"
FT                   /protein_id="ACN44743.1"
FT                   /translation="MRSVPRRERHRRLRNAKDCACRYHSPTPQIFDRLELLNQQLNYAL
FT                   PVGIISQAIITTDNYLGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMETLP
FT                   VSCIEALNQLRALSWQQSDIQFYLLVSDKTPAIAQFIRMAGRFFVLSRRQNLASVREAL
FT                   LSAAKPRLSESFSRTDWLMIETLAQGASLKEIARQQSVPYHRVVYRLKQLITLLNLPHR
FT                   QSFLRLLQQLNVTFHDIF"
FT   gene            complement(606771..607082)
FT                   /locus_tag="SPC_0565"
FT   CDS_pept        complement(606771..607082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44744"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK1"
FT                   /protein_id="ACN44744.1"
FT                   /translation="MVAQGTLLKERINPPHLASSPTRHSYLNSELLKSEPIVNLSTAQL
FT                   IGYEVLTQLPSEHDSEVFFQQLMLMEGIETSEQRSIAFYAGATMEQGYLWPAILPDIY"
FT   gene            complement(607244..607840)
FT                   /gene="fimW"
FT                   /locus_tag="SPC_0566"
FT   CDS_pept        complement(607244..607840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimW"
FT                   /locus_tag="SPC_0566"
FT                   /product="fimbriae w protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44745"
FT                   /db_xref="GOA:C0PVK2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK2"
FT                   /protein_id="ACN44745.1"
FT                   /translation="MLSIAIKEQNSHFEHGLKIIMTRLANQWQQKIDFLPPEEIDNADI
FT                   AFLALDDDWFSAGCYQIPMHTQHQLRVIICNKCDKEKLMFRPCLYMLPHIYREDDVEEI
FT                   TRKMILILHKRALRHSVPSSICHYCTTRHFSVTERHLLKLIASGYHLSETAALLSLSEE
FT                   QTKSLRRSIMRKLHVKTEQQFLKYIRVNLHFLLSK"
FT   gene            607796..608032
FT                   /locus_tag="SPC_0567"
FT   CDS_pept        607796..608032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44746"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK3"
FT                   /protein_id="ACN44746.1"
FT                   /translation="MLKVTVLFLNSDTQHKKYPTRQVNHGEILKKLIDFLNTGGLNSHF
FT                   MRAEMCPGDFLEPGIAPEKTIFVHLVSNQNKSH"
FT   gene            608095..608171
FT                   /locus_tag="SPC_t006"
FT   tRNA            608095..608171
FT                   /locus_tag="SPC_t006"
FT                   /product="tRNA-Arg"
FT   gene            complement(608510..608635)
FT                   /locus_tag="SPC_0568"
FT   CDS_pept        complement(608510..608635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0568"
FT                   /product="putative Transposase within prophage"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44747"
FT                   /db_xref="GOA:C0PVK4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK4"
FT                   /protein_id="ACN44747.1"
FT                   /translation="MDSQILSLYVKGMVTREISATFKEMYDADVSLTLISKVTAS"
FT   gene            609844..610206
FT                   /gene="rfbI"
FT                   /locus_tag="SPC_0569"
FT   CDS_pept        609844..610206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbI"
FT                   /locus_tag="SPC_0569"
FT                   /product="putative glycosyl translocase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44748"
FT                   /db_xref="GOA:C0PVK5"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK5"
FT                   /protein_id="ACN44748.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIA
FT                   VSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLVTFSAISL
FT                   ICGFIYSKFIVFRDAK"
FT   gene            610203..611129
FT                   /gene="yfdH"
FT                   /locus_tag="SPC_0570"
FT   CDS_pept        610203..611129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdH"
FT                   /locus_tag="SPC_0570"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44749"
FT                   /db_xref="GOA:C0PVK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK6"
FT                   /protein_id="ACN44749.1"
FT                   /translation="MKISLVVPVFNEEATIPIFYKTVREFEELKPYEVEIVFINDGSKD
FT                   ATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPR
FT                   LIDKWQSGADMVLAKRSDRSTDGRLKRKTAEWFYKLHNKISNPKIEENVGDFRLMSREV
FT                   IENIKLMPERNLFMKGVLSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGITSFS
FT                   TFPLRIWTYIGLAVAGVAFLYGAWMIFDTLAFGNAVRGYPSLLVSILFLGGIQLIGIGV
FT                   LGEYIGRIYIETKARPKYILKGKNSVK"
FT   gene            611119..612573
FT                   /locus_tag="SPC_0571"
FT   CDS_pept        611119..612573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44750"
FT                   /db_xref="GOA:C0PVK7"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK7"
FT                   /protein_id="ACN44750.1"
FT                   /translation="MLNKNTVALYSIFSLCVFALCLYISFNNPVTSDGASLFLEAKDMA
FT                   AGNILLRGWTLSTVSFYFTEAIWYAMVIRIFGDSIYLMYVLPATFYTIAIVLAFALSRT
FT                   DGKRKWSIAALIPCVIISSPLASTMALETCVHVGTIIFALVCLNALKCDRHTTIKQTCV
FT                   ATLTAASVFSDSIFNYYITIPIALAFAVNVLLNRDFSKWRYVVAVIIGVFIAKLLAIIA
FT                   NHFGLLNAPGTQPPAFVSYDNIPSNLNLFIVGIIQYFDAFIFGKQLSASNALIFGRFAV
FT                   MMLWLVLLVVAIRNRFKETFVDTVLAISSVLLPVAYVASNMPVDLGTTRYLVFSFITGS
FT                   ALIARYLNSKADQRLFAFASTIILIVVFAPSGRYELPNSRVQDISSFVRDNNLGDGYGT
FT                   YWVASGVTLFKNGDVRPITFTEENKAVRLNWLSNKAWYGFKSRYIVTEFKHDIDKILNQ
FT                   YGREGHIKEIDNAYIIYYDDARIVIE"
FT   gene            complement(612617..612745)
FT                   /locus_tag="SPC_0572"
FT   CDS_pept        complement(612617..612745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0572"
FT                   /product="TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44751"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK8"
FT                   /protein_id="ACN44751.1"
FT                   /translation="MWKVIYLAIKDVSKKWSMPIQHWRLAMSRFIIEVGDRLSDHL"
FT   gene            complement(612922..613173)
FT                   /locus_tag="SPC_0573"
FT   CDS_pept        complement(612922..613173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0573"
FT                   /product="IS285 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44752"
FT                   /db_xref="GOA:C0PVK9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVK9"
FT                   /protein_id="ACN44752.1"
FT                   /translation="MLVELKNRGFQDILIACVDGLKDFPDAINSVYPQPHIQLCIIHMV
FT                   RSSLKYVSWKDYKAVTSGLKTVYRRGGADDAECVRGRV"
FT   gene            complement(613348..613470)
FT                   /locus_tag="SPC_0574"
FT   CDS_pept        complement(613348..613470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0574"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44753"
FT                   /db_xref="GOA:C0PVL0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL0"
FT                   /protein_id="ACN44753.1"
FT                   /translation="MTTHEIAATFKEMYDADVSLTLISKVTDALKEQATEWQNR"
FT   gene            complement(613579..613812)
FT                   /locus_tag="SPC_0575"
FT   CDS_pept        complement(613579..613812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44754"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL1"
FT                   /protein_id="ACN44754.1"
FT                   /translation="MDENKLKALAAELAKGLKTKADLNQFSQMLTKLTVETARNAELTD
FT                   HPGHEKNMHNKAQTSVMATRQTSCFAVMARLN"
FT   gene            complement(613900..615486)
FT                   /locus_tag="SPC_0576"
FT   CDS_pept        complement(613900..615486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44755"
FT                   /db_xref="GOA:C0PVL2"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL2"
FT                   /protein_id="ACN44755.1"
FT                   /translation="MMEFKKNYFWHVSVIIIGLVIGLVHHIYIYPNFFHADSAAYQVLA
FT                   SAIRDEGVLLPHDFFYGNQLIMLKISPFIALANYIGFSGYKAYAIGGAIAICVWFYICN
FT                   LIISKYCGNKYFSLLLSTCLFIPLGMDDIDFLLGQESHLSNVVLSIMICLPVIIYIQES
FT                   KKSFLCISALAVILMTAEQPIRTLIIIAPFILFILIIFRSKTSVVSMLSIAVSFVIGKM
FT                   ANDYLLGRHFPLKVDYSQASLLISPDKAIDNLFIILKSILVYSSSSSLAVGSNAIGILT
FT                   PFYFMGLLYILLFIATIVYGLKIFLHILIDGRKTKTSICRLDLLCALGATGFVLGLLLI
FT                   SCLNPEGRHIFWATCILKISVFATIFKIFKSNIKNNVYSYSLTIAMTICMSAIAPVLYT
FT                   TKAESFSYNKSNMNSEINKKIISIVRLTGIKYIYGEDFWRMQLLNSIDAEVHSSELTDS
FT                   YDKFVIPRTWLSRPSWYCINGEVLYYTKDGKADKIIESELKSKNGKILYNGAEGKIWLG
FT                   PVIWSKPKWCN"
FT   gene            complement(615483..616409)
FT                   /gene="yfdH"
FT                   /locus_tag="SPC_0577"
FT   CDS_pept        complement(615483..616409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdH"
FT                   /locus_tag="SPC_0577"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44756"
FT                   /db_xref="GOA:C0PVL3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL3"
FT                   /protein_id="ACN44756.1"
FT                   /translation="MKISLVVPVFNEEATIPIFYKTVREFEELKPYEVEIVFINDGSKD
FT                   ATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPH
FT                   LIEKWQAGADMVLAKRSDRSNDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSREV
FT                   IENIKLMPERNLFMKGVLSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGITSFS
FT                   TFPLRIWTYIGLAVAGVAFLYGAWMIFDTLAFGNAVRGYPSLLVSILFLGGIQLIGIGV
FT                   LGEYIGRIYIETKARPKYIIKKVGQIK"
FT   gene            complement(616406..616768)
FT                   /gene="rfbI"
FT                   /locus_tag="SPC_0578"
FT   CDS_pept        complement(616406..616768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbI"
FT                   /locus_tag="SPC_0578"
FT                   /product="putative glycosyl translocase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44757"
FT                   /db_xref="GOA:C0PVL4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL4"
FT                   /protein_id="ACN44757.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIA
FT                   VSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLVTFSAISL
FT                   ICGFIYSKFIIFRDAK"
FT   gene            617196..617420
FT                   /locus_tag="SPC_0579"
FT   CDS_pept        617196..617420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44758"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL5"
FT                   /protein_id="ACN44758.1"
FT                   /translation="MFNLFMVLLSLELMGERMGIIHRLMDDHCFFIVVHFRKGCRIFRR
FT                   SRGAGFLCLSHLLVREGVTVIHHLMCRGG"
FT   gene            complement(617634..617963)
FT                   /locus_tag="SPC_0580"
FT   CDS_pept        complement(617634..617963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0580"
FT                   /product="sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44759"
FT                   /db_xref="GOA:C0PVL6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL6"
FT                   /protein_id="ACN44759.1"
FT                   /translation="MLRRAISNLLSNAMRYTPPGKTITLRIKEADDQIHIIVENPGTPI
FT                   APEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVIAHQGKVSVTSDTRATRFILTL
FT                   PKHLR"
FT   gene            complement(618254..619092)
FT                   /pseudo
FT                   /locus_tag="SPC_0581"
FT                   /note="frameshift compared to STM0563 in Salmonella
FT                   typhimurium LT2"
FT   gene            619308..620633
FT                   /gene="ykgC"
FT                   /locus_tag="SPC_0582"
FT   CDS_pept        619308..620633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="SPC_0582"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44760"
FT                   /db_xref="GOA:C0PVL7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL7"
FT                   /protein_id="ACN44760.1"
FT                   /translation="MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCIN
FT                   IGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRDKNFHNLADLDNVDVIEGRAEFIDN
FT                   HTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPARLGI
FT                   LGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANV
FT                   QAVSSKEGAVQVETPEGAHLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLR
FT                   TTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKRSTRDRQNVPYSVFMTPPLSR
FT                   VGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDS
FT                   HEMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK"
FT   gene            620790..621026
FT                   /locus_tag="SPC_0583"
FT   CDS_pept        620790..621026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0583"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44761"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL8"
FT                   /protein_id="ACN44761.1"
FT                   /translation="MLKVTTLIASLLAAPLAFSVSAQPLTDVEYISVSAVSATPSMLED
FT                   AIARLAQSKQASSWKITSMRIDNTGYATAILYK"
FT   gene            621039..621599
FT                   /gene="ykgB"
FT                   /locus_tag="SPC_0584"
FT   CDS_pept        621039..621599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="SPC_0584"
FT                   /product="ykgB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44762"
FT                   /db_xref="GOA:C0PVL9"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVL9"
FT                   /protein_id="ACN44762.1"
FT                   /translation="MDKYLRLLSQGDRLGLTLIHLSIAIVFIWIGLLKFVPYEADSITP
FT                   FVANSPFMSFFYEHPEEYRQHLTHEGELKPEERAWQTANNTYAFSDGLGVVELIIAALV
FT                   LANPVSRWLGLAGGVLAFLTPFVTLSFLITTPEAWVMPLGDAHYGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARSLLLQRQ"
FT   gene            complement(621678..622853)
FT                   /locus_tag="SPC_0585"
FT   CDS_pept        complement(621678..622853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0585"
FT                   /product="putative ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44763"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM0"
FT                   /protein_id="ACN44763.1"
FT                   /translation="MNKIIKRLEIIKSAIELEDEEIIRQQLIYLKNEPQDAVISAIAQA
FT                   IEARRFSDAMQEIAAWLQAQRALSTWQDPSIAASKLELKALEAQLRDLIDKRNARVQIL
FT                   DDFNDLYHLRLGPLMSRILELRKQLAVSMQRKQEAEIKRREKDYQSCLQFISQAVDQLA
FT                   TLKQQWTGLNAASREAVGIRQRIQQQTELITALLAEIRELEADFSHQDDSAFRQAQENA
FT                   EQDYHQYREQQQEAQFRYARDQRLSADERNELKRLWRQASRLCHPDVVADELKEKAHQM
FT                   MVQLNQARQNADLAAIRALLTQLQSGLEPMMASDRLNNLEHLRHKIRQLRTQIDALLKE
FT                   ITQLETENAWRLASSVADKEAYFSEQERALTEIRNTLEAQVQQVEQELLSG"
FT   gene            623179..624573
FT                   /gene="pheP"
FT                   /locus_tag="SPC_0586"
FT   CDS_pept        623179..624573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="SPC_0586"
FT                   /product="phenylalanine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44764"
FT                   /db_xref="GOA:C0PVM1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM1"
FT                   /protein_id="ACN44764.1"
FT                   /translation="MKNASTASGASVSDAASKNEPTLQRGLQNRHIQLIALGGAIGTGL
FT                   FLGIGPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAWKYWGPFAG
FT                   FLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPTWVWAAAFFIIINAVNLVNVRLYGE
FT                   TEFWFALIKVLAIIGMIGFGLWLLFSGHGGEHASIDNLWRYNGFFATGWHGLLLSLAVI
FT                   IFSFGGLELIGITAAEARDPQKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNS
FT                   SPFVMIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVS
FT                   HRGVPVNSLILSGAITSLVVLINYLLPQKAFSLLMALVVATLLLNWIMICLAHLRFRAA
FT                   MRRKGRETQFKALFYPAGNYLCIAFLALILVLMCTMDDMRLSAILLPVWIVFLFIAFTV
FT                   LRRKAH"
FT   gene            complement(624615..625862)
FT                   /gene="ybdG"
FT                   /locus_tag="SPC_0587"
FT   CDS_pept        complement(624615..625862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="SPC_0587"
FT                   /product="ybdG"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44765"
FT                   /db_xref="GOA:C0PVM2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM2"
FT                   /protein_id="ACN44765.1"
FT                   /translation="MQELISRVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIVL
FT                   RAFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTCAQ
FT                   LWIMTYALLSLFSLLDVIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHFLDDDE
FT                   KQRLLTAQLLKPYLTSRHQEIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEYLRHHPR
FT                   IRKDMTLMVRQLAPDDHGLPIEIYAFTNTVVWLEYESIQADIFDHIFAVVEEFGLRIHQ
FT                   TPTGSDIRALSGTLRH"
FT   gene            625889..626074
FT                   /locus_tag="SPC_0588"
FT   CDS_pept        625889..626074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44766"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM3"
FT                   /protein_id="ACN44766.1"
FT                   /translation="MMTAEWHLCKSGRLRFRHNQQQTGKSASGVIHTLYFIQRPVNVVI
FT                   LRGSLFLNRRQSVNNE"
FT   gene            626173..628146
FT                   /gene="apeE"
FT                   /locus_tag="SPC_0589"
FT   CDS_pept        626173..628146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apeE"
FT                   /locus_tag="SPC_0589"
FT                   /product="outer membrane esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44767"
FT                   /db_xref="GOA:C0PVM4"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM4"
FT                   /protein_id="ACN44767.1"
FT                   /translation="MTQKRTLLKYGILSLALAAPLSACAFDSLTVIGDSLSDTGNNGRW
FT                   TWDSGQNKLYDEQLAERYGLALSPSSNGGSNYAAGGATATPELNPQDNTADQVRQWLAK
FT                   TGGKADHNGLYIHWVGGNDLAAAIAQPTMTQQIAGNSATSAAAQVGLLLDAGAGLVVVP
FT                   NVPDISATPMLLEAVIAAGLGAAAPPALKAALDALAEGATPDFASRQQAIRKALLAAAA
FT                   TVSSNPFIQQLLVEQLLAGYEAAAGQASALTDYYNQMEEKGLEQHGGNIARADINGLFK
FT                   EILANPQAFGLTNTVGMACPPGVSASACSSAMPGFNASQDYLFADHLHPGPQVHTIIAP
FT                   QYIQSIIAAPVQATYLNQSVQSMAQGSRTTLDSRYQQLRQGENPVGSLGMFGGYSGGYQ
FT                   RYDNNEADGNGNHNNLTVGVDYQLNEQVLLGGLIAGSLDKQHPDDNYRYDARGFQATVF
FT                   SHLRAGQAWLDSDLHYLSAKFSNIQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMM
FT                   PWLTTGPMLQYAWDYSHVNGYSEKLNTSTSMRFGDQNAHSQVGSAGWRLDLRHSIIHSW
FT                   AQINYRRQFGDDTYVANGGLKSTALTFSRDGKAQDKNWVDIAIGADFPLSATVSAFAGL
FT                   AQTAGLSDGNQTRYNVGFSARF"
FT   gene            complement(628412..629065)
FT                   /gene="nfnB"
FT                   /locus_tag="SPC_0590"
FT   CDS_pept        complement(628412..629065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="SPC_0590"
FT                   /product="oxygen-insensitive NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44768"
FT                   /db_xref="GOA:C0PVM5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM5"
FT                   /protein_id="ACN44768.1"
FT                   /translation="MDIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVNQEDA
FT                   DGRFATPEAKAANDKGRRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVP
FT                   IEGFDAEVLDAEFGLKEKGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV"
FT   gene            complement(629162..629530)
FT                   /gene="ybdF"
FT                   /locus_tag="SPC_0591"
FT   CDS_pept        complement(629162..629530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="SPC_0591"
FT                   /product="ybdF"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44769"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM6"
FT                   /protein_id="ACN44769.1"
FT                   /translation="MDGQTLHAWAKRCALELPFTEHCWPFGPQYDVFKVGGKIFMLFTE
FT                   HHCRPVVNLKSDPQKSLVNQQIYPSIAPGYHMNKKHWISVYAGEDITISLLNDLINDSW
FT                   NLVVDGLPKREQLRLRPR"
FT   gene            complement(629530..630111)
FT                   /locus_tag="SPC_0592"
FT   CDS_pept        complement(629530..630111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0592"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44770"
FT                   /db_xref="GOA:C0PVM7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM7"
FT                   /protein_id="ACN44770.1"
FT                   /translation="MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLF
FT                   RYFATKDELINTLYLHLKQDLCQSMIMELDRSITDAKMMTRFIWNSYISWGLNHPARHR
FT                   AIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAETTM
FT                   DFAARDPARAGEYIALGFEAMWRALTREEQ"
FT   gene            630400..630741
FT                   /gene="ramA"
FT                   /locus_tag="SPC_0593"
FT   CDS_pept        630400..630741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ramA"
FT                   /locus_tag="SPC_0593"
FT                   /product="transcriptional activator RamA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44771"
FT                   /db_xref="GOA:C0PVM8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM8"
FT                   /protein_id="ACN44771.1"
FT                   /translation="MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQ
FT                   YKGESLGRYVRERKLKLAARDLLDTDQKVYDICLKYGFDSQQTFTRIFTRTFNLPPGAY
FT                   RKEKHGRTH"
FT   gene            complement(630747..630995)
FT                   /gene="ybdJ"
FT                   /locus_tag="SPC_0594"
FT   CDS_pept        complement(630747..630995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="SPC_0594"
FT                   /product="ybdJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44772"
FT                   /db_xref="GOA:C0PVM9"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVM9"
FT                   /protein_id="ACN44772.1"
FT                   /translation="MKHPLESLMTAAGILLMALLSSLLLPAPSLGLALAQKLVGIFHLM
FT                   DLNQLYTLLFCLWFLLLGALEYYVIRFIWRRWFSLAD"
FT   gene            complement(631062..632180)
FT                   /gene="ybdK"
FT                   /locus_tag="SPC_0595"
FT   CDS_pept        complement(631062..632180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="SPC_0595"
FT                   /product="ybdK"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44773"
FT                   /db_xref="GOA:C0PVN0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PVN0"
FT                   /protein_id="ACN44773.1"
FT                   /translation="MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLIDAVKSRL
FT                   TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAMQHVILQAASEHHLGICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCANGDDAIYLLHGLSHFVPHFIA
FT                   LSAASPYMQGSDTRFACARLNIFSAFPDNGPMPWVSNWQEFAGLFRRLSYTTMIDSIKD
FT                   LHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLIQATAHWLLTERPFKPQEQDYLLYK
FT                   FNRFQACRYGLEGVLTDAYTGDRRRLADDTLRLLDNVTPSARKLGADSAIDALRLQVKK
FT                   GGNEAQYMREFIADGGSLIGLVQKHCEIWAGQ"
FT   gene            complement(632192..632896)
FT                   /gene="entD"
FT                   /locus_tag="SPC_0596"
FT   CDS_pept        complement(632192..632896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="SPC_0596"
FT                   /product="enterobactin synthetase component D"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44774"
FT                   /db_xref="GOA:C0PVN1"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN1"
FT                   /protein_id="ACN44774.1"
FT                   /translation="MLTSHFPLPFAGHRLHIVDFDASSFHEHDLLWLPHHDRLRSAGRK
FT                   RKAEHLAGRIAAVHALREMGVRTVPGIGDKRQPLWPDGLFGSISHCATTALAVISRQRI
FT                   GIDIEKIMSQHTATELAPSIIDSDERQILQASLLPFPLALTLAFSAKESVYKAFSDRVT
FT                   LPGFNSAKVTSLTATHISLHLLPAFAATMAERTVRTEWFQRDNSVITLVSAITRVPHDR
FT                   SAPASILSAIPR"
FT   gene            complement(632942..635197)
FT                   /gene="fepA"
FT                   /locus_tag="SPC_0597"
FT   CDS_pept        complement(632942..635197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="SPC_0597"
FT                   /product="ferrienterobactin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44775"
FT                   /db_xref="GOA:C0PVN2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN2"
FT                   /protein_id="ACN44775.1"
FT                   /translation="MNKKIHSLTLLVNLGIYGAALPVMAEEKTDSAALTNEDTIVVTAA
FT                   QQNLQAPGVSTITADEIRKNPPARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMG
FT                   PENTLILIDGKPVTSRNSVRLGWRGERDTRGDTAWVPPEMIERIEVLRGPAAARYGNGA
FT                   AGGVVNIITKKGGSEWHGSWNTYFNAPEHKDEGATKRTNFSLNGPLGGDFSFRLYSNLD
FT                   KTQADARNINQGHQSERTGSYADTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSR
FT                   QGNLYAGDTQNTNTNQLVKDNYGKETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRN
FT                   SRMPEGLAGGTEGIFDPKASQKYADADLNDVTLHSEVSLPFDLLVNQNLTLGTEWAQQR
FT                   MKDELSNSQTFMGGNIPGYSSTNRSPYSKAEIFSLFAENNMELTDSTMLTPGLRFDHHS
FT                   IVGDNWSPSLNLSQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYATGAGTG
FT                   IGCYMMGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGTVPLQRINNGK
FT                   TDVYQWENVPKAVVEGLEGTLNVPVSDTVNWTNNVTYMLQSKNKETGERLSIIPQYTLN
FT                   STLSWQVRQDVSLQSTFTWYGKQEPKKYDYQGNPVTGTDKQAVSPYSIVGLSATWDVTK
FT                   NVSLTGGVDNLFDKRLWREGNAQTVRDTQTGAYMAGAGAYTYNEPGRTWYMSINTHF"
FT   gene            635386..636600
FT                   /gene="fes"
FT                   /locus_tag="SPC_0598"
FT   CDS_pept        635386..636600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="SPC_0598"
FT                   /product="enterochelin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44776"
FT                   /db_xref="GOA:C0PVN3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN3"
FT                   /protein_id="ACN44776.1"
FT                   /translation="MKEALATGSEAWWRTKTGPEWIREKDGNYRVTFWWRDPQGNETHS
FT                   PIRRVWVYITGVTDHHQNAQPQTMARIAGTDVWRWSTALSANWRGSYCFIPTERDDVFA
FT                   AFAPGETPDRNALREGWRQLLPQAIADPLNSRSWRGGRGHAVSALEMPDAPLQPGWDRP
FT                   ETPYSPPLMMQWHSERLGNSRRVWILTTGDEAPEERPLAILLDGQFWAENMPVWPALAS
FT                   LTHQRLLPGAVYLLIDAIDTQHRSQELPCNADFWLAVQQELLPQVRAVTPFSDDAGRTV
FT                   VAGQSFGGLSALYAGLNWPTRFGCVLSQSGSFWWPHRITPPEGEVITWLKTGTLCARGL
FT                   RIVLEAGVREPIVFQANQALYAQLNTSQQSIFWRQVDGGHDALCWRGGLTQGLMLLWQP
FT                   LIDTL"
FT   gene            636631..636849
FT                   /gene="ybdZ"
FT                   /locus_tag="SPC_0599"
FT   CDS_pept        636631..636849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="SPC_0599"
FT                   /product="ybdZ"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44777"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN4"
FT                   /protein_id="ACN44777.1"
FT                   /translation="MEFSNPFDNPQGQFYILQNAQRQFSLWPAACALPAGWDVVCEPQS
FT                   QDACQQWLNTRWTTLNPAYYADKQEAK"
FT   gene            636846..640730
FT                   /gene="entF"
FT                   /locus_tag="SPC_0600"
FT   CDS_pept        636846..640730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="SPC_0600"
FT                   /product="enterobactin synthetase component F"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44778"
FT                   /db_xref="GOA:C0PVN5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN5"
FT                   /protein_id="ACN44778.1"
FT                   /translation="MTQRLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELNGELDAALLA
FT                   KAVAVGMQQADTLRMRFTEENGEVWQWIDPEHTFGEPPIADLRDQPDPHHAALALMQAD
FT                   LRQNLRADSGKPLAFHQLICIDDTRWYWYQRYHHLLVDGFSFPAITRQIAAIYRAWQSD
FT                   APTPESPFTPFADVVEEYQRYRQSEAWQRDGAFWAQQRRELPPPASISAAPLPGRSASA
FT                   GILRMKLSAPAGAFRQLAVHMPEIPRADLALALVTLWLGRLCGRMDYAAGFIFMRRMGS
FT                   AALTATGPVLNVLPLAINLHATEDLPTLAKRLAAQLKKMRRHQRYDAEQIVRDSGRAAG
FT                   ETPLFGPVLNIKVFDYHLDLPGIQAQTHTLATGPVNDLELALFPDENGGLDIELLANAQ
FT                   RYDDATLSRHALRLMALITQFADNPALRCGDAQMLLAEEQTQLAHLNNTAVTIPAATLS
FT                   DLVAQQAQKTPEASALADAHYHFTYREMREQVVALAYALRERGVQPGDSVAVALPRSVF
FT                   LTLALHGIVEAGAAWLPLDTGYPDDRLRMMLEDAQPKLLITTQAQLARFHDIPGMEYLC
FT                   YSQPLPVSDATPLGLSLPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQDHYPLTA
FT                   DDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAQRDPLAMQRFFAQYGVTTTHFVP
FT                   SMLAAFIASLTPASAGKSCASLKRVFCSGEALPTALCREWETLTNAPLHNLYGPTEAAV
FT                   DVSWYPACGDELAAVDGNSIPIGYPVWNTGLRILDAHMQPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFAPGERMYRTGDVARWLDSGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQTLPDVEQAVAHACVFNQAAATGGDARQLVGYLVSHSGLPLDLPALQEKLRQKL
FT                   PAHMVPVVLLQLASLPLSANGKLDRKALPLPDLTPRVKGRAPQSATEIAVAAAFSRLLG
FT                   CEINDVESDFFALGGHSLLAMKLAAQLSQTFNRQVTPGQVMVASDVAQLSKLLDTDDDE
FT                   RSRNLGFGPLLPLRESDGPTLFCFHPASGFAWQFSVLSRYLSPSWSIMGIQSPRPAGPM
FT                   QTATTLDEVCEHHLATLLARQPHGPYYLLGYSLGGTLAQGIAARLRARGETVAFLGLLD
FT                   TWPPETQNWREKEANGLNPDVLAEIERERAAFVAAQQGNASDALFTAIEGNYADAVRLL
FT                   TTAHSVPFDGHATLFVADKTVPEGVSPEQSWSPWIASLAIYRQPCAHVDIISPSAFETI
FT                   GPIISELINK"
FT   gene            640980..642116
FT                   /gene="fepE"
FT                   /locus_tag="SPC_0601"
FT   CDS_pept        640980..642116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="SPC_0601"
FT                   /product="ferric enterobactin (enterochelin) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44779"
FT                   /db_xref="GOA:C0PVN6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN6"
FT                   /protein_id="ACN44779.1"
FT                   /translation="MPSLNVKQEKNQSFAGYSLPIANSHEIDLFSLIEVLWQAKRRILA
FT                   TVFAFACVGLLLSFLLPQKWTSQAIVTPAESVQWQGLERTLTALRVLDMEVSVDRGSVF
FT                   NLFIKKFSSPSLLEEYLRSSPYVMDQLKGAQIDEQDLHRAIVLLSEKMKAVDSNAGKKN
FT                   ETSLFTSWTLSFTAPTREEAQKVLAGYIQYISDIVVKETLENIRNQLEIKTRYEQEKLA
FT                   MDRVRLKNQLDANIQRLHYSLEIANAAGIKRPVYSNGQAVKDDPDFSISLGADGISRKL
FT                   EIEKGVTDVAEIDGDLRNRQYHVEQLAAMNVSDVKFTPFKYQLSPSLPVKKDGPGKAVI
FT                   IILAALIGGMMACGGVLLRHAMVSRKMENALAIDERLV"
FT   gene            complement(642170..642964)
FT                   /gene="fepC"
FT                   /locus_tag="SPC_0602"
FT   CDS_pept        complement(642170..642964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="SPC_0602"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44780"
FT                   /db_xref="GOA:C0PVN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN7"
FT                   /protein_id="ACN44780.1"
FT                   /translation="MTESVARLRGDQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPVDGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDADAVASAMRATGITSLAAQSVDTLSGGQRQRAWIAMVLAQETS
FT                   IMLLDEPTTWLDISHQIDLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALREGNI
FT                   VAQGAPKEIVTAELIEKIYGLRCMIIDDPVAGTPLVVPLGRR"
FT   gene            complement(642961..643950)
FT                   /gene="fepG"
FT                   /locus_tag="SPC_0603"
FT   CDS_pept        complement(642961..643950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="SPC_0603"
FT                   /product="ferric enterobactin transport protein FepG"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44781"
FT                   /db_xref="GOA:C0PVN8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN8"
FT                   /protein_id="ACN44781.1"
FT                   /translation="MFLSRRLIVSCLLLAAGCFAIGLWSLQSGAVPLETGQIIAALLGD
FT                   APRNITLVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGVL
FT                   VAMVLFGQHLTAIALAAMAGGIVTSLIVWLLAWRNGIETFRLIIIGIGIRAMLVAFNTW
FT                   LLLQASLETALTAGLWNAGSLNGLTWAKTWPSAPLIMVMLTGAALLVRRMRLLEMGDDS
FT                   ACALGVSVERSRLMLMLVAVSLTAAATALAGPISFIALVAPHIARRLSGTARRGLTQSA
FT                   LCGALLLLAADACAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   gene            complement(643950..644939)
FT                   /gene="fepD"
FT                   /locus_tag="SPC_0604"
FT   CDS_pept        complement(643950..644939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="SPC_0604"
FT                   /product="ferric enterobactin transport protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44782"
FT                   /db_xref="GOA:C0PVN9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVN9"
FT                   /protein_id="ACN44782.1"
FT                   /translation="MTRAFAVPGLLLLLSLAAVLSLVIGAKPLPAAVVLEAFTGVCQSA
FT                   DCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNNGASFAIVLGAA
FT                   LFGFSTPLEQLFMAFSGALIASLIVAFTGSQGGGQLSPVRLTLAGVALGAVLEGLTSGI
FT                   ALLNPEVYDQLRFWQAGSLDIRSLQTLKVALAPVVIAGIVALFLSRALNSLSLGSDTAT
FT                   ALGSKVARTQLIGLLAITVLCGSATALVGPIAFIGLMMPHMARWLVGADHRWSLPVTLL
FT                   ATPALLLFADIIGRLLVPGELRVSVVSAFIGAPVLIFLVRRKSNGGGL"
FT   gene            645068..646312
FT                   /gene="ybdA"
FT                   /locus_tag="SPC_0605"
FT   CDS_pept        645068..646312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdA"
FT                   /locus_tag="SPC_0605"
FT                   /product="putative membrane protein p43"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44783"
FT                   /db_xref="GOA:C0PVP0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023722"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP0"
FT                   /protein_id="ACN44783.1"
FT                   /translation="MNRQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFIGLMVGGVLADRYERKKVILLARGTCGIGFIGLCVNSL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MLGGILLASGGVAWNYGLAAAGTFITLLPLLTLPRLPVPPQPRENPFIALLAAFRFLLA
FT                   SPLIGGIALLGGLVTMASAVRVLYPALAMSWQMSAAQIGLLYAAIPLGAAIGALTSGQL
FT                   AHSVRPGLIMLVSTVGSFLAVGLFAIMPVWTAGVICLALFGWLSAISSLLQYTLLQTQT
FT                   PENMLGRMNGLWTAQNVTGDAIGAALLGGLGAMMTPVASASVSGFGLVIIGLLLLLVLG
FT                   ELRRFRQTPPVSDAG"
FT   gene            complement(646375..647331)
FT                   /gene="fepB"
FT                   /locus_tag="SPC_0606"
FT   CDS_pept        complement(646375..647331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="SPC_0606"
FT                   /product="ferrienterobactin-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44784"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP1"
FT                   /protein_id="ACN44784.1"
FT                   /translation="MRLPAFYRWLLLVVGISISGISLAQDAGWPRQIQDSRGVHTLDHK
FT                   PARIVSTSVTLTGSLLAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLYIG
FT                   EPNAETVAAQMPDLILISATGGDSALALYEQLSAIAPTLVINYDDKSWQSLLTQLGEIT
FT                   GQEKQAAARIAEFEAQLTTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKLLTQL
FT                   GFTLATLPRGLQTSKSQGKRHDIIQLGGENLAAGLNGESLFLFAGDNKDVAALYANPLL
FT                   AHLPAVQNKRVYALGTETFRLDYYSATLLLNRLAALF"
FT   gene            647640..648815
FT                   /gene="entC"
FT                   /locus_tag="SPC_0607"
FT   CDS_pept        647640..648815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="SPC_0607"
FT                   /product="isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44785"
FT                   /db_xref="GOA:C0PVP2"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP2"
FT                   /protein_id="ACN44785.1"
FT                   /translation="MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVA
FT                   GDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQR
FT                   TARYFTDHQSLTVTARKAIPEQDAFEAMVARAAMLTATPDVDKVVLSRLIDITTDVAVD
FT                   SGALLERLVAQNPVSYNFHVPLADGGVLLGASPELLLRKEGERFSSLPLAGSARRQPDD
FT                   VLDREAGNRLLASQKDRHEHELVTQAMKQILRDRSTELQLPSSPQLITTPTLWHLGTPF
FT                   EGKANAGENALTLACLLHPTPALSGFPHQVAKKLIAELEPFDRELFGGIVGWCDAEGNG
FT                   EWVVTIRCAKLHGNQVRLFAGAGIVPASSPVGEWRETGVKLSTMLNVFGLH"
FT   gene            648822..650435
FT                   /gene="entE"
FT                   /locus_tag="SPC_0608"
FT   CDS_pept        648822..650435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="SPC_0608"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44786"
FT                   /db_xref="GOA:C0PVP3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP3"
FT                   /protein_id="ACN44786.1"
FT                   /translation="MMRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIE
FT                   GERAFSYRQLNQAADNLACYLRHQGIKPGETALVQLGNVPELYITFFALLKLGVAPVLA
FT                   LFSHQRTELNAYAMQIAPTLVIADRQHTLFAGEDFLNTFVAEHRSVRVVLLRNDDGDHS
FT                   LDAAMRQAAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEICGFN
FT                   EETRFLCAIPAAHNYAMSSPGALGVFLAKGTVVLTTDPGATLCFPLIEKHQINATALVP
FT                   PAVSLWLQAIQEWGGNAPLASLRLLQVGGAQLSATLAARIPPEIGCQLQQVFGMAEGLV
FT                   NYTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPGEIGRLMTRGPYTFRGYFNSP
FT                   LHNASAFDANGFYCSGDLISIDQDGYITVHGREKDQINRGGEKIAAEEIENLLLRHPAV
FT                   IHAALVSMEDELLGEKSCAYLVVKEPLRAVQVRRFLREQGVAEFKLPDRVECVASLPLT
FT                   PVGKVDKKQLRQRLASRSPL"
FT   gene            650449..651306
FT                   /gene="entB"
FT                   /locus_tag="SPC_0609"
FT   CDS_pept        650449..651306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SPC_0609"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44787"
FT                   /db_xref="GOA:C0PVP4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP4"
FT                   /protein_id="ACN44787.1"
FT                   /translation="MAIPKLQSYALPTALDIPTNKVNWAFEPERAALLIHDMQDYFVSF
FT                   WGRNCPMMDQVIANIAALRQYCKEHHIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVEALTPDEADTVLVKWRYSAFHRSPLEQMLKDTGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSREEHLMALNYVAGRSGRVVMTESLLPTPVPASKAALRALI
FT                   LPLLDETDEPLDDENLIDYGLDSVRMMGLAARWRKVHGDIDFVMLAKNPTIDAWWALLS
FT                   RGVE"
FT   gene            651306..652061
FT                   /gene="entA"
FT                   /locus_tag="SPC_0610"
FT   CDS_pept        651306..652061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="SPC_0610"
FT                   /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44788"
FT                   /db_xref="GOA:C0PVP5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP5"
FT                   /protein_id="ACN44788.1"
FT                   /translation="MPCIDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQE
FT                   SYPFATEVMDVADAGQVAQVCQRVLQKTPRLDVLVNAAGILRMGATDALSVDDWQQTFA
FT                   VNVGGAFNLFSQTMAQFRRQQGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGL
FT                   ELAGCGVRCNVVSPGSTDTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARPQEIA
FT                   NTILFLASDLASHITLQDIVVDGGSTLGA"
FT   gene            652064..652477
FT                   /gene="ybdB"
FT                   /locus_tag="SPC_0611"
FT   CDS_pept        652064..652477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="SPC_0611"
FT                   /product="ybdB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44789"
FT                   /db_xref="GOA:C0PVP6"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP6"
FT                   /protein_id="ACN44789.1"
FT                   /translation="MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDAR
FT                   THQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLP
FT                   LHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG"
FT   gene            652659..654764
FT                   /gene="cstA"
FT                   /locus_tag="SPC_0612"
FT   CDS_pept        652659..654764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="SPC_0612"
FT                   /product="carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44790"
FT                   /db_xref="GOA:C0PVP7"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP7"
FT                   /protein_id="ACN44790.1"
FT                   /translation="MNKSGKYLVWTALSVLGAFALGYIALNRGEQINALWIVVASVCVY
FT                   LIAYRFYGLYIAKKVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGATAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAASPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGDLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLHQIANEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKIGFLAIANKFQAMIDSGNIPPQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLAVFSIKTALAALKIDKPTANETPYEPMPENVDEIV
FT                   TQAKGAH"
FT   gene            654828..655025
FT                   /gene="ybdD"
FT                   /locus_tag="SPC_0613"
FT   CDS_pept        654828..655025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="SPC_0613"
FT                   /product="ybdD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44791"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP8"
FT                   /protein_id="ACN44791.1"
FT                   /translation="MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   gene            complement(655061..656149)
FT                   /gene="ybdH"
FT                   /locus_tag="SPC_0614"
FT   CDS_pept        complement(655061..656149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="SPC_0614"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44792"
FT                   /db_xref="GOA:C0PVP9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVP9"
FT                   /protein_id="ACN44792.1"
FT                   /translation="MNHTEIRVVTGPANYFSHAGSLERLTDFFTPEQLSHAVWVYGERA
FT                   IAAARPYLPEAFERAGAKHLPFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTAKA
FT                   LARRLALPFVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIILQAP
FT                   DDYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINSACAIRDLLLTSSEQALADKQQ
FT                   RRLTQAFCDVVDAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLITAYRRFHLPARLSELDVDIHNTAEIDRVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVEFFRI"
FT   gene            656240..657436
FT                   /gene="ybdL"
FT                   /locus_tag="SPC_0615"
FT   CDS_pept        656240..657436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="SPC_0615"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44793"
FT                   /db_xref="GOA:C0PVQ0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ0"
FT                   /protein_id="ACN44793.1"
FT                   /translation="MSTTTSLAGMKIMRNNPLIPKSKLPNLGTTIFTQMSALAQKHQAI
FT                   NLSQGFPDFDGPRYLHERLAYHVAQGANQYAPMTGAQALREAIADKTAEIYGYRPDDVS
FT                   DITVTAGATEALYAAITALVRAGDEVICFDPSYDSYAPAVALSGGVLKRIALTPPHFRV
FT                   DWQAFSALLSERTRLVILNTPHNPTATVWRQADIEALWQAIGEREIYVLSDEVYEHICF
FT                   AAEGHASVLAHPQLRERAVAVSSFGKTFHMTGWKIGYCVAPAAISAEIRKVHQYLTFCV
FT                   NTPAQLALADMLRAAPEHYRALPDFYRKKRDVLVNALAQSRLKVLPCEGTYFLLIDYSA
FT                   VSTLNDVEFCQWLTEEVGVAAIPLSVFCAAPFPHQLIRLCFAKQESTLLAAAERLCKL"
FT   gene            complement(657437..658054)
FT                   /gene="ybdM"
FT                   /locus_tag="SPC_0616"
FT   CDS_pept        complement(657437..658054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="SPC_0616"
FT                   /product="ybdM"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44794"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ1"
FT                   /protein_id="ACN44794.1"
FT                   /translation="MQHRLTTEITHFLSELPEEERIAAINEFRMAIHSVSPFRDEPVDC
FT                   VLWVKNDHISPNDYNPNNVAPPEKKLLLKSIEQDGFTQPIVVVKANTEEYEIVDGFHRH
FT                   ELGKGKAALKRRLKGYLPITCLDRERHERMAATIRHNRARGRHQIHAMSEIVRELSLLG
FT                   WDESKIGQELGMDADEVLRLKQINGLQELFADRRFSRAWTVK"
FT   gene            complement(658027..659262)
FT                   /locus_tag="SPC_0617"
FT   CDS_pept        complement(658027..659262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44795"
FT                   /db_xref="GOA:C0PVQ2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ2"
FT                   /protein_id="ACN44795.1"
FT                   /translation="MSVYKVPLEQNVLEAAQERIMWTLETLPRVCVSFSGGKDSGLMLH
FT                   LTATLARKMNKKIHVLFIDWEAQFSCTITYIESLREYYADVIERFYWVALPLTTQNSLS
FT                   QYQPEWQCWQPGTDWVRQPPEDAITDPAFFSFYQHGMTFEQFVRDFADWFSEKRPAAML
FT                   VGIRSDESYNRFAAIANSHKLRFADDKPWTTLAPKGHTWYIYPIYDWKTADIWTWFAKT
FT                   GKPCNPLYNLMYQAGVPPRYMRICEPFGPEQRQGLWLYHVIEPERWAAMCARVSGALSG
FT                   GIYAGQDSHFYGHRKILKPDHLNWEEYALLLLHSMPEVTAEHYRNKIAVYLQWYKKKGM
FT                   HTIPQTQHGDIGSRDIPSWRRICKVLLNNDYWCRALSFSPTKPKNYQRYNERMKAKRQE
FT                   WGILCNTDSQPK"
FT   gene            complement(659428..660330)
FT                   /gene="ybdO"
FT                   /locus_tag="SPC_0618"
FT   CDS_pept        complement(659428..660330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="SPC_0618"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44796"
FT                   /db_xref="GOA:C0PVQ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ3"
FT                   /protein_id="ACN44796.1"
FT                   /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAETLYITPSAVSQSL
FT                   QRLRTQFNDPLFIRSGKGITPTVTGINLHYHLENNLNSLEQTINIMNQSSLKKKFIIYS
FT                   PQLLITQYVMKLVKYIRKDPQVEIEHHDILTTDELPEDLLAYRKADIVVSMAPLNNRSI
FT                   VCTHFNRLECILVCSENHPRLGDTATIDEILQESFTQLVSRATGMKEYHSLMDDVLGER
FT                   IIGFRSKSLMTIANSISSTELIGFLPQTFFDYYSSSIKLKKVTIPFTIAPIQFYLMYNR
FT                   ASLNNSGFAELIEHITKKH"
FT   gene            complement(660647..661453)
FT                   /gene="dsbG"
FT                   /locus_tag="SPC_0619"
FT   CDS_pept        complement(660647..661453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="SPC_0619"
FT                   /product="thiol:disulfide interchange protein DsbG
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44797"
FT                   /db_xref="GOA:C0PVQ4"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ4"
FT                   /protein_id="ACN44797.1"
FT                   /translation="MSVIGIIINTLFALILKGKNMIKRTLLLAMLPILAHAEELPAPVK
FT                   AIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNAL
FT                   IEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPFCPYCKQFWQQARPWVESG
FT                   KVQLRTLLVGVIKPESPATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVI
FT                   NQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQLDAMMGQP"
FT   gene            661834..662397
FT                   /gene="ahpC"
FT                   /locus_tag="SPC_0620"
FT   CDS_pept        661834..662397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SPC_0620"
FT                   /product="alkyl hydroperoxide reductase c22 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44798"
FT                   /db_xref="GOA:C0PVQ5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ5"
FT                   /protein_id="ACN44798.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAAHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   gene            662522..664204
FT                   /gene="ahpF"
FT                   /locus_tag="SPC_0621"
FT   CDS_pept        662522..664204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="SPC_0621"
FT                   /product="alkyl hydroperoxide reductase F52A protein
FT                   (subunit F)"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44799"
FT                   /db_xref="GOA:C0PVQ6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ6"
FT                   /protein_id="ACN44799.1"
FT                   /translation="MFQSWAHPRPFHFSTMTQVALMQSREVGLHDDVFREGRRMLDTNM
FT                   KTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSF
FT                   LITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETY
FT                   YSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQ
FT                   GRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGLMG
FT                   ERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEGG
FT                   LHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
FT                   IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKG
FT                   DGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCET
FT                   SVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA"
FT   gene            664537..665097
FT                   /locus_tag="SPC_0622"
FT   CDS_pept        664537..665097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0622"
FT                   /product="putative anaerobic dehydrogenase component"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44800"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ7"
FT                   /protein_id="ACN44800.1"
FT                   /translation="MDSIYESLTELEKTGLTLRDFFNSHDSHSLKSAYVRLNPSAAVNL
FT                   TDRAWLEAEYDFNALFVGPGKLLAAPFASVYLEDDALVMGKATLEIREFMAALGLSVNQ
FT                   ESNIPDDHISCVLELTTLLLANTRQTSPYRSTLTQYINNYLTKWVPLYIEKIKTHAQTT
FT                   TLYTVADILFYWLDELKREYQYE"
FT   gene            665090..667369
FT                   /locus_tag="SPC_0623"
FT   CDS_pept        665090..667369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0623"
FT                   /product="molybdopterin-containing oxidoreductase catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44801"
FT                   /db_xref="GOA:C0PVQ8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ8"
FT                   /protein_id="ACN44801.1"
FT                   /translation="MSNETGHLNRRSFLKGIVALGAVAALPGGLLTSRCALAQPPVPFN
FT                   PKTYKIYRNACPRNCYDTCSLKTWVKDGVITFVEGAPESTFTHGTPCVKGLSYPRRVYS
FT                   PDRIKYPMAQDVRGSGNWRRISWEEAMQRIAAKMLEIKKKDGSMLGLALTKYSGKFGVL
FT                   NYAVEGMMSSLGYTTRFAGTPCWPAGIDAQNYDMGDMWCNDPEDMVKAKYIIIWGANPA
FT                   WCSMHSMKYIYQAREKGAKVVVIDPLLSQTAAKADLYLRVRPGSDGALALGMARHLVDK
FT                   GLVDQDFVNNDAHGYPEFEAYLRNHVTVEWAAEICGLSADVIRQLAEEFTAVKPATVWI
FT                   GYGMQRHVNGGANVRAIDAFVAMSGNIGVEGGGARYGHLHTWGFNYNAMLQKPPVGAIG
FT                   IPGAAGTTSEFGAAAGSDAVQYSDRSLNINQTAQGILEANDPPVRMLWVACKNPFAQDF
FT                   DRSKMKKAFEKLEMVVCADQFFNETVQHADIVLPVTTAFEEWNVDASYWHYWLSINQPA
FT                   IKPMYEAKCDLEIATMLSRTINKMAPGSCTFPQEFDHKRWLDQEFNDGMAKMFGISSWD
FT                   DLLDGPKKAILPSSAAWYDRKFKTPSGKYEFKSELAEKNGHTALPEYKPEAESKLPFHL
FT                   FTPHVQFGLHSLFINLDWMQVFYPEPFVYLHPSSAKRKGISENDLVKVFNGTGEVELRA
FT                   KVTTNVPEDFLVMYEAWFPKRQYNVQNVVADTPADMGLMKTGAPGAAIHSQFADVVLIG
FT                   KGESVA"
FT   gene            667384..667923
FT                   /locus_tag="SPC_0624"
FT   CDS_pept        667384..667923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0624"
FT                   /product="molybdopterin-containing oxidoreductase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44802"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVQ9"
FT                   /protein_id="ACN44802.1"
FT                   /translation="MNSDKCIGCRGCAMACKSFNQLEPDRFWRNVYPLDKDIYPHEERA
FT                   FYSLACNHCEHPACVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAPRFNEET
FT                   RKAEKCSMCYERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPGFPHMPQLNP
FT                   GTRFILARQPKQPEDK"
FT   gene            667923..668690
FT                   /locus_tag="SPC_0625"
FT   CDS_pept        667923..668690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0625"
FT                   /product="molybdopterin-containing oxidoreductase membrane
FT                   anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44803"
FT                   /db_xref="GOA:C0PVR0"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR0"
FT                   /protein_id="ACN44803.1"
FT                   /translation="MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFYWLATG
FT                   LVLALASIAAILHLAHPDRAYDALINLRHAWLSREILGATLFGAAVGVTFLAKGHKAMA
FT                   LIASVFGVLLVAVQGMTYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLKLRPAVPAL
FT                   RQGIVVCIAVLIAAPLVWLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHGDSRP
FT                   KLLFVLLFVGVFLSRLVFFGDTVSTIVNIGHLY"
FT   gene            complement(668758..669051)
FT                   /locus_tag="SPC_0626"
FT   CDS_pept        complement(668758..669051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0626"
FT                   /product="putative universal stress protein UspA and
FT                   related nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44804"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR1"
FT                   /protein_id="ACN44804.1"
FT                   /translation="MSLHRFAADVRRFEEHLQHEAETRLQTMVGHFSIDPSRIKTHVRF
FT                   GSVRDVVNEMGEELDADVVVIGSRNPSITTHLLGSNASSVVRHATLPVLVVR"
FT   gene            669073..669324
FT                   /locus_tag="SPC_0627"
FT   CDS_pept        669073..669324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44805"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR2"
FT                   /protein_id="ACN44805.1"
FT                   /translation="MQQMNDAILLRQKLSVANGFIAKFHFKNINRHNDCLIHTRYSLLI
FT                   NTEFIQAYNNVSFCYLSGNFKYCDNLTLKKSCIFQEKS"
FT   gene            669409..670647
FT                   /gene="ybdR"
FT                   /locus_tag="SPC_0628"
FT   CDS_pept        669409..670647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdR"
FT                   /locus_tag="SPC_0628"
FT                   /product="putative zinc-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44806"
FT                   /db_xref="GOA:C0PVR3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR3"
FT                   /protein_id="ACN44806.1"
FT                   /translation="MKALTYHGPHHVKVENVPDPGIEQPDDIILRVTATAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGHDVKNIRKGERVVIPFVIACGDCFFCRLQQYSAC
FT                   ENTNDGHGAAMNKKQIPPPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNAQIQQGSSVAVFGAGPVGLLTIACARLLDAEQIFVVDHHAW
FT                   RLRFAEERYGAIPINFDDENDPAEKIIEQTAGHRGVDAVIDAVGFEAKGSMTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGVVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHFMPFEEAARGYEIFEKREEECRKVILVPGATSAQAAQKQ
FT                   ATGVINPMPGGVV"
FT   gene            complement(670730..671140)
FT                   /gene="rnk"
FT                   /locus_tag="SPC_0629"
FT   CDS_pept        complement(670730..671140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="SPC_0629"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44807"
FT                   /db_xref="GOA:C0PVR4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR4"
FT                   /protein_id="ACN44807.1"
FT                   /translation="MSRPTIIINDLDAERIDRLLEQPAYADLPIADALNAELDRAQMCS
FT                   PQEMPNDVVTMNSRVKFRNLSDGETRVRTLVYPANMTDSSTQLSVMAPVGAALLGLRVG
FT                   DTIHWELPGGTSTHLEVLELEYQPEAAGDFLR"
FT   gene            complement(671375..672182)
FT                   /pseudo
FT                   /gene="rna"
FT                   /locus_tag="SPC_0630"
FT                   /note="frameshift compared to STM0617 in Salmonella
FT                   typhimurium LT2"
FT   gene            complement(672292..673755)
FT                   /gene="citT"
FT                   /locus_tag="SPC_0631"
FT   CDS_pept        complement(672292..673755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="SPC_0631"
FT                   /product="citrate carrier"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44808"
FT                   /db_xref="GOA:C0PVR5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR5"
FT                   /protein_id="ACN44808.1"
FT                   /translation="MSLSKDNIWKLLAPLVVMGVMLLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDASELADPAFKASKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVTGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGVQISWLQWFLSFLPVGIILLIVAPWLSYVLYKPEVTHSAEVAAWAGGELKNMG
FT                   RLSRKEWTLIGLVLLSLGLWVFGGKIINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   TLVNLATLVVMANGLTRSGFIDWFANTMSTHLEGFSPDATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSR
FT                   DYWRLGAIFGVIYIAMLLLVGWPILAMWN"
FT   gene            complement(673793..674686)
FT                   /gene="citG"
FT                   /locus_tag="SPC_0632"
FT   CDS_pept        complement(673793..674686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SPC_0632"
FT                   /product="CitG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44809"
FT                   /db_xref="GOA:C0PVR6"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR6"
FT                   /protein_id="ACN44809.1"
FT                   /translation="MPIPANPTNASIQPQSLYDAWADLAWRAMLTEVNLSPKPGLVDRL
FT                   NCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAGLRPLGMACEAAMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPITAETLCATAADFCRGLTTRELRQNNLQ
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVIRHALPHYRALLAQGRDPELALLDTLLLLMSL
FT                   NGDTNVASRGGADGLRWLQQQAAVLLHQGGIRTPDDLVYLHRFDQQCIERNLSPGGSAD
FT                   LLIVTWFLAQISQVNH"
FT   gene            complement(674661..675212)
FT                   /gene="citX"
FT                   /locus_tag="SPC_0633"
FT   CDS_pept        complement(674661..675212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="SPC_0633"
FT                   /product="2'-(5'-triphosphoribosyl)-3'-dephospho-CoA:apo-citrate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44810"
FT                   /db_xref="GOA:C0PVR7"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR7"
FT                   /protein_id="ACN44810.1"
FT                   /translation="MRLFPELATCHDVSIPELLASRDERQARQRAWLTRHATPLVSFTV
FT                   VAPGPMKDSALTRRIFNHGVAALHTLAEEYGWTIREQAALVSASGPEGLLAIDAPAQAL
FT                   KQATIALEQRYPLGRLWDIDVLTAEGEILSRRHFALPARRCLLCGQSAAECARGKTHAL
FT                   TDLLIHMEALLHDADSCQPD"
FT   gene            complement(675216..676745)
FT                   /gene="citF"
FT                   /locus_tag="SPC_0634"
FT   CDS_pept        complement(675216..676745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="SPC_0634"
FT                   /product="citrate lyase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44811"
FT                   /db_xref="GOA:C0PVR8"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR8"
FT                   /protein_id="ACN44811.1"
FT                   /translation="MTQKNESQRQDRVAAWSRHAESELSAYQSAAKLDLQAQKPRDHKL
FT                   CASLEEAIRRSGLRDGMTLSFHHAFRGGDLTINLVMETIAKMGFKNLTLASSSLSDCHA
FT                   PLVEHIRNGVVSRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAF
FT                   LGVPSCDEFGNANGYTGKACCGSLGYAMVDADSAKQVVMLTEQLLPYPHNPASISQDQV
FT                   DLIVQIEEVGDANKIGAGATRMTTNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGAS
FT                   LAVTRFLEDKMRSRNIVANFALGGITATMVDLHEKGLIRKLLDVQSFDRNAAQSLARNP
FT                   NHIEISANQYANWGSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDT
FT                   AVAAALSIIVAPLVRGRIPTLVDNVTTCVTPGSSVDILVTDHGIAVNPARPELAERLKA
FT                   AGIKVVSIEWLRERAQLLTGQPRPIEFTDRVIAVVRYRDGSVIDVVHQVKE"
FT   gene            complement(676755..677663)
FT                   /gene="citE"
FT                   /locus_tag="SPC_0635"
FT   CDS_pept        complement(676755..677663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SPC_0635"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44812"
FT                   /db_xref="GOA:C0PVR9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVR9"
FT                   /protein_id="ACN44812.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVIDIENEILRIENACGREPGSTGLLAAVESPLGITRAVEIADASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAAFLQEAAHIK
FT                   QLGFDGKSLINPRQIELLHNLYAPTRKEVAHARLVVEAAEAAAREGLGVVSLNGKMVDS
FT                   PVIERARLVLSRAELSGIREE"
FT   gene            complement(677660..677956)
FT                   /gene="citD"
FT                   /locus_tag="SPC_0636"
FT   CDS_pept        complement(677660..677956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="SPC_0636"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44813"
FT                   /db_xref="GOA:C0PVS0"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVS0"
FT                   /protein_id="ACN44813.1"
FT                   /translation="MKINQLAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGEAI
FT                   RATILEVLSRYDVRGVQLNVDDKGALDCILRARLETLLARASGIAALPWEDRQ"
FT   gene            complement(677953..679029)
FT                   /gene="citC"
FT                   /locus_tag="SPC_0637"
FT   CDS_pept        complement(677953..679029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="SPC_0637"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44814"
FT                   /db_xref="GOA:C0PVS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVS1"
FT                   /protein_id="ACN44814.1"
FT                   /translation="MFGNNVFTRVKRSENKKMAEIAHFLKENDLSVDTTVEVFITVSRD
FT                   DRLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAWERHCTHLFIYTKTEYEAL
FT                   FKQCSFSTIASVPGVMVLMENSATRLKRYAESLATLRHEGKKIGCIVMNANPFTNGHRY
FT                   LIQQAAAQCDWLHLFLVKEDTSRFPYEDRLDLVLKGTTDIPRLTVHRGSEYIISRATFP
FT                   CYFIKEQSVINHCYTEIDLKIFRQYLAPALGITHRFVGTEPFCTVTAQYNLDMRFWLET
FT                   PTLPAPPITLVEIERLCFQETPISASWVRKLLVKHDLTAIAPLVPDATLRYLQGMVERH
FT                   PGSAAARQKSPVLATGEK"
FT   gene            679095..679232
FT                   /locus_tag="SPC_0638"
FT   CDS_pept        679095..679232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44815"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVS2"
FT                   /protein_id="ACN44815.1"
FT                   /translation="MITFSFQSEWEYFYDELFIFLSDVYIVRSILVVNFDLFHKALDGF
FT                   "
FT   gene            679240..679404
FT                   /locus_tag="SPC_0639"
FT   CDS_pept        679240..679404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44816"
FT                   /db_xref="GOA:C0PVS3"
FT                   /db_xref="UniProtKB/TrEMBL:C0PVS3"
FT                   /protein_id="ACN44816.1"
FT                   /translation="MVLSFLINLIAIPAVGFSCLIDLMWGICNDWFLYASRYSKHFYYI
FT                   CDKSEEKCP"
FT   gene            679414..681075
FT                   /gene="dpiB"
FT                   /locus_tag="SPC_0640"
FT   CDS_pept        679414..681075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpiB"
FT                   /locus_tag="SPC_0640"
FT                   /product="sensor kinase DpiB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44817"
FT                   /db_xref="GOA:C0PW54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW54"
FT                   /protein_id="ACN44817.1"
FT                   /translation="MSYQKNKKLFPFFRQLAFPLRIFLLILVVSVFIVAALAQYLSASF
FT                   EDYLASHVRDMAMNQAKIIASNDSIIAAVKNRDYKRLAIIANKLQRGTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKPGALERGESYFITGKGSIGMAMRAKTPIFDNKGNVIGVV
FT                   SIGYLVSKIDSWRLDFLLPMAGVFVLLLVVLMLLSWFFAAHIRRQMLGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPEGHITAINRNARKMLGLPSPGRQWLGKLIAEVVNPADFFTC
FT                   QIAERRQDVMANFNGLSVIANREAIRSGEELLGAIISFRSKDEIATLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVREMVQGESQAQQQLIDSLRGAFADRQVAGLL
FT                   FGKVQRARELGLKMVIVPGSKLHQLPEGLDSTEFAAIVGNLLDNAFEASLRTQEGDKTI
FT                   ELFLSDEGDEVVIEVADQGCGVPEALREKIFEQGVSTRTDEPGEHGIGLYLIASYVGRC
FT                   GGVITLEDNDPCGTLFSLFLPKVKKNDDRTINPIDR"
FT   gene            681065..681724
FT                   /gene="dpiA"
FT                   /locus_tag="SPC_0641"
FT   CDS_pept        681065..681724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpiA"
FT                   /locus_tag="SPC_0641"
FT                   /product="transcriptional regulatory protein DpiA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44818"
FT                   /db_xref="GOA:C0PW55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW55"
FT                   /protein_id="ACN44818.1"
FT                   /translation="MIVEDETLLAEMHAEYIRHIPGFNQIWLAGNLAQARMMIDRFKPG
FT                   LILLDNYLPDGKGITLLHELMQSRYPGGVVFTTAASDMETVAEAVRSGAFDYLVKPIAY
FT                   ERLGQTLTRYQQRRRMLASADSASQKQIDEMFNAYARGEPKGDLPTGIDALTLNAVMKL
FT                   FADPTVRHTAETVAQALTISRTTSRRYLEYCASRHLIVAEIIHGKVGRPQRIYHGG"
FT   gene            complement(681778..683163)
FT                   /gene="dcuC"
FT                   /locus_tag="SPC_0642"
FT   CDS_pept        complement(681778..683163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuC"
FT                   /locus_tag="SPC_0642"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44819"
FT                   /db_xref="GOA:C0PW56"
FT                   /db_xref="InterPro:IPR004669"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW56"
FT                   /protein_id="ACN44819.1"
FT                   /translation="MLTVIELLIGVVVIVGVARYIIKGYSATGVLFVGGLVLLIISALM
FT                   GHKVLPASETSTGYTATDIVEYIKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVK
FT                   LASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISSGAAA
FT                   AICASPAAIILSPTSGNVVLAAKAAEMPLIDFAFKTTLPISIAAIIGMAIAHFFWQRYL
FT                   DKKENISHEMLDVAEITTTAPAFYALLPFTPIIGVLIFDGKWGPQLHIITILVICMLLA
FT                   AVLEFVRGFNTQNVFSGLEVAYRGMADAFAGVVMLLVAAGVFAQGLSTIGFIQSLISIA
FT                   TSFGSASIILMLVLVILTMLAAMTTGSGNAPFYAFVEMIPKLAHSSGINPAYLSIPMLQ
FT                   ASNLGRTISPVSGVVVAVAGMAKISPFEVVKRTSVPVIVGLLIVIIATEIMVPGASSAV
FT                   TGG"
FT   gene            683531..684112
FT                   /gene="pagP"
FT                   /locus_tag="SPC_0643"
FT   CDS_pept        683531..684112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pagP"
FT                   /locus_tag="SPC_0643"
FT                   /product="antimicrobial peptide resistance and lipid A
FT                   acylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44820"
FT                   /db_xref="GOA:C0PW57"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW57"
FT                   /protein_id="ACN44820.1"
FT                   /translation="MNGMAVVMIIRKYFLIIALLVMPWLAIPSVSAADKGGFNTFTDNV
FT                   AETWRQPEHYDLYVPAITWHARFAYDKEKTDRYNERPWGVGFGQSRWDDKGNWHGLYMM
FT                   AFKDSFNKWEPIGGYGWEKTWRPLEDDNFRLGLGFTAGVTARDNWNYIPIPVLLPLASI
FT                   GYGPATFQMTYIPGSYNNGNVYFAWMRFQF"
FT   gene            684300..684509
FT                   /gene="cspE"
FT                   /locus_tag="SPC_0644"
FT   CDS_pept        684300..684509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="SPC_0644"
FT                   /product="cold shock protein E"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44821"
FT                   /db_xref="GOA:C0PW58"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW58"
FT                   /protein_id="ACN44821.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVTAL"
FT   gene            complement(684567..684950)
FT                   /gene="ccrB"
FT                   /locus_tag="SPC_0645"
FT   CDS_pept        complement(684567..684950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrB"
FT                   /locus_tag="SPC_0645"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44822"
FT                   /db_xref="GOA:C0PW59"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW59"
FT                   /protein_id="ACN44822.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGA
FT                   FIIGMGFAWFNRMTHIDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVL
FT                   INLLGSFAMTALAFWLFSAAAAR"
FT   gene            685041..685829
FT                   /gene="ybeM"
FT                   /locus_tag="SPC_0646"
FT   CDS_pept        685041..685829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="SPC_0646"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44823"
FT                   /db_xref="GOA:C0PW60"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW60"
FT                   /protein_id="ACN44823.1"
FT                   /translation="MFVAAGQFVVSSVWEKNAQVCVSLMAQAAGRGVSLLVLPEGILAR
FT                   NDIDLDLPIRAAQPLDGAFMTRLLEESAHNNMTTIFTILVPPTPGRAVNMLVALRAGHI
FT                   VARYAKLHLYDAFSMQESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQG
FT                   ADVLALPTGWVRGPLKEQQWSTLLAARALDTTCYMIAAGECGNRNIGQSRIIDPLGVTI
FT                   AAAADRPALIVAEIFRERIDQVREQLPLLQQRRFAPPQLL"
FT   gene            685958..686161
FT                   /gene="tatE"
FT                   /locus_tag="SPC_0647"
FT   CDS_pept        685958..686161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatE"
FT                   /locus_tag="SPC_0647"
FT                   /product="twin arginine translocase protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44824"
FT                   /db_xref="GOA:C0PW61"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="InterPro:IPR024905"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW61"
FT                   /protein_id="ACN44824.1"
FT                   /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGTAIKGFKKAMND
FT                   EDAGVKKDVDGSVQAEKLSHKE"
FT   gene            complement(686247..687212)
FT                   /gene="lipA"
FT                   /locus_tag="SPC_0648"
FT   CDS_pept        complement(686247..687212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="SPC_0648"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44825"
FT                   /db_xref="GOA:C0PW62"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW62"
FT                   /protein_id="ACN44825.1"
FT                   /translation="MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKL
FT                   PADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEI
FT                   KIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFK
FT                   EAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   EEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK"
FT   gene            complement(687253..687387)
FT                   /locus_tag="SPC_0649"
FT   CDS_pept        complement(687253..687387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44826"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW63"
FT                   /protein_id="ACN44826.1"
FT                   /translation="MGKQHKTTTILHFAGLSGCFMALINDILRVTNSKIVDKYNFPLN"
FT   gene            complement(687418..688371)
FT                   /gene="ybeF"
FT                   /locus_tag="SPC_0650"
FT   CDS_pept        complement(687418..688371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="SPC_0650"
FT                   /product="lysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44827"
FT                   /db_xref="GOA:C0PW64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW64"
FT                   /protein_id="ACN44827.1"
FT                   /translation="MSDNNQAERQPADQHLQDKPQIFRTLRNIDLNLLTIFEAVYVHKG
FT                   IVNAAKILNLTPSAISQSIQKLRTIFPDPLFIRKGQGVTPTTYATHLHEYISQGLESIL
FT                   GALDLTGSYDKQRTITIGTTPSVGALVMPIVYQAIRPRYPQLLLRNIPVDDAESQLSQF
FT                   QTDLIINTHSYNNRSIQHHVLFSDTLEIVCRQHHPCLANAITEERLNSADHTFLMLEGQ
FT                   HLSLLRQRLQETFPDQQISFSSYNIFTIASLIASSDLLGLMPTRFYDLFSRCWPLERLP
FT                   YAPVNSEQVEFSLHYNKLSLRDPVLENVIDIIREAF"
FT   gene            complement(688673..689314)
FT                   /gene="lipB"
FT                   /locus_tag="SPC_0651"
FT   CDS_pept        complement(688673..689314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="SPC_0651"
FT                   /product="lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44828"
FT                   /db_xref="GOA:C0PW65"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW65"
FT                   /protein_id="ACN44828.1"
FT                   /translation="MYQDKILVRQLGLQPYEAISQAMHNFTDMRDENSHDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVVQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRDLVTL
FT                   LEQTVVNTLAEIGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKITQWKEDATTDNIAPRLLANILALLNNPPYEYIAA"
FT   gene            complement(689414..689710)
FT                   /locus_tag="SPC_0652"
FT   CDS_pept        complement(689414..689710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44829"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW66"
FT                   /protein_id="ACN44829.1"
FT                   /translation="MLFFLRNAGADMKTKLNELLEFPTPFTYKVMGQALPELVDQVVEV
FT                   VQRHAPGDYSPTVKPSSKGNYHSVSITINATHIEQVETLYEELGNIDIVRMVL"
FT   gene            complement(689786..690997)
FT                   /gene="dacA"
FT                   /locus_tag="SPC_0653"
FT   CDS_pept        complement(689786..690997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="SPC_0653"
FT                   /product="D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44830"
FT                   /db_xref="GOA:C0PW67"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW67"
FT                   /protein_id="ACN44830.1"
FT                   /translation="MKTTFSARFMQRMALTTALCAAFISTAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADERRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYAVYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTSKAGYNLVASATEGQMRLISAVMGGRTYKGRETES
FT                   KKLLTWGFRFFETVNPLKAGKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNTAELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
FT   gene            complement(691137..692282)
FT                   /gene="rlpA"
FT                   /locus_tag="SPC_0654"
FT   CDS_pept        complement(691137..692282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="SPC_0654"
FT                   /product="rare lipoprotein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44831"
FT                   /db_xref="GOA:C0PW68"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW68"
FT                   /protein_id="ACN44831.1"
FT                   /translation="MRKQLPVICVAAGIVLLAACTNDGGQQQTTVAPQPAVCNGPTVEI
FT                   SGAEPRYEPLNPTANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFD
FT                   PMQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGTDRVISLSRAAADRLNTSNN
FT                   TKVRIDPIIVAPDGSLSGPGMACTTVAKQTYALPPRPDLSGGMGSASSAPAQPQGDVLP
FT                   VSNSTLKSDDTTGAPVSSSGFLGAPTTLAPGVLEGNEPTPAPQPAPVSAPVAAPATAPA
FT                   TATPVSAPAAAAPVSAPVSAPAAAASGRFVVQVGAVSDQTRAQQYQQRLSQQFSVPGRV
FT                   IQNGAVWRIQLGPFASKAEASALQQRLQTEAQLQSFIASAQ"
FT   gene            complement(692293..693405)
FT                   /gene="mrdB"
FT                   /locus_tag="SPC_0655"
FT   CDS_pept        complement(692293..693405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="SPC_0655"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44832"
FT                   /db_xref="GOA:C0PW69"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW69"
FT                   /protein_id="ACN44832.1"
FT                   /translation="MTDNPNKKTFWDKIHIDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVVMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTAIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAIVLIAAFIPILWFFLMHDYQRQRVMMLLDPETDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
FT   gene            complement(693408..695309)
FT                   /gene="pbpA"
FT                   /locus_tag="SPC_0656"
FT   CDS_pept        complement(693408..695309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="SPC_0656"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44833"
FT                   /db_xref="GOA:C0PW70"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW70"
FT                   /protein_id="ACN44833.1"
FT                   /translation="MKRQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIL
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLNDDDIAAFKKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLDRENKLANYAATHDIGKLGIERYYEDILHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVIVTDPRTG
FT                   GVLSLVSMPSYDPNLFVDGISSKDYSGLLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTSLFDPGWWQLPGSEKRYRDWKKWGHGHLNITKSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGVVKVPHLLMSTAENGKQVPWVQPHEPPVGDIHSGYWEIAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAIILENGGAGPAVGTIMRQILDHIMLGDNNTHLPAENPVVAAAEDQ"
FT   gene            complement(695340..695807)
FT                   /gene="ybeA"
FT                   /locus_tag="SPC_0657"
FT   CDS_pept        complement(695340..695807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="SPC_0657"
FT                   /product="ybeA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44834"
FT                   /db_xref="GOA:C0PW71"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW71"
FT                   /protein_id="ACN44834.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLANELERWKQDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
FT   gene            complement(695811..696128)
FT                   /gene="ybeB"
FT                   /locus_tag="SPC_0658"
FT   CDS_pept        complement(695811..696128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="SPC_0658"
FT                   /product="ybeB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44835"
FT                   /db_xref="GOA:C0PW72"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW72"
FT                   /protein_id="ACN44835.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQSSRAAGMLPLGVEGENAADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
FT   gene            complement(696457..697098)
FT                   /gene="cobC"
FT                   /locus_tag="SPC_0659"
FT   CDS_pept        complement(696457..697098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="SPC_0659"
FT                   /product="alpha-ribazole-5'-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44836"
FT                   /db_xref="GOA:C0PW73"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW73"
FT                   /protein_id="ACN44836.1"
FT                   /translation="MFCAFNLMRNTMRLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQ
FT                   AKTLHTLLRHAPFDLVLCSELERARHTARLVLEGRDTPQHILPELNEMYFGDWEMRHHR
FT                   DLTHEDAESYAAWCTDWQNAVPTNGEGFQAFTRRVERFISRLDAFSDCQNLLIVSHQGV
FT                   LSLLIARLLAMPATSLWHFRVEQGCWSAIDICEGFATLKVLNSRAVWRPE"
FT   gene            697162..698256
FT                   /locus_tag="SPC_0660"
FT   CDS_pept        697162..698256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0660"
FT                   /product="threonine-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44837"
FT                   /db_xref="GOA:C0PW74"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW74"
FT                   /protein_id="ACN44837.1"
FT                   /translation="MALFNSAHGGNIREAATVLGISPDQLLDFSANINPLGMPVSVKRA
FT                   LIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGEMESIFTVASGLKPRRAMIV
FT                   TPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLP
FT                   ERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPG
FT                   LRLGYLVNSDDAAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFY
FT                   QALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVAI
FT                   RSAAQNERLLAALRNVLTGIAPAD"
FT   gene            complement(698231..698881)
FT                   /gene="nadD"
FT                   /locus_tag="SPC_0661"
FT   CDS_pept        complement(698231..698881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="SPC_0661"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44838"
FT                   /db_xref="GOA:C0PW75"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW75"
FT                   /protein_id="ACN44838.1"
FT                   /translation="MGDMKSLQALFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNV
FT                   PPHRPQPEASSAQRKYMLELAIADKPLFTLDERELQRNAPSYTAQTLKAWREEQGPEAP
FT                   LAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEMTQAQHQQWLEQHLTHTPDD
FT                   LHQLPAGKIYLAETPWLNISSTLIRERLEKGESCDDLLPENVLNYINQQGLYR"
FT   gene            complement(698874..699896)
FT                   /gene="holA"
FT                   /locus_tag="SPC_0662"
FT   CDS_pept        complement(698874..699896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SPC_0662"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44839"
FT                   /db_xref="GOA:C0PW76"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW76"
FT                   /protein_id="ACN44839.1"
FT                   /translation="MYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAIRLAAASQGFE
FT                   EHHAFTLDPSTDWGSLFSLCQAMSLFASRQTLVLQLPENGPNAAMNEQLATLSELLHDD
FT                   LLLIVRGNKLTKAQENAAWYTALADRSVQVSCQTPEQAQLPRWVAARAKAQNLQLDDAA
FT                   NQLLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGK
FT                   SKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRP
FT                   MIGDALQRLHPAQLRQAVQLLTRTEITLKQDYGQSVWADLEGLSLLLCHKALADVFIDG
FT                   "
FT   gene            complement(699905..700495)
FT                   /gene="rlpB"
FT                   /locus_tag="SPC_0663"
FT   CDS_pept        complement(699905..700495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="SPC_0663"
FT                   /product="rare lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44840"
FT                   /db_xref="GOA:C0PW77"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW77"
FT                   /protein_id="ACN44840.1"
FT                   /translation="MRYLVTLLLSLAVLVTAGCGWHLRSTTQVPASMKTMILDSGDPNG
FT                   PLSRAVRNQLRLNNVNLLDKDTTRKDVPSLRLGTVTISQDTASVFQDGQTAEYQMVMTV
FT                   NASVLIPGHDIYPISTKVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLTSVR
FT                   AADIQATKEEATADNETAAPASTPARVSTTLSN"
FT   gene            complement(700510..703092)
FT                   /gene="leuS"
FT                   /locus_tag="SPC_0664"
FT   CDS_pept        complement(700510..703092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SPC_0664"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44841"
FT                   /db_xref="GOA:C0PW78"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0PW78"
FT                   /protein_id="ACN44841.1"
FT                   /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDN
FT                   IAYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQ
FT                   TVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLRDLDKLDHWPDTVKTMQRN
FT                   WIGRSEGVEITFDVKGYDNTLTVYTTRPDTFMGATYLAVAAGHPLAQKAAANNAELAAF
FT                   IDECRNTKVAEAEMATMEKKGVDTGYKAIHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
FT                   HDQRDYEFASKYGLTIKPVILAADGSEPDLSEQALTEKGVLFNSGEFDGLAFEAAFNAI
FT                   ADKLAEKGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVLPTPEDQLPVILPEDV
FT                   VMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYQEGMLDSKA
FT                   ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVTSDEPAKQLLCQGMVLADAFYY
FT                   VGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVE
FT                   RYGADTVRLFMMFASPADMTLEWQESGVEGANRFIKRVWKLVYEHTAKGPVAALNVDAL
FT                   SEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPQEGEQDRALLQEA
FT                   LQAVVRMLNPFTPHVCFTLWQELGGEGDIDNAPWPVADEQAMVENTTLVVVQVNGKVRG
FT                   KITVAVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG"
FT   gene            complement(703219..703335)
FT                   /locus_tag="SPC_0665"
FT   CDS_pept        complement(703219..703335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44842"
FT                   /db_xref="GOA:C0PW79"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW79"
FT                   /protein_id="ACN44842.1"
FT                   /translation="MPFFNYMVYMTLFLQANLAVTGTAVICLSRVAFCVTSS"
FT   gene            703380..703670
FT                   /locus_tag="SPC_0666"
FT   CDS_pept        703380..703670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0666"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44843"
FT                   /db_xref="GOA:C0PW80"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW80"
FT                   /protein_id="ACN44843.1"
FT                   /translation="MKKNAVVIHPQDCVATAITALKAGETATMFIGEREISVVLHQDVP
FT                   FGHKFAICDVPFHGEVYKYGESIGRATQEIKSGDYVHVHNVESERGRGDWK"
FT   gene            703654..704859
FT                   /locus_tag="SPC_0667"
FT   CDS_pept        703654..704859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0667"
FT                   /product="putative hydrolase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44844"
FT                   /db_xref="GOA:C0PW81"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW81"
FT                   /protein_id="ACN44844.1"
FT                   /translation="MVTGNNIKQGKMIMSNETFLGFRRPDGRFGIRNYVLILPTSVCAN
FT                   KVAQDIARQVKGATWVNNDFGCCQVAGDARLTEKTLINVANNPNVGAIVVVGLGCEGAE
FT                   PLRIAEEITAFGKPTSCITIQEEGGTLKCQARGISLARDYAQQLSMQKPQQAPVSELLL
FT                   AMECGGSDTTSGLASNPSCGVASDKLIRCGGSSILSETTEFIGAEHVMAKRAVTPEVGQ
FT                   QLIDLVVGCEARAKALGEDIRGGQPTPGNIKGGLTTIEEKSLGCMHKAGHAPLQGVLEY
FT                   ADRPTHPGLWIMDTPGQDIESISGMVAGGAQIVIFTTGRGTPAGNPIAPVIKITGNKAT
FT                   WEMMQDNIDIDVSAIMSGEASITQMGEEIYQEILRVANGKTTKSEDLGHNEFSIYKIAP
FT                   TF"
FT   gene            704909..705862
FT                   /locus_tag="SPC_0668"
FT   CDS_pept        704909..705862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0668"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44845"
FT                   /db_xref="GOA:C0PW82"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW82"
FT                   /protein_id="ACN44845.1"
FT                   /translation="MKIKKTLERFPGGMMVVPLIIGALFKTFAPEALEIGGFVTSISHG
FT                   AMAILGMFLVCMGADIQFKAAPKALKKGAAITFAKFASGVIIGILVGKFCGPDGLLGLS
FT                   ALAIISAMTNSNSGLYAALVGEYGDETDGGAIAVISLNDGPFFTMLALGSAGMVSIPFM
FT                   NLVAVIIPIIIGMILGNLDEDMRKFLKQGSVVTIPFFAFGLGYGIDFARLITAGSSGIL
FT                   LGLMTVAIGGFFNIFADRLTGGSGVAGAAVSTTSGNAVATPAAIALLDPHFTDLASTAA
FT                   AQVAASTIITALCAPFLTVWIKKRYDRKLNPAAAGG"
FT   gene            705927..707858
FT                   /locus_tag="SPC_0669"
FT   CDS_pept        705927..707858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0669"
FT                   /product="putative sigma-54 dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44846"
FT                   /db_xref="GOA:C0PW83"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW83"
FT                   /protein_id="ACN44846.1"
FT                   /translation="MMNKTKDIAASPLCFVSPYPQLAKAAEALVAQLDYAVTIHQTTLN
FT                   RILDELPLLESRGHQVLISRGGCAEILKKHSKLPVVEIKMSGYDILDALIPFKGQKGTV
FT                   GIVGFSSVIKGCARVAEQLNINYKIFTLQGNDKETISCLKQQLASTPLDCIVGDTVCQD
FT                   YFSPLGSQFRLLDSSPASITEALEEARSLYLAFRSQLLERHHLQLILDQFDKAVITLDD
FT                   TGALLHYNKYASQLFKVNASGEIYDASFLKQVLLQERHTLREGKTVSAKVVDTPQGAMV
FT                   VNLYPVFAARQLSRVVLTMQTVSSLQGAEHHVRRQELSRRGLSARYHFDDLLTENPEML
FT                   RRLAIIKNYAGTDATILINGESGTGKEVLAQSIHNASQRVNGPFVAINCGAMAPQILES
FT                   ELFGYVAGAFTGASPKGKIGLFELAHHGTIFLDEISELDKPLQTRLLWVLQERQIMRLG
FT                   SDQMIPVDIRVIAATNQTLTKLIADGTFREDLYYRLNVLKVTTIPLRKRPEDIKAIGLS
FT                   LLTSFSQHYKRPALTLTPALWQELQRFAWPGNVRQLSNIIERLVLSIDHSPATLDEGRL
FT                   LLDDLEEGSRREPNTCHDCQMLAGDYKTIRLRILRKLLEAERDNKSLVAKRLNVDRTSL
FT                   TRWIRESA"
FT   gene            707948..708424
FT                   /gene="ybeL"
FT                   /locus_tag="SPC_0670"
FT   CDS_pept        707948..708424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="SPC_0670"
FT                   /product="ybeL"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44847"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW84"
FT                   /protein_id="ACN44847.1"
FT                   /translation="MMNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELT
FT                   RTEVDELTRAVRRDLEEFAMSYEESQDDSVFLRVIKESLWQELADITDKTQLEWREVFQ
FT                   DLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLPLCPKCGHDQFQRRPFEP"
FT   gene            complement(708463..709458)
FT                   /gene="ybeQ"
FT                   /locus_tag="SPC_0671"
FT   CDS_pept        complement(708463..709458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="SPC_0671"
FT                   /product="putative TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44848"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW85"
FT                   /protein_id="ACN44848.1"
FT                   /translation="MNHSITSHPCDNVSLAQLTELAQSGNSEAQYILGRLYNDERIDGS
FT                   EEDKLSFYWLQQAAEQGHCEAQYWLGLRYKDTPTDMKDNTLALFWSEKAAQQGHRHAFN
FT                   TLGWVQEGETGMAPDYAQAVAWYRKGAEQSHNLAQYNLGRMYRSGTGVEQNDTQALYWF
FT                   KQAALQGHCASQERLAYMYGNGKGCRKNLSLAALWYKKSALQESSYSQYQMGYCYYIGE
FT                   GIKQDYQQAIYWFRKAADQGDDGAYNSIGWMYKCGHGVEQNYSLALEWFHKSAECNNSS
FT                   GWYNLGCMYRDGHGTAQDLQQALYWFKKAQPTGKWNVDEEIRKLEAQLHA"
FT   gene            709559..710290
FT                   /gene="ybeR"
FT                   /locus_tag="SPC_0672"
FT   CDS_pept        709559..710290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="SPC_0672"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44849"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW86"
FT                   /protein_id="ACN44849.1"
FT                   /translation="MNIFWRFIMDKESQYLLFALSSPMEVLNEDCLPSHSSPKMYLGVK
FT                   RFDLESSWGIENRDELLQTISRMTDDGHATQLEWLYRRWFRYASQEWQEYTDALDEGDR
FT                   IYARFVPDTAVCCGEGGIRSWDYVRMGFLCRMGVLNEWLTEEESLWLQSRIQLRALSYY
FT                   SGWLQYFSAYYTGRLYWQLRNGDNLPLLRETFARKEFDDEGRRMMNKLIAGKDSFYATL
FT                   PWRYLPHYPECPDTLQEVSDL"
FT   gene            710287..711722
FT                   /pseudo
FT                   /gene="ybeS"
FT                   /locus_tag="SPC_0673"
FT                   /note="frameshift compared to STM0656 in Salmonella
FT                   typhimurium LT2"
FT   gene            711734..712429
FT                   /gene="ybeU"
FT                   /locus_tag="SPC_0674"
FT   CDS_pept        711734..712429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="SPC_0674"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44850"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW87"
FT                   /protein_id="ACN44850.1"
FT                   /translation="MDKEEQYLLFALSTPMEVLYIGNEPSHTSPAMYTGIPAVDLSDSW
FT                   GIDNREDLIQTIYRMTDDGHAADLAPFYIRWFTLSTRQWREFTAQFGEQGQIYARFVAE
FT                   TALCCGRGGIKAWDYVRMGFLCRMGVLNQWLTEEESLWLQSRIYARAYYFYDGWTQYFA
FT                   AYSLGRLYWQAKGDTIQAYFAHLKYDASGARMFNELASTTESYYAQLPWRPLNEQPTCP
FT                   ETLKGVSDL"
FT   gene            712426..713889
FT                   /pseudo
FT                   /gene="ybeV"
FT                   /locus_tag="SPC_0675"
FT                   /note="stop compared to STM0658 in Salmonella typhimurium
FT                   LT2"
FT   gene            complement(713911..715590)
FT                   /locus_tag="SPC_0676"
FT   CDS_pept        complement(713911..715590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_0676"
FT                   /product="putative heatshock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACN44851"
FT                   /db_xref="GOA:C0PW88"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR042030"
FT                   /db_xref="UniProtKB/TrEMBL:C0PW88"
FT                   /protein_id="ACN44851.1"
FT                   /translation="MDNATLAIGIDLGTTNSLIAVWQDGAAQLIPNKFGEYLTPSIISM
FT                   DENKKILVGKPAAARKTSHPDKTSALFKRAMGSNTHWHLGEESFNAPELSSLVLRSLKE
FT                   DAEDYLQQPIKDVVISVPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ
FT                   QNSRSLVFDLGGGTFDVTVLEYATPIIEVHASAGDNYLGGEDFTHLLLDEVLKRWNLDK
FT                   SALTDSDLAALYACVEAAKCASGSPLRMSWLYQERALESTFYDDELEALWLPLLNRLRT
FT                   PIEQALRDSRLKPEQIDSLVLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAT
FT                   QAACRLRHEDVEEVILTDICPYSLGVEVNRQGVPGIFSPIIERNTTVPVSKVETYSTMH
FT                   PEQDSICVRVYQGESHKVKNNILIDSFDVMLKPNGHIQAIDIRFSYDINGLLEVDVLLE
FT                   DGKSESRIISHNATSLTTQQIDASRERLQALKIYPRDMLINRTFKAQLEEQWSRALGDE
FT                   REMLGEIITDFDAALLSNDMQRVDDVRRRACEYLGIDEPKAP"
FT   gene            complement(715666..716904)
FT                   /locus_tag="SPC_0677"
FT