(data stored in SCRATCH zone)

EMBL: CP000858

ID   CP000858; SV 1; circular; genomic DNA; STD; PRO; 55414 BP.
XX
AC   CP000858;
XX
PR   Project:PRJNA20993;
XX
DT   04-MAR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
DE   plasmid pSPCV, complete sequence.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
OG   Plasmid pSPCV
XX
RN   [1]
RP   1-55414
RX   DOI; 10.1371/journal.pone.0004510.
RX   PUBMED; 19229335.
RA   Liu W.Q., Feng Y., Wang Y., Zou Q.H., Chen F., Guo J.T., Peng Y.H., Jin Y.,
RA   Li Y.G., Hu S.N., Johnston R.N., Liu G.R., Liu S.L.;
RT   "Salmonella paratyphi C: genetic divergence from Salmonella choleraesuis
RT   and pathogenic convergence with Salmonella typhi";
RL   PLoS One 4(2):E4510-E4510(2009).
XX
RN   [2]
RP   1-55414
RA   Liu G.-R., Feng Y., Liu W.-Q., Liu S.-L., Zou Q.-H., Guo J.-T., Chen F.,
RA   Huang H., Tang J., Wang C.-Z., Zhang Y.-N., Wang Y., He X.-Y., Wang L.,
RA   Peng Y.-H., Li J.-Q., Xu G.-M., Hu S.-N., Li Z.-J., Sanderson K.E.,
RA   Johnston R.N.;
RT   ;
RL   Submitted (12-OCT-2007) to the INSDC.
RL   Microbiology, Peking University Health Science Center, 38 Xueyuan Road,
RL   Beijing, Beijing 100083, China
XX
DR   MD5; 281dbe1b72a0a6881c0ff086766f7c03.
DR   BioSample; SAMN02603245.
DR   EnsemblGenomes-Gn; EBG00001086484.
DR   EnsemblGenomes-Tr; EBT00001688772.
DR   EuropePMC; PMC2640428; 19229335.
DR   EuropePMC; PMC3133335; 21602358.
DR   RFAM; RF00042; CopA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..55414
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Paratyphi C str. RKS4594"
FT                   /plasmid="pSPCV"
FT                   /sub_species="enterica"
FT                   /strain="RKS4594"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Paratyphi C"
FT                   /db_xref="taxon:476213"
FT   gene            1..894
FT                   /gene="spvR"
FT                   /locus_tag="SPC_p001"
FT   CDS_pept        1..894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spvR"
FT                   /locus_tag="SPC_p001"
FT                   /product="SpvR"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p001"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48774"
FT                   /db_xref="GOA:C0Q8G8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8G8"
FT                   /protein_id="ACN48774.1"
FT                   /translation="MDFLINKKLKIFITLMETGSFSIATSVLYITRTPLSRVISDLERE
FT                   LKQRLFIRKNGTLIPTEFAQTIYRKVKSHYIFLHALEQEIGPTGKTKQLEIIFDEIYPE
FT                   SLKNLIISALTISGQKTNIMGRAVNSQIIEELCQTNNCIVISARNYFHRESLVCRTSVE
FT                   GGVMLFIPKKFFLCGKPDINRLAGTPVLFHEGAKNFNLDTIYHFFEQTLGITNPAFSFD
FT                   NVDLFSSLYRLQQGLAMLLIPVRVCRALGLSTDHALHIKGVALCTSLYYPTKKRETPDY
FT                   RKAIKLIQQELKQSTF"
FT   gene            1406..2173
FT                   /gene="spvA"
FT                   /locus_tag="SPC_p002"
FT   CDS_pept        1406..2173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spvA"
FT                   /locus_tag="SPC_p002"
FT                   /product="SpvA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p002"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48775"
FT                   /db_xref="InterPro:IPR003518"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8G9"
FT                   /protein_id="ACN48775.1"
FT                   /translation="MNMNQTTSPALSQVETAIRVPAGNFAKYNYYSVFDIVRQTRKQFI
FT                   NANMSWPGSRGGKAWDLAMGQAQYIRCMFRENQLTRRVRGTLQQTPDNGTNLSSSAVGG
FT                   IQGQAERRPDLATLMVVNDAINQQIPTLLPYHFPHDQVELSLLNTDVSLEDIISESSID
FT                   WPWFLSNSLTGDNSNYAMELASRLSPEQQTLPTEPDNSTATDLTSFYQTNLGLKTADYT
FT                   PFEALNTFARQLAITVPPGGTVDCGYSACQPAV"
FT   gene            2355..4130
FT                   /gene="spvB"
FT                   /locus_tag="SPC_p003"
FT   CDS_pept        2355..4130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spvB"
FT                   /locus_tag="SPC_p003"
FT                   /product="SpvB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p003"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48776"
FT                   /db_xref="GOA:C0Q8H0"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H0"
FT                   /protein_id="ACN48776.1"
FT                   /translation="MLILNGFSSATLALITPPFLPKGGKALSQSGPDGLASITLPLPIS
FT                   AERGFAPALALHYSSGGGNGPFGVGWSCATMSIARRTSHGVPQYNDSDEFLGPDGEVLV
FT                   QTLSTGDAPNPVTCFAYGDVSFPQSYTVTRYQPRTESSFYRLEYWVGNSNGDDFWLLHD
FT                   SNGILHLLGKTAAARLSDPQAASHTAQWLVEESVTPAGEHIYYSYLAENGDNVDLNGNE
FT                   AGRDRSAMRYLSKVQYGNATPAADLYLWTSATPAVQWLFTLVFDYGERGVDPQVPPAFT
FT                   AQNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHFPDELGEADTLVSRLLLEYDENPI
FT                   LTQLCAARTLAYEGDGYRRAPVNNMMPPPAPPPMMGGNSSRPKSKWAIVEESKQIQALR
FT                   YYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEFKNAMSVYINDIAEGL
FT                   SSLPETDHRVVYRGLKLDKPALSDVLKEYTTIGNIIIDKAFMSTSPDKAWINDTILNIY
FT                   LEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVNCGSQDFASQLSKLRLSDDATAD
FT                   TNRIKRIINMRVLNS"
FT   gene            4411..5130
FT                   /gene="spvC"
FT                   /locus_tag="SPC_p004"
FT   CDS_pept        4411..5130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spvC"
FT                   /locus_tag="SPC_p004"
FT                   /product="SpvC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p004"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48777"
FT                   /db_xref="InterPro:IPR003519"
FT                   /db_xref="InterPro:IPR038498"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H1"
FT                   /protein_id="ACN48777.1"
FT                   /translation="MPINRPNLNIPPLNIVAAYDGAEIPSTNKHLKNNFNSLHNQMRKM
FT                   PVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAGDKFH
FT                   ISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVSLGAQFTLYIKPDQEN
FT                   SQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGE
FT                   MQRQALREEPFYRLMTE"
FT   gene            5391..6041
FT                   /gene="spvD"
FT                   /locus_tag="SPC_p005"
FT   CDS_pept        5391..6041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spvD"
FT                   /locus_tag="SPC_p005"
FT                   /product="SpvD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p005"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48778"
FT                   /db_xref="GOA:C0Q8H2"
FT                   /db_xref="InterPro:IPR008834"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H2"
FT                   /protein_id="ACN48778.1"
FT                   /translation="MRVSGSASSQDIISRINSKNINNNDSNEVKRIKDALCIESKERIL
FT                   YPQNLSRDNLKQMARYVNNTYVHYSGNCVLLSACLHYNIHHRQDILSSKNTASPTVGLD
FT                   SAIVDKIIFGHELNQSYCLNSIDEVEKEILNRYDIKRESSFIISAENYIVPIIGECRHD
FT                   FNAVVICEYDKKPYVQFIDSWKTSNILPSLQEIKKHFSSSGEFYVRAYDEKHD"
FT   gene            complement(6168..6593)
FT                   /locus_tag="SPC_p006"
FT   CDS_pept        complement(6168..6593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p006"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p006"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48779"
FT                   /db_xref="GOA:C0Q8H3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H3"
FT                   /protein_id="ACN48779.1"
FT                   /translation="MSNHHESLEGFLRKRHSVSKLVVHLIFTTKYRCKLFDGQIIAQLR
FT                   DAFGSAAAKLECEIIEMDGEQDHVHLLIAYPLKLGVSVMVNNLKSVSSRLLRQQNTHLR
FT                   MQSKTGLLWSRSYFACSAGGATIETLKAYVLRQNTPE"
FT   gene            6650..7000
FT                   /gene="orfE"
FT                   /locus_tag="SPC_p007"
FT   CDS_pept        6650..7000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfE"
FT                   /locus_tag="SPC_p007"
FT                   /product="hypothetical protein"
FT                   /note="OrfE"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p007"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48780"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H4"
FT                   /protein_id="ACN48780.1"
FT                   /translation="MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRHG
FT                   VSLTPRKDIKPLLAVAKKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKARF
FT                   PMFKRKHGKLLG"
FT   gene            complement(7126..7482)
FT                   /locus_tag="SPC_p008"
FT   CDS_pept        complement(7126..7482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p008"
FT                   /product="putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p008"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48781"
FT                   /db_xref="GOA:C0Q8H5"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H5"
FT                   /protein_id="ACN48781.1"
FT                   /translation="MEDYEERPASGWDLRAEGYLPSYPQLGAKMVYEQYYGNEVGLFGK
FT                   DERQKNPHALTAGVSWTPVPLLKLSAEQRAGKAGEHDTRFGAEASYRIGDSLRSQLDPD
FT                   AVGPCAAWRAAATT"
FT   gene            complement(7506..8093)
FT                   /locus_tag="SPC_p009"
FT   CDS_pept        complement(7506..8093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p009"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48782"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H6"
FT                   /protein_id="ACN48782.1"
FT                   /translation="MQATTPLVLTLTPAMTARADIASRIGQSPFSADRDAALAGIRTVP
FT                   YTLKKGETVAQAHGLTVPQLKKLNGLRTFARGFDHLQAGDELDVPAVPLTGGKGDNNRH
FT                   DARGPFAADRENEDAQAQQMVGMASQAGSFLASHPDGQAAAGMVTVTSGRLTCSGRTSS
FT                   STMTSPATTPAPASAENTGATSLSFPPTPMSA"
FT   gene            complement(8346..8831)
FT                   /locus_tag="SPC_p010"
FT   CDS_pept        complement(8346..8831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p010"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p010"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48783"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H7"
FT                   /protein_id="ACN48783.1"
FT                   /translation="MLIIVSDCQFTRLALTRLLAHLDPVNMSVARWLQTAPPAGSHVLL
FT                   AASPGMLASLVPACHHARTSLSLKLALLGSGGQAVFLNTLGLRPDCLLPRTASATQLKA
FT                   AVSSWLRRARGWRQATTESLSLRERQALCATLAGLSARTAPGSASAPKPFTAIAAAR"
FT   gene            complement(8825..9313)
FT                   /locus_tag="SPC_p011"
FT   CDS_pept        complement(8825..9313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p011"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48784"
FT                   /db_xref="GOA:C0Q8H8"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H8"
FT                   /protein_id="ACN48784.1"
FT                   /translation="MNQPLLFRTVAGRQSNHEGFYMPPGIRHLGTLSLYRAVAWWGLFL
FT                   GREFTRDDVSEAFSIEPRRASGILNYICNRHNDDDICFDSRLHPVRGGRAQLVVRIRAV
FT                   ESRPDTIRRQRTDRPGGKVSDRQYDRQMAHWLLSRPAGGDTAKLAAWQAACPVREASC"
FT   gene            complement(9500..10051)
FT                   /locus_tag="SPC_p012"
FT   CDS_pept        complement(9500..10051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p012"
FT                   /product="putative diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p012"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48785"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8H9"
FT                   /protein_id="ACN48785.1"
FT                   /translation="MHFSAFRLQQAIRNREFTPFYQPIVCATGGEVVGCEMLARWLHPQ
FT                   KGLLSAGNFIPAIEATGLGGALLRGLADEVCGDGQDLARSAGRRLMMTLNLSLSLVMTP
FT                   LFRPHLLALSIRLEQAGMTPVFEITEREDIRAFPQAAVFRQLAAGGLRFAVDDFGTGHA
FT                   GPASTVADRMIARTVSLARC"
FT   gene            complement(10060..10842)
FT                   /gene="rsdB"
FT                   /locus_tag="SPC_p013"
FT   CDS_pept        complement(10060..10842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsdB"
FT                   /locus_tag="SPC_p013"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p013"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48786"
FT                   /db_xref="GOA:C0Q8I0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I0"
FT                   /protein_id="ACN48786.1"
FT                   /translation="MSQPPLPAVCTQAASALLPVAIDYPAALALRQMAMQHDDYPKYLL
FT                   APEVSALLHYVPDLHRRMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQRA
FT                   EKAARTAGRMPSGSQPHRLVPLSDNQYVSELQMMVATLKIPLERRNRRTGRTEKARLWE
FT                   ITDRTVRTWIGEAVEAAAADDVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQALMGHKS
FT                   VSSTEVYTKVFALDVAARHRVQFQMPGADAVAMLKGGS"
FT   gene            complement(10855..11397)
FT                   /locus_tag="SPC_p014"
FT   CDS_pept        complement(10855..11397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p014"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p014"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48787"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I1"
FT                   /protein_id="ACN48787.1"
FT                   /translation="MTRSRICPDTESTGLSPASDALPVRETTEQFAQVFFGKSVSLLTP
FT                   EERFTTVYAGSRDIPADLHPASWFPADTWFRNELRACAAYVGRRQGWPLYHASEAERLR
FT                   ALYPLRLATPATDPGKQLLTRTALLKAGYSRATIAAMTPVAERQNRHSGDWYPLYRVQT
FT                   ETRDDSGKKHDVPEYFT"
FT   gene            complement(11394..11564)
FT                   /locus_tag="SPC_p015"
FT   CDS_pept        complement(11394..11564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p015"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p015"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48788"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I2"
FT                   /protein_id="ACN48788.1"
FT                   /translation="MLETPGERGDTPLCHVDFAVVQKWLVCEETWTQTLGGTEFGGTVW
FT                   RLRTDRENTTS"
FT   gene            complement(11686..11991)
FT                   /gene="ccdB"
FT                   /locus_tag="SPC_p016"
FT   CDS_pept        complement(11686..11991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="SPC_p016"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p016"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48789"
FT                   /db_xref="GOA:C0Q8I3"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I3"
FT                   /protein_id="ACN48789.1"
FT                   /translation="MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEK
FT                   VPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEVADLSLRENDIKNAINLMFRGI"
FT   gene            complement(11993..12211)
FT                   /gene="ccdA"
FT                   /locus_tag="SPC_p017"
FT   CDS_pept        complement(11993..12211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="SPC_p017"
FT                   /product="antidote"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p017"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48790"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I4"
FT                   /protein_id="ACN48790.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQ
FT                   EENREGMAEVASFIEANGSFADDNRNW"
FT   gene            12919..13407
FT                   /locus_tag="SPC_p018"
FT   CDS_pept        12919..13407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p018"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48791"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I5"
FT                   /protein_id="ACN48791.1"
FT                   /translation="MNTALLVPFISTALSGVGVYTRYYFKKYQASRDLCQKVHRMMVNT
FT                   LTDTARLFSRSAPAQALKSELRIMQQKLSQETQKLDKMTTRLPLKRLQREQRHILGHAK
FT                   WLLGYLDSHLADNEGKFFLFLHDLATDSDDKVLDFLTSLHDTKRFRNRRLQTGSTTCP"
FT   gene            complement(13541..13771)
FT                   /locus_tag="SPC_p019"
FT   CDS_pept        complement(13541..13771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p019"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48792"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I6"
FT                   /protein_id="ACN48792.1"
FT                   /translation="MNMTNMPAEPLIFQSGTQSAGLELVNIYFWIFRQFMEEKELTKPL
FT                   ARLVYTNLKTARTDSVSLQSVGKRFEASFEN"
FT   gene            13891..14079
FT                   /locus_tag="SPC_p020"
FT   CDS_pept        13891..14079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p020"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p020"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48793"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I7"
FT                   /protein_id="ACN48793.1"
FT                   /translation="MDAEFQKQGLTGLTETDLQAVVTPGETLRLLPALARLLHVLRENQ
FT                   RPSPSQQLHTKKILPQL"
FT   gene            14680..15669
FT                   /gene="repA"
FT                   /gene_synonym="repC"
FT                   /locus_tag="SPC_p021"
FT   CDS_pept        14680..15669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /gene_synonym="repC"
FT                   /locus_tag="SPC_p021"
FT                   /product="RepA/RepC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p021"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48794"
FT                   /db_xref="GOA:C0Q8I8"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I8"
FT                   /protein_id="ACN48794.1"
FT                   /translation="MFEEVDKSSGEIVNLTPNASNTVQPVALMRLGVFVPTLKSLKNRK
FT                   KNTLSRTDASEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGVIHSFARHKVIGDK
FT                   VELPFVEFAKLCGIPSSQSSRKLRERISPSLKRIAGTVISFSRTTEKHTKEYITHLVQS
FT                   AYYDTEKDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
FT                   PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPKL
FT                   KPPHDESVENPQLPATPGDVSPEMAEKLALLDKLGITLDDLEKLFKSR"
FT   gene            complement(15787..15948)
FT                   /locus_tag="SPC_p022"
FT   CDS_pept        complement(15787..15948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p022"
FT                   /product="probable site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p022"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48795"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8I9"
FT                   /protein_id="ACN48795.1"
FT                   /translation="MRALSEKTQARRECPPKDEVRLVPLTDISYVRQIESWVITPVPAA
FT                   QILRILPS"
FT   gene            complement(16001..16387)
FT                   /locus_tag="SPC_p023"
FT   CDS_pept        complement(16001..16387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p023"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48796"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J0"
FT                   /protein_id="ACN48796.1"
FT                   /translation="MKKTLITLIITTLSFSSLARQTDIVSSVEQPGYVQGGFTGPAPTQ
FT                   TSVSQAKKQWDDAWVVLEGNIIRQVGHELYEFRDSSGTVYVDIDNKYWMGQTASPADKV
FT                   HIEGEVDRDWDGIKIDVKNIRVMK"
FT   gene            complement(16754..17065)
FT                   /locus_tag="SPC_p024"
FT   CDS_pept        complement(16754..17065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p024"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48797"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J1"
FT                   /protein_id="ACN48797.1"
FT                   /translation="MTENFQRKQTLCRELYTDVCFEKDHFCNPFYHTNKTNKNTPPKNQ
FT                   KKVGQESICHTKFSIKDRHNTKNQNICNANLFAHEKTYIKKEKININFQKYKNQPHQD"
FT   gene            17094..17396
FT                   /gene="pefB"
FT                   /locus_tag="SPC_p025"
FT   CDS_pept        17094..17396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pefB"
FT                   /locus_tag="SPC_p025"
FT                   /product="PefB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p025"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48798"
FT                   /db_xref="GOA:C0Q8J2"
FT                   /db_xref="InterPro:IPR004356"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J2"
FT                   /protein_id="ACN48798.1"
FT                   /translation="MMLNRKDADYYLGKEIMLARIRRGALIPAKVNEEHFWLLIGISSI
FT                   HSEKIIQALRDYLVFGVSRKDVCERYEVNNGYFSTSLNRLSRISQAAAQMVVYYS"
FT   gene            17671..18189
FT                   /gene="pefA"
FT                   /locus_tag="SPC_p026"
FT   CDS_pept        17671..18189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pefA"
FT                   /locus_tag="SPC_p026"
FT                   /product="PefA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p026"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48799"
FT                   /db_xref="GOA:C0Q8J3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J3"
FT                   /protein_id="ACN48799.1"
FT                   /translation="MKKSIIASIIALGVLGGTAHAANEVTFLGSVSATTCDLTTSVNGA
FT                   AQPNQVVQLGTVQANQTGNAVEFAMKPADPTAQACGNLAQKTATITWASAALDGEGFGA
FT                   TSGTAADAKVLVDSVNSKAPGAVNANASSVDFDGANLTTDGLKFTAKLKGGQTEGDFKS
FT                   VASFAVTYK"
FT   gene            18416..20824
FT                   /gene="pefC"
FT                   /locus_tag="SPC_p027"
FT   CDS_pept        18416..20824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pefC"
FT                   /locus_tag="SPC_p027"
FT                   /product="PefC"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p027"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48800"
FT                   /db_xref="GOA:C0Q8J4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J4"
FT                   /protein_id="ACN48800.1"
FT                   /translation="MSFHHRVFKLSALSLALFSHLSFASTDSELNLDFLQGMGAIPSVL
FT                   KSGSDFPAGQYYVDVIINQENVGKARLSITPQEESANALCLSPEWLKAAGVPVRLEGYA
FT                   STLNAAGQCYVLSRNPYTRVDFSYGSQSLVFSIPQSFLVGKTDPSRWDYGVPAARLKYS
FT                   ANASQTSGQSTSAYANADLMVNLGRWVLASNMSASRYADGSGEFTARDITLSTAISQVQ
FT                   GDLLLGKSQTRSALFSDFGFYGAALRSNSNMLPWEARGYAPLITGVANSTSRVTISQNG
FT                   YTVYSKVVPPGPYQLDDVRSVGNGDLVVTVEDASGHKTTTVYPVTTLPTLLRPGEIEYN
FT                   VAAGRKSSNYQLKKPFRDGESGTFWMGSVGYGFDSTTLNAASILHGKYQAGGVSVTQAL
FT                   GGFGAVSAGMNLSQAKYDNGDNKRGHSVSAKYAKSFSDSSDLQLLAYRYQSKGYVEFAD
FT                   FYSTDRYTRYNTKSRYEMRFSQRLGNSNLNLAGWQEDYWWMKGKATGGDVSLSTTILDG
FT                   VSVFLNGSYSKRPYLDKPDYSTSLSFSIPFTLGGVRHYSSTGLSYSSSGRMGMNRGVSA
FT                   SPTDRLSYGLNTNLSDKGDRSLSGNLSYGFDAIQTNMMLSQGRDNTTVSGSVSGTILGT
FT                   ADSGLMMTKETGNTLGVARIPGVKGVRINGSAPTNSKGYSVVNLSDYSLNRVSVDMENV
FT                   PDDLELQTTSFNVVPTEKAVVYREFGAEHVLRYILRVKERDGRILNGGSAQTEQGLDAG
FT                   FIAGNGVLLMNMLSAPSRVSVERGDGSVCHFSVKGIVPNTGKVQEVYCE"
FT   gene            20817..21509
FT                   /gene="pefD"
FT                   /locus_tag="SPC_p028"
FT   CDS_pept        20817..21509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pefD"
FT                   /locus_tag="SPC_p028"
FT                   /product="PefD"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p028"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48801"
FT                   /db_xref="GOA:C0Q8J5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J5"
FT                   /protein_id="ACN48801.1"
FT                   /translation="MNKMMKWGLVSLLSLAVSGQAMAAFVLNGTRFIYEEGRKNTSFEV
FT                   TNQADETFGGQVWIDNTTQGSSTVYMVPAPPFFKVRPKEKQIIRIMKTDSALPSDRESL
FT                   FWLNVQEIPPKPKASEGNVLAVAVNTKVKLIYRPKALVEGRRNAEKNLQITHRGGEAYL
FT                   KNPTPYYFAVTGVKLNGQPVRLNDRVMNEIAQLAPKSEVALGKLSLNGTVTVQAVNDWG
FT                   GTQDYTLK"
FT   gene            21506..22084
FT                   /locus_tag="SPC_p029"
FT   CDS_pept        21506..22084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p029"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p029"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48802"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J6"
FT                   /protein_id="ACN48802.1"
FT                   /translation="MSREGRIMKQKEYRTVRITRHMRAGMLAAGLLLPLVAGAATSGGM
FT                   LIPFEINNPQQTCDLTFDNGSTMMTYQLGTMSRGNRIQHRPFTVTVDCRGSTAVKTALT
FT                   ARSTTGTLQGGGDSVMMRVNGQASTNGPLFWLENGGQRVKLTGAKSDAFCISPTAPNRC
FT                   ELRPVTDIPTNSPEGNIDATVVFDVVYPQ"
FT   gene            22129..23121
FT                   /locus_tag="SPC_p030"
FT   CDS_pept        22129..23121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p030"
FT                   /product="hypothetical protein"
FT                   /note="Orf6e"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p030"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48803"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J7"
FT                   /protein_id="ACN48803.1"
FT                   /translation="MRMNRVDNNGQNCTGMIMKPISYFTGSRKRSSTCLISSLLLPGMI
FT                   AMGISLPGTAAMVEFGGDYTYRGTITVTGEALIGPVVDVRVPKAGVTLCSPTRVTVEQC
FT                   NARLEHKNQDGSWNVVTGMQCIGQGSNYLSVVTPISKIYKLVYGDFYRVVFDDVRGRFE
FT                   PSGAVEHSSRCMIDKNSITWGNPVSGGVLELSTSSGQTERLAIYGQPETTFLMPVTAVD
FT                   KTYIEYPAMTRLSVAPDGSARGQVVTVVGRNAQVKFTLREAYGNNNLNQYWIPTAASGN
FT                   KIKPQLIKKDGSQCVNAREGESCDLYYPPGSVPPGRYYRGYVDIYATVY"
FT   gene            23382..23594
FT                   /gene="pefI"
FT                   /locus_tag="SPC_p031"
FT   CDS_pept        23382..23594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pefI"
FT                   /locus_tag="SPC_p031"
FT                   /product="PefI"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p031"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48804"
FT                   /db_xref="GOA:C0Q8J8"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J8"
FT                   /protein_id="ACN48804.1"
FT                   /translation="MSESIITHIISIIRERQSAHDGAPVKTRDIADAAGLSIYQVRSYL
FT                   EQLRTVGGLEKVNAGKGVPGLWRLL"
FT   gene            23579..23914
FT                   /gene="orf7"
FT                   /locus_tag="SPC_p032"
FT   CDS_pept        23579..23914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf7"
FT                   /locus_tag="SPC_p032"
FT                   /product="putative bacterial regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p032"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48805"
FT                   /db_xref="GOA:C0Q8J9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8J9"
FT                   /protein_id="ACN48805.1"
FT                   /translation="MASALTAFPEDGDFGRIWYDRLCIEFNSDGGLSPAELRVIRLLLR
FT                   GYNSGQIAALCFRSVKTISAQKGQAFRRLGVRNDATLLPTLILLGMVTLYTDLNRVHSL
FT                   EEDGPES"
FT   gene            24063..24512
FT                   /pseudo
FT                   /gene="srgB"
FT                   /locus_tag="SPC_p033"
FT                   /note="degenerate compared to PSLT010 in Salmonella
FT                   typhimurium plasmid pSLT"
FT   gene            complement(25213..25428)
FT                   /locus_tag="SPC_p034"
FT   CDS_pept        complement(25213..25428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p034"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48806"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K0"
FT                   /protein_id="ACN48806.1"
FT                   /translation="MKIRLTSEDFVRLSPGAACFLRGTLVLPAKISLILLPEWPEMFPP
FT                   ESFPVAIFSYSQITARDLSIKLQPIY"
FT   gene            complement(25440..26321)
FT                   /gene="repA"
FT                   /locus_tag="SPC_p035"
FT   CDS_pept        complement(25440..26321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SPC_p035"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p035"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48807"
FT                   /db_xref="GOA:C0Q8K1"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K1"
FT                   /protein_id="ACN48807.1"
FT                   /translation="MQAEVTDTRTLFTHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAE
FT                   GFTSRFDFSVHVAFVRSLGKRHRMPPLLRRRAIDALLQGLCFHYDPLANRVQRSITNLA
FT                   IECGLATESKSGNLSITRATRALKFMAELGLITYQTEYDPQIGCNIPTDITFTPALFSA
FT                   LDVSDVAVMAARCSRVEWENQQRKKQNLEPLEMDELIAKAWRFVRERFRSYQSERKLHG
FT                   LKRARARRDADRTRKDIETLVKQQLTREYASGRFTGGLDAMKRELQRRVKERMMMSRGK
FT                   NYTRLTMATVPI"
FT   gene            complement(26302..26379)
FT                   /gene="tap"
FT                   /locus_tag="SPC_p036"
FT   CDS_pept        complement(26302..26379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tap"
FT                   /locus_tag="SPC_p036"
FT                   /product="plasmid replication control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p036"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48808"
FT                   /db_xref="InterPro:IPR012605"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K2"
FT                   /protein_id="ACN48808.1"
FT                   /translation="MLRKFQYLFLWHLLLPCIVSAGRSD"
FT   gene            complement(26384..26506)
FT                   /gene="repA3"
FT                   /locus_tag="SPC_p037"
FT   CDS_pept        complement(26384..26506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA3"
FT                   /locus_tag="SPC_p037"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p037"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48809"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K3"
FT                   /protein_id="ACN48809.1"
FT                   /translation="MSTRDQKSKNPDNLLISWRERKINGAYLNCIATNQAMQGV"
FT   gene            complement(26629..26874)
FT                   /gene="repC"
FT                   /locus_tag="SPC_p038"
FT   CDS_pept        complement(26629..26874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="SPC_p038"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p038"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48810"
FT                   /db_xref="GOA:C0Q8K4"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K4"
FT                   /protein_id="ACN48810.1"
FT                   /translation="MSQIENAVTSSSKRIYRKGNPLSSAEKKRLSISRKKTTHKELNVF
FT                   IQNIHKESLQQLCEETGTTQAQMIELLIEREMAKRA"
FT   gene            complement(27074..27205)
FT                   /locus_tag="SPC_p039"
FT   CDS_pept        complement(27074..27205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p039"
FT                   /product="putative phospholipase D"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p039"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48811"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K5"
FT                   /protein_id="ACN48811.1"
FT                   /translation="MSSPGNPGKTSDGRHTEVGSFNYSRAADRSNSENVLSSGMTQS"
FT   gene            complement(27226..27678)
FT                   /locus_tag="SPC_p040"
FT   CDS_pept        complement(27226..27678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p040"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p040"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48812"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K6"
FT                   /protein_id="ACN48812.1"
FT                   /translation="MFKYWPTFVQQWENSLKAAQKGLEIWKSARADAWLAYHNGIFATS
FT                   HYEGALTSEDISSAAAAVLKGHKIRGGNVNTKSILDASNRLAHTLALQGSPVMIMMPVK
FT                   KATEKNVTVIPGGAGQETLENAAVLILAGMERNDRATTREGNNNLS"
FT   gene            complement(27795..28358)
FT                   /gene="finO"
FT                   /locus_tag="SPC_p041"
FT   CDS_pept        complement(27795..28358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="SPC_p041"
FT                   /product="finP binding-protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p041"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48813"
FT                   /db_xref="GOA:C0Q8K7"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR021065"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K7"
FT                   /protein_id="ACN48813.1"
FT                   /translation="MTEQKRPVLTLKRKTDGEAPARSRKTIINVTTPPKWKVKKQQLAD
FT                   RAVREASLAEKKARARKDLSIYLRFQSVEEAVSTLKPWWPGLFDGDTPRLFACGVREAL
FT                   FEDASRRGIPLSHKKIIRALKAIARSEAYLSAMKAGACRYDTEGYVTEHITVEEEQYAL
FT                   ARLAKVRAQNARKAELRAVLAQTV"
FT   gene            complement(28413..29153)
FT                   /gene="traX"
FT                   /locus_tag="SPC_p042"
FT   CDS_pept        complement(28413..29153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="SPC_p042"
FT                   /product="pilin subunit acetylation"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p042"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48814"
FT                   /db_xref="GOA:C0Q8K8"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="InterPro:IPR014125"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K8"
FT                   /protein_id="ACN48814.1"
FT                   /translation="MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVAD
FT                   HINRILHLNQEWLFLAGRGAFPLFALVWGLNLSRHTHIRQSAINRLWGWAVIAQSGYFL
FT                   AGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLV
FT                   ICYRLYRITDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTGKSRP
FT                   RFWPADFFPVFYTCHLAALGVLAM"
FT   gene            complement(29173..34355)
FT                   /pseudo
FT                   /gene="traI"
FT                   /locus_tag="SPC_p043"
FT                   /note="frameshift compared to PSLT108 in Salmonella
FT                   typhimurium plasmid pSLT"
FT   gene            complement(34352..35701)
FT                   /pseudo
FT                   /gene="trbH"
FT                   /locus_tag="SPC_p044"
FT                   /note="degenerate compared to PSLT105 in Salmonella
FT                   typhimurium plasmid pSLT"
FT   gene            complement(35071..37314)
FT                   /gene="traD"
FT                   /locus_tag="SPC_p045"
FT   CDS_pept        complement(35071..37314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="SPC_p045"
FT                   /product="ATP-binding protein/DNA transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p045"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48815"
FT                   /db_xref="GOA:C0Q8K9"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8K9"
FT                   /protein_id="ACN48815.1"
FT                   /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLVL
FT                   WVKLSWQTFVNGCIYWWCTTLEGMRDLIKSQPIYEIRYYGQTFRMNAAQVLQDKYTVWC
FT                   GEQLWSAFVLAACVALVICLITFFMATWILGRQGKQQSEDDVTGGRQLTDNPKDVARML
FT                   KKDGKASDILIGDLPIIKDSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVVMYDRS
FT                   CEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDPFWQGS
FT                   GRTIFAEAAYLMRNDSDRSYSKLVDTLLSIRIEKLRTYLRDSPAANLVEEKIEKTAISI
FT                   RAVLTNYVKVVRYLQGIERNGEPFTIRDWMRGVREDQKNGWLFISSNADTHSSLKPVIS
FT                   MWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEIVPEARKFGGCYVFGIQSST
FT                   QMEDIYGEKAAATLLDVMNTRAFFRSPSYKIADYVAHEIGEKEILKASEQYSYGADPVR
FT                   DGVSTGKEMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLALKYQERPKVAPEFIPRE
FT                   MNPEAEARLSAVLAAREAEGRQMSSLFEPDTEAVAPTAAEAQAEQPQQPQQPQQPQQPQ
FT                   QPQQPQQPQQPQQPQQPQPTVVSDKKSAAAGTAVNTPAGGVGQELKMKPEDEEQPLPLG
FT                   INASGEVVDMAAYERWQQEQEVNTQQQMQRREEVNINVHRGHGKDEPEPGDDF"
FT   gene            complement(37686..38417)
FT                   /gene="traT"
FT                   /locus_tag="SPC_p046"
FT   CDS_pept        complement(37686..38417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traT"
FT                   /locus_tag="SPC_p046"
FT                   /product="surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p046"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48816"
FT                   /db_xref="GOA:C0Q8L0"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L0"
FT                   /protein_id="ACN48816.1"
FT                   /translation="MKMKKIMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSQTIWL
FT                   DPSSERTVYLQVKNTSDKDMSDLQSLIAKDIQAKGYTVVTSPDKAYYWIQANVLKADKM
FT                   DLRESQGWLNRGYEGALSGAALGAGITAYNSNSAGATLGVGLAAGLAGMAADALVEDVN
FT                   YTMITDVQIAERTKATVTTDNVAAPRQGTSGAKIQTSTETGNQHKYQIRVVSNANKVNL
FT                   KFEEAKPVLEEQLAKSIANIL"
FT   gene            complement(38434..38643)
FT                   /locus_tag="SPC_p047"
FT   CDS_pept        complement(38434..38643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p047"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48817"
FT                   /db_xref="GOA:C0Q8L1"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L1"
FT                   /protein_id="ACN48817.1"
FT                   /translation="MWIYLISYAALYAMLAVYISSIYFSVIWFIALSMILMVVMAIIMN
FT                   VDFGRYQLSALTSLIESFKNKKGN"
FT   gene            complement(38720..38962)
FT                   /locus_tag="SPC_p048"
FT   CDS_pept        complement(38720..38962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p048"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48818"
FT                   /db_xref="GOA:C0Q8L2"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L2"
FT                   /protein_id="ACN48818.1"
FT                   /translation="MITNEVIKKEIEDLRKNLILNELEIPSFFSCIWPAIFFALIFTGI
FT                   PFFLFSNDIYTDDIDLIAVTVFGCFFECCFFCINR"
FT   gene            complement(38959..39729)
FT                   /locus_tag="SPC_p049"
FT   CDS_pept        complement(38959..39729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p049"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48819"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L3"
FT                   /protein_id="ACN48819.1"
FT                   /translation="MDYFTSRKTSQSASHTDNNAESRVDQLSASLNNAKQSYDQYTTNL
FT                   TRSHEYAEMASRTESMSGQMSEDLSQQFVNYVQKHAPNDAESILTNTNSPDVAERHRAM
FT                   AWAFVQEQVQPGVDSAYSGANENIGMGMPTNSNGGTRSDVVNDYTTNSGVIDHHTRTSG
FT                   IRSDISGEVDNMIDQNQQRHDADKTQITNQSNDIKNQNSELEKQYNLEKNKHEKMYNEK
FT                   MESQGHIPGGYSKEELTKMAEDMQKKHRGGKGDS"
FT   gene            39962..40384
FT                   /gene="samA"
FT                   /locus_tag="SPC_p050"
FT   CDS_pept        39962..40384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="samA"
FT                   /locus_tag="SPC_p050"
FT                   /product="SamA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p050"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48820"
FT                   /db_xref="GOA:C0Q8L4"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L4"
FT                   /protein_id="ACN48820.1"
FT                   /translation="MLLLVAPEQEPVQSTAPLFTERCPAGFPSPAADYTEEELDLNAYC
FT                   IRRPAATFFVRAIGDSMKEMGLHSGDLMVVDKAEKPMQGDIVIAETDGEFTVKRLQLKP
FT                   RIALLPINPAYPTLYPEELQIFGVVTAFIHKTRSTD"
FT   gene            40384..41658
FT                   /gene="samB"
FT                   /locus_tag="SPC_p051"
FT   CDS_pept        40384..41658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="samB"
FT                   /locus_tag="SPC_p051"
FT                   /product="SamB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p051"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48821"
FT                   /db_xref="GOA:C0Q8L5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L5"
FT                   /protein_id="ACN48821.1"
FT                   /translation="MFALADVNSFYASCEKVFRPDLRDRSVVVLSNNDGCVIARSAEAK
FT                   KLGIKMGVPWFQLRSAKFPEPVIAFSSNYALYASMSNRVMVHQEELAPRVEQYSIDEMF
FT                   LDIRGIDSCIDFEDFGRQLREHVRSGTGLTIGVGMGPTKTLAKSAQWASKEWSQFGGML
FT                   ALTLHNQKRTEKLLSLQPVEEIWGVGRRISKKLNTMGITTALQLARANPTFIRKNFNVV
FT                   LERTVRELNGESCISLEEAPPPKQQIVCSRSFGERVTTYEAMRQAVCQHAERAAEKLRG
FT                   ERQFCRHIAVFVKTSPFAVTEPYYGNLASEKLLIPTQDTRDIIAAAVRALDRIWVDGHR
FT                   YAKAGCMLNDFTPTGVSQLNLFDEVQPRERSEQLMQVLDGINHPGKGKIWFAGRGIAPE
FT                   WQMKRELLSPAYTTRWADIPAAKLT"
FT   gene            complement(41740..42714)
FT                   /gene="parB"
FT                   /locus_tag="SPC_p052"
FT   CDS_pept        complement(41740..42714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SPC_p052"
FT                   /product="ParB"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p052"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48822"
FT                   /db_xref="GOA:C0Q8L6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L6"
FT                   /protein_id="ACN48822.1"
FT                   /translation="MSNERRKTIGRQLNTQASMVEMTDTQRSQVFTLKTGRKITFRFVR
FT                   VPASDVESKTFVNQETNGRDQLALTRESLKSIIQTIKFQQFFPCIGIQQGERIEILDGS
FT                   RRRASAIYIRTGLDVMVTNELLSADEARHLAKDIQTAKEHNLREIGLRLMALKESGFNQ
FT                   KEIAELEGVSQAKVTRALQAAAVPQELISLFPVQSELSFSDYKILLEVNEKLSEKGLTS
FT                   EGLIQSVSDQHDAILSDYERPDDEQKSSILKLISQASQALIAPPPKEKSVISALWTFEE
FT                   KDKFARKRVKGRTLTYEFSRMSKVVQDELDKAINEVLERNLSQ"
FT   gene            complement(42714..43919)
FT                   /gene="parA"
FT                   /locus_tag="SPC_p053"
FT   CDS_pept        complement(42714..43919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SPC_p053"
FT                   /product="ParA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p053"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48823"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041250"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L7"
FT                   /protein_id="ACN48823.1"
FT                   /translation="MENIEQLRKVATRAGKLLTSLSESIRQQKEELKLTEFYQEYSKAA
FT                   LYKLPKLSKGSVEYAVAEMEASGYIFKKKPSGNTMKYAMTIQNVIDLYFHRKVPKYRDR
FT                   FDKAFTIFVCNLKGGGSKTVSTASLSHAFRAHPQLLFEDLRILAIDFDPQASLTMFLSH
FT                   ENSVGLVENTAAQAMLQNVSREELLSDFIVSSIIPGVDVIPASIDDAFLAEGWKGLCEE
FT                   HLPGQNIHAVLKENIIDKLRYDYDFIFLDSGPHLDAFLKNCIGAADLMLTPLPPATVDF
FT                   HSSLKFVASLPALIDSIEQDGHTCNLIGNVGFMSKILNKSDHKICHSQAKEVFGADMLD
FT                   MVLPRLDGFERCGETFDTVISANPATYDGSTEALKSAKSAAEDFAKAVFDRIEFIRTNG
FT                   GM"
FT   gene            44334..45275
FT                   /locus_tag="SPC_p054"
FT   CDS_pept        44334..45275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p054"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p054"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48824"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L8"
FT                   /protein_id="ACN48824.1"
FT                   /translation="MKKKNTTPTPHDATFRQFLTQPDIARDFMELHLPAELRAICDLST
FT                   LKLESGSFVEDDLRQYFSDVLYSLKTTAGDGYIHVLVEHQSTPDKHMAFRLIRYAVAAM
FT                   QRHLEAGHKKLPLVIPVLFYTGKRSPYPYSTRWLDEFDDTALADKLYSSAFPLVDVTVI
FT                   PDDEIAGHRSMAALTLLQKHIHQRDLAELVDRLAPILLAGYLSSSQVISLVHYIVQAGE
FT                   TSDAEAFVRELAQRVPQHGDALMTIAQQLEQKGIEKGIQLGEQRGIEKGRSEGEREATL
FT                   KIARTMLQNCIDRNTVMKMTGLTEDDLAQIRH"
FT   gene            complement(45307..45873)
FT                   /locus_tag="SPC_p055"
FT   CDS_pept        complement(45307..45873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p055"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48825"
FT                   /db_xref="InterPro:IPR021316"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8L9"
FT                   /protein_id="ACN48825.1"
FT                   /translation="MTLTEKSGHLAWCALVALALARQDGGVLSPAQENLFLTRWLATAL
FT                   KQRRFSRDVTPDIEWLLKQGRQMGVSAKLASKLNYLWRSCTGELSEQNDLFRLTYALET
FT                   AKDMHWNYRLLSDREWSGRNAVALSAGVNGIYLSRAKLDVGFNDSGRQINSLTARLTGN
FT                   VAGVMKLFDRCGWQSLMPPCPTSIR"
FT   gene            complement(45930..46331)
FT                   /locus_tag="SPC_p056"
FT   CDS_pept        complement(45930..46331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p056"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48826"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M0"
FT                   /protein_id="ACN48826.1"
FT                   /translation="MSQHNAALWLVRQLQGLIQESEMENMLKTMREHFPVRTVVIEQSL
FT                   DMFGVKRNEDGTLLFPRHSDKRFPVARIRKRLAAYGWRGERLNKEVARIVAGPDILPER
FT                   RDYSIIFPYGWEKKQLTREMRRMFLRKTG"
FT   gene            complement(46318..46437)
FT                   /locus_tag="SPC_p057"
FT   CDS_pept        complement(46318..46437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p057"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48827"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M1"
FT                   /protein_id="ACN48827.1"
FT                   /translation="MAHSAVTDAVMTAQVVNNIAGYWHELQCEMNDDAGSEPA"
FT   gene            complement(46449..46958)
FT                   /locus_tag="SPC_p058"
FT   CDS_pept        complement(46449..46958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p058"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48828"
FT                   /db_xref="GOA:C0Q8M2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M2"
FT                   /protein_id="ACN48828.1"
FT                   /translation="MRDDDNSDACDEAPRAEDKCYTKGRLRDEFRMKPAPGAEPVRIYK
FT                   SPYGGKYGVWRLADCVPMRAKRPQTEKQRLASTRLGLQARMKSERGRFAMLAHTWLALG
FT                   PVFLDTETTGLDAGAQALEIGLVNARGERIFETRLKPTVGIDPAAAAVQIVTEPYRFPV
FT                   LSVRLA"
FT   gene            complement(46951..48066)
FT                   /gene="tlpA"
FT                   /locus_tag="SPC_p059"
FT   CDS_pept        complement(46951..48066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA"
FT                   /locus_tag="SPC_p059"
FT                   /product="TlpA"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p059"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48829"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M3"
FT                   /protein_id="ACN48829.1"
FT                   /translation="MRPATYEPEQIIEAGLALQAEGRNITGFALRNQVGGGNPTRLRQI
FT                   WDEYQASQSTVVTEPVAELPVEVAEEVKAVSAALSERITQLATELNDKAVRAAERRVAE
FT                   VTRAAGEQTAQAERELADAAQTVDDLEEKLDELQDRYDSLTLALESERSLCQQHDVEMA
FT                   QLKERLAAAEENTRQREERYQEQKTVLQDALNAEQAQHKNTREDLQKRLEQISAEANAR
FT                   TEELKSERDKVNTLLTRLESQENALASERQQHLATRETLQQRLEQAIADTQARAGEIAL
FT                   ERDRVSSLTARLESQEKASSEQLVRMGSEIASLTERCTQLENQRDDARLETMGEKETVA
FT                   ALRGEAEALKRQNQSLMAALSGNKQTGGQNA"
FT   gene            complement(48340..48819)
FT                   /locus_tag="SPC_p060"
FT   CDS_pept        complement(48340..48819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p060"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48830"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M4"
FT                   /protein_id="ACN48830.1"
FT                   /translation="MHLIPCAFLSVLIFLVVLLHSPDILQNCLPVVLCLLPVAFGNGSN
FT                   NVRITVMAAVHASLLAKDINNNILAALPVEKMSAQALYNQRSIVQPGLISDLEEEVQHL
FT                   IRFVALDGRTESGCPLWCFPGVIPLVTQFCLVVGFQVFLCTPVVAEKVFPGPFDD"
FT   gene            49468..50208
FT                   /gene="mig5"
FT                   /locus_tag="SPC_p061"
FT   CDS_pept        49468..50208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mig5"
FT                   /locus_tag="SPC_p061"
FT                   /product="Mig5"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p061"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48831"
FT                   /db_xref="GOA:C0Q8M5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M5"
FT                   /protein_id="ACN48831.1"
FT                   /translation="MEQNQPAQPSRRAILKQTLAVSALSVTGLAALSVPTISFAASLSK
FT                   EERDGMTPDAVIEHFKQGNLRFRENRPAKHDYLAQKRNSIAGQYPAAVILSCIDSRAPA
FT                   EIVLDAGIGETFNSRVAGNISNRDMLGSMEFACAVAGAKVVLVIGHTRCGAVRCAIDNA
FT                   ELGNLTGLLDEIKPAIAKTEYSGERKGSNYDFVDAVARKNVELTIENIRKNSPVLKQLE
FT                   DEKKIKIVGSMYHLTGGKVEFFEV"
FT   gene            50415..50975
FT                   /locus_tag="SPC_p062"
FT   CDS_pept        50415..50975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p062"
FT                   /product="putative resolvase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p062"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48832"
FT                   /db_xref="GOA:C0Q8M6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M6"
FT                   /protein_id="ACN48832.1"
FT                   /translation="MALYGYARVSTSDQDLTLQTQILRAAGCEIIRAEKASGSGRTGRS
FT                   ELQLLLEFLRPGDTLMVTRVDRLARSIKDLQDIVYALNQQGVTLRATEQPVDTRSAAGK
FT                   AFLDMLGVFAEFETNLRRERQMEGIAAAKARGVYRGRKPSIDPAEVYRLYTIEKMGATA
FT                   IARQLGIGRASVYRALENYEQPA"
FT   gene            51124..52623
FT                   /gene="rlgA"
FT                   /locus_tag="SPC_p063"
FT   CDS_pept        51124..52623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlgA"
FT                   /locus_tag="SPC_p063"
FT                   /product="putative integrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p063"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48833"
FT                   /db_xref="GOA:C0Q8M7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M7"
FT                   /protein_id="ACN48833.1"
FT                   /translation="MKPRTAHRSDHGQPRILPPSELEHYCELIAALKLRTTNKSGRHLS
FT                   TGRAIQLLEEHGVETVQGLIKSPKGLLRKQTVNRWLSRWRLDQPRLLREPPAVRFQAEN
FT                   SNDCWQFDMSPSDLKHIERPDWVDPARGEPTLMLFSVVDDRSGVAYQEYRCVYGEDAES
FT                   ALRFLFNAMAPKTRSDFPFQGRPKLLYLDNGPVAKNHVFQNVMQSLKVDWLTHTPAGKD
FT                   GTRTTARSKGKVERPFRTVKEAHETLHHFHKPETELQANEWLWNYLSRYNAQRHRSEKH
FT                   SRLEDWLANIGQEGVRDMCSWEQYCRFAREPESRKVGVDARITIDGTAWEVEPDMAGET
FT                   VILLWGLFDEEMYVEFTGETWGPYYPVSGPVPLHRYRTFRRGKAAERADRIHALARQLN
FT                   IPISALSGSDLRVVSDDTQQRIDALPHQPFDTRKFEYHFPTVIAAKLAIADDLAIPLAR
FT                   MSDEDRAFIDSILTETLNRSEVLARIRDYFRSRQSGEDHAG"
FT   gene            52613..53581
FT                   /locus_tag="SPC_p064"
FT   CDS_pept        52613..53581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p064"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p064"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48834"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M8"
FT                   /protein_id="ACN48834.1"
FT                   /translation="MRVEVMEHYGLTQSIEQAGYYETAHHKQLMKDIKGAIREGRLIAV
FT                   CGVVGSGKTVTLRRLQQQLLDENKIIVARSLSVDKQSVRLATLINALFYDLAQDKQVQI
FT                   HKQGERRERELQELVKKGKRPVALFVDEAHDLNGNTLTGLKRLMEVVEDGGGRLSVVLA
FT                   GHPKLRNDLRRPTVEEIGYRTDIFTLDGITGSQREYIQWLLKTSTGKGKPEDILTTEAV
FT                   DLLAMKLRTPLQVQLHLTLAMEAGYQTGEKPITATLVESVLSRQLDDLEPTLTRHGYRL
FT                   KDMVEQFDAKPAEIRALFNNQLDPARTAELRDRMLAVGLPI"
FT   gene            complement(53770..54807)
FT                   /locus_tag="SPC_p065"
FT                   /note="IS630"
FT   CDS_pept        complement(53770..54807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPC_p065"
FT                   /product="transposase of IS630"
FT                   /db_xref="EnsemblGenomes-Gn:SPC_p065"
FT                   /db_xref="EnsemblGenomes-Tr:ACN48835"
FT                   /db_xref="GOA:C0Q8M9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C0Q8M9"
FT                   /protein_id="ACN48835.1"
FT                   /translation="MPIIAAIPDEERQLMRKEAQQTHDKNHARRLIAMLMLHQGMTVTD
FT                   VARLLCAARSSVGRWINWFTLHGVEGLKSLRPGRAPRWPVADILQLLPLLVQRSPKDFG
FT                   WLRSRWSTELLALVINRLFDVTLHRSTLHRYLRQADMVWRRAAPTLKIKDPHYEEKRLV
FT                   IDQALAQEQTAHPVFYQDEVDIDLNPKIGADWMPKGQQKRIATPGQNQKHYLAGALHSG
FT                   TGRVHYVSGSSKSSDLFISLLETLRRTYRRAKTITLVADNYIIHKSRKVERWLEENPKF
FT                   RLLFLPMYSPWLNPIERLWLSLHETITRNHQCRYMWQLLKQVAQFMNAASLFPGNQQGL
FT                   AKVER"
XX
SQ   Sequence 55414 BP; 13060 A; 14917 C; 14314 G; 13123 T; 0 other;
     atggatttct tgattaataa aaaattaaaa attttcataa cactgatgga aacaggttcc        60
     ttcagtatcg caacatcagt actgtatatc acccgaaccc cgctgagcag ggttatttca       120
     gacctggaaa gagagctgaa acaaagactc tttatacgga agaatggcac tcttatccca       180
     accgaatttg cacaaactat ttatcgaaaa gtaaaatccc attatatttt cttacatgca       240
     ctggagcagg aaatcggacc tacgggtaaa acgaaacaac tagaaataat atttgacgaa       300
     atttatccgg aaagtttaaa aaatctgatc atttcagcac tgaccatttc cggccaaaaa       360
     acaaatataa tggggagagc cgttaacagc caaataatag aagaactgtg tcagacaaac       420
     aactgcattg ttatttctgc cagaaattat tttcatcggg aatcgcttgt ctgccggaca       480
     tcagtggagg gtggggtcat gttatttatt cctaaaaaat tctttctctg cggcaaacct       540
     gatatcaaca ggctggccgg aacacctgta ctttttcatg agggggctaa aaattttaat       600
     ctggacacca tataccattt ttttgaacag acactaggta ttaccaaccc tgcattcagt       660
     tttgataacg tcgatttgtt cagttcactg taccggttac aacaagggct ggcgatgtta       720
     ctcatccccg tcagagtctg tcgggctctg ggattatcaa cagatcacgc actgcacatc       780
     aaaggcgtag cgctctgtac ctccttgtat tacccgacca agaaacggga gacaccagat       840
     tatcgtaaag ctataaaact gatacagcag gaactgaaac agtccacctt ctgaccttat       900
     gcagcgtaag ggccgcaaca cctgtattca cggcatttgc cagattcaga ttgtcagcaa       960
     tccccatcct ccatagcggt agttcaccgc ggagcatgga gtaaaccggc tggtcgccgt      1020
     caatctgaca cagaatcagt ttgatgctct ggtggattac ctaaaacatg ggcattaacg      1080
     cgctggctca cgccacttta ctgaagaaac tgaataacgg tgactatgac ggcgcagcga      1140
     atgaattcct gaaatgggac cacgccagcg gtcaggttgt tcccggcctg acccgacgcc      1200
     ggagcgctga acgttgttta ttcctgagtt aatttgttgt gccatctttg cacaccggga      1260
     accgcgattc cgcacagcag aaaaatagca cataaataaa ctcaatataa gccactcatt      1320
     ttctggcaat acaaaataat tcccctgcag acattatcag tcttcaggat ttcattctgt      1380
     ttattttcag gagtcatcat tatttatgaa tatgaatcag accaccagtc cggcactttc      1440
     acaggtcgaa accgccatcc gggtcccggc agggaatttt gcaaaatata attattattc      1500
     cgtgtttgat attgtccgtc agacccgtaa acagtttatt aacgccaata tgtcatggcc      1560
     gggctcccgc ggaggtaaag cctgggacct ggcgatgggc caggcgcagt atatccgctg      1620
     catgttccga gaaaatcaat tgacccgcag agttcggggg accttgcagc agacaccgga      1680
     caatggcacg aacctgagca gttccgctgt cggcggtatt cagggacagg cagagcgtcg      1740
     gccggacctg gccaccctga tggtggttaa tgatgccatt aaccagcaaa taccgaccct      1800
     gctgccgtat cattttccac acgaccaggt ggagttatct ctgctgaata ccgatgtgtc      1860
     gctggaagat attatcagcg agagcagcat tgactggccg tggttcctga gcaactcgct      1920
     gaccggcgat aacagtaact atgccatgga gctcgccagc cggctgtcac cagagcagca      1980
     gacactgccg accgagccgg acaacagtac cgccactgac ctgacctctt tttaccagac      2040
     caatctgggg ctgaaaaccg ccgactatac gccatttgaa gcactgaata cctttgcccg      2100
     acagttagcg attaccgttc ccccaggtgg aacagttgat tgcgggtact ctgcgtgcca      2160
     gccggcagtt tagcttcccg cgctaccaga gtagtgagca gcagaccatt ctgcagaatc      2220
     tgagcgacgt cattgttcag gtgcattcta ccgcgctgta cggcggcagc acttttgaac      2280
     aggccgtaga gcagacgctg taagcagaaa atatacctgg ccatcgtcag acggccagtt      2340
     tcaggagata gtgtatgttg atactaaatg gtttttcatc tgccacttta gcgctgatca      2400
     ctcccccttt cctgccaaaa gggggcaagg cgctgagtca gtcaggccct gacggcctag      2460
     ccagtataac gctgcctctg cccatcagcg ccgaacgcgg ctttgcgcct gcgctggcgc      2520
     tgcactacag cagcggtggc ggcaatggcc ccttcggcgt gggctggtcc tgcgcgacaa      2580
     tgagcattgc ccgccgcacc agccatggcg tgccgcagta taacgacagc gatgagtttc      2640
     tggggccgga cggagaagtg ctggttcaaa cgctcagcac cggtgatgcc cccaatcccg      2700
     tcacctgctt cgcgtacggt gacgtatcgt tcccgcaaag ctacacggtg acccgctatc      2760
     agccccgcac ggagagcagt ttttatcgcc tggagtactg ggtgggcaac agcaacggcg      2820
     atgatttctg gttactgcat gacagtaacg gcatcctgca cctactgggg aaaaccgccg      2880
     cagcacgcct cagcgatccg caggccgcct ctcatacggc gcaatggctg gttgaggagt      2940
     cggtgacccc tgccggcgag catatctatt actcctactt ggcggagaac ggtgacaatg      3000
     tggacctcaa tgggaacgag gccggacgcg atcgcagcgc catgcgctat ctcagcaagg      3060
     tacagtatgg caacgcgacc cccgccgccg atctgtacct ctggactagc gccacacccg      3120
     cggtacagtg gctgttcacc ctagtgtttg actacggcga acgtggtgta gatccacagg      3180
     taccgcctgc attcactgct cagaacagct ggctcgcccg ccaggatccc ttctccctgt      3240
     ataactacgg ctttgagatc cgcctccatc gcctgtgccg ccaagtcctg atgttccacc      3300
     actttcctga tgaactgggt gaagccgata cgctggtttc ccgtctgctg ctggagtatg      3360
     acgaaaatcc gatactgaca cagctttgcg ctgctcggac gctggcctat gaaggcgacg      3420
     gttatagaag agctcctgtc aacaatatga tgccaccgcc agcgcctcct ccgatgatgg      3480
     gaggtaattc atctcgacca aaatcaaaat gggcgattgt agaggaatca aagcagattc      3540
     aagctctgag gtactattca gctcaagggt acagtgtgat taataaatat ttacgtgggg      3600
     atgattatcc tgaaacacag gcaaaagaaa ctctgctctc cagagactat ctttccacaa      3660
     atgaacccag tgatgaggag tttaaaaatg ccatgtcagt ttatataaat gatattgcgg      3720
     agggattaag ttcacttccc gaaacagatc acagagtcgt ataccggggc ctgaagcttg      3780
     ataagcccgc attatcggat gtgctgaagg aatacactac tataggtaat ataataatag      3840
     ataaagcttt tatgagtaca tcgccagata aggcatggat aaatgacact attctcaaca      3900
     tatacctaga aaaaggacat aaaggtagaa tactcggaga tgttgcacat tttaagggag      3960
     aggcagagat gcttttccct ccaaatacta aactcaaaat cgaaagcatt gtaaattgtg      4020
     gatcccaaga ctttgcaagc cagcttagta agctgagatt aagtgatgat gcaactgctg      4080
     acacaaacag gataaaaaga ataataaaca tgagggtact caactcatag atactaagaa      4140
     tctattccag aagtggtatg agcggcctag ctctataagg ggttatactc cggaacccca      4200
     gatttttccg tcaccctagg cccgcaaagt agtgcatcta aacttttgcc attacccttc      4260
     tttaactttc tgctcggaac ggaccgaaat atcatttttt cgcctgataa aaaatgaggt      4320
     tttctggata actaatcgtt ttattaaaaa aaactgagaa tttatatcta ataatatggc      4380
     gatatatcca tatcgcaaag gagatttccc atgcccataa ataggcctaa tctaaacatc      4440
     cctcctttga atattgtagc tgcttatgat ggggcggaaa taccatctac aaataagcac      4500
     ctgaaaaata atttcaactc cttgcacaac caaatgcgga agatgccggt atcccacttt      4560
     aaagaggcgc tggatgtgcc tgactattca gggatgcgcc agagtggttt ctttgctatg      4620
     agccaaggtt ttcagctgaa taaccatggt tacgatgttt tcatccatgc tcgtcgagaa      4680
     tcacctcagt ctcagggcaa atttgccggt gacaagttcc acatcagtgt gctcagggat      4740
     atggtgccac aagcatttca agcgctgtcc ggattgctgt tttcagagga cagtccggta      4800
     gataagtgga aagtgaccga tatggagaag gtcgttcaac aagcccgtgt tagcctgggc      4860
     gctcagttca cgttgtatat aaaaccagac caggaaaatt cgcagtacag tgcgtcgttt      4920
     ctccacaaga cacggcaatt tatagagtgt ctggaatcca gactatccga aaatggggtt      4980
     atttcaggac agtgtcctga gtcagacgtt catcctgaaa attggaaata tctcagttat      5040
     cgtaatgaac tacgaagtgg gcgtgatggt ggtgaaatgc agagacaggc tttacgtgag      5100
     gaaccgtttt atcgtttgat gacagagtaa gtatgggttt ggggagcaac ggaacagtaa      5160
     acgccgttaa acagctattt taaatgctca ttaatttatt aatcaataaa ttacaaattt      5220
     tcattgaagg ctcccccctt actgacgaat tccggcaccg taaaggaata acgctcatgc      5280
     atattgatat gtccgcactg taatggtgaa aattacataa gcaagagcgt tttttgaaaa      5340
     atattatatt taatgttttg taatatgcat tttattgagg tagtgtaact atgagagttt      5400
     ctggtagtgc gtcatcccaa gatataatat cacgtataaa ttcaaaaaat atcaataata      5460
     atgattcaaa tgaagtcaag agaattaaag atgcgctttg tattgaatca aaagagagaa      5520
     ttttgtatcc acaaaatttg agtcgagata atttaaaaca aatggctaga tatgtaaata      5580
     atacatacgt ccattactct gggaactgcg ttttattatc agcgtgttta cattataaca      5640
     tacatcaccg acaggatata ttaagttcga agaacactgc ctctcctaca gtgggattag      5700
     acagcgccat tgttgataaa atcatttttg gtcatgagct taaccaatca tattgtttaa      5760
     attccatcga tgaggtggaa aaagaaatat taaaccgtta tgacattaag agggaaagtt      5820
     cttttatcat tagcgcagag aactacatag ttccaataat tggcgaatgt agacatgatt      5880
     tcaacgctgt ggttatctgt gaatatgata aaaaaccata tgtacaattc attgattctt      5940
     ggaaaacatc caacatactt cctagcttac aagaaataaa aaaacacttc tcatcatcag      6000
     gggaatttta tgtcagggct tatgatgaaa aacacgattg ataacttttt taaatattca      6060
     ttttatgaat ggtaagttaa tagagagcct tagcaagatc cgctgtaaac cctcgcccaa      6120
     tgcgggcggg gatataaggc gaaaagcccg aagggcttta gggcaggcta ctccggcgta      6180
     ttctgtctga gcacgtatgc tttaagcgtt tctatcgtgg caccaccggc gctacaggca      6240
     aagtaagaac gagaccacag cagcccggtt ttgctctgca tccgcaagtg ggtattctgc      6300
     tgacggagaa gccgcgacga taccgacttt aaattattta ccatcacgct gacccccagt      6360
     tttagcggat acgctatcag cagatggacg tgatcttgtt caccatccat ctcgataatt      6420
     tcgcactcca actttgccgc agccgaacca aaagcatcac gtaactgagc gataatctgc      6480
     ccgtcaaaca gcttgcagcg gtattttgtc gtaaagatta aatgcacaac cagcttactt      6540
     acactatgcc gtttacgaag aaagccttcc agtgattcgt ggtgattact caattgaatt      6600
     tttcacttaa catgttaaaa taaatacaat atattaatga gcgctgaata tgttaagagc      6660
     cacgaaagta tgcatatatc cgacaccgga acaggcggag caccttaacg cccagttcgg      6720
     tgcagtccgt tttgtgtaca gcaaatctct gcatatcaag aaacacgctt atcaacgaca      6780
     cggcgtaagt ttaaccccgc gtaaagacat taaaccgctt ctggctgtag cgaaaaaatt      6840
     ccgtaaattc cgtaaatacg catggctaaa ggaatatgac tctattgcgt tgcaacaggc      6900
     ggtgatcaat ctcgatgttg ccttttccaa ctgcttcaat ccgaagctaa aagcccgctt      6960
     ccctatgttc aagcgcaaac acggcaagct gttggggtaa aagtgctgga tggtgcggtc      7020
     agaatcccga aaatcccggt gattgaagca caattgcatc gtgaaattac tggcacgtca      7080
     cctcctgctt acggtactcg aggataatgt cattgttacg gtcagtcagg tcgtagcggc      7140
     tgcccgccaa gctgcgcagg ggcccacggc atccggatcc agctggctgc gcaggctgtc      7200
     accaatgcgg taactcgctt ctgccccgaa gcgggtgtca tgctccccgg ccttgccggc      7260
     gcgctgctcc gcgctgagct tcagcagcgg caccggagtc cagctgaccc cggcggtcag      7320
     ggcgtgcggg ttcttctgcc gctcatcctt cccgaacagg cccacttcat ttccgtaata      7380
     ctgctcatac accatcttcg ccccgagctg cgggtacgac ggcaggtagc cttcagcacg      7440
     caggtcccag ccgctggccg gacgctcttc gtagtcctcc acatccgggg aggttttcca      7500
     gccggtcagg ccgacatagg cgttggcgga aagcttaagg aggtcgcgcc agtattctcc      7560
     gccgaagccg gcgcgggcgt ggtcgcggga gaggtcatag tcgaggaaga tgttcgcccc      7620
     gagcatgtca gacggccgga agtgacggta accatcccgg cggcggcctg accgtccgga      7680
     tggctggcga ggaagctgcc ggcctgtgag gccatgccga ccatctgctg cgcctgcgcg      7740
     tcctcatttt cccggtcagc agcaaacgga ccgcgggcgt catggcggtt attgtcacct      7800
     ttcccgccgg tcagcgggac cgccggcacg tcaagctcgt cgccggcctg caggtggtca      7860
     aagccgcggg cgaaagtgcg gagcccgttc agttttttca gctgtgggac ggtcaggccg      7920
     tgcgcctgcg ccaccgtctc cccctttttc agggtataag gcacggtccg gatcccggcg      7980
     agggcggcat cccggtcggc agagaacggg ctctgcccga tccgggacgc gatgtccgcc      8040
     cgggccgtca tggccggcgt gagcgttaaa accagcggtg tggtggcctg catccacaat      8100
     gtggcccagg tacaccccgt ccacgccggg gagtacagga ggataatttc atagtgtcat      8160
     gtccgtataa tgagaacggt gtgttaccgg aaggtgcacg gggtgatgtg cagaaacgtt      8220
     gtggctaccg gcgccggtcg tccggctgct gaaaaagggc ggcgaccccg ggtggagcat      8280
     catgctgtag tgcgccgcag ggtcaggcag gccgatcacc ggattggcca gcagctccag      8340
     gcggttcagc gcgctgcggc gatggccgta aaaggttttg gggctgatgc cgagccgggc      8400
     gccgtgcgcg cggagaggcc ggcgagcgtg gcacacagcg cctgtcgctc gcgcagggag      8460
     agactctccg tcgtcgcctg ccgccagccc cgcgcacggc gcagccagct gctgaccgcg      8520
     gccttcagct gagtcgcgga ggcggtgcgc ggcagcaggc agtccggcct gagaccgagg      8580
     gtgttcagga agacagcctg tcctcctgag cccagcagcg ccagtttcag ggacagtgat      8640
     gtcctggcgt gatggcaggc cgggaccagc gatgccagca tgccgggaga ggccgccagc      8700
     agcacatggc tgcctgccgg cggcgcggtc tgtaaccacc gggcaacact catgttcacg      8760
     gggtccagat gtgcgagcag gcgcgtcagc gccaggcggg taaactgaca gtcactgacg      8820
     ataatcagca tgatgcctcc cggaccgggc aggctgcctg ccaggcggct agttttgccg      8880
     tatcaccgcc ggccgggcgg gacagcagcc agtgcgccat ctggcggtca tactgccggt      8940
     cactcacctt cccgcccggc cggtctgtcc gctgccggcg gatggtgtcc gggcgggatt      9000
     ccactgcccg gatacgcacc acgagctggg cgcggcctcc ccgcacgggg tgcaggcggg      9060
     aatcaaagca aatgtcgtcg tcattgtgac ggttacagat gtaattgagg ataccgctgg      9120
     cacggcgggg ctcaatgctg aacgcctcgc tgacgtcatc gcgggtaaac tcccggccca      9180
     gaaacagccc ccaccaggcc acggcccggt acagggacag ggtgcccaga tggcggatgc      9240
     ccgggggcat gtaaaaccct tcatggttgc tctgcctgcc ggcaacggtc cggaataaca      9300
     acggctggtt catagaaatg actcctgtgc gcataactta accaaaggcc ggctggcttt      9360
     tttgcgtcag ccggaaatga aacagcccga agggcatcgg ggcgccgcag tgccagccct      9420
     gcaggtaatc gccccccgcg tcccgcaggc gcgccgcctg cgccggggtc tcgatacctt      9480
     cggcaatgac ccgggccccc tagcaccggg ccagactgac ggtgcgcgca atcatccgat      9540
     cagccaccgt gctggcggga ccggcatgac cggtgccgaa gtcgtccacg gcgaaccgca      9600
     gccccccggc ggcaagctgg cggaataccg ccgcctgagg aaaggcgcgg atatcttccc      9660
     gctcggtgat ttcaaagacg ggggtcatgc cggcctgctc cagccggatg ctgagggcca      9720
     gcaggtgcgg acggaaaagc ggcgtcataa ccaggctcag gctgagattc agcgtcatca      9780
     tcagcctgcg gccggcactg cgggcaaggt cctgcccgtc cccgcagacc tcgtcggcca      9840
     gtccgcgcag cagcgctccg ccgaggccgg tggcttcaat ggcgggaata aagttcccgg      9900
     cgctcagcag gcccttctgc ggatgcagcc agcgggccag catttcgcag cccaccacct      9960
     cccctcctgt ggcgcagaca atgggctgat aaaacggcgt aaactcccgg ttccggatgg     10020
     cctgttgcag gcgaaaggct gaaaaatgca tacacgtctc tatgaacctc ctttgagcat     10080
     agccactgca tcagcacccg gcatctgaaa ctgcacccgg tgtcgtgcgg caacatcaag     10140
     cgcaaacact ttcgtgtaca cttccgtcga gctcaccgat ttgtgtccca tcagcgcctg     10200
     cagcaccttc agcggtatgc cggcgtacag catgtgcatc gcataggagt ggcggaatgt     10260
     atggggtgtc accgggactg agaacgtcac gtcgtcagcc gctgcggcct caaccgcctc     10320
     cccaatccag gtacggaccg tccggtcggt gatctcccag aggcgcgcct tttccgttct     10380
     gccggtacgt ctgttacgac gctccagcgg gattttcagc gtggccacca tcatctgcag     10440
     ttcgctgaca tactggttat cagaaagcgg caccaggcgg tggggctggc tgccggacgg     10500
     catccgtcct gccgttctgg ccgccttttc cgcccgctgt ttcagagtgg ccagctgcac     10560
     aaacggataa ggtggtgcca gcgaaaagtc tccccgtgtc agggccagcg cctcgttaat     10620
     ccgtgcgccg gtattccata gagtggccag cagcatcctg cgatgcagat cagggacgta     10680
     gtggagcagg gcacttacct ccggtgccag cagatatttc gggtagtcgt catgctgcat     10740
     tgccatctgg cgcagtgcga gggccgccgg gtaatcaatg gccaccggca gcagggcgga     10800
     cgctgcctgc gtacagacag caggtaacgg tggctgactc atgtcctctc tccgttaagt     10860
     gaaatattcc gggacatcat gttttttccc ggagtcatct ctggtttcag tctgaaccct     10920
     gtataaagga taccagtcgc cgctgtgacg gttctgccgt tcggccaccg gtgtcatggc     10980
     cgcaatcgtg gcacgtgagt aacccgcttt cagcagcgcc gtacgggtca gcaattgttt     11040
     tcccggatcg gtcgcgggcg tggcgagccg tagcggatag agtgcgcgca gccgttccgc     11100
     ttctgaagcg tgatacagtg gccagccctg acgacgtccg acataggccg cgcaggcgcg     11160
     aagttcgtta cgaaaccagg tgtcggccgg aaaccagctc gccggatgca aatccgcagg     11220
     tatatcccgg gagccggcgt acaccgtcgt gaaccgctct tccggcgtca gcagggacac     11280
     agattttccg aaaaagacct gtgcaaactg ttctgtcgtc tccctgaccg gcagggcatc     11340
     cgatgccgga ctgagaccgg tggattcagt atccggacag atgcgtgacc gtgtcatgag     11400
     gtggtgttct ccctgtcagt acgcagtcgc cagaccgtcc cgccgaactc cgttcccccg     11460
     agggtctgtg tccaggtttc ctcgcagacc agccacttct gtaccaccgc aaaatccaca     11520
     tgacagagtg gggtatcccc gcgttcaccg ggggtttcca gcacaagccc gtccggaacg     11580
     atcggagagg gcgtacccgc cagtctggcg gagcggcgcc agaaactccg cacacagccg     11640
     ccctgacgta gactactgag cagcacctgt tcgctgacac gcatatcaga tcccccggaa     11700
     catcaggtta atggcgtttt tgatatcgtt ctcccggagg ctgagatcgg ccacctcttc     11760
     cccgatgacg gtggccggca cactggtcat atccgtggtc agcaggcggt aaggctcatc     11820
     cccgatatgc atcaccgggt aaagatcgcg gggaaccttt tccgacagca gacgggcgct     11880
     gaccagcggg acagccatcc gccgtccggg ggtgtcaatg atgtcgctct gcacgtccac     11940
     aaacagccgg tagcggctct cccttttaca ggtgtaaacc ttaaactgca tatcaccagt     12000
     tcctgttgtc gtcagcaaac gatccgttag cctctataaa gctggccacc tcagccatac     12060
     cttcccgatt ttcttcctgc cagcgttcgg ctcgcagacg gcgggcttcg ttctgcatgg     12120
     tcgtactgac cagaccggag atattcacgt cgtatgcctt gagcagctga tagctgtcgc     12180
     tgtccactgt cactgtaatt cgctgcttca tgattcacct cttttttaca tacttcaggt     12240
     atgcaattaa gtatacattc cgatgaagca aaaatctgcc acgcattgtg aatactgtta     12300
     accagcttat agtgactgag ttaactgttc gccgccatta tctacatatc tcttatatgt     12360
     attttctcgt gcattttact gatgcatgtt ttcaatcctt aaaacgcata ctgttatcac     12420
     gctattagta aatcactcat ctttttcata atgaaacttt aaccacatgc aattacaatc     12480
     caacttataa aaacgtaacg gaattacagg acggctattt tcaggtgatc cgattttttc     12540
     tctattcacg actttccgga agtgtaccac ggtcagggaa taagcaaagc ggtcttttct     12600
     gccctgcgcg ccgggtcaca gggaaggggt ataacacaac atctggtagc aacagcagat     12660
     gactgagccg ctacatcttg tgttaccggg tcgcggcgca ccggtgagga taaagaagat     12720
     ccgggactac ctttttccgg atctcaggtg acagaggaag atacaaaata catgaaccac     12780
     agaacaaaac ataaatcaat acataaaatt gaagttagca ctttttgcaa aatatatagc     12840
     acaaattgct aaagtgggtt atatttcatc cgtcgtccac atcacgtggc cattccacct     12900
     acttataagg agatttttat gaacacagca ttactcgttc catttatctc aactgcatta     12960
     tccggagtgg gcgtttatac ccgctattac tttaagaaat atcaggcttc cagggatctg     13020
     tgccaaaagg tccacagaat gatggtaaat acactgaccg ataccgcgag gttattcagc     13080
     cggagcgccc ccgcgcaggc gcttaaatca gaactgagaa tcatgcagca gaaactctct     13140
     caggagactc aaaaactgga taaaatgacg acacgccttc cgttaaagcg tctgcaacgg     13200
     gaacaacgtc atattttggg gcatgcaaag tggttgttag gttatctcga ttcgcatctg     13260
     gcagataatg aagggaaatt ttttctgttc ctgcatgact tggcgacgga tagcgatgat     13320
     aaagtcctgg atttcctgac gtcattacat gacacaaaga gattcagaaa tcgccgtctg     13380
     caaactggat caactacctg tccctgagag gggacaggta aacgtaaata tataaccggt     13440
     attaaaagag ttatttggac atcatatatg gcttacgtct ggcctcttct aattcatgca     13500
     gttcacgtac ctgagccatt ttctctgctg taggctcagg ttaattttca aaagatgcct     13560
     caaaacgttt tccaactgac tgcagggaaa cgctgtctgt tctggcagtc ttaagattgg     13620
     tataaacaag gcgcgcaaga ggcttggtta attccttctc ttccataaat tgcctgaaaa     13680
     tccagaaata aatattaacc agttctaacc ctgcgctttg cgtacccgac tggaaaataa     13740
     gtggttcagc tggcatgttt gtcatattca tgacgagcaa tcctggtcca ggttcccacg     13800
     gttgttcgcg aatattgaaa taaagctcgt tcagttcccg ttaggaggaa ttaaactgta     13860
     actgctgatc cacaatgatg gttccggcag atggatgctg aatttcagaa acagggactc     13920
     accggcctga cagaaacaga tctgcaggcc gttgtaactc ccggggagac actccggtta     13980
     ctgccggcac tggcgcggtt gctgcatgtt ttgcgagaaa accagaggcc ttctccctct     14040
     cagcagcttc atacgaagaa gatacttcct cagctttgaa aacactgctg gtccgtacag     14100
     gattcacaat acaccagata agagaaatgc gacttcacct tattcgctgg caattaataa     14160
     gtcaggaaga gtttgaccgg gaataagccc gggaaccggc gaggaagcgc aaaaaaacag     14220
     aagttaaagg aagcagatac gcactggagt cacagcaagt gattattgaa aaactatacg     14280
     aatcaccttg tcggtcagca ggttatccac atatacagtc actcgatcca gtaataagat     14340
     ccttacaacg atccctgtta gatcaaaaga agatcccgac tcttctaaag gccgcgtcag     14400
     tactgggcct ggagaatgat cacctaaact gtagcatgtt aatcataagc tgtaactggt     14460
     aaacaataag ctgtattatg caaaggatat actgtaatga gttagtaata taaactacag     14520
     tgagtatgtt cccctgaaac ttcttcaggg ctgtgtataa gctgaagcca gttgtttagc     14580
     acctttcagg ctataacatg aaaacagtgg ctgcttttat tcttaaacta tccaccgatc     14640
     ggaggcgctc tggacaagga caatctggac ataaaaaagt tgtttgaaga ggtggataaa     14700
     tcctccggtg aaatcgtaaa tctcactcct aatgccagta ataccgtgca gcctgtagct     14760
     ctgatgcggc ttggagtatt tgttcctacg cttaagtcac tgaaaaaccg caaaaagaac     14820
     acactttcgc gtactgatgc gtcggaagaa ctgacgcgtc tgtctctcgc cagggccgag     14880
     gggtttgata aagtggagat caccggtccc cgcctggata tggataatga cttcaagacc     14940
     tgggtagggg tgatccattc ctttgcccga cataaagtta ttggcgataa agttgagctg     15000
     ccgtttgtcg aattcgccaa actctgtggg atcccctcca gtcagtcatc ccggaagctc     15060
     cgggaacgta tcagtccttc acttaagcgt atcgcgggta ctgtgatctc gttttcccgc     15120
     acaacggaga agcacaccaa agagtacatt acgcatctgg tacagtcggc ttactatgat     15180
     acggaaaaag atatcgttca gctgcaagcc gatccgcgcc tctttgaact ctaccagttt     15240
     gaccggaaag tgctgctgca gctcaaggcc atcaatgccc tgaagcgccg ggagtccgct     15300
     caggctcttt atacctttat agagagtctg ccgcgggatc cggcgccgat atcactggcg     15360
     cgtctacggg cccgtctgaa cctgaaatcc cctgtgttct cgcagaacca gacggtgagg     15420
     cgtgccatgg agcagctccg ggagattggc tatctggatt acactgagat ccagcgtggg     15480
     cgcacaaaac tcttctgtat tcactaccgc cggcccaagt taaagccacc tcatgatgag     15540
     agtgtggaga acccgcaact gccagccaca ccgggtgacg tcagtccgga gatggctgaa     15600
     aaacttgcgc ttcttgataa actgggcatc acacttgatg acctggagaa actcttcaaa     15660
     tcccgctgaa cataatctgt agtgagttat ccactactgt ttacttatta cagcttatat     15720
     tactgcctct ggtgagtgtt ctgctcacta cagcttatat aagctgtggt gagtgacgtt     15780
     gtcatgtcag gacgggagta tccggaggat ctgtgcggct gggacggggg tgatcaccca     15840
     gctctctatc tgcctgacat agcttatatc tgttagcggg accagacgaa cctcatcttt     15900
     tggcgggcac tcgcgtcgtg cctgtgtttt ttcagacagc gcccgcactg gttatggata     15960
     cagttagtct ggatatacga cttgttctta aactccggta ttacttcatt acccggatat     16020
     tttttacatc tatctttata ccatcccagt cccgatccac ttctccttca atatgaacct     16080
     tatccgcagg cgaggctgtt tgacccatcc agtatttgtt atcgatgtcc acataaacag     16140
     taccgctgct gtcacggaat tcataaagct cgtgaccgac ttgcctgata atgttgcctt     16200
     ccagtaccac ccacgcatca tcccactgtt ttttagcctg tgaaaccgat gtctgggtgg     16260
     gggccgggcc tgtaaatcct ccctgaacat acccgggctg ctctacggaa gaaacaatgt     16320
     ccgtttgccg ggcaagcgaa ctgaaagaaa gagtggtaat aataagagtg attaaagttt     16380
     ttttcatttc tgttttccct gaaaaaaatt cttggaaaac ttaatgagca aatcttaact     16440
     aaaccttaag cgaaactaag cgacagggta tttgctcctt tttcctgatt acatccgatg     16500
     gataaacttt atccagtggg tgctttcatg ggaggctctt acccccggag agcataaaca     16560
     ttacagagca atacacgagg cctggttctt acttctctgt tttagcgtga aggttgccgt     16620
     gatttttttc atctcttacg gagtgccctg cctaaagcca ccggaggcaa agatacatcc     16680
     ggataatctc acagcccgaa gcattacata ataatttcac ggatgttaag aacttatttt     16740
     tattatgttt tttctaatcc tggtgtggct gatttttata tttttgaaag tttatattta     16800
     ttttttcttt tttgatatat gtcttttcat gtgcaaaaag atttgcattg cagatatttt     16860
     gattttttgt gttgtggcga tcttttatgc tgaattttgt atggcaaata gattcttgcc     16920
     ctactttttt ttgatttttt ggtggtgtat tcttgtttgt tttgtttgta tggtagaaag     16980
     gattgcaaaa atgatctttt tcaaaacaaa catctgtata taattcccgg cataaagttt     17040
     gtttcctttg gaaattttct gtcacaacac cagattgagc cggagataat ccaatgatgc     17100
     tgaacagaaa agatgctgat tattatttgg gcaaagaaat catgctggcc agaataagaa     17160
     gaggggcgct gatacctgca aaagtaaatg aggaacattt ctggttactc atcggtatat     17220
     catccattca cagcgagaag attattcagg cactcaggga ctaccttgtt tttggtgtgt     17280
     ccagaaagga tgtctgtgaa cgctatgaag tgaacaacgg gtatttcagt accagtctga     17340
     accgcctgtc acgtatcagt caggccgcag cgcagatggt tgtttactat tcataagtct     17400
     gtgttgttca cggactgaag gacagcttcc gccaggtatt aaaaacagat aacagacact     17460
     gaatttaatt cagatgcgta tttgtgcgcc tgttttacag agcggttatt aaatatgtcg     17520
     gatgacaact caggattttt acgccgtcac gtcatggctg actttatttc tgccctgtcc     17580
     gggaaggaat aaagccagcc atgctggaaa atgtgaatgt gtattttcat tttgtgaaag     17640
     tcaaaaaatt aaattcaaga ggttatatac atgaaaaaga gcattattgc ttccattatt     17700
     gcactgggtg ttctgggcgg gactgcacac gctgccaatg aagtgacttt cctggggtca     17760
     gtgagcgcca cgacctgtga cctgaccact tctgtcaacg gcgcagctca gccgaaccag     17820
     gttgttcagc tgggtaccgt tcaggctaac cagacgggta atgctgttga gttcgccatg     17880
     aagccggctg acccgaccgc acaggcttgt ggaaacctgg ctcagaaaac ggccactatc     17940
     acctgggctt ctgctgccct ggatggtgaa ggcttcgggg caaccagcgg tacagctgct     18000
     gatgccaagg tactggttga cagcgtgaac tccaaagcac cgggtgctgt aaatgctaac     18060
     gccagttcag ttgacttcga cggcgctaac ctgaccaccg acggcctaaa gttcactgca     18120
     aaactgaagg gtggccagac tgaaggtgac ttcaaatctg tggcatcttt cgcggtgact     18180
     tacaagtaat cacccgtaag cagaacctta catattttat ttaaatgacg cggcgtacgg     18240
     cggtgcgccg catttaatta ccttgttcgt tgtttttata tcgctgattg caggccggga     18300
     cagcacctgt atattcatcc cgccatcctg cattccgtta ttacctgttt aacaggaaat     18360
     tgtattttcc gtgcaatttc ctccggagag ggactgtctg agtcaggggg ttgttgtgtc     18420
     atttcatcac cgggtattta aactgtcggc gctgagtctc gccttatttt ctcacctgtc     18480
     ttttgccagt actgactcag agcttaacct ggatttcctg cagggaatgg gcgccattcc     18540
     ctccgtatta aaatccggtt cggattttcc ggccggacag tattatgtcg acgtcattat     18600
     taaccaggaa aacgtgggta aggcccgttt atccattacg ccacaggaag agtcagcaaa     18660
     cgccctgtgc ctgtcgccgg agtggctgaa agctgccggg gttcctgtcc gcctggaggg     18720
     gtatgcctcc acgctgaatg ctgccgggca gtgctatgtc ctcagccgca acccctatac     18780
     cagggtggac ttcagctatg gctcccagag cctggtgttc agtattcccc agtcgttcct     18840
     ggtcggtaaa acggacccca gccgctggga ctacggcgtg ccggcggcgc gcctgaagta     18900
     ctccgccaac gcctcgcaga cgtccgggca aagcaccagt gcctatgcga atgccgacct     18960
     gatggtcaac cttggccgct gggtgctggc cagtaacatg agcgcatccc ggtacgctga     19020
     cggctccggt gagttcaccg cccgggatat cacgctgtcc accgccatca gccaagtgca     19080
     gggggacctg ctgctcggta aatcccagac ccgcagcgcc ctgttctctg atttcggctt     19140
     ttacggggcg gcactgcgct ccaacagtaa catgctgccg tgggaggccc gcgggtatgc     19200
     cccgcttatc accggggtgg caaactccac ctcccgcgtc accatcagcc agaacgggta     19260
     caccgtgtac tcaaaagtgg tgccgcccgg cccgtaccag ctggatgatg tccgctccgt     19320
     ggggaacggt gacctggtgg tgaccgtgga ggatgcgtcc ggccacaaaa ccaccaccgt     19380
     ctatccggtc accaccctgc cgacgctgct gcgtcccggg gagattgaat acaacgtggc     19440
     ggccggtcgc aagtccagta actatcagct gaaaaaaccg ttccgggacg gtgaaagcgg     19500
     cacgttctgg atgggaagcg tggggtacgg ctttgactcc accacgctga atgccgcctc     19560
     catcctgcac ggtaaatacc aggccggcgg ggtgagcgtg acgcaggccc tggggggctt     19620
     cggcgccgtg tctgccggga tgaacctgtc acaggcgaaa tacgacaacg gggacaacaa     19680
     gcgcgggcac agcgtcagcg ccaagtatgc caaaagcttc tctgacagct cggacctgca     19740
     gctgctggcc taccgttacc agagtaaggg gtatgtggaa ttcgcggact tctacagcac     19800
     ggaccggtat acccgctaca acacaaaatc acgctatgag atgcgcttct cgcaacgtct     19860
     ggggaacagc aacctgaacc tggccggctg gcaggaggac tactggtgga tgaagggaaa     19920
     ggccaccggg ggcgatgtct ccctcagcac caccattctt gatggtgtgt cggtcttcct     19980
     gaacggcagc tacagcaaac gcccgtacct ggacaaaccg gactacagca cgtcgctctc     20040
     cttcagcatt ccgttcaccc tgggtggcgt gcgccattac agcagtaccg gactgagcta     20100
     cagcagcagc ggcaggatgg ggatgaacag gggggtgtca gcaagtccga cggaccgcct     20160
     gagctacggc ctcaacacca acctgagtga taagggcgac cgcagcctga gcggcaacct     20220
     ctcgtatggc tttgatgcca tccagaccaa catgatgctg tcgcagggac gtgataacac     20280
     caccgtgtca ggcagcgtga gcggcaccat tctgggcacg gcagacagcg gcctgatgat     20340
     gacgaaggaa accgggaaca cgctgggcgt ggcgcgcatt ccgggggtga agggcgtgag     20400
     gattaacggc tcagccccca ccaacagcaa gggatactcc gtggtgaacc tgtcggatta     20460
     ctccctgaac cgggtcagcg tggacatgga aaacgtgccg gatgacctgg agctgcagac     20520
     cacctccttt aacgtggtgc cgacggaaaa agctgtcgtg taccgtgagt ttggcgccga     20580
     gcatgtgctg cgctacatcc tgcgggtgaa ggagcgtgac ggacggatac tgaacggggg     20640
     cagcgcgcag acggagcagg gactggatgc cgggttcatt gccggtaacg gcgtcctgct     20700
     gatgaatatg ctgagcgcgc cgtcacgggt cagcgtcgag cggggggacg gcagcgtctg     20760
     ccatttttca gtgaaaggta ttgtgcccaa taccggcaaa gttcaggagg tttattgtga     20820
     ataagatgat gaagtgggga ctggtgtccc tgctgtccct ggccgtcagc gggcaggcca     20880
     tggcagcctt tgtgctgaac ggcacgcgtt ttatctatga ggaagggaga aagaacacct     20940
     catttgaggt gaccaaccag gcggatgaga cctttggcgg ccaagtgtgg atagacaaca     21000
     ccacccaggg cagcagtacg gtgtatatgg taccggcgcc gccgttcttt aaggtcaggc     21060
     ccaaagaaaa gcagattatc cgcatcatga agacggacag cgcgctgccg tcagaccgtg     21120
     agtcgctgtt ctggctgaac gttcaggaaa tcccgccgaa gccaaaggcg tcggaaggga     21180
     atgtcttggc ggtggccgtg aacacgaagg tgaagctgat ttaccggccg aaagcgcttg     21240
     ttgagggacg ccgtaatgcc gagaagaacc tgcagattac gcaccgcggc ggtgaggctt     21300
     acctgaagaa cccgacgccg tactactttg cggtcaccgg ggtgaaactg aacggacagc     21360
     cggtcaggct gaacgacagg gtgatgaatg agattgcgca gctggcgccg aagagtgagg     21420
     tggcgctggg gaaactgtcg ctgaacggaa cggtgacggt acaggctgtt aacgactggg     21480
     gcggcaccca ggactacacg ctgaaatgag ccgggagggc aggataatga aacagaaaga     21540
     ataccggacc gtgcggataa cgcgacacat gcgtgcgggc atgctggccg ccgggctgct     21600
     gcttcccctg gtggccgggg cggcgacaag tggaggcatg ctcatcccgt tcgagataaa     21660
     caacccgcag cagacctgtg acctgacctt tgataacggc agcaccatga tgacctatca     21720
     gctgggcacg atgagcaggg ggaaccggat acagcacagg ccgtttaccg tcaccgtgga     21780
     ctgcaggggg agcacggcag tgaagacggc cctgacggca aggagcacca cgggaacgct     21840
     gcaggggggg ggtgacagcg tcatgatgcg ggtgaacggt caggcgtcaa ctaatggtcc     21900
     gctgttctgg ctggagaatg gcggacagcg ggtgaagctg acgggggcaa aaagtgatgc     21960
     cttctgcatc tcccccaccg ccccgaacag gtgtgagctt cgtccggtga cggatatccc     22020
     gacgaactcc ccggagggga atattgatgc gacggtggtc tttgatgtgg tttatccgca     22080
     gtaggcagcc agtataaatc gcccggcgtg ggttaagcgc accacaatat gcgaatgaac     22140
     cgtgtcgata acaacggaca aaactgtaca ggaatgatta tgaaaccgat ttcttatttt     22200
     accgggagca gaaaacgcag cagcacatgt ctgatatcgt cgttgctgct tccgggaatg     22260
     atagccatgg gtatttcact ccccggcacc gctgcaatgg ttgagttcgg gggggactat     22320
     acctacagag gcacaataac cgtgaccgga gaggcgctca tcggtcctgt tgtagatgta     22380
     agggtgccta aggctggtgt gactctctgt agcccgacca gagtgacggt ggaacaatgc     22440
     aacgcccggt tagagcacaa aaatcaggat ggctcatgga atgttgtgac agggatgcag     22500
     tgtatagggc aaggtagcaa ttatttaagt gtggtgaccc ccatctcaaa aatctataag     22560
     ctcgtgtacg gcgatttcta ccgtgtcgtt tttgacgatg tgagggggag gtttgaacca     22620
     agtggagcag ttgagcatag ttcgcgttgt atgattgaca aaaatagcat cacttgggga     22680
     aatcctgtca gtggaggagt actggagttg agtacatcgt caggtcaaac tgaacgtttg     22740
     gctatctatg gccagcccga gacgacattc ttaatgccag tcactgcggt cgataaaact     22800
     tatatcgaat acccggccat gacccggttg agtgttgctc ccgacggaag cgcgcgcgga     22860
     caggtagtca ccgttgtggg tcgtaacgca caagtgaaat ttaccctgag ggaggcttat     22920
     ggtaataata atttgaatca gtattggata ccaacggctg ctagcgggaa taaaattaaa     22980
     ccgcagttga taaaaaagga cggatcacaa tgtgtcaatg cccgtgaagg ggagtcatgt     23040
     gacctttatt atccaccggg ctctgtacct cccggacgat actaccgcgg ctatgtggat     23100
     atttacgcca cggtatattg acgtcacggt gaaataatcc gggagcaact tcagctattc     23160
     ccgagcttat gctcacattt tctcatggag actggaattg tcggcacagg catctttcac     23220
     cggaataaca aagcgggtca aaaatgcata aatgttattc agcgagctgc tcaaatgtta     23280
     ttacccgacc tcaatggatg ttattgggtt atatctttcc atggaaatac gcaatgagaa     23340
     ggcgctgttt ttatttacat cacaaagagt aactccggtt tatgagtgaa tccatcatta     23400
     cacatatcat ctccatcatc cgggagcgtc agagcgcgca cgacggcgcg cctgttaaaa     23460
     cccgcgatat tgccgatgct gccggactca gtatctacca ggtccgctcg tatcttgagc     23520
     agctccgcac tgtcgggggg cttgagaaag tgaatgccgg aaagggagta cccggattat     23580
     ggcgtctgct ctgaccgctt tcccggaaga cggggatttc ggccggattt ggtacgaccg     23640
     gctttgtatc gaatttaaca gcgacggcgg actgagtccg gctgagctgc gggttatccg     23700
     gctgctgctg cggggttata acagtgggca gattgccgcc ctctgttttc gcagcgtcaa     23760
     aaccatttca gcccagaaag gccaggcttt caggcgcctc ggcgtcagga atgatgccac     23820
     cctgttgccg accctgatac tgctggggat ggtgacactg tacaccgacc tgaaccgggt     23880
     tcattcactg gaagaggacg gcccggaatc atgatgccgg cagataaaac accccccggt     23940
     accgtccgga ggagagatat ccccccgctc cgcgcgctga ttctcctgct gctgaccagt     24000
     gtctttatct ccggctttct gaccggcgtc ctggccatgc tctggcttat ctgccgtggg     24060
     gcatgatgtg aagtccggtc tcccctgtaa cagaaaacat aactttcacc accacgatgt     24120
     tcagatattt atataaccag aaagcagcac tgctgaccgc cattctcctg atggcggccg     24180
     gcgtgctcac cctgtgtttc ccggagtcct ggtacccgca ggaaacagaa tggcagctca     24240
     cggcagaaaa agaaattacc gggatacacg gcggcctctc cggcctgaca tggaacccgg     24300
     acagcagaac gctgtttgcc gtgaccgacc acccctcctc ggtggtggag ctggacacgg     24360
     aagggaacgt gctgcgggtg ataccgtcag acggcgacca cgattttgag gccatcgaat     24420
     acctcggcgg gaaccgctat gccctgtccc gggagcggga acggacgctc accacccact     24480
     gcattgacag cagcacgacc gtcctcccgc cgtccaggcc cgacaccacg accacggcag     24540
     actcatgaga attgagtttg tagcgcgttc tgggcaattt tttctgcttt gctggtactt     24600
     tctgtttaaa acggttctga gtggctcctg ttacgttcag gggatggagc aaaaggaacg     24660
     tatgacgtca cggtagctaa aattgtcaac tgctgaatcg tggggtcccg cgccagcggc     24720
     gtgggttccg attcagtggt tgacaactgc atataaaata ccctgctggc ggggtgatgg     24780
     ttcacgcagt gggccatcgc cctgcaaagc cagacgggac ataacgccac tcagtaattt     24840
     agttacatca ttcattatta aaagcgactc cattccggcc ctttgggccg gggcggcggc     24900
     gcttttcagt ggtgggaatg ggctggatat caggtttttg cttcggtttc gttggtcagg     24960
     attttggatg ttgtaactat ttgcatgacc ggggcccggc gcatcgcgac gggaggtact     25020
     aatgttgttt ccgaaccggc gcggacgtga gtccgctgca agggcgggca ttctcctctg     25080
     gaacctgtcc acagggcagg tgatgaacag gttatttatt tataagagag aaagattatg     25140
     tatttaaaag aagtacagat ctggggttta aaggaaacca cgcactttga aatcaggtcg     25200
     cctggcgctt tgtcagtata tcggttgtaa ctttatggaa aggtcccttg cagttatttg     25260
     tgagtaactg aatattgcga ccggaaatga ctcaggcggg aacatttctg gccattctgg     25320
     cagcagaatg agagatattt tagcaggaag aacgagcgtt ccgcgcagaa aacaggcggc     25380
     gcccggcgac agacgtacaa aatcctccga cgtcagccgg attttcataa tctggtgggt     25440
     tatatgggga cggtggccat ggtcagtcgc gtgtagtttt tgccccgcga catcatcatg     25500
     cgctctttca cgcgccgctg cagctcccgc ttcatggcat caagcccgcc ggtaaagcgt     25560
     ccgctggcgt attcccgcgt cagctgctgt ttcaccagtg tttcgatgtc cttacgggtt     25620
     ctgtccgcgt cacgccgcgc ccgggcgcgt ttcagtccgt gcagtttacg ttcagactgg     25680
     tagctgcgga accgttcgcg cacaaatcgc caggctttcg ctatcagttc gtccatctcc     25740
     agtggctcca gattctgctt tttgcgctgc tgattttccc attcgacacg actgcagcgg     25800
     gcggccataa cagccacgtc agaaacgtcg agcgcggaga acagtgccgg cgtgaaggtg     25860
     atatcggtcg ggatgttgca gccaatctgc ggatcgtact cggtctggta ggtaatcagc     25920
     cccagctctg ccataaactt cagcgcccgt gtggcgcggg tgatggacag attaccactt     25980
     tttgactcag tggccagacc gcactctata gccagattgg tgatggatct ctgtacacgg     26040
     ttggccagtg gatcataatg gaagcacaac ccctgaagca gcgcatcgat ggcacgacgg     26100
     cgcagcaaag gcggcatccg gtgacgcttt cccagcgaac gaacgaacgc cacatggacg     26160
     gaaaaatcaa aacgggacgt gaacccttcg gctttcgcca tcagcttacg acagaacggc     26220
     agggtctttt tcccttctct cggcgtgaat tccggattcg gatttttgac ctgtcggtaa     26280
     tgagtgaaca gtgttcgggt gtcagtcact tctgcctgca cttacaatgc acggaaggag     26340
     taaatgccac agaaacaagt attgaaattt tctgagcata aaactatact ccctgcatag     26400
     cctgattggt ggctatacag tttaagtagg ccccgttaat ctttcgttcc cgccaagaaa     26460
     tgagaagatt atcggggttt ttgcttttct ggtcccgggt agacacctca tcagaaccag     26520
     ttccctgcca ccttacggcg tggccagcca tcaaaattct ttagacgatc agcaatctaa     26580
     cactcactga cgagacgatc aagaaagtta ctcattcacc ttcttatctc aggctctttt     26640
     agccatttcc cgttcaatta gtagctcaat catttgagcc tgagtagttc cagtctcttc     26700
     acaaagctgc tgcaagcttt ctttatgtat gttttgtatg aaaacattga gctctttatg     26760
     cgtcgtcttt tttcgtgaaa tagataatct cttcttctca gcggaagata agggattacc     26820
     ctttctgtaa atgcgtttcg atgaggaagt tactgcattt tcaatctgcg acatctctgt     26880
     ctcctcaagg atcaaaccta gatcgtttgc agagaatact acagatttct aaaatcagcg     26940
     acttacttta tgaacgtaac ctgtgttggc gcacggttta cgtttcaaga tcgtttcctg     27000
     ggatgtcagt acgtctgttt ccagtccgtt ccctgcgccc agcgggatgt ccagtggttc     27060
     aggtagctgc gggctaggac tgagtcatcc cagacgacag cacgttctcc gaattcgaac     27120
     ggtctgctgc acgggaatag ttaaacgatc ccacttcggt gtggcgaccg tcgctcgttt     27180
     ttcccggatt gccggggctg gacaatgacg cgagcggcgg aggcgtcagg ataaattgtt     27240
     attgccttcc ctagtggtgg cacgatcatt acgctccatc ccggccagaa tcagcacggc     27300
     cgcgttttcc agagtttcct gtcccgcgcc gcccggtatc actgtcacgt tcttctccgt     27360
     ggccttctta accggcatca ttatcatcac cggcgagccc tgcagcgcaa gcgtatgtgc     27420
     cagtcggtta ctggcatcca gtatgctttt cgtgttcacg tttccacccc tgattttatg     27480
     ccctttcagg acggcggccg ccgcactact gatatcttca ctggtgagcg cgccttcata     27540
     atgactggtg gcaaaaatac cgttgtgata cgcaagccag gcatccgccc tcgctgattt     27600
     ccagatttcc agccccttct gtgcggcttt cagcgagttt tcccactgct gtacaaatgt     27660
     gggccagtac ttaaacacat agcggacctg cggcctagct tcacagcctg cagcatcggg     27720
     gtaaggccgg tgccacgccg tacagacgat ctttctgttt catccgttca ctcattatac     27780
     tgggcttctc cggttcagac cgtctgcgcc agcaccgcgc ggagttccgc ttttctggcg     27840
     ttctgcgccc ggacctttgc cagtcgcgcc agcgcgtact gttcttcctc cacggtaata     27900
     tgctccgtca catacccttc cgtgtcatat cggcaggccc cggctttcat cgcgctgaga     27960
     tatgcttcag aacgggcaat cgctttcagc gcacggatta tctttttgtg tgacagcggg     28020
     ataccacgcc tggaggcgtc ctcaaacagc gcctcacgca cgccacaggc gaaaagacgg     28080
     ggcgtgtcgc cgtcaaacag ccccggccac cagggtttca gcgtgctgac cgcttcctcc     28140
     actgactgaa atcgcaggta gatggacaga tcttttcttg cccgggcttt tttttctgcc     28200
     agtgacgctt cccggacagc cctgtcagcc agttgctgtt tcttcacctt ccacttcggg     28260
     ggcgtggtga cgttaataat ggttttgcgg ctgcgggccg gcgcttcccc atccgttttc     28320
     cgtttcagtg tcagtaccgg tcgtttctgc tcagtcatgc tgtatgctgc ccctgccaaa     28380
     tcctgctcat accgccaaag ataccacacc cgtcacatcg ccagaacgcc cagggcagcc     28440
     agatggcagg tgtagaatac cgggaaaaaa tcagccggcc agaaccgggg ccgtgatttg     28500
     cctgtcagcg aaacaagcca taccgtcagc ccggtcacca gaagtcctgc caccgccgcg     28560
     gcatcactgg taaccagatt cagcgcgggg acggccacca ccaggcaggc cgcaagcgcc     28620
     agatgttctt cagtatctgt gatccggtac agccggtaac agatgaccag caccagcacg     28680
     ccggcaacgc cgtagctggt tccggacagg ggtatccacg ccgtcagcag taacagcgcg     28740
     gccgcagagt gaaacaggca gcgctgctca caccacttca gcgcctgcgc ggtcaccgca     28800
     aaggcaaaca gaatattccc ttcataccac ggaaatcccg ccagaaaata tccggactgc     28860
     gcgataaccg cccatcccca cagccggtta atcgcagact ggcggatatg cgtatgccgg     28920
     gacaggttca gcccccacac cagggcaaac agcggaaacg ccccgcgccc ggccagaaac     28980
     agccactctt ggttcaggtg caggatacgg ttaatatggt cagccaccat cagcagcagc     29040
     gccacggttt tgatgagatc tctctgtccc ggcgaccagg ccagcagtcg ctgcagccgg     29100
     gtatccaccc ggactgcccg cgaatcgtta cgtgtggcgt tatccatcgt catcgtggtt     29160
     tatcttcccg tatcagtccc cgcccggggt tttctctttc tgcaggtcac gcaccatctc     29220
     ctgctccatc tgctgcagcc gctcccggcc ccggttttcc cgcgccactt cccggatggt     29280
     ctcccgctcc cgttgtggtt cgcgcagcac actctccggc agcgggggtt cccgttcagg     29340
     cggggtcatt ctgtcctgct cctggccggc aatctccctg accgcctgcg cggttttctc     29400
     ctccggcagg tcagatttgt cctcagccat tttacggaca atctcatccg cacggcgttc     29460
     tgtttcacgg cggactgcct cttctgcctg ccgctgtgcc agaatctctg ccgtgaccgg     29520
     ctccccgttc cccgcgccgg gctgcacgtt actgtcagga atatcgcccc acaccctgcc     29580
     gccggtaatg gcgacgggat tccatggacg cccgtcaccg gcaattcgca ccaccacgcc     29640
     gctgtcgggg ttctcccggg caatccggac gccatcctgc atgctaccag ccagcaggct     29700
     ttcgccgtta cgactgccct gcagggccac aaactgcgcc tcttcactgc ctttcacccg     29760
     accttccccg gtgaatcccc gcagcccggc accgtcatcc gttgtcagcg ggttcagcca     29820
     gataccggcg gatttaccgt tacggtcaaa cgccggcagc gccacatatg gctgcggata     29880
     cttgcgcccc ggtgcaataa aacgcgcccg gctgtctccc tgcgccagtc cggcgttgcg     29940
     cagcacggca cggccggcag ccacgtcccg cagttcccgg gcggtgctga acaggcgctc     30000
     tgcgttcatc atctcacgct ctgatttagg ctccagcacg tcatgggccg tgcccttttg     30060
     ctccgcactg ttgatggcct taacccagcc ctgacggtcg tcggtgtaca cctgcacatg     30120
     ctgcttcata cgcgacagcg ccacatacgc cgactcaaaa ccggccatct gtttccggcc     30180
     cccttcggtt ccctccagcg caatggcaaa cgtctcactg gccccctgcg caccgtgggc     30240
     ggtgatggca tacgccaggt caatatgctg ctctgccctg tcctgcccgg gccgcaccac     30300
     gcgggtctgt ttcccgtctg acagcgtgac gctgtcaccg gccccccccc cccccggata     30360
     gtttccggat tgtacagtgt gacgccctct gccgctgctt cccgggggga aatcaggcgc     30420
     gtgttgccgt cggcatcctg cagggttatc agcccgtcct ccttactgat accggcaatc     30480
     cggtgataca cattatccac cagggcaagc gcgccctgat gattctccca ggtggacaga     30540
     cggcgcagct ccccgtcacg gatattcgcg gtggtaagta cagggacagt gacctgctgc     30600
     tcactcggtt tcgccagtgc atcctgaatc atactgttca gcacccgacg atcctcattc     30660
     agatgcgtga caatcagcgt ctgctcccgg gcgtccggcg ttctgccggt atagtcgcgg     30720
     acaatggcct catacagcgt cacgggcaca tccggaaagg cttcgccctt tttctccgcc     30780
     tcctgtgcgg ctttctccag ctcccgctcc tgcagacggc tgaactccgt caccgagttt     30840
     tccggcgccc atgccccctt caggcgggga accagaaccg gcttcacgct ttcaagcccg     30900
     gacagtgcct tattcacatc ccggttaatc aggctgtaca cggcgtcccg cagttccggc     30960
     gtctggcgca caatctcctt catgatggcc acatcagccg cgctgcgcgt ctgctgcaga     31020
     cggaaaggct ggccgggtgc gatggcctgc agctggtccg tgtcaccact cgccacggca     31080
     cgaccaccac cggccgcaat cagggcgtat gcccgcgcca tatcggtgtt gcccaccatc     31140
     gaactctcat cgagaaggaa cagcgtgttg ctgaaatccg gcatttctcc gctgcgctgc     31200
     tgcagcttcg tgtcatgcag aaaggacgcc agcgtctgtg cttccacgcc ggcactgcgc     31260
     atctccccga ccgcacggtg cgtggggcca agccccacga cacggggaca ctcactctcc     31320
     ggtagcatgt tcacggcaga catcaccgcc cggaactggg tggttttccc cacaccggca     31380
     tacccctgta ccacggtgaa acgatcggac gtttcgagta tcatgcgggt ggcggcgcgc     31440
     tgccctgatg tcagcgtctc catgagttcg cccggcacct tcgtcatcag cggcgtgacc     31500
     gcttccttgc cttcgagaat atggcgcaga atgctctttt cagcctcata cgacgcacgg     31560
     gaaaccagca ggtctgtgcc ataacctttt gccacatcca catgcagtaa atcgccccgt     31620
     tttatctgag catcaatttc ccgtcccagg tcagcaaaac cggttccctc tgcagcaaat     31680
     gatttcgcct ccgtcagcag gtccacctgg ctgaatgcca ggtttttact ttccaccaca     31740
     ggaatggcca gatgaatggc ctgctgtgcc ggcatgtgaa gcccggtttt ctggcggctg     31800
     atggcggttt ccagcgatac ctcaccggca cgcgccttta tctgctcaga aacgactgta     31860
     aaagacgggt gacgggagag tttttcagca gtgcgggtct catccagtga ggaatacagc     31920
     cggacatccc ggccgctgcg ggccagagcg ttcagggtgg cgttgtccat cgccatctgt     31980
     gtgacggagg caaaaacttt cgcactgtca ctgacggaat gtccgggtgt ttccacccag     32040
     ccgttttcca gcttcagcgc cgtgaacggg gaatccccca ccggcaggga agccggctca     32100
     gcccgtcccg gagcgatgac cgtcatcatg ccatcgttca ccgctgatac ctgcagccgg     32160
     tcgccgccgg agacgcgaag cccgggaatt tttcccgtca ccataagacg ctcgccgtct     32220
     gccaccggta tcttctccgg ccggaagagt gaccagctgc tgtccagggc tgaaatccgc     32280
     accatctgcg tctctccctg cgcatcccgc agggtcagac tgtgactttg tgcggtcacc     32340
     cggtcaatca cataccggtc atgggaccgt ttctccgggt tccactgctc catcaccatc     32400
     ccttcacggt acatgtcgcg caggtaacgg ttccggctgt ccagccagac cggcgacagg     32460
     acggtcatca tggtgtcctg ctgcccgagt atctcctgcg tcttcagctc actgcgtatc     32520
     atccccgcca gtatggcctg ctcacgcacg ccgctgacct gcgccacgct ctcttccccg     32580
     gctttcaccg cggccacaaa atccccggcc agccgggcat agcggacatt ccggtccggc     32640
     tcgctgataa tggtcgccgg ggtctgctgc ccgccctgcc agcggtaact gttcacgccg     32700
     gcctccttca tggccatcag cgcgctgccg gtaccggtgc gctgaccgct gtcggtaatg     32760
     agtacctgga cgttatgacg cgccgcgcca tccagcaggg tcagagtctc cttcagggac     32820
     agcttttcgc cctggtcgac aataacggta ctgcccgggg aaaatgacat gccctcctgc     32880
     aactgacgac gcccggttat cagctcaccg gacagacgtt catcctgctt caggtttgtc     32940
     tgcgaacggc ggtcggcggc aataatctgc acctcacgcc cctgctcccg ggccatcatc     33000
     gtaagttctg ccacccgctc ccgctgaccg gcagcaccgc cctgaccact gataatggcc     33060
     agtgacgggc ggtcccgggc caggacactc accgcgtcgc tgtaacttcc cgtgcggggc     33120
     acgctcttct ccggatggac ggtcacccgg ttctgcttca tgatatcgct gctgagtgcc     33180
     cggacagaca gctcatcgag cacatgaata cctgaggtga acagtccttt cttccggtcg     33240
     agggggataa gctgttcgcg gctgatggct tcatcaatcc cggcccgggc cttctcaatc     33300
     acgccggctt ccggcggcag catcccgacc gttctggcca gcacgtcggt atacgtaaac     33360
     tgaaccttcc ggtcgcttaa cccggcaatg gcctgcgtca ccgcctgctg aatatccggc     33420
     tgctcctgtg acggaacagg ctgcgctgcc tgtatttccg ccctcctgtc cgcagcctca     33480
     cggtatgcgc tgatatcaaa accggtatct ttcagggtct gcatccactc agccattttc     33540
     acttccggat cgacatgctg tttggattta cgcgtatcca gcgccgccac atcccgggat     33600
     ttcagcgacg cgtcatcacc tactgcttcc cgtatagtct gcgaacgact ggaaaaggcc     33660
     tccaccggga caccgggcat ctcccacata ccgtgcttac cgaccacttc cgtttcatag     33720
     cccagcgctt caaccttctc tttcagcacc gcgcggtaaa tcttcccgaa ggctatctgg     33780
     ttagcataga cattctcgat aaatcccgtt tttcccacct tatcgctgct cagggtcttc     33840
     cattccccgt catgctgcgt gacgttggcc accacggcat gggtatgcag ctgcggctcc     33900
     tggtcacgac tggtgtcatg gttgaacagc gccatcacca gattaccggt gagcaccgtt     33960
     tctgactgcc cgtccgtcat caccctggtg gaggccagcg cttccacctg acggacagcg     34020
     atatccaccg cctggttgtg tgcctcagtc aggcgtttat cgcctgccag catggccatc     34080
     agggaaacac ttttgggggc agagaaggtc agatcatagc cggggcggtg tttgttgccg     34140
     ccgtcctgct gccggctcag atcagccccg tcgggcagtc tgccttccag tacccgggtg     34200
     aacacctcct tatcgacggc gccctgcagc cccagctgct ccgcgccttt tccggcccag     34260
     cgttcctcca gactgcccag cacgtagtag ttatccctgt cgctgtaata accggcggca     34320
     ctccccgctg accggacctg tgcaatgctc atcataaatg tatatccctt tgacatatcc     34380
     catcacaaaa accataatgg atatacgtaa gacatatccc tgtaaggagg cacatgatgg     34440
     aaaccagcgt atttctcagt aaccgaagtc aggcggtcag actgccaaaa gcagtggcat     34500
     tgccggaaca tgtaaaacgt gtggaagtta tcgctgtcgg gcgaacccgg atcatcacgc     34560
     cggccggaga atcgtgggat gaatggttcg acgggaacaa cgtcagcgcc gattttatgg     34620
     ataaccggga acaaccctct gtgcaggaac gggaatcatt ctgatgctga agtttatgct     34680
     ggatactaac atctgcattt tcacgataaa aaacaaacct gccagcgtca gggagcgttt     34740
     taacctgaac caggggagaa tgtgtatcag ctcggtcacc ctgatggagc tgatttacgg     34800
     tgccgaaaaa agccagatgc ccgaaagaaa tctcgctgtg atagaggggt ttgtttcccg     34860
     acttgatgtt ctggattatg acacgccggc cgccacccat acggggcaga tcagggcaga     34920
     gcttgcccgt cagggacgcc ctgtcgggcc attcgatcag atgattgccg gtcacgcacg     34980
     cagccgggga ctgattgttg tcacgaacaa cacccgggag tttgaacgtg tgggtggact     35040
     gagaactgag gactggagct gataccgcca tcagaaatca tctcccggct ccggttcatc     35100
     ctttccgtgc ccacggtgaa cgttgatatt cacctcctcc cgccgttgca tctgctgctg     35160
     agtattcacc tcctgctcct gctgccagcg ctcatacgcc gccatgtcca ccacctcacc     35220
     ggacgcatta atcccgaggg gcagtggctg ctcttcgtct tccggcttca ttttcagttc     35280
     ctgtccgaca ccgcctgcag gcgtattcac ggcggtaccc gccgctgctg attttttatc     35340
     gctgacaacc gtgggctgtg gctgttgcgg ctgttgcggc tgttgcggct gttgcggctg     35400
     ttgcggctgt tgcggctgtt gcggctgttg cggctgttgc ggctgttgcg gctgttcagc     35460
     ctgcgcttct gctgctgtcg gcgcaaccgc ttctgtatcc ggttcaaaca ggctggacat     35520
     ctgacgtccc tcggcttccc ttgcagccag aacggcgctc agacgggctt ccgcctccgg     35580
     attcatttcc cggggaataa actccggcgc cactttggga cgttcctggt atttcagggc     35640
     cagcttcact gccggatagg gtccgggcag cgtgacataa caggtcaggt cgggcagtga     35700
     ctgaatatcg gagtagctga ccagtgtgac acgctccatc tctttaccgg tcgacacccc     35760
     gtcacgaacg ggatcggcac cataggaata ctgctcactg gctttcagga tctctttttc     35820
     accaatctca tgtgcgacat agtcggcaat tttataactg ggtgagcgga agaaggccct     35880
     tgtgttcatc acatccagca gggttgccgc cgctttctca ccatagatat cctccatctg     35940
     tgtactggac tgaataccaa agacatagca gcccccgaat ttacgggctt ccgggacaat     36000
     ttccacgagg tcgggcagct tgtgcagcgt gggcaactca tcacagaaga accacacccg     36060
     acggttacgg ttctctccca tcgccagcag gccccggatg gcaatggaca gccacatgga     36120
     aatcaccggc ttcagggaag aatgtgtgtc agcgtttgaa gaaataaaca gccagccgtt     36180
     tttttgatcc tcccggacgc cgcgcatcca gtcacggatg gtgaacggtt caccgttacg     36240
     ctcgatcccc tgaagatagc ggacgacttt tacgtagttg gtcagcacag cccggatgga     36300
     aatggccgtc ttctcgattt tttcttccac caggttggcc gccggggaat cacgcaggta     36360
     ggttcgcagt ttttcaatcc tgattgagag cagagtgtca accagcttgc tgtagctgcg     36420
     atcgctgtca ttacgcatca ggtatgccgc ttcagcaaaa atggttcgtc cggaaccctg     36480
     ccagaacgga tcttccttcg tgcccatcgg gatcagggta ttcgccgcat tatcaaaatc     36540
     cggcagggtg aggcattccc gccataaatc ccatgcggca caccgcgcgt cacaagggtt     36600
     gagaatttta tcgatggacg ggtcgtagta gcttttgaca aactcacagg aacgatcgta     36660
     catcaccacc atgtcgccgc gctgacgggc atagttagcc agccggcgta tgatttcaga     36720
     cttaccggta ctgactgtcc cgtggagcaa aaagttctga atctctgaat ccttaatgat     36780
     tggcaaatcg ccaatcagga tatcggacgc ttttccgtct tttttcagca tcctggcaac     36840
     gtctttcgga ttgtcggtaa gctggcgtcc tccggtaaca tcatcctcac tctgctgttt     36900
     tccctgacgg cccagaatcc atgtggccat aaaaaatgta atcaggcaga taaccagcgc     36960
     cacacaggcg gccagaacaa aggccgacca cagttgttcc ccacaccaga ccgtgtattt     37020
     gtcctgcaga acctgggcgg cgttcatccg gaacgtctgg ccgtaatacc ggatctcata     37080
     gataggctgg gatttaatta aatcccgcat tccttcaagc gtggtacacc accagtagat     37140
     acacccattc acaaacgtct gccagctgag tttcacccat aacaccaggc cgacgagtat     37200
     ccagaagaaa ataaacaggc agtaaaatat aatgttggcg atctggctga acatgcgaat     37260
     acgcatggac gcaatctgac cgccctgggt catatccttc gcattaaagc tcatagatgt     37320
     tattccaaag aaagattatc agtccggacg gggaattaat ttgaataaat gaccagccgt     37380
     tactttcgtt ttttcagaaa ataaagaaca gcagcacagg ctaccagtac agcaaacagc     37440
     caggaaaacg gattgccgtt agtcatgtga caaagaagtt ctgataatgg cattccgtat     37500
     ccttattatt cccgcttcgc ggcaacactt cacggccgca caaagaattt gcacaaccgc     37560
     tcagtgtttt catatttatt tcggaaacgc cggagagaaa tgaaatttat ttctttccgg     37620
     ccctggacaa cgagcaaagc gaggcgtcag tcaggaggcc agtcagaccg gcctcctgaa     37680
     gatgattaaa gaatatttgc aattgatttg gccagttgtt cttccagaac aggcttcgcc     37740
     tcttcaaact tcaggttaac cttgttggca ttcgatacca cacggatctg gtatttatgc     37800
     tgattaccgg tttcagtgct ggtctggatt ttagcacccg aggttccctg gcgaggtgcg     37860
     gccacgttat cggttgtgac cgtcgctttt gtccgttcgg caatctgcac atccgtaatc     37920
     atggtgtagt tgacatcctc aaccagtgca tcggcagcca tacccgccag tccggcagca     37980
     agccctaccc ccagcgtggc acctgctgag ttagagttat acgctgtgat accggccccg     38040
     agcgctgccc cggagagcgc accttcataa ccacggttca gccatccctg ggactcacgc     38100
     aaatccatct tgtcggcctt cagcacgttg gcctgaatcc agtagtatgc tttgtctggt     38160
     gaggtaacca cagtataccc ttttgcctga atatcttttg caatcaggct ctgcaggtca     38220
     ctcatatcct tatcggaggt gtttttcacc tgcagataca ccgtccgttc actggacggg     38280
     tcaagccaga tggtctggct catctgggtt ttcacttcaa gattacgctt tttgattgct     38340
     gtgctcatcg caccacaccc tgacagggcc agagtggaac tgaccagtgc aaccatcatt     38400
     atttttttca ttttcatcag gatttccttt tcatcagtta cctttcttat ttttaaatga     38460
     ctcaattaat gaagtcaggg ctgacaattg atatcgacca aagtcaacat tcattataat     38520
     ggccattacc accataagaa tcattgagag ggctataaac catataaccg aaaagtaaat     38580
     agagctaata tatacggcca gcatggcata taacgcagca taactaatca gatatatcca     38640
     cactttcctc ccccagaaag catatagttt tgagttacgc ctgaattttc taggaacaga     38700
     gagaaacaaa gctcttgcat taccgattga tgcaaaaaaa acaacactca aaaaaacaac     38760
     caaaaacagt tactgcaatt aagtcaatgt catccgtata aatatcatta gaaaacagaa     38820
     aaaaaggaat accagtgaaa attagagcaa aaaatatagc aggccatata caactaaaaa     38880
     aagatggtat ttccaattca tttaatatca aattttttct taaatcttca atttcttttt     38940
     ttatgacttc atttgttatc atgaatcccc cttaccaccc ctgtgttttt tctgcatatc     39000
     ctctgccatc ttggttaatt cctctttaga ataacctcct ggtatatgtc cttgactctc     39060
     cattttctca ttatacattt tttcatgttt atttttttct aaattatact gtttttccag     39120
     ctcagagttc tggtttttga tgtcatttga ctgattggtg atctgagttt tatcagcatc     39180
     atggcgctgt tggttttggt cgatcatatt atctacctca ccactgatat cactccttat     39240
     acctgatgtc cgagtatggt gatctatcac acctgaattg gtagtataat cgttcacgac     39300
     atcgctacgg gtaccaccat tcgagtttgt aggcattccc ataccaatat tctcattagc     39360
     gccactatac gcactatcta ctccaggttg aacttgttcc tgaacgaatg cccaggccat     39420
     tgcccgatgt ctttccgcca cgtcagggga atttgtgttc gtcagtatgg attctgcgtc     39480
     attaggcgca tgtttctgta cataattcac aaactgctgt gacaaatctt cactcatctg     39540
     tccactcatg ctttcagtcc gggacgccat ttcagcatat tcatggctgc gggtgaggtt     39600
     tgtcgtatac tgatcataac tctgcttagc attattaagt gatgctgaaa gctgatccac     39660
     acgagactct gcattattat ctgtatggct ggctgactgg ctggttttac gactagtaaa     39720
     gtagtccaag cggccggggt gacaacagga gctgaaggga aacaccagag gaggacagat     39780
     gacataccaa cagttctgcg ttgctcctcc acagggttat taactgattc tgtggataac     39840
     ctgacatctg tttttccagg cagaacagtt atctgacggg aaacagtaaa atttcacttg     39900
     caggacagaa aatatcttaa ataatgctgt atataaaaac aggtatttta agaggtatgc     39960
     catgttactg cttgtagcac ccgaacagga gccggtacag tccactgccc cgctgttcac     40020
     cgaacgttgc ccggcggggt ttccgtcgcc ggccgccgat tacacggagg aggaactgga     40080
     tctgaatgcc tactgtatac ggcgtccggc tgcaacgttc ttcgtcaggg ctatcgggga     40140
     ttcgatgaaa gaaatgggtc tgcattccgg cgatttaatg gttgtcgaca aagctgagaa     40200
     acccatgcag ggggatattg tcatcgcgga aacagatggc gagttcaccg ttaagcgcct     40260
     gcagttgaag ccccgtatcg ccctgctgcc gattaatccg gcctacccca cgctttatcc     40320
     ggaagaactg cagattttcg gggtggtgac ggcttttata cacaaaaccc ggagcacaga     40380
     ctgatgttcg ctttggctga cgtcaactcg ttctatgcca gttgcgaaaa ggtctttcgc     40440
     cccgatttgc gtgacaggtc tgtggtggtc ctgagtaaca acgatggttg tgtaatcgcg     40500
     cgcagcgctg aagcaaaaaa actgggcata aaaatggggg tgccgtggtt tcaactgagg     40560
     tcggcgaaat ttccggagcc ggttatcgcg ttctccagta attacgccct ctacgcatca     40620
     atgtcgaaca gggtcatggt tcaccaggaa gagctggcgc cacgcgttga gcagtactcc     40680
     attgacgaga tgtttctgga tattcgcggt atagacagtt gcatcgattt cgaggatttc     40740
     ggccgacagc tgcgtgagca cgttcgttcc ggcacagggc tgaccatcgg cgtcggaatg     40800
     ggaccgacca aaacgctggc taaaagcgcg caatgggcat cgaaagaatg gtcacagttc     40860
     ggaggcatgc ttgccctgac gttacacaat cagaaacgaa cggagaaact gctgtcactg     40920
     caaccggtgg aggaaatctg gggtgtgggc cgcaggatct caaagaagct gaacacaatg     40980
     gggatcacca cagcactgca gctggcccgc gcgaatccaa cgttcatcag gaaaaacttt     41040
     aatgtggttc tggagagaac ggtccgggaa ctcaatggag aaagctgtat ttccctggag     41100
     gaagcaccgc cccccaaaca gcagatagtc tgcagcagaa gctttggaga acgagtcacg     41160
     acttatgaag cgatgcggca ggcagtctgt cagcacgctg aacgtgccgc cgaaaagctg     41220
     cgtggggaac ggcagttctg caggcatatt gccgtgtttg tgaaaacatc gccgttcgcc     41280
     gtaactgagc cctactacgg taatctggcc agtgaaaaac tgctcatccc cacgcaggat     41340
     acacgggaca tcattgccgc tgccgtcaga gctctggaca ggatctgggt ggatggtcac     41400
     cgttacgcaa aggcaggctg tatgctgaac gatttcacgc caaccggggt atcgcagctt     41460
     aatttgtttg atgaagtaca gccgcgggaa cggagcgagc agctgatgca agtcctagat     41520
     gggattaacc atccgggcaa ggggaaaata tggttcgccg gtcgggggat tgcccccgag     41580
     tggcagatga aaagggaact actttcgcca gcttatacga cacgttgggc agatattcct     41640
     gcagcgaaat tgacttgaaa ttgtggcgat ttcaccttga aattctcaat ataaattact     41700
     taattacaat aagttagatg tgaaatcgcc gtggcgaaat tattgactca aatttctctc     41760
     aaggacctcg ttgatagctt tgtccagttc atcctgaacc acttttgaca tacgactaaa     41820
     ctcataagtt agcgtacgcc ctttcacacg cttgcgcgcg aacttgtcct tttcttcaaa     41880
     ggtccagagt gcggaaatta ctgacttttc cttaggaggc ggagctatca atgcctgaga     41940
     ggcctgagaa atcaatttca gtatactgga tttctgttcg tcgtctggtc gctcgtagtc     42000
     actcaaaatt gcatcatgct gatctgagac agactgaatg agcccttcag acgttaaacc     42060
     cttttcactg agtttttcat taacctctaa cagaatttta tagtcactaa acgacagctc     42120
     agactgaacc gggaacagag aaatcaattc ttgcggtact gctgccgcct gcagtgccct     42180
     ggtgacctta gcctgggata ccccctccag ttcagcaatt tccttttgat tgaatccaga     42240
     ctctttcaga gccatcaatc ttaagccgat ctcccgaagg ttatgctctt tagctgtctg     42300
     gatatcttta gccagatggc gagcttcatc agctgataaa agttcattgg taaccattac     42360
     atcaaggcct gtacggatat aaatcgctga ggctcgccgt cttgaaccat ccagtatctc     42420
     aatcctttca ccttgctgaa tgccaataca ggggaagaac tgctgaaact taatcgtctg     42480
     gataatagat ttcagggact ccctggtcag agcaagttga tctcttccgt tggtttcctg     42540
     gtttacgaat gtcttacttt caacgtccga tgcaggtacc cgaacaaacc tgaacgttat     42600
     cttcctgccg gtttttaggg taaatacctg acttctttgg gtgtcagtca tctcaaccat     42660
     tgacgcctgg gtatttaact gtctgccaat agtttttctt ctctcattcg acatcacata     42720
     cctccattag tacgaatgaa ctcaatgcga tcaaatacgg ccttcgcaaa gtcttccgct     42780
     gctgattttg cgcttttaag cgcctcggtg cttccatcat aggttgctgg atttgcggaa     42840
     ataactgtgt caaaagtctc cccgcatcgc tcgaagccat ccagcctcgg cagaaccatg     42900
     tcgagcatat cggcaccgaa tacttctttg gcctgactat ggcaaatttt gtgatcagac     42960
     ttgttcagga ttttggacat aaaacctaca ttcccgatga gattgcaggt gtgtccatcc     43020
     tgttcgatcg aatcaataag cgcaggaagg ctggctacaa acttcaggga agaatgaaaa     43080
     tcaaccgttg ccggaggaag tggagtcaac atcaggtctg ccgctccgat gcagtttttc     43140
     aggaacgcat cgaggtgagg accactatca aggaagataa agtcgtagtc ataccggagc     43200
     ttgtcgataa tgttctcttt aagcactgca tgaatatttt gccctggcag atgttcctca     43260
     cacaatccct tccagccttc agcaaggaat gcatcgtcaa tggaagcggg aataacatca     43320
     acgcccggga taattgacga cacgatgaaa tcggaaagta attcttcacg agacacgttc     43380
     tggagcatgg cctgagcagc cgtattttca accaggccca ctgaattctc atggctcagg     43440
     aacattgtca gagatgcctg cggatcgaaa tcgatggcca ggatacgcag gtcttcgaac     43500
     agaagctgag gatgagcccg aaatgcatgg gataatgaag cggtagaaac tgtcttggaa     43560
     ccgccacctt taaggttaca tacaaatata gtgaaagctt tatcgaagcg atctctgtac     43620
     ttgggcactt tacgatggaa atacagatcg ataacgttct gaatcgtcat cgcgtacttc     43680
     atggtattgc cagaaggttt ctttttaaaa atgtagccac tggcttccat ttcggccaca     43740
     gcatactcaa cactcccttt gctgagctta ggcagcttat atagggcggc tttgctgtat     43800
     tcctgataga actcggtaag cttcaattcc tctttttgct ggcggatact ttcgctcaag     43860
     gatgtcagaa gtttacctgc acgtgtggcg actttccgta actgctcaat attttccatt     43920
     tatcacctca tgattttttt tgtcattttg aacaaaaaga atcatgttgc aagaaataaa     43980
     tcataatatt ttgattttgc tctcacagga ggcaccgaag attaaatgga gaagagggca     44040
     ctacatccac aatcattttg ttaacccaca gcgcaaaccg tgagtctgtt cagagcttgc     44100
     atctgagcag gcgaagggtt ggacaagccc aaggggcgcg tcagccaggc acattagggt     44160
     atagttcagc agtaccagtt tctgccagga catggatatc tccgggcaag caagctgatg     44220
     attaaaaaag aaagagggga ctgcccctga aggaattgca attccgttcc tcgcaatgtc     44280
     aacatttttt gcctgtgata ctatgaccgg gtcatttttc agagcatgga ctgatgaaaa     44340
     agaaaaacac tacgccgact ccccacgacg cgacattccg gcagtttctg acacaacctg     44400
     acattgcccg ggattttatg gagctgcatc tgccggcaga gctgcgtgcc atctgcgatc     44460
     tcagtacact gaaactggaa tccggctcgt ttgttgagga tgatctccgc cagtatttca     44520
     gcgacgtcct ctacagcctg aaaaccacag ccggcgacgg atatattcat gtcctggttg     44580
     aacaccagtc aacacctgac aaacatatgg ctttccgcct gatacgctat gcggtggccg     44640
     ccatgcagcg ccacctggag gcagggcata aaaaactgcc actggtgata ccagtgttgt     44700
     tctatacggg gaaacgcagc ccgtatccat actccacccg ctggctggac gaatttgacg     44760
     atacggctct ggcagacaaa ctctacagca gtgctttccc gctggtagac gttacggtca     44820
     ttccggatga tgaaatcgcc ggccaccgta gcatggccgc cctgacttta ttgcagaaac     44880
     atattcatca gcgggacctg gcagaattgg ttgaccggct ggcgcccatt ttgctggccg     44940
     gatatctgtc ttcatcgcag gtaatatcgc tggtacacta tatagtgcag gcaggcgaaa     45000
     catcggacgc cgaagccttt gtacgcgaac tggcacagcg tgtgccgcaa cacggagacg     45060
     cacttatgac catcgcacaa cagctcgaac agaagggcat cgagaagggg attcagctcg     45120
     gtgaacaacg tggtatcgaa aaaggccgtt cagaagggga gcgcgaagcg actctgaaaa     45180
     tagcccgtac catgctccag aactgcattg accgcaatac cgtcatgaaa atgaccggtc     45240
     tgactgaaga cgacctagcg cagatccgcc actaatcccc cttttctggc actccctgcc     45300
     cggccatcag cgaatactgg tggggcaggg aggcatcagg ctctgccagc cacagcgatc     45360
     aaacagcttc attacccccg ctacgttccc tgtcaaacgt gctgtcagcg aatttatctg     45420
     tcggccgctg tcgttaaaac cgacatcgag tttggcccgt gagagataaa tgccgttcac     45480
     gcctgcactg agcgccacag cattccggcc ggaccattcc cgatcgctca gcagacggta     45540
     gttccagtgc atatctttcg ctgtttccag agcatacgtc agccggaaca ggtcgttctg     45600
     ctcggacaac tcaccggtgc atgaacgcca gaggtaattc agcttgctgg ccagcttggc     45660
     gctgacgccc atctgacgtc cctgtttcaa aagccactcg atatcgggcg tcacatcacg     45720
     agaaaaacgc cgttgcttca gcgcagtcgc cagccagcgg gtgagaaaga ggttttcctg     45780
     tgccggcgag agaacgccac catcctgcct ggccagcgca agcgccacca gggcacacca     45840
     cgccagatga cctgattttt ctgtcaatgt cacggcttct cccgcaagtc agaaaaatga     45900
     tgtaattcat caggcataat cagcacacgt cagcccgtct tacggagaaa cattcgccgc     45960
     atctcacgcg tcagctgctt cttctcccat ccgtaaggga aaataatgct gtagtccctc     46020
     ctctcaggga ggatatcagg gcccgcgacg attcgcgcca cctccttatt caggcgttct     46080
     cctcgccagc cataagccgc cagtcgctta cggatacgtg caacgggaaa acgtttatcg     46140
     gagtgacggg ggaagagtaa cgtcccgtcc tcatttcgtt tgacaccaaa catatccaga     46200
     gactgttcga tcaccactgt tcgaacgggg aaatgctcac gcatagtttt caacatattc     46260
     tccatttcag actcctgaat taatccctgc aactgtctga ccagccagag agcagcgtta     46320
     tgctggctca ctccctgcgt catcattcat ttcacactgg agttcatgcc agtatccggc     46380
     aatattgttt accacctgtg ctgtcataac ggcgtcagtg acggcggaat gagccacccc     46440
     gatccagctc aggccagcct gactgacagc accggaaagc gatatggttc cgtaacgatt     46500
     tgtactgcag ctgctgccgg atcgatgccg actgtgggtt tcaggcgggt ctcaaatatc     46560
     ctctcaccgc gggcattcac cagaccgatt tccagcgcct gcgcgccagc atcaagtccg     46620
     gtcgtttcgg tatcgaggaa gacggggccc agtgctaacc aggtatgtgc cagcatggcg     46680
     aacctgccac gctcactctt catccgggcc tgcaggccca gacgtgtgct ggccagccgc     46740
     tgtttttctg tctgagggcg tttcgcccgc atcgggacgc agtcagccag ccgccatacg     46800
     ccgtatttcc cgccgtaagg acttttgtat attctgaccg gttccgcacc aggggctggc     46860
     ttcatcctga actcatcccg aagccgccct ttggtgtagc atttatcctc cgcccggggc     46920
     gcttcatcac aggcgtctga attgtcatca tcacgcattc tggccaccgg tctgtttatt     46980
     gcctgaaagc gccgccatca gtgactggtt ctgacgcttc agggcttcag cctcaccacg     47040
     cagtgccgcg accgtttctt tctcccccat cgtctccaga cgggcatcat cacgctggtt     47100
     ttccagctgt gtgcaacgct ctgtcagact ggctatttca ctgcccatac gcaccagttg     47160
     ctccgaggag gccttttcct gcgattccag ccttgcggtg aggctgctga ctctgtcacg     47220
     ttcaagtgca atctcaccgg cgcgcgcctg cgtgtcagcg atggcctgct cgaggcgttg     47280
     ctgcagcgtt tcgcgggtgg ccagatgctg ctgacgttct gaggccagcg cattttcctg     47340
     cgattcaagg cgggtaagga gagtattgac tttatcgcgt tcagacttca gttcttctgt     47400
     acgcgcatta gcttcggcag aaatttgctc cagtcgtttc tgcaggtctt cccgcgtgtt     47460
     tttgtgctgt gcctgctccg cattaagcgc atcctgcagc actgtcttct gctcctgata     47520
     ccgttcctct cgctgacggg tattctcttc agcggccgca agacgctctt tcagctgggc     47580
     catctccaca tcatgctgct gacacagtga acgttctgac tccagcgcca gcgtcaaact     47640
     gtcatatctg tcctgcagtt catccagttt ttcttccaag tcgtcgactg tctgcgcggc     47700
     gtcggccagc tcccgctctg cctgtgcggt ctgttcaccg gcagcacgcg tgacttccgc     47760
     aacccggcgt tctgcagccc ggaccgcctt gtcattcagt tctgtcgcca gctgggtgat     47820
     gcgttcggac agcgcggcgg agacggcctt cacttcttca gccacttcca ctggcagctc     47880
     ggcaacgggt tcagtgacga ccgtgctctg tgaagcctgg tattcgtccc atatctggcg     47940
     gagacgtgtc ggattgccgc cacccacctg gttacgtagt gcgaacccgg tgatattccg     48000
     tccttcagcc tgcagggcca gccctgcttc aataatctgt tctggttcgt atgtcgccgg     48060
     acgcatctgt cagtctccgc ataaaggggt atgcttatat tatacacaaa caaactaaca     48120
     aataaactaa ctaacaaaca aattaaagac gtgacagggt agcgaaaaag ggcaccagga     48180
     cagcgcaccg ccggtcgaat tgctggcaca gcatgtccgg agcccgggcg ggatgcacca     48240
     caggtacgat gcacgccact ctccttgcca ggtactggtg ttaatgctaa tgtacgcata     48300
     cgttagcatt aaccagagac agacatgccg caggatgaat cagtcgtcaa acgggccagg     48360
     gaatactttt tccgccacca ccggtgtaca gaggaagacc tggaatccga ctaccaggca     48420
     gaactgtgta actaaaggga tgacacctgg gaagcaccac aacgggcagc cagactcagt     48480
     gcggccgtca agcgctacaa aacgtatgag atgctgtact tcttcttcca gatcgctgat     48540
     gaggccgggc tggactatac tccgctggtt gtaaagcgcc tgtgcgctca tcttttcgac     48600
     aggcagggca gccagaatat tattgttgat atctttggcc agaagggacg catgcaccgc     48660
     agccatgaca gtgatcctga cattattgct gccgttgccg aacgctaccg gcagcaggca     48720
     gaggaccact ggcagacagt tctgaagaat atcgggagag tgaagcagga ctaccagaaa     48780
     aatcagaaca gacagaaagg cgcaggggat taaatgcatg attaatgcta atgtatgcgt     48840
     acattagcat taatcacata agtcagtgaa aataaatcag gcttattcaa cgttgcgaag     48900
     gttctttggc cagttgctgg agctacttcc cgaaatcagg aaagcctgcg gctgaaagta     48960
     catcagcaac agcactggct ctgggatggc cacgttcaag ccagaccaga ctgagagcca     49020
     cacctgattt ctccgtatca taactgtgac gcgacaaccg gaattaccaa acggacactc     49080
     aaagaatgag atgaacgctc cagacttatg aagttcggaa cacacagagt tcctagttgt     49140
     agcggctcgc aatcgaaatc cccccgactc gcaatcagcg caaatttcgg ctcacattaa     49200
     ctgcaaatga aaaatgccac cggctcacat taagtgacaa tggactcgca tttatcctgc     49260
     ccggctcgca atccattcca ccgggctcac aataactgca agtcaacttc gtcatatcgg     49320
     caaaccgact gccagcattc tattttccag ttcgactggt ctcagatatt tattcatact     49380
     ggttaaaaat tgtcgttttg gtttgattaa cgtttaccta cgtataatcg cagcaattgg     49440
     agttaactca gtaaatagga gcaagtaatg gaacaaaacc aaccagcaca accttcacga     49500
     cgtgcaatac tgaaacaaac tcttgcagta tctgctttgt ctgtcaccgg gctggcggcc     49560
     ttatcggtac caactatctc tttcgccgca tcactgagca aagaggaacg tgacggtatg     49620
     actccagatg cagtcattga acattttaaa cagggtaacc tgcgcttccg ggaaaatcgc     49680
     ccggctaaac atgattacct ggcacagaag cgcaacagta ttgcgggtca gtatcctgct     49740
     gcggtgatcc ttagctgcat tgactcacgt gcgccggcgg aaattgtgct ggatgcgggg     49800
     atcggtgaga cgtttaattc ccgcgtagcg ggtaatatca gtaatcgcga tatgctgggc     49860
     agcatggagt ttgcctgtgc agttgccggc gcgaaagtag tgctggttat aggacacacc     49920
     cgctgtggcg cagtacgctg tgctattgat aatgctgaac tgggtaacct gacggggctg     49980
     ctggatgaaa ttaaacccgc gattgcaaaa acggagtata gcggtgagcg taaaggtagc     50040
     aattatgatt ttgtcgatgc ggtggcacga aaaaatgtcg agctgactat cgaaaacatc     50100
     cgcaaaaaca gcccggtgct gaaacaactg gaagatgaga agaaaattaa aatcgttggc     50160
     agtatgtatc accttactgg cggtaaggtt gagtttttcg aagtataact gaagcagtcc     50220
     gagtccgaat acagtcagcc tcgcattaca ttaagagctc attaaatttt ctctggaatg     50280
     aaaatgtatt ttttgagtac acccaaaacg cacagtctgg tgagacagtt tttctgtctc     50340
     atttgggttg tttttatccc attccggtgt tacgttttca tcatctagag ttaaacgaga     50400
     cagttttcac cattatggca ctttacggct atgcccgcgt ttcaaccagc gatcaggatc     50460
     ttactctgca gacacaaatt ctccgcgctg ctggttgtga aattattcgt gcagaaaaag     50520
     ccagcggaag cggccggacc ggaaggagcg agttgcagct gctgctggag ttcctgcgcc     50580
     ctggtgatac gttgatggtg acacgcgtgg atcgcctggc ccgcagcatt aaggacctgc     50640
     aggacattgt gtatgccctg aatcaacagg gcgtaacgct cagggcaaca gaacagccag     50700
     tggacacgcg ttcagctgca ggcaaagcct tcctcgatat gctgggtgtt ttcgctgagt     50760
     ttgaaaccaa tctgagacgt gaacgccaga tggaaggcat tgccgcggcg aaagccaggg     50820
     gcgtataccg gggaaggaaa ccgtccatag atcctgctga ggtatatcgt ctgtatacca     50880
     ttgagaagat gggagccaca gccatcgccc gccagctcgg gattgggagg gcgtcagtct     50940
     accgggcgct ggaaaattat gagcagccgg cgtagcgcga ttccgtctga ctccctgttg     51000
     caactacggc aacggctcga tcgcctgccg ccaaaaagcc ctgaacgtgc caatcagatt     51060
     gccgctaccg cccagctgta tggtatttca gtcacgacgg tttatcgcgc tcttcacctt     51120
     gttttgaaac cgcgaacggc ccaccgcagt gatcatggtc aaccccggat actgccaccg     51180
     tccgagctgg agcattactg cgaactgatt gctgcactga aattacgaac cacaaataaa     51240
     tccggccgcc atctgtcgac cggacgggca atacagctgc tggaagagca tggcgtggag     51300
     acggtccagg gattgattaa aagtcccaaa ggcttacttc gtaagcagac cgtcaatcgc     51360
     tggctttccc gctggcgtct cgaccagccc cgcctgttac gggagcctcc ggcggtaaga     51420
     tttcaggctg aaaacagcaa tgactgttgg cagtttgata tgtcgccatc cgatctcaaa     51480
     catattgagc ggcctgactg ggtagatcct gcccggggcg aacccacgct gatgctgttc     51540
     agcgtagtgg atgaccggag cggtgtcgca taccaggaat accggtgtgt gtacggtgag     51600
     gatgcggaat ctgcgctgcg ttttctcttt aacgccatgg ccccaaaaac caggtctgat     51660
     tttccttttc agggccgccc gaaattgctg tacctcgata atggaccggt ggccaaaaac     51720
     catgtattcc agaatgtgat gcagtccctg aaggttgact ggctgacgca tacgccggca     51780
     ggcaaggacg gcacccggac gacggcacgg tccaaaggta aagttgaacg tcctttccgg     51840
     accgtcaagg aggcacatga aactctgcac catttccata aaccggaaac ggagctgcag     51900
     gccaacgaat ggctctggaa ctatctgagc cgttataacg cgcagcgtca ccgcagcgag     51960
     aaacactccc gactggagga ctggctggca aatatcggcc aggaaggtgt gagggatatg     52020
     tgcagctggg aacaatactg tcggttcgcc cgggagccgg aatcccgcaa ggtgggtgtt     52080
     gatgcgcgga taacgataga cggcaccgca tgggaagttg aaccggatat ggcgggtgaa     52140
     accgtcattc tgctgtgggg gctgtttgac gaagagatgt atgtggagtt taccggtgaa     52200
     acatgggggc cttattatcc ggtgtcgggg cctgtgccgc tgcaccgtta ccggacgttc     52260
     agacgcggta aagcggctga acgggccgat cgtatccatg ctctggccag gcagctgaac     52320
     atccccatca gcgcattgtc cggcagcgat ctccgcgtgg tcagtgatga cactcagcag     52380
     cgcattgatg cgttgccaca tcagcccttt gatacccgaa aatttgaata ccactttccc     52440
     accgttattg cggcaaaact ggcaattgcc gacgatctgg ccataccgct ggccagaatg     52500
     tcggatgaag accgggcgtt tatcgacagt attctgactg agacgcttaa ccgtagtgaa     52560
     gtactcgccc gcatcagaga ctattttcgt agcagacaat caggagagga ccatgcgggt     52620
     tgaagtgatg gagcattatg gactgacgca gtctattgaa caggccgggt attatgaaac     52680
     tgcccaccat aagcagctga tgaaagacat taagggtgcg atacgcgaag gacgactgat     52740
     agcggtctgt ggcgtggtgg gaagcggtaa aaccgtcact ctgcgacgcc tgcagcagca     52800
     actgctggat gaaaataaaa tcattgtcgc ccgctccctg tcggtggaca aacagagtgt     52860
     ccggctcgcc acgctgatta atgccctgtt ttatgacctg gcacaggata aacaggtgca     52920
     gatccacaaa caaggtgaac gccgcgagcg tgagctgcag gaactggtca aaaaaggcaa     52980
     acgcccggtg gcgctgtttg ttgatgaagc ccatgacctg aacggtaata cactaacggg     53040
     gctcaaacgg ctgatggaag tggttgaaga cggcggtggt aggctgtccg tcgttctggc     53100
     cggtcaccca aaactgcgta atgacctgcg tcgtccgacg gtggaggaaa ttggctatcg     53160
     taccgatatt tttacactgg acgggatcac cggcagtcag cgtgaatata tccagtggct     53220
     gctgaagacc agcaccggta agggtaagcc ggaagatatt ctaacgaccg aagccgttga     53280
     cctgctggcg atgaaactgc gaacaccgct gcaggtccag ttgcacctga cgctggcgat     53340
     ggaagcagga taccagacgg gcgaaaaacc gattactgcc actctggttg aatccgtgct     53400
     gtcacgtcag ctggatgacc tggagccgac gctcacgcga catggttacc ggctgaagga     53460
     tatggtggag cagttcgatg caaaaccagc tgaaatcagg gcattattta ataatcagtt     53520
     agaccctgcc cgcacggccg aactacgcga cagaatgctg gcggtcggtc tgccaatatg     53580
     acgatgttga tttgcagtta ttgtgagccc ggtggaatgg attgcgagcc gggcaggata     53640
     aatgcgagcc cattatcacc taatgtgagc cggtggcgtt tttcatttgc agttaatgtg     53700
     agccaaaatt ggcgctgatt gcgagtcggg gggatttcga ttgcgagccg ctacaaatag     53760
     cttcgcatat taccgctcca ctttagccag accctgttga ttgccgggaa acagtgaagc     53820
     ggcattcata aattgtgcta cctgtttcag taactgccac atgtaccgac actgatgatt     53880
     tctcgttatg gtttcgtgta acgacaacca cagtcgctct atcggattca gccacggcga     53940
     atacatcggc aggaacagca accggaactt cgggttttct tccagccagc gttccacttt     54000
     gcggctttta tggatgatgt agttatccgc caccagtgtg atagttttcg cccgcctgta     54060
     tgtacggcgt aacgtttcta acagactgat aaataaatca gaactcttgc tgctgccact     54120
     gacgtagtga acccgtcccg tacctgaatg cagtgcgcct gccagataat gcttctggtt     54180
     ctgtcccggc gtggcgatgc gtttctgttg ccctttgggc atccagtcag cgccaatttt     54240
     tgggttcagg tcgatgtcga cttcatcctg ataaaacaca ggatgtgcag tctgctcctg     54300
     agccagcgcc tgatcaatga caagccgttt ttcttcatag tgcggatctt tgattttcag     54360
     cgttggcgct gccctgcgcc agaccatatc tgcctgcctc agatatcggt gcagggtgga     54420
     gcggtgcagc gtcacatcaa aaagtcggtt gatgacgagt gccagaagct ccgtgctcca     54480
     gcgtgagcgc agccagccaa aatccttcgg ggaacgctgt accaatagtg gcaagagctg     54540
     aaggatatca gcgaccggcc agcgtggagc acgtccgggt ctgaggcttt ttagtccttc     54600
     aacaccatgt aaagtaaacc agtttatcca tcgaccaacg gatgaacggg cggcacagag     54660
     taatctggca acgtcagtga cggtcattcc ctgatgcagc atcagcatgg cgataagccg     54720
     tcgcgcatgg tttttatcgt gggtttgttg ggcctctttg cgcatcagtt gtcgttcttc     54780
     atcaggaatt gctgctatga tcggcatcgc tcagtccggt tggtgatttg tgatgtttgg     54840
     cgattgatca gatcgcacaa tccgggctga gttccctttc agtgatctac tattttgcga     54900
     agctatttag tgcacactaa tcgatttttc agacaacctt tctcgcctgg cgtgagtttt     54960
     cgttcgactg aacctataaa aaggctctgc attctgtcct gtagtgcgcc aggcctaata     55020
     acgcctcccg tttaattccg gcccggtcgt acatcggttc tgttcattta tgggatcgcg     55080
     actttttcgt tgtaatgctt caagagcgat tttttgttct gcggtcaact caacattcat     55140
     agccatcagc atgatcctga ttatttttga aaccaagcat cttcattgat catgggtata     55200
     catcgttgtt atccagctat acatcataac aggtcaatta aatccactca gaaataaagt     55260
     cagggtatgc ataaaatcta tcgcccataa ccctatccag taacaccatg attagtaaga     55320
     actaatcagt ctgtgcaaaa acaggtcacc gccatcctgt ttttgcacat caaaacattt     55380
     tttcaggatt attctgaaaa aaaaaggaga tatt                                 55414
//

If you have problems or comments...

PBIL Back to PBIL home page