(data stored in ACNUC7421 zone)

EMBL: CP000859

ID   CP000859; SV 1; circular; genomic DNA; STD; PRO; 3944167 BP.
XX
AC   CP000859; AAWN01000000-AAWN01000132;
XX
PR   Project:PRJNA18007;
XX
DT   01-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Desulfococcus oleovorans Hxd3, complete genome.
XX
KW   .
XX
OS   Desulfococcus oleovorans Hxd3
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfobacterales;
OC   Desulfobacteraceae; Desulfococcus.
XX
RN   [1]
RP   1-3944167
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Wawrik B.,
RA   Richardson P.;
RT   "Complete sequence of Desulfococcus oleovorans Hxd3";
RL   Unpublished.
XX
RN   [2]
RP   1-3944167
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Wawrik B.,
RA   Richardson P.;
RT   ;
RL   Submitted (12-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8576f9aac0e82bfb8c46cd832bd0ba3a.
DR   BioSample; SAMN00623035.
DR   EnsemblGenomes-Gn; Dole_R0002.
DR   EnsemblGenomes-Gn; Dole_R0003.
DR   EnsemblGenomes-Gn; Dole_R0004.
DR   EnsemblGenomes-Gn; Dole_R0005.
DR   EnsemblGenomes-Gn; Dole_R0006.
DR   EnsemblGenomes-Gn; Dole_R0007.
DR   EnsemblGenomes-Gn; Dole_R0008.
DR   EnsemblGenomes-Gn; Dole_R0009.
DR   EnsemblGenomes-Gn; Dole_R0010.
DR   EnsemblGenomes-Gn; Dole_R0011.
DR   EnsemblGenomes-Gn; Dole_R0012.
DR   EnsemblGenomes-Gn; Dole_R0013.
DR   EnsemblGenomes-Gn; Dole_R0014.
DR   EnsemblGenomes-Gn; Dole_R0015.
DR   EnsemblGenomes-Gn; Dole_R0016.
DR   EnsemblGenomes-Gn; Dole_R0017.
DR   EnsemblGenomes-Gn; Dole_R0018.
DR   EnsemblGenomes-Gn; Dole_R0019.
DR   EnsemblGenomes-Gn; Dole_R0020.
DR   EnsemblGenomes-Gn; Dole_R0021.
DR   EnsemblGenomes-Gn; Dole_R0022.
DR   EnsemblGenomes-Gn; Dole_R0023.
DR   EnsemblGenomes-Gn; Dole_R0024.
DR   EnsemblGenomes-Gn; Dole_R0025.
DR   EnsemblGenomes-Gn; Dole_R0026.
DR   EnsemblGenomes-Gn; Dole_R0027.
DR   EnsemblGenomes-Gn; Dole_R0028.
DR   EnsemblGenomes-Gn; Dole_R0029.
DR   EnsemblGenomes-Gn; Dole_R0030.
DR   EnsemblGenomes-Gn; Dole_R0031.
DR   EnsemblGenomes-Gn; Dole_R0033.
DR   EnsemblGenomes-Gn; Dole_R0034.
DR   EnsemblGenomes-Gn; Dole_R0035.
DR   EnsemblGenomes-Gn; Dole_R0036.
DR   EnsemblGenomes-Gn; Dole_R0037.
DR   EnsemblGenomes-Gn; Dole_R0038.
DR   EnsemblGenomes-Gn; Dole_R0039.
DR   EnsemblGenomes-Gn; Dole_R0040.
DR   EnsemblGenomes-Gn; Dole_R0041.
DR   EnsemblGenomes-Gn; Dole_R0042.
DR   EnsemblGenomes-Gn; Dole_R0043.
DR   EnsemblGenomes-Gn; Dole_R0044.
DR   EnsemblGenomes-Gn; Dole_R0045.
DR   EnsemblGenomes-Gn; Dole_R0046.
DR   EnsemblGenomes-Gn; Dole_R0047.
DR   EnsemblGenomes-Gn; Dole_R0048.
DR   EnsemblGenomes-Gn; Dole_R0049.
DR   EnsemblGenomes-Gn; Dole_R0050.
DR   EnsemblGenomes-Gn; Dole_R0051.
DR   EnsemblGenomes-Gn; Dole_R0052.
DR   EnsemblGenomes-Gn; Dole_R0053.
DR   EnsemblGenomes-Gn; EBG00001445753.
DR   EnsemblGenomes-Gn; EBG00001445754.
DR   EnsemblGenomes-Gn; EBG00001445755.
DR   EnsemblGenomes-Gn; EBG00001445756.
DR   EnsemblGenomes-Gn; EBG00001445757.
DR   EnsemblGenomes-Gn; EBG00001445758.
DR   EnsemblGenomes-Gn; EBG00001445759.
DR   EnsemblGenomes-Gn; EBG00001445760.
DR   EnsemblGenomes-Gn; EBG00001445761.
DR   EnsemblGenomes-Gn; EBG00001445762.
DR   EnsemblGenomes-Gn; EBG00001445763.
DR   EnsemblGenomes-Gn; EBG00001445764.
DR   EnsemblGenomes-Gn; EBG00001445765.
DR   EnsemblGenomes-Gn; EBG00001445766.
DR   EnsemblGenomes-Gn; EBG00001445767.
DR   EnsemblGenomes-Gn; EBG00001445768.
DR   EnsemblGenomes-Gn; EBG00001445769.
DR   EnsemblGenomes-Gn; EBG00001445770.
DR   EnsemblGenomes-Gn; EBG00001445771.
DR   EnsemblGenomes-Gn; EBG00001445772.
DR   EnsemblGenomes-Gn; EBG00001445773.
DR   EnsemblGenomes-Gn; EBG00001445774.
DR   EnsemblGenomes-Gn; EBG00001445775.
DR   EnsemblGenomes-Gn; EBG00001445776.
DR   EnsemblGenomes-Gn; EBG00001445777.
DR   EnsemblGenomes-Gn; EBG00001445778.
DR   EnsemblGenomes-Gn; EBG00001445779.
DR   EnsemblGenomes-Gn; EBG00001445780.
DR   EnsemblGenomes-Gn; EBG00001445781.
DR   EnsemblGenomes-Gn; EBG00001445782.
DR   EnsemblGenomes-Gn; EBG00001445783.
DR   EnsemblGenomes-Gn; EBG00001445784.
DR   EnsemblGenomes-Gn; EBG00001445785.
DR   EnsemblGenomes-Gn; EBG00001445786.
DR   EnsemblGenomes-Gn; EBG00001445787.
DR   EnsemblGenomes-Gn; EBG00001445788.
DR   EnsemblGenomes-Gn; EBG00001445789.
DR   EnsemblGenomes-Gn; EBG00001445790.
DR   EnsemblGenomes-Gn; EBG00001445791.
DR   EnsemblGenomes-Gn; EBG00001445792.
DR   EnsemblGenomes-Gn; EBG00001445793.
DR   EnsemblGenomes-Gn; EBG00001445794.
DR   EnsemblGenomes-Gn; EBG00001445795.
DR   EnsemblGenomes-Gn; EBG00001445796.
DR   EnsemblGenomes-Gn; EBG00001445797.
DR   EnsemblGenomes-Gn; EBG00001445798.
DR   EnsemblGenomes-Gn; EBG00001445799.
DR   EnsemblGenomes-Gn; EBG00001445800.
DR   EnsemblGenomes-Gn; EBG00001445801.
DR   EnsemblGenomes-Gn; EBG00001445802.
DR   EnsemblGenomes-Gn; EBG00001445803.
DR   EnsemblGenomes-Gn; EBG00001445804.
DR   EnsemblGenomes-Gn; EBG00001445805.
DR   EnsemblGenomes-Gn; EBG00001445806.
DR   EnsemblGenomes-Gn; EBG00001445807.
DR   EnsemblGenomes-Gn; EBG00001445808.
DR   EnsemblGenomes-Gn; EBG00001445809.
DR   EnsemblGenomes-Gn; EBG00001445810.
DR   EnsemblGenomes-Gn; EBG00001445811.
DR   EnsemblGenomes-Gn; EBG00001445812.
DR   EnsemblGenomes-Gn; EBG00001445813.
DR   EnsemblGenomes-Gn; EBG00001445814.
DR   EnsemblGenomes-Gn; EBG00001445815.
DR   EnsemblGenomes-Gn; EBG00001445816.
DR   EnsemblGenomes-Gn; EBG00001445817.
DR   EnsemblGenomes-Gn; EBG00001445818.
DR   EnsemblGenomes-Gn; EBG00001445819.
DR   EnsemblGenomes-Gn; EBG00001445820.
DR   EnsemblGenomes-Gn; EBG00001445821.
DR   EnsemblGenomes-Gn; EBG00001445822.
DR   EnsemblGenomes-Gn; EBG00001445823.
DR   EnsemblGenomes-Gn; EBG00001445824.
DR   EnsemblGenomes-Gn; EBG00001445825.
DR   EnsemblGenomes-Tr; Dole_R0002-1.
DR   EnsemblGenomes-Tr; Dole_R0003-1.
DR   EnsemblGenomes-Tr; Dole_R0004-1.
DR   EnsemblGenomes-Tr; Dole_R0005-1.
DR   EnsemblGenomes-Tr; Dole_R0006-1.
DR   EnsemblGenomes-Tr; Dole_R0007-1.
DR   EnsemblGenomes-Tr; Dole_R0008-1.
DR   EnsemblGenomes-Tr; Dole_R0009-1.
DR   EnsemblGenomes-Tr; Dole_R0010-1.
DR   EnsemblGenomes-Tr; Dole_R0011-1.
DR   EnsemblGenomes-Tr; Dole_R0012-1.
DR   EnsemblGenomes-Tr; Dole_R0013-1.
DR   EnsemblGenomes-Tr; Dole_R0014-1.
DR   EnsemblGenomes-Tr; Dole_R0015-1.
DR   EnsemblGenomes-Tr; Dole_R0016-1.
DR   EnsemblGenomes-Tr; Dole_R0017-1.
DR   EnsemblGenomes-Tr; Dole_R0018-1.
DR   EnsemblGenomes-Tr; Dole_R0019-1.
DR   EnsemblGenomes-Tr; Dole_R0020-1.
DR   EnsemblGenomes-Tr; Dole_R0021-1.
DR   EnsemblGenomes-Tr; Dole_R0022-1.
DR   EnsemblGenomes-Tr; Dole_R0023-1.
DR   EnsemblGenomes-Tr; Dole_R0024-1.
DR   EnsemblGenomes-Tr; Dole_R0025-1.
DR   EnsemblGenomes-Tr; Dole_R0026-1.
DR   EnsemblGenomes-Tr; Dole_R0027-1.
DR   EnsemblGenomes-Tr; Dole_R0028-1.
DR   EnsemblGenomes-Tr; Dole_R0029-1.
DR   EnsemblGenomes-Tr; Dole_R0030-1.
DR   EnsemblGenomes-Tr; Dole_R0031-1.
DR   EnsemblGenomes-Tr; Dole_R0033-1.
DR   EnsemblGenomes-Tr; Dole_R0034-1.
DR   EnsemblGenomes-Tr; Dole_R0035-1.
DR   EnsemblGenomes-Tr; Dole_R0036-1.
DR   EnsemblGenomes-Tr; Dole_R0037-1.
DR   EnsemblGenomes-Tr; Dole_R0038-1.
DR   EnsemblGenomes-Tr; Dole_R0039-1.
DR   EnsemblGenomes-Tr; Dole_R0040-1.
DR   EnsemblGenomes-Tr; Dole_R0041-1.
DR   EnsemblGenomes-Tr; Dole_R0042-1.
DR   EnsemblGenomes-Tr; Dole_R0043-1.
DR   EnsemblGenomes-Tr; Dole_R0044-1.
DR   EnsemblGenomes-Tr; Dole_R0045-1.
DR   EnsemblGenomes-Tr; Dole_R0046-1.
DR   EnsemblGenomes-Tr; Dole_R0047-1.
DR   EnsemblGenomes-Tr; Dole_R0048-1.
DR   EnsemblGenomes-Tr; Dole_R0049-1.
DR   EnsemblGenomes-Tr; Dole_R0050-1.
DR   EnsemblGenomes-Tr; Dole_R0051-1.
DR   EnsemblGenomes-Tr; Dole_R0052-1.
DR   EnsemblGenomes-Tr; Dole_R0053-1.
DR   EnsemblGenomes-Tr; EBT00001599552.
DR   EnsemblGenomes-Tr; EBT00001599553.
DR   EnsemblGenomes-Tr; EBT00001599554.
DR   EnsemblGenomes-Tr; EBT00001599555.
DR   EnsemblGenomes-Tr; EBT00001599556.
DR   EnsemblGenomes-Tr; EBT00001599557.
DR   EnsemblGenomes-Tr; EBT00001599558.
DR   EnsemblGenomes-Tr; EBT00001599559.
DR   EnsemblGenomes-Tr; EBT00001599560.
DR   EnsemblGenomes-Tr; EBT00001599561.
DR   EnsemblGenomes-Tr; EBT00001599562.
DR   EnsemblGenomes-Tr; EBT00001599563.
DR   EnsemblGenomes-Tr; EBT00001599564.
DR   EnsemblGenomes-Tr; EBT00001599565.
DR   EnsemblGenomes-Tr; EBT00001599566.
DR   EnsemblGenomes-Tr; EBT00001599567.
DR   EnsemblGenomes-Tr; EBT00001599568.
DR   EnsemblGenomes-Tr; EBT00001599569.
DR   EnsemblGenomes-Tr; EBT00001599570.
DR   EnsemblGenomes-Tr; EBT00001599571.
DR   EnsemblGenomes-Tr; EBT00001599572.
DR   EnsemblGenomes-Tr; EBT00001599573.
DR   EnsemblGenomes-Tr; EBT00001599574.
DR   EnsemblGenomes-Tr; EBT00001599575.
DR   EnsemblGenomes-Tr; EBT00001599576.
DR   EnsemblGenomes-Tr; EBT00001599577.
DR   EnsemblGenomes-Tr; EBT00001599578.
DR   EnsemblGenomes-Tr; EBT00001599579.
DR   EnsemblGenomes-Tr; EBT00001599580.
DR   EnsemblGenomes-Tr; EBT00001599581.
DR   EnsemblGenomes-Tr; EBT00001599582.
DR   EnsemblGenomes-Tr; EBT00001599583.
DR   EnsemblGenomes-Tr; EBT00001599584.
DR   EnsemblGenomes-Tr; EBT00001599585.
DR   EnsemblGenomes-Tr; EBT00001599586.
DR   EnsemblGenomes-Tr; EBT00001599587.
DR   EnsemblGenomes-Tr; EBT00001599588.
DR   EnsemblGenomes-Tr; EBT00001599589.
DR   EnsemblGenomes-Tr; EBT00001599590.
DR   EnsemblGenomes-Tr; EBT00001599591.
DR   EnsemblGenomes-Tr; EBT00001599592.
DR   EnsemblGenomes-Tr; EBT00001599593.
DR   EnsemblGenomes-Tr; EBT00001599594.
DR   EnsemblGenomes-Tr; EBT00001599595.
DR   EnsemblGenomes-Tr; EBT00001599596.
DR   EnsemblGenomes-Tr; EBT00001599597.
DR   EnsemblGenomes-Tr; EBT00001599598.
DR   EnsemblGenomes-Tr; EBT00001599599.
DR   EnsemblGenomes-Tr; EBT00001599600.
DR   EnsemblGenomes-Tr; EBT00001599601.
DR   EnsemblGenomes-Tr; EBT00001599602.
DR   EnsemblGenomes-Tr; EBT00001599603.
DR   EnsemblGenomes-Tr; EBT00001599604.
DR   EnsemblGenomes-Tr; EBT00001599605.
DR   EnsemblGenomes-Tr; EBT00001599606.
DR   EnsemblGenomes-Tr; EBT00001599607.
DR   EnsemblGenomes-Tr; EBT00001599608.
DR   EnsemblGenomes-Tr; EBT00001599609.
DR   EnsemblGenomes-Tr; EBT00001599610.
DR   EnsemblGenomes-Tr; EBT00001599611.
DR   EnsemblGenomes-Tr; EBT00001599612.
DR   EnsemblGenomes-Tr; EBT00001599613.
DR   EnsemblGenomes-Tr; EBT00001599614.
DR   EnsemblGenomes-Tr; EBT00001599615.
DR   EnsemblGenomes-Tr; EBT00001599616.
DR   EnsemblGenomes-Tr; EBT00001599617.
DR   EnsemblGenomes-Tr; EBT00001599618.
DR   EnsemblGenomes-Tr; EBT00001599619.
DR   EnsemblGenomes-Tr; EBT00001599620.
DR   EnsemblGenomes-Tr; EBT00001599621.
DR   EnsemblGenomes-Tr; EBT00001599622.
DR   EnsemblGenomes-Tr; EBT00001599623.
DR   EnsemblGenomes-Tr; EBT00001599624.
DR   EuropePMC; PMC3278476; 22045996.
DR   EuropePMC; PMC3318803; 22307287.
DR   EuropePMC; PMC5109826; 27846794.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01321; CRISPR-DR8.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000859.
DR   SILVA-SSU; CP000859.
DR   StrainInfo; 159819; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002948
CC   Source DNA and bacteria available from Boris Wawrik
CC   (bwawrik@yahoo.com)
CC   Contacts: Boris Wawrik (bwawrik@yahoo.com)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3944167
FT                   /organism="Desulfococcus oleovorans Hxd3"
FT                   /strain="Hxd3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:96561"
FT   gene            50..1432
FT                   /locus_tag="Dole_0001"
FT   CDS_pept        50..1432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; KEGG: sfu:Sfum_0001
FT                   chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65811"
FT                   /db_xref="GOA:A8ZRP4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP4"
FT                   /protein_id="ABW65811.1"
FT                   /translation="MDSVWKKVKADLKTHVPLNNYMMWIEPLEFESAQPDTLVLNCPNS
FT                   FSKKWVAGNYEKLIAEKVCGLCGKQVHLRLEVAPPGTGAKKQSPAPDSTAIPSGTHTRS
FT                   DAQLTLPSVQVKPATGRVLKADYTFDNFVVGNHNDFAYTAVLSLGARQQSGGRSLFLSS
FT                   RPGMGKSHLAQALGHQTIKAQPGCRVYYTTVEDFSNEMVYAYTTKSSGAFKKKYRTGFD
FT                   MLLIDDIHALAGKDRTQEELAMVVDYMLEADRKVLFAGCCLPGEIPKMNDQLKSRLSCG
FT                   LITTMETPDFTTRVRILEKKARFYGYAVPRDILEYLADVLTEDVRQLESGLANLATKSC
FT                   LLGVPMDRELAESIIKNMAVRNGAITLDAIKKVVCKAYGLAAKEIDSRSRKHRVAWPRQ
FT                   VAIYLSRRYTDHSLKAIGRSYNRYHATVLHSINTVEQAMKANRSVFQEVDYIIQKIESG
FT                   KI"
FT   gene            1624..3012
FT                   /locus_tag="Dole_0002"
FT   CDS_pept        1624..3012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0002"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sfu:Sfum_0534 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65812"
FT                   /db_xref="GOA:A8ZRP5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP5"
FT                   /protein_id="ABW65812.1"
FT                   /translation="MAPLTKKTIEEIQGIVGSDHCTTAPEDRVCYAYDASAADCLPDAV
FT                   VFPADRDQVARVLALAHRDGFCVTPRGSGSGMTGGSVPVAGGVVMVLNRLNRILEIDTD
FT                   NLVARVEPGVITGDFHKAVEALGLFYPPDPSSAAFSTLGGNVAECAGGPRAVKYGVTRD
FT                   YVLGLSAVLPNGDIITTGVRTAKGVAGYDLTRLIAGSEGTLAVITEMTLRLLPLPEAVG
FT                   TMTALFDDIRQAARTVSEIIRQRIVPRTLEFIDNASLGCVEKSLNLGLPITAAAMLLIE
FT                   VDGAPLANTAALEKIAAICTSQGATQVTVADTKQAAEDLWRARKAISPALFNLAPDKIN
FT                   EDIVVPRSRIPDMVAALEALSRQTGLTIACFGHAGDGNIHVNIMADKKDPVQAERAKEA
FT                   TDRLFEETLRLGGTISGEHGIGITKAPYLGKEVGGAELMLMRRIKKVFDPNGILNPGKI
FT                   FHLI"
FT   gene            complement(3019..3234)
FT                   /locus_tag="Dole_0003"
FT   CDS_pept        complement(3019..3234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP6"
FT                   /protein_id="ABW65813.1"
FT                   /translation="MRDFIGMDDIWDRLFRQDEMGCLGDFNPNSRLCTRKCALAVRCII
FT                   VYNHRIETMEVDDLFGFQDSDTAPIQ"
FT   gene            complement(3231..4013)
FT                   /locus_tag="Dole_0004"
FT   CDS_pept        complement(3231..4013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0004"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: ppd:Ppro_0018
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65814"
FT                   /db_xref="GOA:A8ZRP7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP7"
FT                   /protein_id="ABW65814.1"
FT                   /translation="MSVDIAYVRQVGIGAAFKGARALRAFFRGRFSVDKKGVRDLVTEA
FT                   DRASEKAIVDEIHYRFPDHAVLAEESGATGTRSEYRWIVDPLDGTTNFAHGLGLFCVSI
FT                   AFAENGEVTAGVVLNPETGELFTATVDHGAELNGAPIAVSGTSTLSDSLLATGFPYDVD
FT                   KRLDPVMARLSRCMAASRGIRRLGSAALDLCYVACGRFDGFWEEGLYPWDTAAGMLIAR
FT                   RAGATVTDFSGKAFVPEQKTILATNGLIHNEILKEMRE"
FT   gene            complement(4067..5764)
FT                   /locus_tag="Dole_0005"
FT   CDS_pept        complement(4067..5764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0005"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   sat:SYN_01762 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65815"
FT                   /db_xref="GOA:A8ZRP8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP8"
FT                   /protein_id="ABW65815.1"
FT                   /translation="MKKRPHGNTGGLKADHLRRLDNLYRRRVPSSFLVTPELARELCLL
FT                   SREIRRQIGLLIDRQGVVAHVIVGTDSAIVIPDISEYRTAAGRLRGLKCVHTHLGPDPL
FT                   TADDITDLSLLRLDIMAAVADTGGPEENPRYRVYGAHLLPGNGEGGPSGPSCKVLDPLG
FT                   HADLDIGCDGLIASLEDELAQAGALREAGQKSDRAILVSVTGAPRAAAGASLTELSALA
FT                   ASADIAVVDTVLQFRKKTDARFLLGRGKLGELAVLALQTGANLLVFDQELNPSQIRSIT
FT                   DQVDIKVIDRTQLILDIFAQRAQSMEGKLQVAHAQLKYLLPRLVTKNTAMSRLTGGIGG
FT                   RGPGETKLEINRRRVRDQLARLEKQLESIKKQRRQQKARRDKRALPVISILGYTNAGKS
FT                   TLLNTLSKSGVATADRLFMTLDPASRRIRFPREMDVILTDTVGFIQNLPKELMVAFRAT
FT                   LEELERADLFIHVVDAANPAAEAQIRSVERIVTELGLSLTPMVYAVNKADRATPEQVEA
FT                   LVRATGGVPVSANNAATLGPLIDRLADRVGQIVKHNRRLSENPVISDY"
FT   gene            complement(5815..7230)
FT                   /locus_tag="Dole_0006"
FT   CDS_pept        complement(5815..7230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0006"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: sat:SYN_00640
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65816"
FT                   /db_xref="GOA:A8ZRP9"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP9"
FT                   /protein_id="ABW65816.1"
FT                   /translation="MEKAAPKKKGRPKAGAAGAVPSDPLLHRLPPQNIEAEESILSTIL
FT                   IDPDPSTLFDVLEVLAPEDFYKSAHQKIFAAIVRLVEKNEPVDLVTVKNTLAESDELEP
FT                   IGGAAYLAGLVDSAPYAANARHYADIIKNKASLRRMIENANEISRRCFDNPSDVEGVID
FT                   FAERAILEVAEQKAGRSFYKLSQLLVANIETIEANQGKGITGIPSGFDRLDNLTAGFQK
FT                   SDLIILAARPSMGKTAFALNIARNVAVDANVPVAVFSLEMSKEQLSMRLLTAEARIGFQ
FT                   RLRSGYTSRQDMGQITDAASVLEQAPLFIDDSPGLTAMEIRAKARRLKREKGIGMIVVD
FT                   YLQLMRASHQGERRDLEVSEMSRSLKGLAKELDLPILVLSQLNRSPEQSQDKRPMLSHL
FT                   RESGSLEQDADVVLFIYRDEMYNKEPENPNRGSAEIIIGKQRNGPVGKIKLQFSADITR
FT                   FHDLETVHADMEA"
FT   gene            complement(7279..7734)
FT                   /locus_tag="Dole_0007"
FT   CDS_pept        complement(7279..7734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0007"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: sus:Acid_7091
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65817"
FT                   /db_xref="GOA:A8ZRQ0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRQ0"
FT                   /protein_id="ABW65817.1"
FT                   /translation="MQVILMETVEALGLAGTEVKVAPGYARNFLFPRQKAMAATPANRR
FT                   RMEQMRAKIELQIAKERGAAQEAAKKLEGVVCRISAKVSNEGRLYGSVTVGDIVEALAA
FT                   RDITVSKKMVLLRENIKEVGTYPVGIYLYKDVVPEISVEIVADEKAE"
FT   gene            complement(7957..8940)
FT                   /locus_tag="Dole_0008"
FT   CDS_pept        complement(7957..8940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0008"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: sat:SYN_00642 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65818"
FT                   /db_xref="GOA:A8ZRQ1"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ1"
FT                   /protein_id="ABW65818.1"
FT                   /translation="MLHQAEKTGPKNMLAGAGITSLIFLAAGLSPVLGVAAFFMLPPVM
FT                   FYYRSLLGRQAGMTVLSVAGAVALVRWGGMTPDVGVGLTLLALGFFLAEFAEKGLSIEP
FT                   TILFACGAVLAGGLVVLALYSNLSGVGLGAMVSDYVGKNLELTLRLYEDAGMTDDPGVA
FT                   ALAESMDALKTLLVRILPALAAAMVLLAAWATILTARVVMKRRGHAFPDFGRLNRWAAP
FT                   DFLVWAAIVSGGLLLLPVTVAKVTGINGLIVLVVVYFFQGIAIVSFYFETRNAPAALRV
FT                   LVYGMMAVWQMTALLVACLGFVDTWADFRRLRRAGETDPDDDEPVG"
FT   gene            complement(8962..9213)
FT                   /locus_tag="Dole_0009"
FT   CDS_pept        complement(8962..9213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0009"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: gur:Gura_3677
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65819"
FT                   /db_xref="GOA:A8ZRQ2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRQ2"
FT                   /protein_id="ABW65819.1"
FT                   /translation="MNPSPRGKKRVFHRRKYCRFCADSSLPIDYKNPKSLKSFITERGK
FT                   IIPRRISGTCAKHQRAITREIKRARTIALLPYVGKPDN"
FT   gene            complement(9267..9773)
FT                   /locus_tag="Dole_0010"
FT   CDS_pept        complement(9267..9773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0010"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: sfu:Sfum_3188
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65820"
FT                   /db_xref="GOA:A8ZRQ3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRQ3"
FT                   /protein_id="ABW65820.1"
FT                   /translation="MRRYETIFIADPDLSPENQAQLFEKATTLIDANSGVLVEFDEWGT
FT                   RRLAYEIRKKPRGHYVRLDFCGDGATVQGLENAFRIDERVLKFMTVFLSENADPEALRQ
FT                   AIAEEKEKKAEGQAAADAAPADGDDEAPKQPAPASDDDAPKQPETEAGSDETEAAAADK
FT                   SDDNA"
FT   gene            complement(10367..11674)
FT                   /locus_tag="Dole_0011"
FT   CDS_pept        complement(10367..11674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_03116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ4"
FT                   /protein_id="ABW65821.1"
FT                   /translation="MKKITVLALAACMAFAVAVPAMAVDVDFSGYYRVRGFMNSNITLN
FT                   DQDEQSEAYYDNRFRLQTVFKATDAVSVTTRIDALDDNVWGAQNENDIDWDRVYMTIMS
FT                   DVGMFMIGHQQAGVWGLDFFDDDYNDDRIKYVGKTGDFYFGAIIQKTRETDSNVAWLND
FT                   GESDADTDVYYLFGSLKQEGLEAGLLAAYARDTTSSSMTATKQALLPYGKFTAGPLSVR
FT                   GEIIYEFGEMDFDGATPDVDIDTLSYALEGSFSLDMARLYLGWVSVSGQEDGDDMTMGN
FT                   MTYGGLGDDFNPLALLTNDLGAKMLNSKASLGNIMAVDAGMPGATLSSADVVALCGVNL
FT                   LYAGADVAVNDKLNVAGIIGYAMANEDDLLTGTGIDDVYGTEVDVTVTYQIMDNLEYQC
FT                   TLAYLMTEDLLAFTKSVGPNNADDNFGIMHQIKASF"
FT   gene            complement(11993..13690)
FT                   /locus_tag="Dole_0012"
FT   CDS_pept        complement(11993..13690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0012"
FT                   /product="integrin-like repeat protein"
FT                   /note="KEGG: sat:SYN_00931 integrin-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65822"
FT                   /db_xref="GOA:A8ZRQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ5"
FT                   /protein_id="ABW65822.1"
FT                   /translation="MMRIFVCRILFLAVFLLPGLSGGAAHARVASLAITPFAINAETDL
FT                   SYLSRGAAEMLASRIAAQSDVSVMDMALVADAAARAPQPLTRAGAVALGRQLNADYVLF
FT                   GSITVLGGPVSMDVNVIPVAEGSGPPAAFYKQADSIAGVIPAVGALAGEIRTTVFAAAP
FT                   LGDSTVTTPSAAAPTETGPPAPVPVAVPAGAPAGAVMAARAPAPAGERTTDAGSSAFVV
FT                   SGQPGQEQDFWKSQDFEAEIRGLALADVSGDGKTETVLLTDRLLTVRRLEQGRFYKLAE
FT                   HRLAGYENPLAVDAVDTDNNGQAEIFVTCINKTTGALASFVLELSDRTLTTVAQKQAWY
FT                   FRSMGDGAIYGQKKGLGMADIFLPGIFRLARQGGQYTAQAPLETPAGERFSLFNLAMGD
FT                   LTNAGTPQVIAYDDNDHLRIYDKEGQMVWKSENPFGGSETYITTKEDSDNEIGQRFYLA
FT                   QRIWVGDIDGDGRTEVITVANNAVSGRLFDRFRHYSGAQFVCLGWDGLGLAEKWHTRQV
FT                   SGYASDFSLADFDNDGKPELVSAIVSSRGAVVTKPRSSVISYDLEGAQ"
FT   gene            complement(13760..15190)
FT                   /locus_tag="Dole_0013"
FT   CDS_pept        complement(13760..15190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0013"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: sfu:Sfum_1705
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65823"
FT                   /db_xref="GOA:A8ZRQ6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ6"
FT                   /protein_id="ABW65823.1"
FT                   /translation="MAFESVIGLEVHAQLKTGTKIFCGCSTGFGAPPNTHTCPVCTGMP
FT                   GTLPVLNRTVVDYALKMALAVNCRIRSVSRFARKNYFYPDLPKGYQISQYELPIAEHGE
FT                   VVIDTGNGEQKRVGITRIHMEEDAGKLIHDASRPVSYVDYNRTGVPLIEIVSEPDMRSP
FT                   REAGAYLRELRSLLRWLDISDGNMEEGSFRCDANVSIRPSGSTALGTRTEIKNLNSFRH
FT                   VEQALAYEIRRHADRVSEGGAVEQETRLWNPEKMVTVSMRGKEDAHDYRYFPDPDLLPL
FT                   VVDDAWKDRIQATLPELPAFRKKRFVADYGLSEEDAGVLTGSRALADYFEACAAEAKTP
FT                   KPCANWIMGDLLGLLNATATPIEASPVSPVHLGRLVGLINDNVISGKIAKTVFEEMART
FT                   GQDPKAIVEARNLVQVTDTGAIGAAIDQVIAECPDEVEKYKSGKTKVMGFLVGQVMKKT
FT                   KGKANPQAVNDLLAEKLR"
FT   gene            15398..16750
FT                   /locus_tag="Dole_0014"
FT   CDS_pept        15398..16750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0014"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: pin:Ping_1819 putative ribonuclease
FT                   BN"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65824"
FT                   /db_xref="GOA:A8ZRQ7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ7"
FT                   /protein_id="ABW65824.1"
FT                   /translation="MNESKKKRLAARTSGALDFLRTGIWRVRLRELETRERVLVRYARI
FT                   FMIAGREFITDGGPLRASALTFYTVLSLVPVMALAFAVAKGFGLQQTLEKEVLAQFPGQ
FT                   EAVILQMIEYARALLDQTKGGLLAGVGVAVLIWTVIKVLNNIEKSFNAIWANTTPRSMG
FT                   KKFSDYLSIMLVGPLLLILSGSATVLVATQVTAITNKIFFLGWFAPIIMTGLQLLPYLF
FT                   VWLLFSFIYGFMPNTRVPVRSCIFGGVLAGTAFKLLQWAYLIFQVGVSRYNAIYGSFAA
FT                   LPLFLIWMQLSWLVTLFGAELAYAHQSVGHYELEPDSRNISDFLKRIYGLYVAHLLVKT
FT                   FKNGEPPLTADQISARLDLPIRMVNRLLETLSAAGLATQTLSGTGGDPAWQPGRDITDI
FT                   TIASATEAMDKNGTTEMPVVSTPELSRLSDAVSAFYGDIGKSRANVALKDI"
FT   gene            complement(17136..17657)
FT                   /locus_tag="Dole_0015"
FT   CDS_pept        complement(17136..17657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0015"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   vei:Veis_0111 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65825"
FT                   /db_xref="GOA:A8ZRQ8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ8"
FT                   /protein_id="ABW65825.1"
FT                   /translation="MPHIDLPEKEDLPSEIGDLLALLPPLNAFRMMAVVPVSFRPFLDL
FT                   AGSVLSGETFDAKLREIAVLRVVRQLKCDYAWTHHVTVGKATGLTDTEIGAIKTEDPVS
FT                   SLDDEGNLLCRAADEITLSACLSDDTLEQIKARYGNAGAGALILCCAYFNMLGRCLLSM
FT                   RVDLETEKVL"
FT   gene            complement(17995..18588)
FT                   /locus_tag="Dole_0016"
FT   CDS_pept        complement(17995..18588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65826"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRQ9"
FT                   /protein_id="ABW65826.1"
FT                   /translation="MKTVRLIVCLGLAVLMTGFWGCGRSEIDFGSFSGNVYKNDYFDMA
FT                   LTLADDVRIDTRQKAAAAQAAKPSELQTLTLFTAYLYPDDSEVLFNANLMAMADRIDKP
FT                   MGVKTGRDYHLYTKKLLESTPIPVSLSQDITTQTLGGKTFDLMQAAIPLAQVSVKQDLY
FT                   AAAMGDYILVLAISYTNPDERAALLEMLNTVSFK"
FT   gene            complement(18772..19362)
FT                   /locus_tag="Dole_0017"
FT   CDS_pept        complement(18772..19362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65827"
FT                   /db_xref="GOA:A8ZRR0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR0"
FT                   /protein_id="ABW65827.1"
FT                   /translation="MDLNDLIPVLVFLAIVGFQVIGAMIKRARKPAPDGEAADTGAGPG
FT                   GVLGRVFSRIQQEMERAAREVEAKREAPSQWDLLMPEDAPPQAEKPAAPAQGMRQVHEG
FT                   RRAEAVVQPVLRKQAPPAPSPAKTMKRGTTAFETALQQAGAAPAPAALPVSKPSIVTGS
FT                   AAELRRAVVWSEILGPPVALRKTPEDRWEPDVL"
FT   gene            complement(19366..20346)
FT                   /locus_tag="Dole_0018"
FT   CDS_pept        complement(19366..20346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0018"
FT                   /product="protein of unknown function DUF1432"
FT                   /note="KEGG: drm:Dred_2488 protein of unknown function
FT                   DUF1432"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65828"
FT                   /db_xref="GOA:A8ZRR1"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRR1"
FT                   /protein_id="ABW65828.1"
FT                   /translation="MNPNYIILFFLVVAVIVLFYFVGSSVSLWIQALVSGARVGLLNIV
FT                   FMRFRKVPPKLIVESKIMATKAGLDISSDELESHYLAGGNVSRVVQALIAADKAKIELS
FT                   FNRSAAIDLAGRDVLEAVQMSVNPKVIETPMIAAMAKDGIQLKAISRVTVRANIDRLVG
FT                   GAGEETILARVGEGIVTTIGSADSHKHVLENPDLISKRVLEKGLDSGTAFEILSIDIAD
FT                   VDVGKNIGAELETDRAEADKKIAQAKAEERRAMAYAREQEMKAQVEEMRAKVVEAEAKI
FT                   PLAMANAFEKGNLGIMDYYRMKNIMADTQMRDTIGSPDRETPREK"
FT   gene            complement(20373..20849)
FT                   /locus_tag="Dole_0019"
FT   CDS_pept        complement(20373..20849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0019"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bsu:BG11650 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65829"
FT                   /db_xref="GOA:A8ZRR2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR2"
FT                   /protein_id="ABW65829.1"
FT                   /translation="MNPVMLVVILQLVAVVIIIAEVIIPSGGLLSLLAAGLIGYSLYTV
FT                   FGQISVDAGYLLIGIDVVVLPLVILLGLKLLARSPATLRAELSTGAGVTSQRPDMEGLM
FT                   GKKGTALSDLRPSGVAMIEGKRVDVVSRGAYIDRNSEVVVRAVTGNQVIVTTPE"
FT   gene            complement(20846..22312)
FT                   /locus_tag="Dole_0020"
FT   CDS_pept        complement(20846..22312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0020"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   rba:RB7673 conserved hypothetical protein-putative
FT                   periplasmatic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65830"
FT                   /db_xref="GOA:A8ZRR3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR3"
FT                   /protein_id="ABW65830.1"
FT                   /translation="MKRLFLIFCLLVSGFFLVAPGPVSAGDAHTVYVVKVAGDVAPGMA
FT                   AYLKRALDDIPEAPHQTIVLDLDTFGGRVDSALMIVDLITAADSKGKTIAFVSRKAISA
FT                   GALIALACNELVMKPGTTIGDCAPIMVGSQGPEMLGEKFQSPLRAKFRALAKKNGYPEA
FT                   LAESMVTADMEVFRVVTKDGGTFYMDALEYEEMDEAQKSAVVSKKTVVAKGELLTMDDI
FT                   EARDLGFSQMTVSSVKEMLAAMGIDDTDIVVMEQQWSEGLMRWLGTLAPLLMLIGLGAL
FT                   YTEIKSPGFGVPGIVGIICLALFFMNQYAVGLADYTELLIFLLGLVLIGIETFVLPGFG
FT                   IAGIAGAVCIIVSFVLAMQGFVLPDPDMPWQTDLMVNNVIQVLGAVVTAFLAALFLLRF
FT                   VLPRLSAVVSGPYLSATLSEARADATANTGAGVGDRGTAATSLRPAGKMKIGPEMYDVV
FT                   TEGEFLDKGTPVVIIAVRGNVLVVSRETTQ"
FT   gene            complement(22361..23017)
FT                   /locus_tag="Dole_0021"
FT   CDS_pept        complement(22361..23017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0021"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dps:DP0805 similar to
FT                   beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65831"
FT                   /db_xref="GOA:A8ZRR4"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR4"
FT                   /protein_id="ABW65831.1"
FT                   /translation="MSDTTRQTVKIIAFDCDGVLFDTDDANRAYYNRILVNMGLPEMTD
FT                   AQFSYVQMHTVNDSLAFLCGADGLDRAQALRKGLGYGPFIRHMKKAPGLEDLLDRLYNR
FT                   VHTAIATNRSNTMNRVLAEHGLADRFEMVVTALDVMRPKPAPEQLLKILDRFGAAPSEM
FT                   IYIGDSELDERAATSAQVPFIAYNNPALKADFHAPDMRAVGTILDRFSLAGRTGE"
FT   gene            complement(23014..23517)
FT                   /locus_tag="Dole_0022"
FT   CDS_pept        complement(23014..23517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65832"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR5"
FT                   /protein_id="ABW65832.1"
FT                   /translation="MASFTRSIPAGGEGTISIKVYTKHYGDQRITKTASVYTNDPSNKI
FT                   IPLTITGQVERVVSVMPNQVRLSGTVGMELKQVVRIVPGEKYPFAITEVRANQGKEIAF
FT                   DLKEITHDGRPAYQLTVTNTRKEPGTYIDFIYLKTDSQLVPNLKVRVQGTLVSPVLPNQ
FT                   EPVL"
FT   gene            complement(23527..23751)
FT                   /locus_tag="Dole_0023"
FT   CDS_pept        complement(23527..23751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65833"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR6"
FT                   /protein_id="ABW65833.1"
FT                   /translation="MKRLIMLSGMVLFLLSAGAVVFAADVPDKASPVAVIEARTFTFDP
FT                   VPEGTEVVHDFTVKNTGTAELRVEQVKTG"
FT   gene            complement(23770..24261)
FT                   /locus_tag="Dole_0024"
FT   CDS_pept        complement(23770..24261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0024"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: nph:NP1002A hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65834"
FT                   /db_xref="GOA:A8ZRR7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR7"
FT                   /protein_id="ABW65834.1"
FT                   /translation="MLMAVMSDSHDNIANMRKAVAKVREAGCEMILHCGDFVAPFMLAE
FT                   LDMAGIPVHGVFGNNDGDRYLLTKNALTVHKNITLHGDFGRLAADGRQVAFIHDGTIAD
FT                   DLAGGGRYDIVCFGHFHVWMQKKVNHTLVVNPGELLGKDDTPGFCVVDTAALLAERVLI
FT                   "
FT   gene            complement(25106..27145)
FT                   /locus_tag="Dole_0025"
FT   CDS_pept        complement(25106..27145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0025"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: pth:PTH_1792 primosomal protein N'
FT                   (replication factor Y) - superfamily II helicase; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65835"
FT                   /db_xref="GOA:A8ZRR8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR8"
FT                   /protein_id="ABW65835.1"
FT                   /translation="MSDSRYIEVAIHLPVFQTYTYSVPEPLLLQAVCGRRVQVPFGRQM
FT                   VAGTVLGEATACDNAEIKPVAAVLDDGPLFPATMIPFFRWVADYYLYPLGETIANALPA
FT                   GDLPKKSAPPVGKIPKDAVGDPILPDTPPDLTTDQEAVVADLVSRLDAGFCSCLLAGIT
FT                   GSGKTEVYMRVVAAALAMGKTALVLVPEIALIAQAEHRFCARFGHTVAVLHSGLSRTER
FT                   WHQWSKIARGEAAIAIGTRSAVFAPLDRPGIIIVDEEHDTSYKQESGLRYNACDLAVVR
FT                   AKLSDAVVVLGSATPSVQSLHNATTGKFSKTYRMDRRINRQPLPAITVVDLREQQARRG
FT                   PRAYISDELHRAMAETLAQGNQVLLFLNRRGFASLPVCAACGNTIKCKHCDISLTLHKG
FT                   ANAFRCHFCGYSRAAARGCDICGSSSIKLLGLGTEKVEEAVKQLFPEASVARLDRDTTT
FT                   RKGAMLRILKDLKNRKIDILVGTQMIAKGHDFPGITLIGVICADLSLNFPDFRAGERTF
FT                   QLLAQVAGRAGRGVDPGRVILQTYNPDHLCIAAATRQDGSAFYDQEIAFRRQLGYPPFS
FT                   RMVHLHISATDPAKAKARAREAGDCCTALKNSAPAVFGAVEVLGPVEAPIHKLASRYRW
FT                   QILLKSRSAAAVKSFAARLLAQDGQRLRKGGVRLVVDVDPFFMM"
FT   gene            complement(27261..28541)
FT                   /locus_tag="Dole_0026"
FT   CDS_pept        complement(27261..28541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0026"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: dps:DP1088 probable citrate synthase; TIGRFAM:
FT                   citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65836"
FT                   /db_xref="GOA:A8ZRR9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR9"
FT                   /protein_id="ABW65836.1"
FT                   /translation="MTETATIVINGKTYEFPVITGTEGEKAIDIRELRAKTGYITFDPG
FT                   FSNSGSCTSTITYMDGAKGVLRYRGYPIEQLAETSCFVEVCYLLLNGDLPSRAEYQRMS
FT                   VMLNDHSLVHEDMQIFFQNFPRSANPMGILSSMVNALRSFYPELMTTEEAIETTFLRLI
FT                   SKVRTMAAMSHRISRGHKIVYPRPDYSYCANFLNMMHDSPVRPYEIKKEFVEALNMFWV
FT                   LHADHEQNCSTSTVRAVGSARANIYAALSAGIAALWGPLHGGANRAVVEMFEDIRKSGG
FT                   DVKKAVKRAKDKNDPFRLMGFGHSVYKTYDPRAKIMKKMCDKVLAVANTEDPLLDIAME
FT                   LEEVALKDSYFTDHNLYPNIDFYSGIVLRTLGIPVEMFTVMFAIGRLPGWIAQWKELMD
FT                   DPFKKLFRPRQIYVGETMREVLPIDER"
FT   gene            28802..29572
FT                   /locus_tag="Dole_0027"
FT   CDS_pept        28802..29572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65837"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS0"
FT                   /protein_id="ABW65837.1"
FT                   /translation="MKKLWIGLALALLLAVPATSFAIGLEAAIGGWGQDISGDMAYKPL
FT                   NPITDVIDFERDLGYDSETRVMGRVRIDMPLIIPNIYVMATPMEFEGTSQQAVEFKFGN
FT                   DTFEADIPYTSKLSMNHVDVALFYSIPLLEMATFNRLNIDLGINLKVADLSAEITQPDT
FT                   GLSEKEDYVLPIPMAFAAVQLKPIDLLAIEAEGRGISYSGNHLFNVIGRVKVKPFGPFF
FT                   IAGGYRYDSIKLDEKDLRLDAQVDGFFAETGFEF"
FT   gene            29588..30250
FT                   /locus_tag="Dole_0028"
FT   CDS_pept        29588..30250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0028"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sfu:Sfum_1732 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65838"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS1"
FT                   /protein_id="ABW65838.1"
FT                   /translation="MQHSDKNPMVVRQIKLSRMETFCYLVGDPASKTGLLIDPAFDTGR
FT                   ILAAAATAGFTITAVVNTHGHADHCCGNAAVMGASGARLHIHKKDARQLTGFFNGVLCR
FT                   LLGGRPSPRPDVVLQHGEAVVLGQTTLTVLHTPGHTPGSICLYMPGHLFAGDTLFVGSA
FT                   GRTDLSGGSIKDLHASIRTRLFPLPDDTRVWPGHDYGDRPVSTIGHEKKTNPFMQAD"
FT   gene            complement(30274..30918)
FT                   /locus_tag="Dole_0029"
FT   CDS_pept        complement(30274..30918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0029"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: sat:SYN_01019
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65839"
FT                   /db_xref="GOA:A8ZRS2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS2"
FT                   /protein_id="ABW65839.1"
FT                   /translation="MIKVLVADDHKIIREGLCNMLDAEPDLKVVGAASNGREALALARK
FT                   LSPDVVIMDISMPELNGIEATRQIRAEAPQAAVIALSMYADKRYVLGMLKAGVAGYLIK
FT                   DCAFEELARAVVVVHRGETYLSPAIADTVRKVLVTRIDQDPLTRVEELTERERQVLQMI
FT                   AEGIKTKDIAESLHISVKTVETYRSSIMQKLGLFSVAELTKFAVREGITPP"
FT   gene            complement(30896..36115)
FT                   /locus_tag="Dole_0030"
FT   CDS_pept        complement(30896..36115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0030"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: serine/threonine protein
FT                   kinase; KEGG: pth:PTH_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65840"
FT                   /db_xref="GOA:A8ZRS3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS3"
FT                   /protein_id="ABW65840.1"
FT                   /translation="MAHPLGDIARQALAHRYDRLVEMDATGTSTTLSAVDRDTGRAVVA
FT                   RLLGVETRFPAAGTLLDHVARLASLSSDYLLEIYEYREVPADSPSGILVIHEAFTGMPL
FT                   GDLLPSFHRMLSEDARPGHAFCVLAAQMATALRDLHAAGLLYRGITPHSFLFNPATRRF
FT                   KLDGLAWDDAWLPEQGGFSAGVAASALSCLAPEQAGRMDHVVDFRANLYSLGVLFYEMM
FT                   TGKHPFPAGDAAGVLYGHTARTPALPSDLNPAMDTALSRMVLKLLAKHPDDRYQSAAGL
FT                   LFDLADLTGRFDAALSVGEFMPGRKDVSPVFALPDRLYGREEALSFLKKRFDRVRAGDT
FT                   GVVMVTGGTGVGKTEVIRHLSRYVRESGGIFLTGKFDPNQQNVPLSASKTAIASIARWL
FT                   LSRPPDQIRAWREKILSAVWPSGQVLVDMIPEMELIIGKQPPLGELPPMEANMRMALVM
FT                   EKFGTLFLAREHPVVFFLDDLQWADRGTLEHGVAFMLIRQRHYCMVLGTCRDSEVDDTH
FT                   PLSRFLEKLERTSVPVEKLSLRPLDIDQTTAMMADTLSQARTAVLPLARIVFEKTGGNP
FT                   FFIRQFLGSLHANGLIHYDTGRGCWAWNVERIAAADITDNVARLLSTTIDKLPAPTLSV
FT                   LQAAACAGNRIDPELLVLVIGRDRADICAHVQTALEAGLVHPVTDPSATAPAVDTSTGL
FT                   TWEFAHDHILQAVYQTLPETQAREIHWTVGKALLEKASEGAPGERIFDIVHQLRLGMPL
FT                   SLSSPEATELARLNLEAGRVAMETISFEGAADYLRHACNLLPDTAWETHYDLAAGIYGA
FT                   LARCEFALGAFVESERLFGLLLQKAPSLVTRARAYNAMVELHTAAGNIDKALMLGRRAL
FT                   ETLGIHLPRRPGRARVLLLLVRLRLIWGVRRVSAILDAAENRDETLDITLTLLTNIGLP
FT                   TFYVNPLLCLWINATGILLGIRNPKEGFPLQHASFGLITLGAFLGSIFGFIGMGRHYAK
FT                   TGMRLLERQAPGQYQAIAYFVSAFFNRHWYQPARKSIDSFKRAYRHALKTGDISYAGHS
FT                   INSMFMVRFFLGDNLDAVYAYHQRHEAFIQKARSPFAVAHYKLLRQLYRSLKGQALSPA
FT                   GLDTKDYDTAAEFAAVVDTGNLLLRFFFLLSQLKLYVFHRQWENGASLVERIQAMNYLP
FT                   VGTLVVTEYCFFAFLSITNLIVAGTPPQQARRYSRRAARFIRRMRQWYRLQPDNFEPML
FT                   RLMEAEKARVQGRPVQAQERYRQAVAAARDGGFTHLAALGCESAGNFFAAQGDTVAARA
FT                   YLAEARKAYLDWGATAKAADLEKQHAGLFAAIPGHTAVSISPLERADHGAVVAALQAVS
FT                   QEIVVRRLLTRLMEITMAATGASRAAFISNRQGRLFVEVERWGNETDQTLLKSEPLLEQ
FT                   PTSLMAAVVYYVKRTRELVVMNDVKKESSLFQKNSDDAGTPRALVCMPMARNKRLVGIL
FT                   YLENALTGGVFTEDRIGLLTMIASQAAVSFENATLYEHVMKNEQDLKRLSEKLRSLYSE
FT                   LLLTEERERRRIATELHDRIGHALAGAKIGLETLCKGSAKEHEARLRDVLAVLDQSIAD
FT                   TRTLTFELSPPILYHLGLGPALDWLCEETQKKHGLTVSFADTGQEGGLDQKTEILCFQI
FT                   VRELLFNAVKHSQAGHVEVRLYRNGARMGLTIQDDGVGFDGSRQSAGSGFGLFSIHERL
FT                   RLVGGEMNIDTGKNRGTTIDITVPLTGENQNQGEVNDQGSGG"
FT   gene            complement(36230..37147)
FT                   /locus_tag="Dole_0031"
FT   CDS_pept        complement(36230..37147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0031"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bba:Bd1770 ABC-type multidrug transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65841"
FT                   /db_xref="GOA:A8ZRS4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS4"
FT                   /protein_id="ABW65841.1"
FT                   /translation="MELIYSRREKIVGLFVISIIVLLFSTVVLIGRGKNWFKSYVTYYT
FT                   VFEESYNLQENADVKFQKASIGKVSRIDLTEDKVRVTLKILEDYQSRITRDTTVTVKSP
FT                   TFIGDEYVAVIPGNSRAPAMDEGEEIQSIPKKSIEDLLVEFQVEQTAKKLSTAVKNISD
FT                   ITEALRDPEGPLFTVFEELEAILSNLAEATAKTPMAMDHVNTNLVTINKIGNELYFNLT
FT                   DLRNMLADVAASMQRVKTALANVEEASYDIPAITHSTSLGIDEIRGAVESTDRIIQSLK
FT                   ENFLIKGNLPPSPEGENIDAGPRQ"
FT   gene            complement(37152..37847)
FT                   /locus_tag="Dole_0032"
FT   CDS_pept        complement(37152..37847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1540 ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS5"
FT                   /protein_id="ABW65842.1"
FT                   /translation="MAWRPRQKSASMSLIELSNYTVARNELRLKNISLAISPGQCWLVA
FT                   SDLRESAGLLFAALATLVKPETGTFRFKNALLDFSTYRQLLSCKREIGYVSPANVLLSN
FT                   RTILENLLLSDFYDKNTLSVTLDKKTDEMCLLFHIRNRLGQKVTEADRWDLRLAMAVRE
FT                   LAKDPAVLLVEWPEEVVPPDRQWMFVNLLQQALVSGTPLVIFSRDRSFCANFSASGKIV
FT                   IKGERVTVS"
FT   gene            complement(37857..38633)
FT                   /locus_tag="Dole_0033"
FT   CDS_pept        complement(37857..38633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0033"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bba:Bd1768 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65843"
FT                   /db_xref="GOA:A8ZRS6"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS6"
FT                   /protein_id="ABW65843.1"
FT                   /translation="MNSPTGYIGRKTLAYVDHLQNMAAFAIDLCAVLLASPLKGRAVVR
FT                   WGVVEQIYFTAVQALFLIIPLSLLTGSMMLIQFAKFSGQVDLGKLMIILVIREIGPVVT
FT                   AMLVVLRSATAVTIEIGYMNVFNEIDSLEMTGIDPLRLLAIPRFVGITSAIVCLFIVFD
FT                   LVAILGGYGVVRLTTSIPVGNFLSDIGSAITGADIIVGLVKALCFGVVISVVTLYHGFE
FT                   AQKRITVIPKITSTAAIECFFYCIVTNIFISGLFYF"
FT   gene            38838..41114
FT                   /locus_tag="Dole_0034"
FT   CDS_pept        38838..41114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0034"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: sat:SYN_01481 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65844"
FT                   /db_xref="GOA:A8ZRS7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS7"
FT                   /protein_id="ABW65844.1"
FT                   /translation="MDLLKKSGRAIKTVFSRKPLLLSFCIVVAGALVFMSGISFLDIIE
FT                   LKTIDMRFKLRGDIPPGDRVVLAAIDEKSLKQEGRWVWPRTKIAALVDKLSEKGARVIA
FT                   FDVGFFEPESSEVIQTIGRIQAASKDNALRNKRFDDYLATLKNRSDNDRILVEAIQRSR
FT                   ATVVLGFFFQMNPEDALHITEAEIETHTRQIAGGRYTIERFSSDRAREAWLYRVAAPQS
FT                   NIQAISEATSYAGYFNKLADPDGVVRRMTMVMQFNNTLYAPLSLKAAGAYLDAPLSITV
FT                   EEDYGVASLMLGDLSIPVDERGDLLINYRGPEKTFPHISVTDILNDTVDESLIRDKIVL
FT                   VGATAIGIHDECVTPVAKVFPGPEVHLNVIDAILSEDFLFHPAWAALFDLLVIIGGGML
FT                   LAYVLLKTSALPGGLAMAAMFGGYLWLCQFFFTHMGWILNMVYPLCVFLAIYLFVTSYK
FT                   YLSEEGQKKFIREAFSKYLAPEVVNQLISSPQKLVLGGERREITAFFSDVQGFTSISEK
FT                   LAPEELVELLNDFLTEVTDIILHHKGAVDKFEGDAVIAFFGAPNELPNHPEAACLACID
FT                   IQKRMVELRAKWREQGKPELKVRIGLYSGPAVVGNMGSRNRMDYTMMGDTVNTAARLEG
FT                   VNKIYGTYTMVGQPTYEAAADALFARELDAVTVVGKKTPVAIYEVLGRRGEVDETGVKT
FT                   TEVYAKGLAAYRQRQWDQAVAWFKEALAVTPDDGPSLTMIRRCEAYAENPPPDDWNGAF
FT                   SMMTK"
FT   gene            41182..42708
FT                   /locus_tag="Dole_0035"
FT   CDS_pept        41182..42708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0035"
FT                   /product="SpoIID/LytB domain"
FT                   /note="TIGRFAM: SpoIID/LytB domain; PFAM: Tetratricopeptide
FT                   TPR_2 repeat protein; Stage II sporulation D domain
FT                   protein; KEGG: dde:Dde_1785 sporulation protein and related
FT                   proteins-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65845"
FT                   /db_xref="GOA:A8ZRS8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS8"
FT                   /protein_id="ABW65845.1"
FT                   /translation="MWPVLLHAANGGLPAESDFLFAQAETQVAAGRYLEAIGLYQTVAD
FT                   TTPDAGEKARALLLVGYAHAQYLDQHDKALLYFDYILTNWPGSAAAEEALYRKGMVLYE
FT                   TERYAKAYQAFTAYQERYPHTGRRYTAGVWAESAANLAATQALRMNRESLAAVRKDTTV
FT                   RVLVAESADTVHLASGTRLTLTDTASGKTSMLRSQATTIGAKQGRLTINGKSTATTRCR
FT                   ITSPQPIAVNGTRYRGAVVVSADGGTVSAINHVDIEPYLYGVVPREMPASWPEQALMAQ
FT                   AVASRTYALYVKQKSADRSFDVRATTASQVYGGYDAEMPAANRAVDATQGQVLTYNGNL
FT                   IVAYFHANSGGYTECPENVWGAALPYLADRPDRYSREVPGSQWEFFLPYDEAQAQLARY
FT                   GVHVGGVRGFVFNGKSRSGRIQDVSVVSDAGVWHMPGNMFRLAIGSTRLKSMCFEAARS
FT                   DQGVLFRGAGYGHGVGMSQWGARTMALEGHDYKTILKHYYRNITIASLDR"
FT   gene            42966..43844
FT                   /locus_tag="Dole_0036"
FT   CDS_pept        42966..43844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0036"
FT                   /product="protein of unknown function DUF400"
FT                   /note="PFAM: protein of unknown function DUF400; KEGG:
FT                   sat:SYN_02890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65846"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS9"
FT                   /protein_id="ABW65846.1"
FT                   /translation="MKKRAYLIGMVAAMFLLAPVWGFCQWGDALVESMPNGSVNWSTGI
FT                   IQAKGIGAPPESFYGKPQARPMAMRAAQLDAYRNLLEITQGVRVNSTTLVKNYVTENDI
FT                   IMTKVDGLVKGAQVTNTEYMSDGTVEVTLQMSLNGDLARVVLPPEVGSQEPMPPAAPEM
FT                   MPPQEAPAPAPETPAPAVYTGLVVDAKGLGAKPAMAPKILDSEGREVYGSAYVSREYAV
FT                   SQGMSGYAKQLESATANQRVTDNPLVVKGVKTEGPGQCDIVISSADAEMLKSAAENLSF
FT                   LEKCRVMIVVD"
FT   gene            43905..45068
FT                   /locus_tag="Dole_0037"
FT   CDS_pept        43905..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0037"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sat:SYN_02887
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65847"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT0"
FT                   /protein_id="ABW65847.1"
FT                   /translation="MRSKTFLYFMALFGLVFLFACGPKAVAPEAQMDTPEHHVTNGNKF
FT                   LKADKLDEAFTAFTRATQLDPKYAPAYVGLGLVHGKQGIFDKAFDAMKQAARFAKTDAQ
FT                   HAETSVGYIRLYTMGGPAVEENWLNKAGNHFERAHKLAPRDPAPYFYMGMAYRNAYRFS
FT                   DAAGMFKAVLDLDKDFVEAADREYAVMQRIERAMPGTSVGKKIALLEAITRADVAALFI
FT                   EELKVDELFEKNTPKTFDTAFKAPGAAFKTGEYVKAPAVTDIDNHVLRQDIEAVVRLQI
FT                   KGLQPGPDHTFEPDKYITRAEFAMMIEDILIKITGDNSLATRFIGTESPFPDLRSDLAF
FT                   FNAAMVCVTRNIMETVDTATGEFRPQGMVSGADALLSIRQMKVQLNK"
FT   gene            45095..45967
FT                   /locus_tag="Dole_0038"
FT   CDS_pept        45095..45967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0038"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: sat:SYN_03044 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65848"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT1"
FT                   /protein_id="ABW65848.1"
FT                   /translation="MKRMKILYGMVLAAFVAGLLVLPVQAGPVGVGISDGPAVISVLDG
FT                   SAALVDGQQKTLRSLSQGEALNQGDRIRVGDQSRIELRLPDGSFVRFDSNSVFELKAMA
FT                   VDSRDNRRDINVNVVFGKIWASVSKWVSGSSRFDVSMKTTTAGVRGTAYRVNVNSDDSA
FT                   VVKVYDGTVEVKGATGEEASAPQAAGAPAALSAPRPVAGPTPVAGPHPVSMEQWVYTLK
FT                   AMQQIVIRPDGTATPPFRFSYEADRNDWVEWNRQRDTAVGMPVPEPPAADAAPVEYTPS
FT                   PAVPESNQP"
FT   gene            46138..46875
FT                   /locus_tag="Dole_0039"
FT   CDS_pept        46138..46875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0039"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mmp:MMP0426
FT                   nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65849"
FT                   /db_xref="GOA:A8ZRT2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT2"
FT                   /protein_id="ABW65849.1"
FT                   /translation="MSEKKTPDRPDLSRWTPVEEVIFKRRSIRAFKKEPLPDFMIRRIL
FT                   EAGRFAPSAGNAQPWKFIVVKNADILAAMEKDAVRITKLLMWFLDYNRTPLRHLLLKPW
FT                   VKLIIRANHNELHPVPMGLMRSIANGECPVFHHAPTLILLLEDRRGVSCPPTDIGICGQ
FT                   NMVLAAHSMGAGTCWIGLIKLLMYLPKWKKFFGVTYPYRLNDCIAVGWPKVQADGHVPR
FT                   EKQVVRWFVDGMNMPPRIEEQGE"
FT   gene            46877..49003
FT                   /locus_tag="Dole_0040"
FT   CDS_pept        46877..49003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0040"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   btk:BT9727_2709 probable crotonobetaine/carnitine-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65850"
FT                   /db_xref="GOA:A8ZRT3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT3"
FT                   /protein_id="ABW65850.1"
FT                   /translation="MTTQPGVKPWTKIPDYFDAAEMTTGILAFNEETCRRCGICSFICP
FT                   ARSIKSDRGPMKWKEGMPWLATVAPDVTNCIACGCCLAACPEGAITIERWFNPGYFYQR
FT                   LSQTSDLVYPKCYLSTDPAPADTWPAPDPDMLSPRYGSREKWGMRANRLRMTGNVILGG
FT                   SRFFLNEALRGRLFSTVNGFLSKTPSDISWTDLLEENARRVPDKPFLVYQNESYTYRQV
FT                   DEQANRMARFLLALGGGQGSGVGILMRNSPRFLDIFFGAQKIGMYVVPINPELKGDGLA
FT                   YIINHSDIDLLVADAELADAVRSVADRFEQRKKIIVNDIEAEARGMAVPETMDRLSRAY
FT                   ADFSPQHPGTGYRPEDICMIMYTSGTTGPPKGVVYRYNKTSVRLMCLAAHLMLRPSDTY
FT                   YTPYALCHGNALLATTTMTMGVRATMALARKFSASRFWEDVRRHRATVFNTIGSIIPIL
FT                   MKQPEKPDDADNHVRFVTSSGCPPEMWGPFEKRFGVKLYEAYGAIDGGGKGIFNFGTAP
FT                   AGSLGRIPRVVNYRLVDDRGRDVPVGVPGELLFEAKKTSGRVEYYKNPAASRKKSGDGW
FT                   LHTGDLVKQDINGFLYFVGRNTESMRKGGENVSAYEVEQVIMDHPAVEEAAVYAVPSDL
FT                   AEDDILAAVRLVATKTLTPEDLIAFLSDRLARFAVPRYIRFMDEFPKTSSHRIIKGVLE
FT                   KEGITDDTFDAQQA"
FT   gene            49047..50552
FT                   /locus_tag="Dole_0041"
FT   CDS_pept        49047..50552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0041"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   tvo:TVN1120 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65851"
FT                   /db_xref="GOA:A8ZRT4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT4"
FT                   /protein_id="ABW65851.1"
FT                   /translation="MISRGEKVFRLGQRPAFDDMLIGLSAAPKIPAGLVRETREVVALA
FT                   RKFNDEVVRPYTAELDLKMHADPNFIPYEFVSKANEWGFYTMWIPRIFGGRGYNMPSMS
FT                   VFVEEIGSACLAMANLIGVHYLGVATLCAAWNAAMINRLCRDVAAGEKNGVPCLISLAI
FT                   TEPGAGTDVEEVDLVDRANLSCLARRVEGGYMVNGTKIFISNGHISTWHMLITYTDLEK
FT                   PSENTVMLAVKTGDKGFSFGRMEHKLGQKGCPASELVFKDCFIPDDRVCFGWDLAGPRP
FT                   RRDRRAATMQVIDFVVSATRAGVGAFATGGARGAFETALAFAAETEVNGSLLINHEWAQ
FT                   CMLAEMYKNVVVSRLTYVEANHANGRYGFYRLMQQKIMFYYLKYVPAFIVEKIISPLLE
FT                   TPGATWLLRKVMADGQTDEELERCSGMASLSKFAASDAGIRNCHLALEMMGQAGLRHDR
FT                   RAEKILRDAKLLQIYEGTNQLNRLNLFKNLIGRDYPQATVFDE"
FT   gene            complement(50587..51408)
FT                   /locus_tag="Dole_0042"
FT   CDS_pept        complement(50587..51408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0042"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: sat:SYN_00420 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65852"
FT                   /db_xref="GOA:A8ZRT5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT5"
FT                   /protein_id="ABW65852.1"
FT                   /translation="MQAHSDRMRRQGKTIAFVPTMGFLHEGHLSLLETGKAHGDHLVLS
FT                   IFVNPTQFAAGEDFASYPKSFEKDAQAAENQGVDVLFAPEATGLYEPGYETYVSLESLP
FT                   NHLCGIFRPAHFRGVATVVAKLFNIVKPHVAIFGEKDFQQLAVIRRMARDMNFDIKIMG
FT                   APIVREPDGLAMSSRNTYLKPEQRPAALSLYKSLVLARQMVAAGETGAAAIIEAARNLI
FT                   AGFSDTAIDYVAICDPDTLDDMDSLDRPALMALAVRVGTCRLIDNMMLVRP"
FT   gene            51701..54091
FT                   /locus_tag="Dole_0043"
FT   CDS_pept        51701..54091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0043"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: LVIVD repeat protein; KEGG: mma:MM_0391
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65853"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT6"
FT                   /protein_id="ABW65853.1"
FT                   /translation="MKQRLSRWMITIFCCLWATGVHALVGDIQLLNRWPMAGPNSIAIA
FT                   DIDGTDYVFVGDGEVVSVYDTTPALLSRFDVALSGAADLDKPGEVAGTEGIYGIFYAEN
FT                   HLYVACGNEGLQIFDVTDPLNVGTPTGVYIPRETLGRAKVSDVTVLDGYAYLTYFLLTS
FT                   EGYDSGIQVIDVTNPANPVLKGESELPDTFADLKRAQGLHVTDIDGTLYAFVADLYNGL
FT                   AIFDVNVPADPHAEASCYFTYAYDVTVAEIPADSGNYYAYVADDFAGLRIISFDPDEFT
FT                   NEVDILYGAEGNVIPTCQYAGGSSKALSVTVDPANELVFVGDQYYGLLAIDVSDVAKIN
FT                   TLPGDVDLTGYVTNYATDMTSAYSVCAETGGPTVVYVADAIKGFQRASLVDPMDETTWE
FT                   ITGVENTNTPADADALFIDENTNYIYVVDDDATNAGHDEGLRIFYAIVSEEYLTFLLKG
FT                   KLPTDGEAKDVYVHDGYVYVADGSKGLKIIDPGLPEDGDDADEDGDNQFVAQPELTGSC
FT                   VVAGGTGDAMDVVVSGTFAYVAAGAGGLSIINVVNKTAPQEKGVLGGAHISDARAVWVK
FT                   DVDGNGTDDYAYVADGGNGLKIVDISDKTNPALVKTVALEGTAQSVFELRGRAYVAGGD
FT                   AGFHVVFVSDLENARLVSGYNAAPFEDVKDVFAAISNESPAVDLLWVATGKTGMGFFTY
FT                   PPDVPPQLVVHFDTFGDAKAVSVFGDFAFLADGAGGLLATTVSTASGGATDEGWDWLAG
FT                   IVPVDIHSTTYGGSSGCAVDTVRPAATGLWQSLKKLFHKGSAF"
FT   gene            54260..54673
FT                   /locus_tag="Dole_0044"
FT   CDS_pept        54260..54673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0044"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: aeh:Mlg_2746 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65854"
FT                   /db_xref="GOA:A8ZRT7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT7"
FT                   /protein_id="ABW65854.1"
FT                   /translation="MAGVNKAIIVGRLGRDPELRYTQDGRAVASFSVATSEEWKDKDSG
FT                   DKKERTEWHRVVAFGRLGEICGEYLAKGRLVYVDGRLQTRSWEKDGVTRYTTEIVAANM
FT                   QILEPKGSGGSGGGGSMGEPVADDAGIPDDIPF"
FT   gene            complement(54839..55024)
FT                   /locus_tag="Dole_0045"
FT   CDS_pept        complement(54839..55024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0045"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: sat:SYN_00926 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65855"
FT                   /db_xref="GOA:A8ZRT8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT8"
FT                   /protein_id="ABW65855.1"
FT                   /translation="MFGIGMPELIIILVIVLIIFGAGKLPDIGAGIGKSIKNFKKATAE
FT                   VEENDSDKEKIEDKKS"
FT   gene            55182..56252
FT                   /locus_tag="Dole_0046"
FT   CDS_pept        55182..56252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65856"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT9"
FT                   /protein_id="ABW65856.1"
FT                   /translation="MKASFYPDRRAALIGSLPMTDHAAATQLVFEHAPDIPLWVQLPAY
FT                   PAEGMLAQFLPGFPGVSEQNGKLFINTQDPAFHDDVLGFYEAYLAAEQDPSVLDGSVFA
FT                   LDTTVAAGFFEFLNQAGPVADRLFAVKGQITGPFTFATGVTDDQGRALFYDDQLRDVAV
FT                   KLIAAKARWQARRLAALGRPVIIFFDEPALTAFGSSAYISISRADVTACFEEVFAAVHA
FT                   EGALAGVHVCANAEWDLILDSSADIVSFDSYSFFDKFVLYADHIRRFIDREGLLAWGIV
FT                   PTGDKEAIGKETVASLVALWHEQVARVEKLGIDRTTIERLSLITPSCGTGSLDMDSALR
FT                   VLELNAGVSKALRAGQ"
FT   gene            56392..57237
FT                   /locus_tag="Dole_0047"
FT   CDS_pept        56392..57237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0047"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: sat:SYN_02572 MoxR-like ATPase with AAA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65857"
FT                   /db_xref="GOA:A8ZRU0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU0"
FT                   /protein_id="ABW65857.1"
FT                   /translation="MSETGQFTGASRYVLDSELAQIVNVSMALEMPLLLKGEPGTGKTM
FT                   LAYAIAESLGMPLIVLNVKSSMKLVEALYQYDTLTRLNDARFGDSNRNVSDIEDYIKMG
FT                   KIGQAFTADTRTVLLIDEIDKADTDFQDDMLDVLDQMTFDIVEIDKTIRAKTRPVIIIT
FT                   SNAKKDLSDPFLGRCNFHHIAFPDPKMMRKILQVHFSDIDDLLLDNTVDVFYRLRQLES
FT                   IEKKPATRELINWIRALRADRDFNPKKLAKGEIPFLGVLFKKSRDYEQAFSAVERRRLL
FT                   "
FT   gene            57271..58482
FT                   /locus_tag="Dole_0048"
FT   CDS_pept        57271..58482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0048"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_02573 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65858"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU1"
FT                   /protein_id="ABW65858.1"
FT                   /translation="MFIDFFYKLKDIGVPVTPTAFLTLHRALALNLVNSVDDFYTTSRT
FT                   ILVKSERYFDLFDQLFAHYFQGADMPDPDDWEIDEIMRAMLDEWLKDPKELADMLGITP
FT                   EALAQMTPDQVVEYFKERLKDQTERHDGGNRWIGTRGTSPVGHSGTHPGGMRVGGVSRN
FT                   KSAVKVAMERRYKDYSRSGPLTQAQVGEALKRLRNMVPSGPKDQVNIDKSIYHTVKNGG
FT                   EIEIIFDRSLKDRLKVILAIDNGGWSMDPYVEVVQTLFDYAKAQFKEVKTFFFHNTVYD
FT                   ALWKDPTRYKEPQWVSELARRDPDTRVILVGDASMAPYELMAADGAIYLDRRGAYGLKK
FT                   ARRSSIDNLRFIADTFSHAIWLNPVPERMWDYTQTISMIRQVFPMFELSLDGLEQAVTH
FT                   LMAQ"
FT   gene            58501..59181
FT                   /locus_tag="Dole_0049"
FT   CDS_pept        58501..59181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0049"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pfl:PFL_3324 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65859"
FT                   /db_xref="GOA:A8ZRU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU2"
FT                   /protein_id="ABW65859.1"
FT                   /translation="MDKVLIVDDSQQLLDLLRRIQNKYKDEFEMILVNSGTKAMAVLKE
FT                   MPIDLVVTDLVMPQVDGLTLLTHINDRYPDVLCIAMTGYATENVVRMLPDNLLQLLKKP
FT                   FDIQNLITVIRKGLKTEPAAGTMRGIAVASFLQLLELDQKSCALEVALASGQQGTFFFK
FT                   EGVLYDATFGSLTGKEAAIAMISSGEKPQFTLKPATKPHIPRRITCRLMELLLQAAQKK
FT                   DQAG"
FT   gene            59332..59658
FT                   /locus_tag="Dole_0050"
FT   CDS_pept        59332..59658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0050"
FT                   /product="Addiction module killer protein HI1419"
FT                   /note="TIGRFAM: Addiction module killer protein HI1419;
FT                   PFAM: protein of unknown function DUF891; KEGG: dps:DP2055
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65860"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU3"
FT                   /protein_id="ABW65860.1"
FT                   /translation="MYPTRYTRCVKYKLRSTTQYDKWFSSLKESTVKIRVLARLARVEN
FT                   GNFGDFKQISPGLFELRFFFGAGLRIYYTIQESRVVFLLAGGNKSSQEKDIEKVTALLK
FT                   ELED"
FT   gene            59661..59939
FT                   /locus_tag="Dole_0051"
FT   CDS_pept        59661..59939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0051"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Addiction module antidote protein HI1420;
FT                   KEGG: mmw:Mmwyl1_1983 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65861"
FT                   /db_xref="GOA:A8ZRU4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU4"
FT                   /protein_id="ABW65861.1"
FT                   /translation="MKLKTKSFDIAEHLNTPEEIRGFLQEVAATGDESDFIHALNTAAR
FT                   AIGMTEVAKKAGVTRASLYKSLAEDGNPKFITISKVTKALGCKIAVV"
FT   gene            60037..60615
FT                   /locus_tag="Dole_0052"
FT   CDS_pept        60037..60615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65862"
FT                   /db_xref="GOA:A8ZRU5"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU5"
FT                   /protein_id="ABW65862.1"
FT                   /translation="MKKNLPIMLSLVVLAAATLWFVVQANYEFLLYAVTLLVLIGIVFW
FT                   LNRRFGLPAIAKWGFFFWMVLHMAGGGVYLHGTRLYDVVLVPLVGSPYDILKYDQFVHF
FT                   FCYLVMTLLVFPVFKSIVAPGASRMVFAVLLVLAASSIGAVNEIIEFAAVVLFQADGVG
FT                   GYHNTCIDLVANLLGAMVSTVYLAAVRAF"
FT   gene            60688..60942
FT                   /locus_tag="Dole_0053"
FT   CDS_pept        60688..60942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65863"
FT                   /db_xref="GOA:A8ZRU6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU6"
FT                   /protein_id="ABW65863.1"
FT                   /translation="MKNRRAKRLIRAAGFLCSFSSLVLPAFFLLRFSAAFSFRLFLHHL
FT                   ILPFYCLLLLVQRHNTQVCRRTETGARGVKPLAHKSIFA"
FT   gene            complement(60975..62369)
FT                   /locus_tag="Dole_0054"
FT   CDS_pept        complement(60975..62369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0054"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   sfu:Sfum_2643 DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65864"
FT                   /db_xref="GOA:A8ZRU7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU7"
FT                   /protein_id="ABW65864.1"
FT                   /translation="MQTDPNTQTKKRASRRRRSRADKPETPDTPTPAVKDAEPWESSQF
FT                   DVPPDKNRTRFHDMDLPDALMHAIYDLGFTYCTPIQAEILPSTLAGRDAFGRAQTGTGK
FT                   TAAFLISILTHMHNNPITAARKPGTPRALVLAPTRELVIQIGEEAQQLARHLPVNIVSV
FT                   FGGMDFKQQQDRLTREPVDIIVATPGRLLDFSRRRAVMLKQVEILVIDEADRMLDMGFI
FT                   PDVRKIIYATPQKGNRQTLLFSATLTEAITRLASAWTRDPVQVAIEPEHVAVDSVDQVV
FT                   YIVTSDRKLALLYNIIVQQNLSRVLVFCNRKDAVSRLADRLTRYGIKCEILTGDVPQQK
FT                   RSRRLEDFKSGKIRVLVATDVMARGIHVEDMDHVVNFDLPHDPEDYVHRIGRTGRAGAV
FT                   GTSISFADERDSFYIPDIEDFMERPLPCIEPDSTWLELPPPAAPKKERPRKTTPRTGRV
FT                   KSTPGK"
FT   gene            62536..63330
FT                   /locus_tag="Dole_0055"
FT   CDS_pept        62536..63330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0055"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980; KEGG:
FT                   dps:DP1877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65865"
FT                   /db_xref="GOA:A8ZRU8"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU8"
FT                   /protein_id="ABW65865.1"
FT                   /translation="MFHWFSTRRRKKLTAVAFPRAWEAIVQRNVAHFCMLTPDEQARLR
FT                   SLIQVFVAEKQWEGAGGLVLTDEIRISISAQACLLLLGLPHNYYRNVATIIVYPSTVVA
FT                   PPRRPGFFEVPMAPVEPGQAILGQAFHQGPVIIIWDAALQGGRQPELGYNVVYHEFAHK
FT                   LDMLDGAADGTPPLADRAEYRDWVETCSAEYLRLRRDAAQGKPSFLNAYGATNEAEFFA
FT                   VATEQFFDRPREMAAQAPDLYRVLKAYYRQDPVSRLGKNTCT"
FT   gene            63436..63921
FT                   /locus_tag="Dole_0056"
FT   CDS_pept        63436..63921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU9"
FT                   /protein_id="ABW65866.1"
FT                   /translation="MARKVTISVPEDLYEKMSKWRDSFNFSNVFQKAISTLIQKKEDFQ
FT                   SRIQQELDQSAVIERLRQEKSQSENNYYDVGRKDGLKWAKNAHYDDLQYALRWVPDEKP
FT                   TQDRVLGDYFAGVIAGDDIMDYAVGSDPVCVNEFVKTYIDGWKEGISDFWHEIRDKL"
FT   gene            complement(64046..65218)
FT                   /locus_tag="Dole_0057"
FT   CDS_pept        complement(64046..65218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0057"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pth:PTH_0660 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65867"
FT                   /db_xref="GOA:A8ZRV0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRV0"
FT                   /protein_id="ABW65867.1"
FT                   /translation="MNDFSAWAEIDLDAVAHNVAALKALTRPACRLMAAVKADGYGHGM
FT                   CEVASVALESGASALGVSRIDEALDLRNHGITAPILVLGHTPAHRCREMVDQNLIQTVC
FT                   ALAEAQALSRAATAIGATVSVHLKVDTGMGRLGINTVVPGRTAPQEAAVKEALAVLDLP
FT                   GLAAEGVFTHFACADSADKTHANAQFKRFSTLIQELEAAGRPVAVRHAANSAALIDMPE
FT                   THLDMVRAGIAIYGLYPSAEVDRQKVALKPAMAFKTRVAQVKKVPAGFTVSYGATYTTP
FT                   KPTVLAVVSVGYADGLNRLLSSRGFMLVRGCRVPLVGRICMDLTMLDVGGVPDVAVGDE
FT                   VVIFGSQNGAFIGADEIADALNTISYEVVTSITGRVPRVYCNGSSSAVRR"
FT   gene            complement(65215..65940)
FT                   /locus_tag="Dole_0058"
FT   CDS_pept        complement(65215..65940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0058"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: rrs:RoseRS_4592 pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65868"
FT                   /db_xref="GOA:A8ZRV1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV1"
FT                   /protein_id="ABW65868.1"
FT                   /translation="MTTIPTRGQIRLQKFLSGAGVCSRRRAEVYIAEGRVAVNGQVVTE
FT                   LGTKVDPESDDVMFDGHRVTLAESHVYIALNKPPGYVTSCLQKQETTVMELVAVDQRVF
FT                   PVGRLDKPSCGLLLMTSDGGLHQRLSHPSFDHEKEYDVACDRPVSDADLDAMRRGMVIT
FT                   GRKTRPAKVKRLSDRRFLIILQEGRNRQIRRMAEMLGNRVVLLRRIRIAHIHLGDLAEG
FT                   RWRYLTEEEKKALLHQEET"
FT   gene            complement(65937..67118)
FT                   /locus_tag="Dole_0059"
FT   CDS_pept        complement(65937..67118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0059"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: gsu:GSU2049 amino-acid N-acetyltransferase /
FT                   glutamate N-acetyltransferase; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: arginine
FT                   biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65869"
FT                   /db_xref="GOA:A8ZRV2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV2"
FT                   /protein_id="ABW65869.1"
FT                   /translation="MECPGFQWAGVCAGIKNLKKKDLGLLVSDTPAAVAAVFTANRVKA
FT                   APVLLDMERVASGRCRAIVANSGNANCCTGDAGMAAALAMTKAVAEALGIDEALVLVAS
FT                   TGVIGAPMPTETITGAVPGLVKALRPDGLPDFSESILTTDRFAKSALRNVRLENGTTVT
FT                   VCATAKGAGMIRPDMATMLCFVCTDLQADTDALSGMLSVAVDRSFNRITVDGDTSTNDT
FT                   VFLMAGGASGAGLQTDADRQGFQQALDDVLTELARMMVTDGEGATKLVEVRVKGAKSDA
FT                   DARRVADTVANSSLVKTAFFGQDANWGRIMAAAGRAGVDLSPDAVDIFFDDVQMVKNGM
FT                   GCGPEAERKASGVLKQPTICLGIDLNTGGTGAATVLTCDLSIEYVKINADYRT"
FT   gene            complement(67250..67978)
FT                   /locus_tag="Dole_0060"
FT   CDS_pept        complement(67250..67978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0060"
FT                   /product="Vitamin B12 dependent methionine synthase
FT                   activation region"
FT                   /note="PFAM: Vitamin B12 dependent methionine synthase
FT                   activation region; KEGG: bth:BT_0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65870"
FT                   /db_xref="GOA:A8ZRV3"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV3"
FT                   /protein_id="ABW65870.1"
FT                   /translation="MTLFDDATFDAGFCFTGFDPEALGLDLCAENCLELVARRIGYGPD
FT                   TLPVGEKAGRIKTVIAQGIEAVALAGQGKPVTIDRWSGKEVVAGPVCVQSPRWSHVVRQ
FT                   AQEPQALYGFILTLGRDFDRVKEKAALFDAYVLDALGSEMVEQAADRVEQRIRAWCATR
FT                   NRVCSRRFSPGYCDWPLAQGQQALGDFLAPAAIGVKVLASGAMVPSKSITGAVIMARSL
FT                   PLSCPCPVCNQANCAYRRVA"
FT   gene            complement(67985..68638)
FT                   /locus_tag="Dole_0061"
FT   CDS_pept        complement(67985..68638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0061"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   rsh:Rsph17029_0797 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65871"
FT                   /db_xref="GOA:A8ZRV4"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV4"
FT                   /protein_id="ABW65871.1"
FT                   /translation="MNDSATLDLVETSVCASDTDALLSLLPALQEQNTADTLLDALNRG
FT                   IEQARRNFKQGSFALPDFLLAIDAYRTGTAFLKDRFPEAGDRKAPKIVIGVVEGDVHDM
FT                   GKNIVAAVLEACGFHVTDLGKNVPNETFLEAIEAERPDIVALSSMMSTTLENMNRLIEQ
FT                   VKRAYPDTLILVGGAPFDPELARHMGADGYAENVITIPDETRRVLTTGSAKQLT"
FT   gene            complement(68641..69801)
FT                   /locus_tag="Dole_0062"
FT   CDS_pept        complement(68641..69801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0062"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mac:MA0859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65872"
FT                   /db_xref="GOA:A8ZRV5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV5"
FT                   /protein_id="ABW65872.1"
FT                   /translation="MSLMQVGYYLKKRQIPPLALIPDPILDTLAGVSSFRGRFQTLTGI
FT                   ERALTAFRHKEPDHVPVSPILCAGARQISGITFPDYALDGEKAAKVFMDGYNFVGGDAV
FT                   VLLLDLSVEAADFGQAIIYPLNSTPMPDYKNPVITHHDQYRALKSIRFSEAKRMQEFVK
FT                   LCRIVVEEVGLRAIVSGFVFGPLGILAMMRGAENLFKECRLYPKEVMAACDTITEVLVE
FT                   FVLAQCEAGVPAIAIDTLFASRSGLPKDLWEEIEGPFAGEISRAIKSTGRIVAIHNCGD
FT                   APYFDAQIRSMDPALINFSELPDDCASRREMKEKYGDRITLMGHVPTPLLVHGSPQEVI
FT                   DECRRHIDDLAPGGGYILSPGCEYPPNISLVNAFALIHAAKTHGRK"
FT   gene            69963..71192
FT                   /locus_tag="Dole_0063"
FT   CDS_pept        69963..71192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0063"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein domain I
FT                   and II; MoeA domain protein domain IV; KEGG: sat:SYN_02148
FT                   molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65873"
FT                   /db_xref="GOA:A8ZRV6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV6"
FT                   /protein_id="ABW65873.1"
FT                   /translation="MKKEIGFDEAQELTFSSIVARKTETLGLDRLTDRVLAEDVVSSVD
FT                   SPSVNASLKDGYAVRSGDLQKAGPESPVFLEMAGSISAGAATRLKVAAGRAIRITTGAP
FT                   IPQGADAVLAEEFTRLAENRLACYNTAGPGRNILQKGTDIQKGQAVAKKFDRATPPLVG
FT                   LLATAGLDRATVFKSPVVCVMATGDEVVAPGKPLPEGKLYASNITEICAWLTQHRIDSR
FT                   VCFARDTEEAVVSTIREQIDHVDLFISSGGIWGSEKDLMLKVLESLDWKGIYHRVRMGP
FT                   GKAIAFGFLEDKPFFCLPGGPPSNEMAFLQIALPGVLKMRGHQRPRFPVVSARLAETVR
FT                   GVGHWTQFVHAEVRKEEKALVVVPLQQRSRLQSMAGKNALIRIPEGTEVLDAGTLIEVQ
FT                   LLDTRVLREE"
FT   gene            72123..72590
FT                   /locus_tag="Dole_0064"
FT   CDS_pept        72123..72590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65874"
FT                   /db_xref="GOA:A8ZRV7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV7"
FT                   /protein_id="ABW65874.1"
FT                   /translation="MNDLVNSKAGKTAVAGMTGLVLLAAGCVYTPVKTNDISVNDFSCC
FT                   NAGAKVYTNGLDATVIDEDGGLDIEKGQTWREISPSEMPTYVPGQSIAKQLTSIDPKTG
FT                   ATRLEATILQNENSLELYFEKTGKKYTVENPLSVEKDGGGSGSGGGSGGDC"
FT   gene            complement(72623..73765)
FT                   /locus_tag="Dole_0065"
FT   CDS_pept        complement(72623..73765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65875"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV8"
FT                   /protein_id="ABW65875.1"
FT                   /translation="MTEDVPCQDYCYTDVAAPPFCKDDDLGKVFRNICGEDGDGDDCLE
FT                   FKSGVEDYVPCDSGELCVDGEGVCSPCKKVQCADLEYKGEVCVVSRYSDKCIGFDYARE
FT                   GGDACGRFSDDYSFQCFNYKDLQWSGCSESPVCPTITIPGAGLSGIGAGSVPIDLEVPL
FT                   HKIPDSEVPCICDDTAPVVEDEDEVCVDTTWTPARSTVCSGESFTQTSNCGNTRTKTGT
FT                   KTCVPTCTVSSWTPATSTVCSGVSFTQTSNCDTTRTRVGTKNCTAKLSLDFSNVQYKWI
FT                   SPYHYYYHTRTFKETGGVGVTLTSAQLCDKAGCDPKEIVNYRIEKNNNLIHLNKRFWTP
FT                   YNTESFTLKYWGADDNGNAIYVEQYMCVRGTSSYPNVLVC"
FT   gene            complement(73762..74082)
FT                   /locus_tag="Dole_0066"
FT   CDS_pept        complement(73762..74082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65876"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV9"
FT                   /protein_id="ABW65876.1"
FT                   /translation="MEQIAENRSLRKDAVEVKFDLRGDPVFAMLDDFVASKVPVNVGYI
FT                   LRVCNISDPEDHCKLPSIVFTAIPEKDVFADSVIISSDLGDGSDEPVFSPKEVKLFFWE
FT                   GM"
FT   gene            complement(75364..75825)
FT                   /locus_tag="Dole_0067"
FT   CDS_pept        complement(75364..75825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0067"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mgm:Mmc1_1803
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65877"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW0"
FT                   /protein_id="ABW65877.1"
FT                   /translation="METNTIDKSFVIGIMNRLEFFKNFTAEEKESLVHFYQHIVAFQPG
FT                   EIIIRDGDRDDTSFFILLSGEAVVTKGKQCRPIARLAPGDFFGEISFLTKTPRTATISA
FT                   EMELIVIKVDEIMIRELGPPVREKIKDNIIAKLVERLRRMNEMVEQLSI"
FT   gene            complement(75864..77306)
FT                   /locus_tag="Dole_0068"
FT   CDS_pept        complement(75864..77306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0068"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65878"
FT                   /db_xref="GOA:A8ZRW1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW1"
FT                   /protein_id="ABW65878.1"
FT                   /translation="MEKNSWLEKTDPLLDAVCRTIGCHAMIAPGEAVLVGVSGGPDSVA
FT                   LLHALVRLQPELAVARVSVAHVHHGLRGAEADADQAFVAALAERLGLPFYTEKIDVAAA
FT                   ARNTGASVEDAARTARYRFFSDTAAAHGYHKIATAHHAGDNAEWVLMNLVRGAGPEGLS
FT                   GIPPVRENIIRPLIHVSREDILAFLTHGGMDYVEDSTNADLTFTRNRVRHHLLPLIEEH
FT                   YNPGIAACLNRVAEIFREESLWIRDMVSGLFEQAVLLCEPGRVVLKAGFVQALPLAARR
FT                   RLVRRVLEIVKGDLRRITFDHAEAVCRGVDRTFGLDLPDAVHVSGNEQELVFSDTAVCP
FT                   ATATPQVKPFSYTLFDTGLGNGSVTITETGITLGFALAPCAAPANLQHNDRRTALLDAE
FT                   KLTCPLTIRNVRPGDRFVPLGMTGSQKVSDFFINTRVAPIDRAACPVVESGGAIVWVAG
FT                   HRMAEHVKLTPASRQVLKAKIL"
FT   gene            77393..77515
FT                   /gene="ffs"
FT                   /locus_tag="Dole_R0001"
FT   misc_RNA        77393..77515
FT                   /gene="ffs"
FT                   /locus_tag="Dole_R0001"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            77706..78359
FT                   /locus_tag="Dole_0069"
FT   CDS_pept        77706..78359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0069"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: pca:Pcar_0108 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65879"
FT                   /db_xref="GOA:A8ZRW2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW2"
FT                   /protein_id="ABW65879.1"
FT                   /translation="MSKKIRIRDDNTRAQEPEMAEEADLNTEDWPEEASPKAETDTGPD
FT                   QEVQEEDPIEVLDQQLEAALEEKKKVEDKLLRAAAEFDNYKKRLEKQWADFKKYAHEAV
FT                   IRELLSVVDNLERAIVASKDTADQNECLLSGVDMTLTEILKVFEKFGVTRIDALGRSFD
FT                   PNFHEAVARRETDDTDANIVIEEYQKGYMIHDRLLRPAMVVVSAGRKNGNSAGG"
FT   gene            78419..80347
FT                   /locus_tag="Dole_0070"
FT   CDS_pept        78419..80347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0070"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sat:SYN_01983 chaperone protein; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65880"
FT                   /db_xref="GOA:A8ZRW3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRW3"
FT                   /protein_id="ABW65880.1"
FT                   /translation="MAKTIGIDLGTTNSCVAVMEGGEAKVITNPEGGRTTPSIVAINED
FT                   GERLVGQVAKRQAITNPENTVFGVKRLIGRKFDSAEVQHDIKVLPYKIEKAGNGDLRIN
FT                   LRDKQYSPAEISSFILADIKHTAEEYLGEKVTDAVITVPAYFSDSQRQATKDAGKIAGL
FT                   NVLRIINEPTAASLAYGLDKKKDEKIAVFDLGGGTFDISVLEIGDGVFEVKSTNGDTHL
FT                   GGEDFDLRVVDYLASEFKKDQGIDLRQDKMALQRLKEAAEKAKMELSSSPQTDINLPFI
FT                   TADANGPKHLNIKLSRAKLEELVEDLLDKMAKPCETALKDSGFSASQIDEVILVGGMTR
FT                   MPAVQDRVKKIFGKAPNKSVNPDEVVAIGAAIQAGVLQGDVNDVLLLDVTPLSLGIETL
FT                   GGVMTKLIEKNTTIPTKKSQVFSTAADNQPAVSIHVLQGEREMAANNKTLGRFDLADIP
FT                   AAPRGVPQIEVTFDIDANGIVAVSAKDLGTGKEQSIKITASSGLSKEEIDKLVKDAEAH
FT                   AEEDKNKRELVEAQNTADALIYQTEKSIKELGEDKLDNATKAEIQAKIEELKKAKETTD
FT                   TDQIKKLSDELTQASHKLAEAMYQKASQEGQQASGGDAGASADGGTSSAAGGDDDVIDA
FT                   DYEEAGK"
FT   gene            80417..80896
FT                   /locus_tag="Dole_0071"
FT   CDS_pept        80417..80896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0071"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase;
FT                   flavodoxin/nitric oxide synthase; KEGG: sat:SYN_00084
FT                   multimeric flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65881"
FT                   /db_xref="GOA:A8ZRW4"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW4"
FT                   /protein_id="ABW65881.1"
FT                   /translation="MQVLVLYYSKGGNTKALAQAVARGVDSVEGVSSVVRSTEEVTKED
FT                   FIAAGGIIAGSPVYFGGMAAELKQVFDAFVGVRRKMEGKVGAAFTTSGDPTGGKETTML
FT                   SILQCMLIYGMIVVGDPLAATGHYGTACVGAPDASATENGTRLGARVAELVKKIG"
FT   gene            complement(80934..81455)
FT                   /locus_tag="Dole_0072"
FT   CDS_pept        complement(80934..81455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65882"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW5"
FT                   /protein_id="ABW65882.1"
FT                   /translation="MFIMFATAVRADKSGAMDKFLTDKDRAVIAQRVLAGTWYPFETYK
FT                   NCFTAVARVVAKDNPETLREWGRQYGEATMTSIYKIILQKKDARSAMTAYNSVFKSQFD
FT                   FGKTEFKMVSDSEILIGLIGFDQNFTILHHVAQGWMERTIQLVINKPVRSEIAGHNWEG
FT                   TPAVVFRLRW"
FT   gene            complement(81514..82383)
FT                   /locus_tag="Dole_0073"
FT   CDS_pept        complement(81514..82383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0073"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: sfu:Sfum_1702 succinyl-CoA
FT                   synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65883"
FT                   /db_xref="GOA:A8ZRW6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW6"
FT                   /protein_id="ABW65883.1"
FT                   /translation="MAIFVDKETRLVVQGITGKEGGFHTRQCVAYGTKVVAGVTPGKGG
FT                   QDVDGIPVFNTVADAVHQTGANCSMIFVPPAFAADAICEAAYAGVDLIVAITEGIPVLD
FT                   MMRVKHILKGRPIRLIGPNCPGIITPGQAKIGIMPGPIHKPGGPIGVVSRSGTLTYEVV
FT                   HQLTGQGIGQTTCVGIGGDPVNGTDFIDCLKAFQNDPDTRGIVMVGEIGGNAEEKAAEF
FT                   IATEVTKPVVGFVAGLTAPPGRRMGHAGAIISGKSGTAEGKLAALEGAGVHLCRNLGTL
FT                   GELCARVF"
FT   gene            complement(82431..83597)
FT                   /locus_tag="Dole_0074"
FT   CDS_pept        complement(82431..83597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0074"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: sfu:Sfum_1703 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-citrate
FT                   lyase/succinyl-CoA ligase; ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65884"
FT                   /db_xref="GOA:A8ZRW7"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRW7"
FT                   /protein_id="ABW65884.1"
FT                   /translation="MKIHEFQTKELFRTYGIPTPEGRMVNTAEAAGEAAGELGGFPVVV
FT                   KAQIHAGGRGKGGGVKLAKSADEAKSLAGAMLGSRLVTPQTGPEGTLVQKVLVEQGVSI
FT                   AKELYLSVVADRETAGIVIMASEAGGMDIEAVAETTPEKILKVFVNPLAGLSAFHCRQA
FT                   AYGLNLPAEAIKPFTQVVSGLFKLFVDYDASLVEINPLILTTDKAVMALDAKINFDDSA
FT                   LFRHKDILALRDTDEEDPLEVEASRFNLNYINMDGNVGNMVNGAGLAMATMDIIKLAGA
FT                   EPANFLDVGGGANAEMVENGFRIILSDPKVKCILVNIFGGILRCDVLASGIVQAARNTA
FT                   IHVPLVVRMEGTNVDEGKRILAESGLDLHSAASLKDAAARVAQVVAAA"
FT   gene            complement(83597..85642)
FT                   /locus_tag="Dole_0075"
FT   CDS_pept        complement(83597..85642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0075"
FT                   /product="Conserved carboxylase region"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; pyruvate carboxyltransferase; Conserved
FT                   carboxylase region; KEGG: sfu:Sfum_0461 conserved
FT                   carboxylase region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65885"
FT                   /db_xref="GOA:A8ZRW8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW8"
FT                   /protein_id="ABW65885.1"
FT                   /translation="MSDHHSVKMTAMNYDKDRPKAENPLKIMDLSLRDGHQSLFATRGR
FT                   TEDMLPVAGLMDEVGFWAVEVWGGATFDTMHRFLNEDPWERIRTLKRYFKKTPLSMLLR
FT                   GQNLVGYRNYADDVARAFVERAAENGMDVFRTFDALNDFRNFETVVEVIKKCGKHFQGT
FT                   ICYSMTEPRLGGEVYNVEYFVTKAKELESMGADTICIKDMAGLVAPYDIFNVVKALKES
FT                   VKPPIHFHSHFTSGLAPMSHLKAVEAGVDILDTCLSPYAYRTSHPAVEPMVMSLLGTNR
FT                   DTGFDINKLVEITEILEEKVMPKYRQFLNEPTMSVIDINVLLHQTPGGMLSNLFGQLKE
FT                   MDALDRLNEVYKELPRVRKDLGQIPLVTPTSQIVGVQTVNNVLFDKDGERYARITDQVK
FT                   DLCYGLYGKTSVPIDSALQKKALAGYPRGETPFTGRPAEILEPELEESKKEIGDLAVDE
FT                   DDLILYALYPVTGKKFLKWKYGQEEPPASVRAKSLEQAKAELALVAKAKAGKVVEKTDK
FT                   HEIPEKSESFRTFHVFVDSEYFEVGVDESGDSPVISYIQQAAARLGSAPAQPMAAAPAA
FT                   PAAPAAQATAAPAAPAPAPEAKTEISVPAAVAPTEGTPLTAPMPGMIVKYLKKVGDTVA
FT                   EGETVVVLEAMKMENALPAPVAGKIASINFDSGDSVPKDAVLCVVS"
FT   gene            complement(85681..85911)
FT                   /locus_tag="Dole_0076"
FT   CDS_pept        complement(85681..85911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW9"
FT                   /protein_id="ABW65886.1"
FT                   /translation="MKDGNKDKKIKAAISAAVLNYIKSEAEMAAVAGLVAANRGRSALE
FT                   QGPFVSRNTWGTDSRRTQMQLRTLMQLRSIK"
FT   gene            complement(85930..87483)
FT                   /locus_tag="Dole_0077"
FT   CDS_pept        complement(85930..87483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0077"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: sfu:Sfum_1223
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65887"
FT                   /db_xref="GOA:A8ZRX0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX0"
FT                   /protein_id="ABW65887.1"
FT                   /translation="MGNTQDRISELKEKERAVREMGGKEAVAKHKQAGKLTARERIEAL
FT                   FDPGTFRELDMFVTHRCTNFGMEKVAIPSEGVITGHGRVEGRPVFAYSQDFTARAGSLG
FT                   EMHAKKITKVMDMALKAGAPVVGMNDSGGARIQEGIDALSGYGEIFYRNSLCSGVIPQI
FT                   SAIMGPTAGGAVYSPAMTDWVFMVKKTSYMFITGPEVIKAVTGESITFEELGGAMTHNE
FT                   KSGVAHFACENDQDAIDRIRKLLSYIPSNNMEDPPVVATGDDPFREDPALDALMPDDPN
FT                   KPYDMKTVIRSIVDNGEIFEPHEYYAKNILICFARMNNRSLGIIANQPSVQAGCLDSNA
FT                   ADKATRFIRFCDAFNIPLLTIADVPGYLPGKDQEWGGIIRHGAKLLWCYSEATVPKLLL
FT                   ITRKDYGGAYLAMSSRHLGADMVYAWPTAEVAVMGAEGAANIIYRKEIKGADDPAAKRK
FT                   EKIEEYKARFSNPYRAAERGYVDAIIMPRHTRQHLCEALELMCTKRETRPPKKHGNIPV
FT                   "
FT   gene            complement(87606..88601)
FT                   /locus_tag="Dole_0078"
FT   CDS_pept        complement(87606..88601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0078"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; KEGG: rpd:RPD_1922 LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65888"
FT                   /db_xref="GOA:A8ZRX1"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX1"
FT                   /protein_id="ABW65888.1"
FT                   /translation="MSTPQKPEEYIKGVLNRDRRMLAKTITLVESGLAEHRKVAGQVLG
FT                   ELLAHTGRAIRVGITGVPGVGKSVFIETLGTFLTCQGLTVAVLAVDPSSARSGGSVLGD
FT                   KTRMEKLSADPRAFIRPSPSGKTLGGIAARTRESMLVCEAAGFDVVLVETVGVGQSETA
FT                   VAAMVDFFLVLALAGAGDELQGIKKGILELADAVAVTKADGENIKAADQARQQYEVALH
FT                   MLSPSGSAWCPRVFTCSALAGENIDTIWETVLAHRKTLQASGEFEAKRRKQAAQWMWRL
FT                   LEEGIKERVFALPEIADSLSAVVSRVEHGEITAAAGADKLLFYLDKRIKV"
FT   gene            complement(88777..90897)
FT                   /locus_tag="Dole_0079"
FT   CDS_pept        complement(88777..90897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0079"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: pla:Plav_1702 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65889"
FT                   /db_xref="GOA:A8ZRX2"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX2"
FT                   /protein_id="ABW65889.1"
FT                   /translation="MANTEKWKQMAEKEMKGKPVDSLLWKTPEGVTIKPLYTKEDAENL
FT                   SHVDTLPGETPFVRGVKATMYAGRPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAF
FT                   DLATHRGYDSDHPRVAGDVGKAGVAIDSIEDMKILFDGIPLDKMSVSMTMNGAVLPVLA
FT                   AYIVAAEEQGVDQKLLAGTIQNDILKEYLTRNTYIYPPTPSMRIVSDIIQYCSTHMPRY
FT                   NTISISGYHMMEAGADSVLQTAFTLADGLEYIKAALAAGLDIDAFAPRLSFFFGIGMNF
FT                   FMEIAMLRAARLLWSEIVGRFSPKDSRSSMLRTHCQTSGWSLTQQDPYNNIIRTTLECL
FT                   SAVLGGTQSLHTNAFDEAVSLPTELSARVARNTQIIVQEESHVCKVVDPLGGSYYVEAL
FT                   TAAIADEARKIIAEIEEMGGMAKAIETGMPKMRIEEAAARRQARIDQGKETVVGVNKYK
FT                   VADESPLEVREVSEAVREEQEARLKELRASRDNEAVKKALEAVTQCAGSGGNLLEACIP
FT                   AIRARATVGEISDAMEKVFGRFVATTQCISGVYAGEYGDSEVIASLRKRTDQFAEKHGR
FT                   KPRILVVKMGQDGHDRGIKVVATGFADLGFDVDIGPMFQTPEEAAKMAVENDVHVVGVS
FT                   SLAAGHKALVPQLIAALKAEGGDDIHVVAGGIIPPADYDVLRSAGVAAVFGPGTVITDS
FT                   ANQVLKVLEAAG"
FT   gene            complement(90941..91348)
FT                   /locus_tag="Dole_0080"
FT   CDS_pept        complement(90941..91348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0080"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sfu:Sfum_0455
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65890"
FT                   /db_xref="GOA:A8ZRX3"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX3"
FT                   /protein_id="ABW65890.1"
FT                   /translation="MKILKIDHLGIAVNNIEEGKKFWCDMLGLPFEGTETVEAQKVTTA
FT                   FLPVGESEAELLEATGPESPVAKYIEKKGQGVHHIAFRVENIEAALAELKEKGVALIDE
FT                   IPRKGAGGGKIAFIHPKATGGVLVELCERSG"
FT   gene            complement(91385..92572)
FT                   /locus_tag="Dole_0081"
FT   CDS_pept        complement(91385..92572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0081"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dps:DP2938 probable aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65891"
FT                   /db_xref="GOA:A8ZRX4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX4"
FT                   /protein_id="ABW65891.1"
FT                   /translation="MPISKNVKACLSASSWIRKMFEEGARLRAAHGASNVFDFSLGNPN
FT                   VPPPERFKKVLADVSAGPDTGHGYMPNAGYPETRQAVADQVSMEQQAEVSADGVLMTCG
FT                   AAGGLNVILKAILDPGDIVVGLAPFFVEYRFYTENHGGCFKTVQTGAEFDIDLAALEQA
FT                   MDKKTRAVIINSPNNPTGAVYSAQTLEHLGSLLSEKSREHGRPIYLISDEPYRDIVYDG
FT                   TVVPPLFPAYENSLVVSSYSKTLSLPGERIGFVAVNPATACRRELVDAMTFANRVLGFV
FT                   NAPALMQRVITFMQGQHVDIGEYARKRDLLCDLLADAGYDFIKPAGAFYLFPKSPQADD
FT                   VAFVKILQEQRILAVPGVGFGRPGHFRLAFCVEDDTIKNAAPGFARAMAEARHAG"
FT   gene            92860..93045
FT                   /locus_tag="Dole_0082"
FT   CDS_pept        92860..93045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0082"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: sat:SYN_00040 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65892"
FT                   /db_xref="GOA:A8ZRX5"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX5"
FT                   /protein_id="ABW65892.1"
FT                   /translation="MKFFLCVIGMVMIIEGMPYFAFPETVKTWLKQLLELEPRVLRLFG
FT                   LTLMLAGLGLVYLGNQ"
FT   gene            93215..94264
FT                   /locus_tag="Dole_0083"
FT   CDS_pept        93215..94264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0083"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   pca:Pcar_1895 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65893"
FT                   /db_xref="GOA:A8ZRX6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX6"
FT                   /protein_id="ABW65893.1"
FT                   /translation="MFLVSDYDYDLPPDRIAQQPVTQRDSSRLLRLDRARGGISHHRFY
FT                   DLPDLLRPSDLLVVNNTRVVPARLEGIKETGGRAGALILDYPGVRTEKGVICRCMVKAS
FT                   GRLRPGTRFLFEDRLSASVVDAADGLYTLCFSCDGDFDQTLFAVGRTPLPPYITRNRDG
FT                   APCDDRTCYQTVYADRDGAVAAPTAGLHFTPNVLDRLAAKGISTAPVTLHVGHGTFLPV
FT                   RVSDIRDHAMHSERFEVPAATAAAINATRRDGGRVVAVGTTVVRTLEYVARTCGEIRAF
FT                   SGACDLFIYPGYNFQAIAAMITNFHLPRSTLLMLVSAFTGREKVLAAYEAAIQEKYRFY
FT                   SYGDAMLIE"
FT   gene            94358..95512
FT                   /locus_tag="Dole_0084"
FT   CDS_pept        94358..95512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0084"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: gsu:GSU2619 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65894"
FT                   /db_xref="GOA:A8ZRX7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRX7"
FT                   /protein_id="ABW65894.1"
FT                   /translation="MFQFETTTACPDTKARTGKMTTAHGDVATPVFMPVGTLATVKSLS
FT                   PEDLVACGAQIILGNTYHLYLRPGCDIIDAFSGVHAFMGWNRPLLTDSGGFQVFSLAKL
FT                   SRITEEGAAFQSHLDGSSHLLTPESVIDIQNRLGSDIQMCLDQCIAFPAEKGAARDAAN
FT                   LTTRWAGRCRNRWQETGGPSRCGLFGIVQGGMFDDLRADSAGRLVDLDFSGYAVGGLSV
FT                   GEPIETRLAVAEHTLSLLPPDRPRYIMGVGTPAELVELVALGADMFDCVMPTRNARNGK
FT                   LFTSFGAINIRNACHAKETGPVDPACTCYTCTRFSRAYLRHLFMSRELLAYRLATLHNL
FT                   FYYINLINDARAAVAAGRFAAFRKAFYAAQQATGPTGKEPCAGS"
FT   gene            95607..95825
FT                   /locus_tag="Dole_0085"
FT   CDS_pept        95607..95825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0085"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   pca:Pcar_2331 thioredoxin-like proteins and domains-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65895"
FT                   /db_xref="GOA:A8ZRX8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX8"
FT                   /protein_id="ABW65895.1"
FT                   /translation="MKEQVKAALDKIRPQLQADGGDVELVDVENGNVSVRLKGACAGCP
FT                   MSQITLKQRIEAYLKKTVPGVINVEKV"
FT   gene            95992..96306
FT                   /locus_tag="Dole_0086"
FT   CDS_pept        95992..96306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0086"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: sfu:Sfum_3639
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65896"
FT                   /db_xref="GOA:A8ZRX9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRX9"
FT                   /protein_id="ABW65896.1"
FT                   /translation="MYAVIATGGKQYRVEKDEVLRLEKLPGQVGDTVSFDQILLFSDGE
FT                   SVSVGTPVLGNVTVSGKIVEQDRAKKILVFKTKRRKRYRRKQGHRQSFTAVRIETIQAG
FT                   "
FT   gene            96368..96619
FT                   /locus_tag="Dole_0087"
FT   CDS_pept        96368..96619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0087"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: sfu:Sfum_3640
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65897"
FT                   /db_xref="GOA:A8ZRY0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRY0"
FT                   /protein_id="ABW65897.1"
FT                   /translation="MAHKKAGGSSKNGRDSRGQRRGVKRFGGEKVRAGNILVRQLGTHF
FT                   HPGNNVGLGRDYTLFAKIDGVVTYESSGARKQVSVYAD"
FT   gene            96616..97617
FT                   /locus_tag="Dole_0088"
FT   CDS_pept        96616..97617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0088"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP-binding protein HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: sfu:Sfum_3641 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65898"
FT                   /db_xref="GOA:A8ZRY1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRY1"
FT                   /protein_id="ABW65898.1"
FT                   /translation="MKFIDEATITVSSGKGGRGCVSFRRERFVPRGGPDGGDGGSGGSL
FT                   LFRVNPSKRTLYAFRSKKQFAAPNGAPGEGRQKTGKSGDDLVIEVPPGTLIFDADTGAI
FT                   IRDMVSPEEDFVFLTGGRGGKGNKHFATSTHQTPRFAQPGEPAQTATVRLELKLLADVG
FT                   LIGLPNAGKSTLLSVISAARPAIGAYPFTTLSPNLGMVTLAGAEPFAVADIPGLIEGAH
FT                   TGAGLGIRFLKHIERTRLLVHLIDASAIDPADPVAPFRIINAELAMFSPALAERPQVVV
FT                   LNKMDLTGAEALAQQFINAAGIKKCFLISAATRSGVEELKKHLFELLCSHDT"
FT   gene            97607..98737
FT                   /locus_tag="Dole_0089"
FT   CDS_pept        97607..98737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0089"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: sat:SYN_01350 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65899"
FT                   /db_xref="GOA:A8ZRY2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY2"
FT                   /protein_id="ABW65899.1"
FT                   /translation="MTPDERHRYFDQATRVVVKAGSNILTGENGLNLTVVRSISKEICQ
FT                   LMERGLEVLFVSSGAMACGTKKMDMKQRPAELPQRQAVAAVGQAGLILAYEKAFAKHGR
FT                   QVAQILLTGDDLSSRKRYLNARNTLYTLLSWKVVPVINENDTVAVEEIKFGDNDNLAAM
FT                   IALLMDAHLLINLTDIDGLFDKDPRSHADAKRVETVTAVTRSLEQAAGRMPGALGTGGM
FT                   MSKIQAAKKATCSGVPVVIANGRRKNILTDLFAGKPVGTFFLPTEQKLCSRKRWIAYSL
FT                   KTRGTLTVDEGAAGAIVHKGKSLLPGGITSVSGDFSHGAPVDILSASGEHLGIGLVNYS
FT                   AAEIRAIKGLKTGLIEKTLGAKPYDEVVHRNNLVLV"
FT   gene            98775..100031
FT                   /locus_tag="Dole_0090"
FT   CDS_pept        98775..100031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0090"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: pca:Pcar_2579 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65900"
FT                   /db_xref="GOA:A8ZRY3"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRY3"
FT                   /protein_id="ABW65900.1"
FT                   /translation="MTIEATIVDIAKAAKKAALAMATCPTDKKNQALLALADRLHKDAA
FT                   LIQAENKKDLEAAKATGLSSAMIDRLTVSDAVIASMADGLREVAALPDPVGAKSATWRR
FT                   PNGLEVARMRIPLGVIGIIYESRPNVTVDAAGLCLKAGNTVILRGGSEALHSNRALAAT
FT                   ISASLAESGLPETAVQVVPVADREAVTHLLAQEEYIDLIIPRGGEGLIRFVVQHSSIPV
FT                   LKHYKGVCHVYVDQDADMEMARAICFNAKVQRPGVCNAMETLLVHRDAAQRFLPDMARQ
FT                   FADAGVALRGCAATRALLPGIETAEEADWYAEYLDLILAVKVVDSMDAAISHIATYGSS
FT                   HTEVIVTNSYDRAMRFLAAVDSSVVLVNASTRFNDGGQLGLGAEIGISTSKLHAFGPMG
FT                   LEELTTTKFIVLGNGQIRE"
FT   gene            100059..100727
FT                   /locus_tag="Dole_0091"
FT   CDS_pept        100059..100727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0091"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: sat:SYN_02003 nicotinate-nucleotide
FT                   adenylyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain; nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65901"
FT                   /db_xref="GOA:A8ZRY4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY4"
FT                   /protein_id="ABW65901.1"
FT                   /translation="MPTAGIIKKGLFGGTFNPVHTGHVCLTNALLKDFPLDRVIVVPTA
FT                   RPPHKPVDYIADPADRFHMVGLAFENMAGVSVSDAEMVQTGPCYTIDTVRYFISSDPQS
FT                   SFYLILGLDAFLELDTWKSYMSLVASLPLIVFSRTLDHASEKTAFENFLTSTLSKAYVF
FT                   SEKQAGYVHPTLYPVFFYAARHFDISATGIRARIKAGLPIKGLVPDPVAQYIRKKGLYI
FT                   "
FT   gene            100724..101068
FT                   /locus_tag="Dole_0092"
FT   CDS_pept        100724..101068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0092"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: sfu:Sfum_3646 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65902"
FT                   /db_xref="GOA:A8ZRY5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY5"
FT                   /protein_id="ABW65902.1"
FT                   /translation="MTASSKTEIEPYLTAINGMKAENVVALDVSRLTSIADVFILCEGR
FT                   SNRQVSAISDHIVKALKDQGIKPLSMEGVSEGRWVLLDYGDVIIHVFYESVRAFYDIEG
FT                   LWADARRIEV"
FT   gene            101094..102629
FT                   /locus_tag="Dole_0093"
FT   CDS_pept        101094..102629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0093"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: pca:Pcar_2574 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65903"
FT                   /db_xref="GOA:A8ZRY6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY6"
FT                   /protein_id="ABW65903.1"
FT                   /translation="MTKATPPCMLMILDGWGLNPETKGNAVAAARTPHLDRLFSEYPHT
FT                   RLVCSGEAVGLPPGYMGNSEVGHLNIGAGRVVYQELMRINVAIQDGSFFKNTVIVQLMD
FT                   QVTKKQGRLHLIGLLSDGGVHSHLDHLKALVRMASNKNLPVLIHTILDGRDTPPDSGKT
FT                   YMADLCEFLADYPSASVATVCGRFYAMDRDTRWDRTKKAYDLYTLGEGTRESDPVTAVK
FT                   NAYLRGETDEFVTPVIIASGSQDGGTVADNDGILFFNFRADRMREIVRAFTDPDFSFFN
FT                   RKKTPAVAPPVCMTLYDKTFPLPVAFPPENPPNTLGEVISRQGYSQLRIAETEKYAHVT
FT                   YFFNGGVETPFTGEDRKLIPSPREVATYDMKPEMSAPQVANTLAEEIIKQKYDFIVVNF
FT                   ANMDMVGHTGIFAAAVAACETVDACIGKIIPLFLKSGGVVLVTADHGNSEQMEDQNGHP
FT                   FTAHTTNPVPLILVDENRKQIILKEGKLADIGPTILFIMKIDQPAEMTGNSLL"
FT   gene            103072..104205
FT                   /locus_tag="Dole_0094"
FT   CDS_pept        103072..104205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0094"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppd:Ppro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65904"
FT                   /db_xref="GOA:A8ZRY7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY7"
FT                   /protein_id="ABW65904.1"
FT                   /translation="MKLSVEKKDIIEMLANVQGIAGKRSSLAITENILIKTGKEGISVS
FT                   ATDIETGFEGIYPATIENEGTIAINARQFYEIVKKIDSNIIYLREEKKQWIQISDTEDG
FT                   SRLKYQIMGGETESFPQLPVIADVSYIDVNSADFKNMILWATVITSSGTEKRAHVIGAN
FT                   LEYIKDGKIKKIRMVSTDGKRLTKTEYSYKKGEPDTPETSTILPKKALNELFKFLKDEG
FT                   TIQIGTRDNYFIVKNNNEIIYINLLSGEYPNLETLFSDEKGRTEIKINRKKLKDMLERM
FT                   SILTTDNYKGVIFTFEKNILTINAQNPDRGESYEWMDIQYDKKQIKSMFNPDYFIDAVN
FT                   LIEDDEVCLKLKEDQAPCIVCGGKHPENINIIMPMKI"
FT   gene            104210..106654
FT                   /locus_tag="Dole_0095"
FT   CDS_pept        104210..106654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0095"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sat:SYN_02049 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65905"
FT                   /db_xref="GOA:A8ZRY8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY8"
FT                   /protein_id="ABW65905.1"
FT                   /translation="MKKEEIKEAYNESSINVLEGLEPVRKRPSMYIGNVDKEGLHHLVY
FT                   EVVDNSIDEAMAGYCDFIHVIIHKDNTVSVVDNGRGIPVGMHEKEHVPAVEVVLTKLHA
FT                   GGKFDNNNYKVSGGLHGVGISVVNALSSFLEVNVYRDGKIYKQTFSEGQKTSELEIIGD
FT                   TTQRGTKIIFKPDTTIMNTDNFSFDILTRRLRELAFLNNGVRIKIEDHRSDESAEFFYE
FT                   GGLATFVDYLNRAHAVLHKPIYISGEKNDVQIEAAIQYNDSYSETMYSFANNINTVEGG
FT                   FHLIGFKGALTRSINQYAASQGGGSSKKNGDKITGDDVREGLTAVISVRIKNPQFEGQT
FT                   KTKLGNSEVKGYVDSLVYEKLNIFLEENPSVGKIIIKKATEAARARNAAKKARDIARSQ
FT                   GSLLDSSLPGKLAECQSSIPAERELFLVEGDSAGGSAKQGRDRRFQAILPLKGKILNIE
FT                   KARFDKILKSEEIKNIITVLGTGVGSEEYNIEKIKYHKVIIMTDADVDGAHIRTLLLTF
FT                   FFRQMQDLIKQGHLYIAQPPLFKVGRGKKEVYIDSELLLKDYFIQNACEKKYVKTGEKK
FT                   LQDHELYLFLCNLSEFISEMAGLKRRGYNSKLIETLIRQNIREKSLLQDRDRVAALQQT
FT                   LSENGFVVDDVLYNEEKEMYEFLVTIPLHEDEEEAVTGSAKKDIKPVRIGRNLIYSNRY
FT                   QNIVMLSEKIAPYNVPPFTVYNSDTDQEEARFDTVKQLYQYMEALGKKGVVFQRYKGLG
FT                   EMNADQLWQTTMEPETRKLLKVTIDDAAEADAVFTLLMGDVVEPRKKFIQENALEVETL
FT                   DI"
FT   gene            complement(106651..107988)
FT                   /locus_tag="Dole_0096"
FT   CDS_pept        complement(106651..107988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0096"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: dde:Dde_0099
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65906"
FT                   /db_xref="GOA:A8ZRY9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY9"
FT                   /protein_id="ABW65906.1"
FT                   /translation="MDHTKILHLLKAKTPLSGVRVCGWVKTCRNSKALSFLEINDGSCL
FT                   QSLQVVAPAQLDNFEQVQKLLSGSAVAVSGDLVASPAKGQQWELAARRVDIVSRTDETY
FT                   PLQKKRHSDEFLRTIAHLRPRTNKYSALFRLRSEAGFAIHSYLRDQGFFHVHTPILTGS
FT                   DCEGAGELFSVTSRSPLFDRDVFLTVSGQLAAEMFALCLGRVYTFGPVFRAEHSNTARH
FT                   AAEFWMVEPEIAFCNLEQNMDFAQAFVKQTVTHMVENCGPDMDLFSRFVDPELPATLDN
FT                   ILASEFERISYKTAIDLLVRSGTAFSFTPEYGNDLQTEHERYLTETVFKKPVFVYDYPR
FT                   AIKPFYMRVNDDGRTVAAMDLLVPRIGELIGGSQREERLDVLEQQMDNSGLSKDHYGWY
FT                   LDSRRYGSVAHSGFGMGFERFLMLVSGVSNIRDVIPFPRTPGTIEF"
FT   gene            108032..110485
FT                   /locus_tag="Dole_0097"
FT   CDS_pept        108032..110485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0097"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: gur:Gura_0300 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65907"
FT                   /db_xref="GOA:A8ZRZ0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ0"
FT                   /protein_id="ABW65907.1"
FT                   /translation="MQTGLNGSLLASVRKPSTYLGNEINTIRKDPASVDLLMALCFPDL
FT                   YEIGTSHFGLQILYHILNRDKQIAAERVFSPGPDMEALLRTTGRSAFSLESRRPLETFN
FT                   IIGFSLLYELNYTNILTLLDLSGIPFYAADRKAAHPLVIAGGPCTVNPEPVADFFDAMV
FT                   IGDGERVTEEMCRAWLEIKKSSGTVDRAEILDRWSSIEGVYVPSLFTATYDADGFQHLA
FT                   PAKKDYIRVTRAVVPHLTAADFPNTPVVPYGKPVHDRLRLEIARGCTRGCRFCQAGMIY
FT                   RPVRERPVEDLLALAGQALEATGYEDLSLLSLSTGDYSRLHHLLERMLSVHGKDNVAVS
FT                   VPSFRAGSLGQEEMGLIRSVRKTGFTIAPEAGTQRLRDVINKNITEEEIVHTVSDAFGL
FT                   GWNLIKTYFMVGLPTETDADIDGIVSLVSRLARIKAPGGRGKKLHVSVAAFIPKSHTPF
FT                   QWEPQVSVARAKELIFSLKRRLESGKVGFKWQHPETSLLEGLFARGDRRLSALIEAAWR
FT                   RGCRFDGWSDSFDFAAWQAAAEDCDLDMEASVTRKREITEPLPWDHVFTGVSRVFLEKE
FT                   RDSAYGARLTPDCRDQECSGCGVCDFETVAPRLSPAPAPVQEGLAPGRQNLPPVCLEVS
FT                   YSKTGEARFFGHLEFIAILSRAIRRARVPVVFSQGFHPKPKLSFSDPLPVGMESECERF
FT                   WMTVYGPADPEAIRQALNRCLPDGFFLHECRMVATRKDKSSGRTGPAVYNITINQDLFD
FT                   ARHEVPAPSETDPFAITVLDPRNLVLEIRQRQKGLSSPGQIVASVFGVDEALIVQGRVV
FT                   KRAGL"
FT   gene            110589..112142
FT                   /locus_tag="Dole_0098"
FT   CDS_pept        110589..112142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0098"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: sfu:Sfum_1609
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65908"
FT                   /db_xref="GOA:A8ZRZ1"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ1"
FT                   /protein_id="ABW65908.1"
FT                   /translation="MLLHMSKELIINATENETRVALLEDGILAEFFMERGNHLNISGNI
FT                   YKARVNRVLPGMQAAFVDIGLDQAAFIYVTDVFSEPSREVENIFNETAEEPEPVAVARE
FT                   DEFDLSVPVPPADVKIEDLLSEGQEILVQVSKSPIGSKGARITTRISLPGRFLVLMPTV
FT                   DHVGVSKRIVEDGERQRLKELVVSLRTEPFGFIVRTAAEGVEKEKLEKEMILLVNLWQK
FT                   VQKRFASASAPALLHRDMTVSLRAVRDYLTHEADRVVVDADYVYDEIMTFLDEIMPRMK
FT                   ASVERYTGSEPIFDAYNIEGDVFRSLKKKVWLKSGGYIIIEPTEALVVIDVNTGGYVGK
FT                   HNFEETVFKTNLEAAREIAYQIRLRNLGGIIIIDFIDMAREANREKVFVSLKEFLEKDK
FT                   SKTTLLPFSELGLIQMTRKRTRNSVARMLCEPCFYCNGDGYLLSRQTICFNIYREIMRE
FT                   SQDLSGEKITVKVHPDIAEMLHGEESRVVTGLEADLGRQIIIYPVPKFHIEQFEIEEIL
FT                   "
FT   gene            112349..112483
FT                   /locus_tag="Dole_0099"
FT   CDS_pept        112349..112483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0099"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: pmy:Pmen_4623
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65909"
FT                   /db_xref="GOA:A8ZRZ2"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRZ2"
FT                   /protein_id="ABW65909.1"
FT                   /translation="MKRTYQPSNVKRARKHGFRARMATKQGRSILKRRRAKGRKRLTV"
FT   gene            112621..112986
FT                   /locus_tag="Dole_0100"
FT   CDS_pept        112621..112986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0100"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: sat:SYN_01012 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65910"
FT                   /db_xref="GOA:A8ZRZ3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRZ3"
FT                   /protein_id="ABW65910.1"
FT                   /translation="MTAFSFKKEDRLLKRYEFIEIFTSGKTVHSSCFLAGIKKNRKERI
FT                   RLGITVSKKVGKAARRNRIKRHVREFFRLHRDNLSNCWDINVIAKKKAVNASPAELERS
FT                   LAELFHKSSREFPSDRQ"
FT   gene            112986..113180
FT                   /locus_tag="Dole_0101"
FT   CDS_pept        112986..113180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0101"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   chy:CHY_0003 conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65911"
FT                   /db_xref="GOA:A8ZRZ4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ4"
FT                   /protein_id="ABW65911.1"
FT                   /translation="MILIRAYQLVVSPLLGPRCRFYPSCSQYAHEAVFRHGVVKGLFLS
FT                   IKRIARCHPFCPGGYDPVP"
FT   gene            113359..115038
FT                   /locus_tag="Dole_0102"
FT   CDS_pept        113359..115038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0102"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   dps:DP0855 conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65912"
FT                   /db_xref="GOA:A8ZRZ5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ5"
FT                   /protein_id="ABW65912.1"
FT                   /translation="MEHIRLVLAVVLSVLVLLVWQVFFIGSPEAPVRPDGAPVAPAQEA
FT                   AAPPNPAAGDVALPRENAPPEQVTPADSALVPTEAPAAPVVVETGLYTVTLNGNGAHIS
FT                   DFVLKNYRETNDPASPAKRLLSDNNPQGSLRVNLEGDTLAGMANGPYSADVADGPVVVS
FT                   DQPRSVVFTRQFPGGRVVEKRYTFTPDSYMIDLAVTLKNGSETPLSGNLAVTLARYFTD
FT                   DGSRFVFEGPSALVGHDLEEIKLGDIQKKASLTGSLAWISIQNRYFMSALIPETPTEAA
FT                   MRLSRTPEQVVTATYLAPARTVGANSTETYRFSVFMGPKSVQILGRAGHALDRAVNFGF
FT                   FDFIARPCLWLMNFLYRYIPNYGIAIIIITLLFKLVFWPLGNKSYKSMAEMKRLAPLMA
FT                   EIREKYKDDRKKMNEEVMNLYRTYKINPLGGCLPILVQIPVFFAFYRMLYQAIELRHAP
FT                   FFGWINDLSAPDRLFNFDVSLPLIAPPVGIPVLTIVMGATMIIQQKLQPPMGDPTQAKI
FT                   MMLMPIFFTFIFINFPSGLVLYWLVNNTISIFQQYYITRKNA"
FT   gene            115053..116078
FT                   /locus_tag="Dole_0103"
FT   CDS_pept        115053..116078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0103"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; KEGG: dvl:Dvul_1916 single-stranded nucleic
FT                   acid binding R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65913"
FT                   /db_xref="GOA:A8ZSK0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK0"
FT                   /protein_id="ABW65913.1"
FT                   /translation="MTDTKEFEGKNIDAALEKASSALNMTKDQLRYEVVCTGSSGIFGL
FT                   VGVKNARIRILNSKKGSGGAGAGGRRDVLDEDRQEILSMLDEAFAEPAPEPESRPRPEA
FT                   KAAPRGEPRAESKKAPRAKPKSRPRTEKGAPAPAERSRAAGRPPANGAKPPAPEERPET
FT                   PPAASEELPESPPAPPVEVKEADVVLARDVLSKILDNITDEATVKVAFEPGRVGFSMEG
FT                   GNSSVLIGKRGKTLKAMQHIVEKVVKKSMGEAVEVQVDVEGYLEKRASSLTTLASRLAE
FT                   KARQTGKPTTISRMDAYERKIIHDALRTDRSVKTRSVGNGDIRNVVIHPGRRTSRKKTA
FT                   P"
FT   gene            116099..117487
FT                   /locus_tag="Dole_0104"
FT   CDS_pept        116099..117487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0104"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Miro domain protein; KEGG: pth:PTH_2917
FT                   predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65914"
FT                   /db_xref="GOA:A8ZSK1"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK1"
FT                   /protein_id="ABW65914.1"
FT                   /translation="MERSTIAAIATPAAPGGIGIVRLSGPRAVAIALSVFSSRPDAAAA
FT                   SLSEAGAESHRMYHGYVFDDDALVDEVLLVVMRAPRSYTGEDVAEIHTHGGPAVVSAVC
FT                   DLVLRAGAEPAAPGEFTQRAFLNGRIDLTQAEAVADMIEAASIEQVKAAAAQVSGEIRQ
FT                   AVSGLKQSLAGLMAEMEAAIEFDDQVEGSFSPEKAACRIETEVLPCLQDLLDRRRATEA
FT                   GRGATVVIAGPPNAGKSTLLNRLLGTDRALVSEIPGTTRDLVDGRVWVSGTPFVFTDTA
FT                   GLRPDSGDAVEAMGMARARTAMDQADLILFVVDAAAGMGPESGALFCEASAKPFVVVAN
FT                   KSDLPEARGFMPPSAWPAAPVVHVSALHGLGIKELKNLLVRMVGEQAVPASGRAAPNPR
FT                   HRAALVACREALVAAGAALKNGVPADVAVLDIRAAVDRLNEISGEGAGPTVLDAIFERF
FT                   CIGK"
FT   gene            117620..118303
FT                   /locus_tag="Dole_0105"
FT   CDS_pept        117620..118303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0105"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dde:Dde_3774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65915"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK2"
FT                   /protein_id="ABW65915.1"
FT                   /translation="MEFDFTPYFTRYEMLVSMVDGIFDRVKDEYPACVTCSQGCSDCCH
FT                   ALFDLTLIEALYINHKFNAAFGRNEQMLEKANRADRQIYKLKKQAYLDHEQGKNEVAIL
FT                   AEMGMERVRCPLLNNEEMCDLYAFRPITCRIYGIPTSISGMSHTCGKSGFEAGGKYPTL
FT                   NMDKIYSQLYALSRELMVDIQTRYTKMDEMLVPVSMALLSDYDDAFFGFNQEAENTEDG
FT                   KEEKE"
FT   gene            118300..118668
FT                   /locus_tag="Dole_0106"
FT   CDS_pept        118300..118668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65916"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK3"
FT                   /protein_id="ABW65916.1"
FT                   /translation="MKIEAFSPEEKAARKQAIFDAMSPRAQRWVQKKGYDKWDPFQEPK
FT                   DPIDMRKDKTRRTSQVLIREFLQTLAMETYSTQYARGAFELCLGIINEEERALGMFAFA
FT                   SWYRDLLEKEGIDLFENQ"
FT   gene            118655..119527
FT                   /locus_tag="Dole_0107"
FT   CDS_pept        118655..119527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0107"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="PFAM: ribosomal L11 methyltransferase; KEGG:
FT                   ppd:Ppro_2959 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65917"
FT                   /db_xref="GOA:A8ZSK4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK4"
FT                   /protein_id="ABW65917.1"
FT                   /translation="MKTSDPDPIAADVVRMVTDAEARLVCRQVIRAVSEQHGVGIRRVK
FT                   AAITGLVDAGTLRFSEECGNCFLEKNYGGTVRLSPHVMVAPPRVPVPLEIGCQMVRLMP
FT                   GAAFGDCRHPTTRLSVCGLDFLFTAHTGLDRSAAALDIGTGSGVLALVAARLGVFRVLA
FT                   IDIDPCARKEAADNVALNDLSDRIVVSDRGLEQVSGPFFLVTANLRLPTLKRYAPLIDN
FT                   LLMPGGGLVVSGIRTQETAPLMAAFDTTATCIWQSSDGGWSAMVFIKHPSKANKHQRTV
FT                   LDSQKRGDT"
FT   gene            119524..120198
FT                   /locus_tag="Dole_0108"
FT   CDS_pept        119524..120198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK5"
FT                   /protein_id="ABW65918.1"
FT                   /translation="MTIETKEQYLERLLAEKKPRCPACGQEMEIWEPPILNFSDGLGWG
FT                   TPYLFVCFNNNCPTYTQGWAYMQETFGHKASYRNMCYPFTEQFETMPVFSDQGGLAQVV
FT                   TEETVAEQDRIREATKRGFSLLAEFYTTKSWYEVLTLLLDATEPAKVRLKAAEMVGDIG
FT                   DLEAIEPLRSYNFGNAILNEAAQKAVAKIHERHFTLECPYCAEIIKKRAKVCKHCGKEL
FT                   ST"
FT   gene            complement(120309..121034)
FT                   /locus_tag="Dole_0109"
FT   CDS_pept        complement(120309..121034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65919"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK6"
FT                   /protein_id="ABW65919.1"
FT                   /translation="MKRFGFVLGVLGLLLGVGVSSATAAAVSAGADVVSAYVWRGITFN
FT                   DEAVVQPYLDVTAENGINLNVWGNYDVGDYGGTLAEDNEFSEIDLTLSYGFSLDPVDIT
FT                   VGHIEYLFPNGGGQGTSELFISTWASLVAGLSAGVDFYYDYDELDEYYLSAGIAYDLEL
FT                   PRGIGLGFGASAGYAGNRYAADGNHDFYDYNLSLSAGFPVTDSVDLSAFIAYTDTFDNT
FT                   TLPDQDVDVYGGAGFCVNF"
FT   gene            121442..121936
FT                   /locus_tag="Dole_0110"
FT   CDS_pept        121442..121936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65920"
FT                   /db_xref="InterPro:IPR021471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK7"
FT                   /protein_id="ABW65920.1"
FT                   /translation="MKTPRCMVRIGMAVLVCLMVFLSTAGAESVLPLSTGQTLYVPAYS
FT                   HIYSGNNEQPFLLTVTLSIRNIDPGRAILVTKADYYATQGKQLKSYVSAPVKLKPLESI
FT                   RYVVPERDKSGGSGANFIVEWTSDGPVNPPIVESIMIGTQIQQGISFTSRGQPITPFSS
FT                   Q"
FT   gene            121952..122761
FT                   /locus_tag="Dole_0111"
FT   CDS_pept        121952..122761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0111"
FT                   /product="RimK domain protein ATP-grasp"
FT                   /note="PFAM: protein of unknown function DUF201; RimK
FT                   domain protein ATP-grasp; KEGG: maq:Maqu_0076 RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65921"
FT                   /db_xref="GOA:A8ZSK8"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK8"
FT                   /protein_id="ABW65921.1"
FT                   /translation="MRLVSFDPLQTLDIPGVRTIKPAHWFREKETVKSADWILYPEYWQ
FT                   VNPLYYGLKKRIFPSVSTYHIGHDKIEMARAFEAVCPENAPVTRILSRNEYATEQILDE
FT                   FDFPFVAKEVRSSMGEGVFLITDKKALKAYVDRNDTLFVQEYLPISRDLRVVVVGKSVV
FT                   AAYWRQAPDGAFCNNVSRGGTVCFEDIPDSALGLVEKVAIELDINHAGFDVAVVDGHCF
FT                   LLEFNPRFGTQGLITRGIRLGRVVLDYLIEMSRPPEVPGNPRLPRAG"
FT   gene            complement(122992..124710)
FT                   /locus_tag="Dole_0112"
FT   CDS_pept        complement(122992..124710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0112"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcz:BCZK2688 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65922"
FT                   /db_xref="GOA:A8ZSK9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK9"
FT                   /protein_id="ABW65922.1"
FT                   /translation="MAYTIQKLKLAKDALTGIAAFVSRETRHGRLIKLITGLVSDKPRD
FT                   IAWSDLLEDCAADVPEKTFLRYKTESFTYRQMNANANRMAAFLVAAGGGRGKGVGILMR
FT                   NAPRVLDVFFGSQKAGMYSVMINPELRGDGLAYVINHSDIDFLVADAELLDTLIPVMDA
FT                   LDRIRPDTVFINDVEEEARGIALPDTMGLLSRAYRMPAVRPDIQYDPEDLCLIIYTSGT
FT                   TGPPKGVVYRYNTTGVTRLRLVGHLFLKPGDVYYTYLSLCHGNALFISTTATMAARAGM
FT                   ALARKFSASRFWDDVRGYNATVFNTIGSIVPILMKQPEKPTDSDNSVRVVFSAACPADM
FT                   WEPFEKRFGVTLYEGYGAIDGGGKGIMNFGTAPRGSLGKPMASGRVRLVDEKGHDVGPG
FT                   AAGELLFKVGGGKSRVEYYKNEAASEKKVKDGWLYTGDILRKDKNGYFYFVGRNTESMR
FT                   KGGENVSAYEVEHVIMKHPAVEDVAVYAVPSEMAEDEIMAAVKLVEGQSVTPAGLQAFL
FT                   AGQLAKYAVPRYIRFVDDFPKTNTHRIIKRVLEQEGVTGDTWDALKKGAGTSPSS"
FT   gene            complement(124751..126148)
FT                   /locus_tag="Dole_0113"
FT   CDS_pept        complement(124751..126148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0113"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /note="PFAM: Thiolase; KEGG: rfr:Rfer_4205 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65923"
FT                   /db_xref="GOA:A8ZSL0"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL0"
FT                   /protein_id="ABW65923.1"
FT                   /translation="MRDVYVIGAHTIRFGKHLDRGIKDLAIWTVTECLKDAGLEKEAIE
FT                   ALWFSNSGWDHAKGQSCIRGQVALRPMGIDAIPITNVENACASGSTAFHHAWLAVTAGA
FT                   CDVTMAVGAEKLYHPNKYHVFSGFLGGIDIENCVQIAEGLSVFRLTPEEKKDLAAFKAK
FT                   YQPARPVGEKKKKTLKERLLDLRYQLAEAVMLGEKLGYDTVKKMSRLSAGDHSPFMDIY
FT                   GYAARQHMKKYGSTVEQLAIIASKSHFNSTLNPNAQYRFEVPVEKVLADRIVSFPVTRA
FT                   MCAPIGDGAASAILCSEEKVRQLGLMDQAVRVRASILGSGRARTPDEPEIGERLAKKAY
FT                   AVSGLGPKEIDLAEVHDATAYGEMVQAENLGFCPKGEGGRLAEQGETRLGGKIPINTSG
FT                   GLVSRGHPIGASGLAQIHELVTQLRGAAGKRQVEGARLGMAENGGGALGTEEAAMCIHI
FT                   LEAPARA"
FT   gene            126600..127382
FT                   /locus_tag="Dole_0114"
FT   CDS_pept        126600..127382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0114"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   mva:Mvan_2942 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65924"
FT                   /db_xref="GOA:A8ZSL1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL1"
FT                   /protein_id="ABW65924.1"
FT                   /translation="MGQRFKAVVNSLMRDIFSNKLAPGDKLAAERELSKKMDIDRTSLR
FT                   IALKQLEALGVLEIRQGDGIYVKDYMKNAGLDFLRLLFLQEEKEGEGPVIDEYIIDEAM
FT                   EFWVEFMPLMVKVALRRITPLHIKRFVDTFNNELEVIGDREKVVESELLQQEMVAEATD
FT                   NLLFLLLSNTTRPLRKKFLEIFVSQLDKETMRRHVEFKRALLRSDLATDPRGPEVISEG
FT                   YKKMMIYYRDVARKSWQVTPEDDKLVKQFMASVDAGQA"
FT   gene            127402..128238
FT                   /locus_tag="Dole_0115"
FT   CDS_pept        127402..128238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0115"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hch:HCH_06637 short-chain alcohol dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65925"
FT                   /db_xref="GOA:A8ZSL2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL2"
FT                   /protein_id="ABW65925.1"
FT                   /translation="MSLKRFPEKRILITGAGSGFGRALALEFAKLGWRIGVAEINAERA
FT                   AESAELIRQAGGRPVEILCDVTKPEDLDAAAALVQKEWGGLDILVNNAGVAAAGLVEKT
FT                   PLETWDWILALNTKSIILGCRSFIPMLKAQKSGYIVNMASAAGISSLPEMGCYNITKAA
FT                   AISLSETLRGELAPFNIGVSVICPSFFKTNLMDQFTSPDERQRKMAAAFFKKSRVTADQ
FT                   IARHVVKSVDKKRFYIITQKDARVMWYAKRFFPETYFRIAASIYKKNLMDKYLGVS"
FT   gene            128291..129049
FT                   /locus_tag="Dole_0116"
FT   CDS_pept        128291..129049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0116"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pth:PTH_0474
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65926"
FT                   /db_xref="GOA:A8ZSL3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL3"
FT                   /protein_id="ABW65926.1"
FT                   /translation="MRKKEEALSPLGSYEPGMEWNPVEKTIMERRSIRKFKKDPVPATL
FT                   IRRVLEAGRFAPSAGNQQPWKFVVITSPEIIAAMDKDAAMVTRFFLFFLGYVNHTGIRR
FT                   AISKFLAHVFAFRLFSNEMHPAPYGAMRQAALGKTPYWHNAPVVILILMDRRGVSDPAV
FT                   DVGVAGQNMVLAAHSLGLGTCWVGFTKLLTYLPWWKKRFNVTYPYVLKESIALGWPASK
FT                   ADGEVVREVHLVDWYEGGINDKPRTERQGE"
FT   gene            129053..129430
FT                   /locus_tag="Dole_0117"
FT   CDS_pept        129053..129430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0117"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mka:MK0462 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65927"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL4"
FT                   /protein_id="ABW65927.1"
FT                   /translation="MATGLSLKERFDIPEYDDMAAMHYALLDFDQEKCVQCGLCVSACA
FT                   GGCILIGSLYRSDFISGQGKARQGFPELDTLPNQTPMCVGCLTCSAACPTGAITIKQPF
FT                   RPGGRLKKLHQAPEMTPPHRY"
FT   gene            129618..130499
FT                   /locus_tag="Dole_0118"
FT   CDS_pept        129618..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65928"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL5"
FT                   /protein_id="ABW65928.1"
FT                   /translation="MRPVRQLFLLPFLLLVFASSGLCFTDVTTLEFKGFTLGMSLEQAV
FT                   KTLKARAYRENRDIRVFSSGEYAISAYFQNDIPLHLVSAKESDYTDMTLQFANNELLML
FT                   DAKTRYVTADQARALPDKYTRIFGPFDFRGEKLSRDTAVLFWLWGGESIRPETPPMAPH
FT                   VQVQIISKRENGKETPESEELRMVDVPKLMGVQYAETLEQYLKGNALYAAKVEEGRKLA
FT                   AGHIPKIQAAIDGDDRYRQVKLNPFEDTILVSGVVKQGDLNPLKEMVAATDPPLKITWN
FT                   VREYPAEVFKQK"
FT   gene            130561..131370
FT                   /locus_tag="Dole_0119"
FT   CDS_pept        130561..131370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0119"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cgt:cgR_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65929"
FT                   /db_xref="GOA:A8ZSL6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL6"
FT                   /protein_id="ABW65929.1"
FT                   /translation="MTSISNNDLLSLGDLNLAEFNREFARWNERYEIIESDDLLMTLGA
FT                   DAFPGANFVMRLAPACTPSANELLDRAMAFFQARQRGFSIHVRRHIDTDLEAACEAAGM
FT                   FKVGNSAGMCLDTPLPDKPEDGSVQVRVIEERQGAVDFADVTVASYKSLGLPEETGKKM
FT                   FAAPERMLKPHIVPVVAYDHGVPVSVAMALMSHGIAGIYWVGTVETHRRRGLAERCTRI
FT                   AGNRAFAMGATRVVLQASHMGEPVYQGMGYREFTRYPWYMWFYKKRG"
FT   gene            131723..132865
FT                   /locus_tag="Dole_0120"
FT   CDS_pept        131723..132865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0120"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: dps:DP3095
FT                   probable carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65930"
FT                   /db_xref="GOA:A8ZSL7"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL7"
FT                   /protein_id="ABW65930.1"
FT                   /translation="MKALLALEDGRTFACKSFTGPGETGGEIVFNTGMSGYQEVLTDPS
FT                   YRGQIVTMTYPLIGNYGVNHQDVESDRVQVAGFVVREYQDCPSNFRSEQSLAKYLQSQG
FT                   VLGITDLDTRALTRHLRTVGALRACISTHELDPAALVEKALAVPSMAGCDLVTGVFSKK
FT                   PYRWINGAPAAVDMDLADMDERVWHKTGGFRVAAFDFGIKYNILRNLEAAGFQVLVVPA
FT                   GATAAQVKQVNPDGIFLSNGPGDPEPLTGPVATIRELLDYRPMFGICLGNQLAGLALGG
FT                   ATYKLKFGHRGANQPVKDLETGKIEITSQNHGFAVDIDSLKKENLVVTHINLNDNTLEG
FT                   FAHKDIPLFTVQYHPEASPGPHDARYLFDRFKALIEKTHA"
FT   gene            132858..136085
FT                   /locus_tag="Dole_0121"
FT   CDS_pept        132858..136085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0121"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; MGS domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: sat:SYN_01625 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65931"
FT                   /db_xref="GOA:A8ZSL8"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL8"
FT                   /protein_id="ABW65931.1"
FT                   /translation="MPKRTDIEKILIIGAGPIIISQACEFDYSGTQACKALKEEGYSVV
FT                   LVNSNPATIMTDPEFADATYIEPVTPEAVAAIIEKERPCAILPTLGGQTGLNTAVAVAE
FT                   MGVLEKFNVEMIGASLSAIKKAEDRDLFRKAMNNIGLRIPRSGIATSMDQVRAIADEIG
FT                   LPLIVRPSFTLGGTGGGVAHTQAELDALSAGGLEASLINQVMIEESVVGWKEYELEVMR
FT                   DRADNVVIICSIENLDPMGVHTGESITVAPIQTLSDKEYQVMRDASIAIMREIGVDTGG
FT                   SNVQFAVNPANGEMVVVEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEIANDIT
FT                   GETRAAFEPTLDYCVVKIPRWTFEKFPETKDELSTSMKSVGETMAIGRTFKEALQKGIR
FT                   SLEISRFGLGADGADKIDPSIQEITDKLATPNSERLFYLRYALQKGFTIDDIYRLTRID
FT                   PWFLDQIEKILFVEKTLIEHKDNLSADLLWRAKREGFSDVQLAHITGKTEEEIRALRYE
FT                   AGLRPVYKLVDTCAAEFKAATPYYYSTYETENEARVSDRKKVVILGGGPNRIGQGIEFD
FT                   YCCVHASFALREEGVESIMVNSNPETVSTDYDTSDKLYFEPLTVEDVLHIIDTEKCDGV
FT                   IVQFGGQTPLNIAEALARAGAPIIGTSPESIRRSEDRKFFAAMLSKLGLLQPPNGTAVN
FT                   VEEAAAIAQNLGYPVIVRPSFVLGGRAMKIVYTPAELANFARHAIKASPKHPILVDKFL
FT                   EDAIELDVDAISDTTGHTVIGGIMEHIEEAGIHSGDSACVLPPHSVKPHVIDEIIRATK
FT                   AMAAELKVVGLMNVQYAVKGDTLYVIEVNPRASRTVPFVSKATGVALAKAATKVMLGRT
FT                   LKELGIVDDAWRTAHIAVKEAVFPFNRFPDVDTLLGPEMKSTGEVMGLDMDFGAAFAKA
FT                   QLGAGQKLPVKGNVFISVQDKDKRATAGIARQLSDAGFEIVATAGTAAFLKEQRIAVRP
FT                   INKVSDGHPHVVDAIVNGEIQLVINTGTGQDSQVKRDGYMIRRTTLRCQVPYATTLPGA
FT                   LAVCRGILQLKKQALGVKSIQEYHQKP"
FT   gene            136082..137485
FT                   /locus_tag="Dole_0122"
FT   CDS_pept        136082..137485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0122"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: sfu:Sfum_0007
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65932"
FT                   /db_xref="GOA:A8ZSL9"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL9"
FT                   /protein_id="ABW65932.1"
FT                   /translation="MNEPERPREACGIFGIHDHEEAARLTYFGLYALQHRGQESGGIAV
FT                   ARDTRIVCHKDMGLVHEVFTPRHMARLSGTSAVGHVRYSTTGDSVLVNAQPFVVTHKKK
FT                   TYALAHNGNLVNAYELKRDLEEEGSILQTTMDSELVVHLFIKNLAHGFEKALEETVLRL
FT                   KGAYSFVMLTGLGELVGIKDPNGFRPLCLGKLNGSYVLASESCALDLVQATFVRELDPG
FT                   EIVIIDDNGIRSFNPHKKSPRAFCIFEFIYFARPDSTFFGKNVYTVRKAHGRQLAREAP
FT                   VKADLVMPFPDSGNYAALGYAEESGIPLEMAMIRNHYVGRTFIQPTQSMRDFGVRVKLN
FT                   PIREVLAGKDIIIIEDSIIRGTTIKTRVKTLRALGVKKIHMRVSGPAHRFPCHYGIDFS
FT                   TRGELIAARMELAELTRYLDLDSLHYLSVPGLLEATCVDRPEEHFCKACFDGCYPVAFD
FT                   DTAAKDCLA"
FT   gene            complement(137939..138916)
FT                   /locus_tag="Dole_0123"
FT   CDS_pept        complement(137939..138916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0123"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: afu:AF1263 iron-sulfur cluster binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65933"
FT                   /db_xref="GOA:A8ZSM0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM0"
FT                   /protein_id="ABW65933.1"
FT                   /translation="MEKRINDVLTLLDNKSYLRTFFFRFFAMTTMDYIKFVYWSAEKSR
FT                   TPVIGRLFKFMSESYYKNVHTSAIKLPLKDIEDVILNCDHVSVGPCPCRIIFDDGTCKA
FT                   PVYTCIKINYFSKMTTKLEKIASHLRKKRGMRVGNKHSKELTKDEALEIVRNSRKHDLI
FT                   FSLESCIQPYQNNICACCTDCCIELNGRYKFGLDVSPKGPYMPVVKKEACKKCMDCVNR
FT                   CPVKAISHQEDTITIDMGLCLGCGICTEKCPHEAMELVVDTEYIPSYVQPGFFKMIYIC
FT                   CLTMTVFFFFIYYKLTRKSINFMYSKAEPRESDLIQADSNIKTN"
FT   gene            complement(139017..139463)
FT                   /locus_tag="Dole_0124"
FT   CDS_pept        complement(139017..139463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0124"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: drm:Dred_0308
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65934"
FT                   /db_xref="GOA:A8ZSM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM1"
FT                   /protein_id="ABW65934.1"
FT                   /translation="MYKTNMKVNNKNFLYKLSCIRKSAFSFLEGEMARVGVTDIPPSYG
FT                   DILYAIYHQKTGYVKEIVGQSHKDKSTVSSIINQLEKKGYVEKFSDPEDGRRVKVRLTK
FT                   QAEQQITVVSEISLKLQDKLFKNMSDEEQEILFLMLNKIEKNLK"
FT   gene            139717..140736
FT                   /locus_tag="Dole_0125"
FT   CDS_pept        139717..140736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0125"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343;
FT                   Methyltransferase type 11; KEGG: pca:Pcar_2700 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65935"
FT                   /db_xref="GOA:A8ZSM2"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM2"
FT                   /protein_id="ABW65935.1"
FT                   /translation="MPRDLRRFELELFTLPSQIDFLREHQPLKSILTELLICPVCLPGE
FT                   HGLKLKSDETVADDIIRGDLTCDCCGRSFPIRDGLADLDPGREARSRTASKYETPLVLS
FT                   SYLWSHFAGILKDSQASGAYVEWAGLMASHDGLALDVGSAVGRFAFEMAQKCDFVIGLD
FT                   NSVTFIRTARELMQQRRKRLCLPDEGHLTLDMDLVLPETWRTSNMEFIVADAQALPFRC
FT                   NQFASVASLNMVDKLPRPLAHLQESNRVAKDHDARFLLSDPFSWSGEVAAEENWLGGLG
FT                   KGPFAGHGLENTMTLLADEKGLLGPRWTIEQQGHVWWKIRTHSNHFELIRSRYVKAVR"
FT   gene            140761..142818
FT                   /locus_tag="Dole_0126"
FT   CDS_pept        140761..142818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0126"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: sat:SYN_01672 molybdopterin dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65936"
FT                   /db_xref="GOA:A8ZSM3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM3"
FT                   /protein_id="ABW65936.1"
FT                   /translation="MKKDTICRLCSACCPVEAHIEKGRLVAAERKSFLPASKARQCPKL
FT                   KAAPDIVYSPDRILKPLIRDASGPSGFREASWDEALDRVAGSLLKCREVAGPERLAWLR
FT                   GMAADWGAPWDYANRLMNAFGAPNTIGNGSVCHVAREMAHNFTYGAMTLAQPKDAACIV
FT                   VWGKNDRNTAPGVFEAICHAQRQGARLIVIDPVKNAMAEMADLWLPVKPAHDGLLAMAM
FT                   IHEIIAQDLYDVDFVSRYTTGFDELAAAARPFSPDKVAEKIWLSPADIRRATRWYAGTP
FT                   PACIIDGNGLDMQLQAFQATRAVCILRALTGNIDRPGGDFIPQPVPVRDMQLKHRLPGG
FT                   VAPVTHDFPLFDQFHPTWGRHAQSCLVDAMVDHRPYPVTTLVVQSGNPAVTMTDANRVV
FT                   RGLKNLDFLVVIDMFMTRTARLADVILPACGCFEKTQLNRAYLRNSPVMLQDQVIECIG
FT                   ESRPDWQITFELGRRLGLADAFPWETVEEAIDYQLEPSGITVAALRQNPDGLRAAPLAF
FT                   EKHHQQGFATPSKKVEFVSDRLREKGFPAVPFADGGLGEAISFADPADPDPLIGMSGER
FT                   TPRFTHTQFHTIASLVRQEPEGLVEIRDADARRKNIGNGDWVRIKTPRGEVRMKARISD
FT                   RIRPGSILIAWGWGDVDPAANVNNLTDDNQRDPVTATPSGRSFMCSLEKE"
FT   gene            143290..143562
FT                   /locus_tag="Dole_0127"
FT   CDS_pept        143290..143562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_3623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65937"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM4"
FT                   /protein_id="ABW65937.1"
FT                   /translation="MNISDVRPGESAINVFFSEDTLSVDLNDGRTITVPLAWFPRLLHA
FT                   TPGQRENWKICGGGFGIHWPDIDEDLSTAGLLRGAPAPKALSNVA"
FT   gene            143604..144326
FT                   /locus_tag="Dole_0128"
FT   CDS_pept        143604..144326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0128"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   sfu:Sfum_1596 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65938"
FT                   /db_xref="GOA:A8ZSM5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM5"
FT                   /protein_id="ABW65938.1"
FT                   /translation="MLKTIPMVAWTVIVITVDTLVMGGAVILLAPFSKTGRLTFFFCRA
FT                   WAWILLKAHFIKVQVDGREHLQANRSYVFMSNHASHLDPPAVVLGLPHTLRFVGKRSLS
FT                   RIPVFGLAARMAKMIFIDRDNSAGSLETLNRSIAELKEGISAYFFAEGTRSEDGSLKAF
FT                   KKGGVMLALKARLPIVPIAITNSHNLLAKHKLRITPGTIRVIISPPMETTGYTEEKKDD
FT                   LLEAVRSAISRHLPQATA"
FT   gene            144424..145266
FT                   /locus_tag="Dole_0129"
FT   CDS_pept        144424..145266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0129"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: aci:ACIAD3032 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65939"
FT                   /db_xref="GOA:A8ZSM6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM6"
FT                   /protein_id="ABW65939.1"
FT                   /translation="MAKLDKTVGFIGGGNMAEAMIGGLLAAGVCEASRVHAADVSRDRL
FT                   AYLKTTFGIHTTGDNCAVVDGCDVLVLAVKPQVMGSVLSTLDAGCGPRLSKKLVITIAA
FT                   GIPVQTIEGMLASAPGLAVVRAMPNTPALVGCGMCGMYANPHVTSADRGHARAILEATG
FT                   RVIEFETEALLDAVTAVSGSGPAYVFYFVEAMVKAGENLGLDTKDAFAMTLQTVKGAVT
FT                   LMEERGESPKELRQKVTSPGGTTEAALRVLREKEFPEIVMTAIEAACQRAGELSRQYV"
FT   gene            145259..145945
FT                   /locus_tag="Dole_0130"
FT   CDS_pept        145259..145945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0130"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: ppd:Ppro_2005 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65940"
FT                   /db_xref="GOA:A8ZSM7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM7"
FT                   /protein_id="ABW65940.1"
FT                   /translation="MFDTPSVSYAVAFGAGLLSFFTPCVLPLIPVYFTLITGLSLENLT
FT                   QAPDAEVRARVIFSTIAYVLGFSAVFILLGASAFFLGSLINQHLGVLRVIGGVVIVVLG
FT                   IHMTGVITIPGLQSEKRVHVRQRSMSLAGAFLVGALFAAGWTPCIGPILGSILIVAGSQ
FT                   ETALRGMLLLSAYSAGLALPFLLLSFFINALISFIRRASRVIKYINIVAGVLLIGIGIV
FT                   LIAGLW"
FT   gene            146077..146526
FT                   /locus_tag="Dole_0131"
FT   CDS_pept        146077..146526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0131"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: pca:Pcar_0427
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65941"
FT                   /db_xref="GOA:A8ZSM8"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM8"
FT                   /protein_id="ABW65941.1"
FT                   /translation="MKGRFQSACLALFIVAGLLIGGAPAIFAADQTRDGIRWFSYDQGL
FT                   ARAKAQQKKVFLHFYTNWCRYCDMMAASTFVDKKVIDTLNQDFVSIRVNSDEVRDVAGK
FT                   YQVRGVPVSFFLEANGGQIGSRPGFLQPDVFLRLLEFVKAEGYKP"
FT   gene            146529..147116
FT                   /locus_tag="Dole_0132"
FT   CDS_pept        146529..147116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0132"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: son:SO_2220 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65942"
FT                   /db_xref="GOA:A8ZSM9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSM9"
FT                   /protein_id="ABW65942.1"
FT                   /translation="MKVDLSILEKVMTSAVGPPAPAFDHQAAAVSLLFFDKEETFILGI
FT                   LKADRGTGYPWSNQVALPGGLIDTSDLSPLHAAKRELEEELCICGDNVTYFGSIGHFQT
FT                   LQNKVIEVFAGVWNQKDALCFDPGEIARVIPIPLSAIVHTHATKGLSGRLPAMHELLYP
FT                   VADVVVWGVTAKILHFTLEQLYPFIRKNDTGL"
FT   gene            complement(147111..147398)
FT                   /locus_tag="Dole_0133"
FT   CDS_pept        complement(147111..147398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65943"
FT                   /db_xref="GOA:A8ZSN0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN0"
FT                   /protein_id="ABW65943.1"
FT                   /translation="MRRTSLLADQEPVISWHDTTAVYGIAAGFALAVMLFAGAGISVAG
FT                   EKAEFSHYVWVAWLLLVLGAVVLMASMLRLGRRLFLAIERYRDKGPGLPL"
FT   gene            complement(147419..147877)
FT                   /locus_tag="Dole_0134"
FT   CDS_pept        complement(147419..147877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0134"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pca:Pcar_2325 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65944"
FT                   /db_xref="GOA:A8ZSN1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN1"
FT                   /protein_id="ABW65944.1"
FT                   /translation="MIRKAKIKDIPQIYRLLSDFARQGSLLSRPLSKLYDDIRDFSVFV
FT                   DPSSDETVIGCCALPVCWADLAEIRSLAVRQDHWGKNIGTQLVENAFDEARVFDIQQVF
FT                   ALTYVPAFFEKFGFSRIDRADLPLKIWADCITCVKFPDCDEIAMMKIL"
FT   gene            complement(148111..150051)
FT                   /locus_tag="Dole_0135"
FT   CDS_pept        complement(148111..150051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0135"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: sat:SYN_00304 multimodular
FT                   transpeptidase-transglycosylase; TIGRFAM:
FT                   penicillin-binding protein, 1A family; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65945"
FT                   /db_xref="GOA:A8ZSN2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN2"
FT                   /protein_id="ABW65945.1"
FT                   /translation="MLKSRWPLLLVLVAGVLAGTAGGVFFAVVHDLPQIQALEDFSPSA
FT                   ITRVYSAEGGLIAELFAEKRDPVAFEQVPPWIIAALVATEDNAFFRHRGLDLKGIARAV
FT                   IKDILTLDFRQGGSTLTQQLAKTLFLTSEKSLMRKLKEAVLAFQLERRYTKNEILELYL
FT                   NQVYFGSGAYGIKSAARIFFNKPVEALSLAECALIAGMPKAPSRYSPLVNPDLALWRRN
FT                   IVLGQMKKNGQISEAEYHQAAGEPLVPATITPPVARPDYFIEYIRGDLENAVGVQQLYR
FT                   AGLSVHTTLSLPLQAAAREAVAMGIKALEERMAEKGLTEPPQAALVAMDVATGGVLAMV
FT                   GGRDFQASPFNRAVSARRQPGSAFKPILYACALDHGFTQATTVLNTPAVFPGAKKDDTW
FT                   QPENFSKDYSSEMTVREALVHSKNIPAVRVIHQLGPAPVAGFAAKLGISSPLSPYLSLA
FT                   LGTSEVSLMELTAAYAVFPRLGKRIQPYGVTRVIDAHNRVLWQASPLSQIVMPAENAAI
FT                   VADMLRGVVLDGTGRAARNLPCPVAGKTGTTDTYKDALFVGFSQDIAAGVWVGTDRHTT
FT                   LGAGETGAQAALPIWKQFMEKTFDTRPCQGFDVPDGMVRVRVNPMTGKRAGVNEEGQTM
FT                   LFTPGTEPLQP"
FT   gene            150159..150455
FT                   /locus_tag="Dole_0136"
FT   CDS_pept        150159..150455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD0736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65946"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN3"
FT                   /protein_id="ABW65946.1"
FT                   /translation="MSHHHDSHDHSHGHDHGHHHDHHHTHAGGGEMSTKEKLVKLFDYW
FT                   LRHNESHGDTYTQWIDQAEQEGLSDTAAILKEIADLTRQITAKFQAGAATLKK"
FT   gene            150540..151301
FT                   /locus_tag="Dole_0137"
FT   CDS_pept        150540..151301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0137"
FT                   /product="ATP-grasp domain protein"
FT                   /note="PFAM: ATP-grasp domain protein; KEGG: pho:PH1788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65947"
FT                   /db_xref="GOA:A8ZSN4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN4"
FT                   /protein_id="ABW65947.1"
FT                   /translation="MPGAVVNHHQCRAVFYQEMQMKQKEEAEKILQAAVAQGRLALSEY
FT                   EAKQVLAAYGVPVTREVLAKTPDEAVAAAGELGYPVVLKACSPSLMHKSDTGLVELGLA
FT                   DEKAVRSAFDRISSRLTSEADGMLVSEMVSGKRELVVGMNRDPQFGPCVMLGLGGVMTE
FT                   IFKDAVFRMAPVDPIEVAEMAGSLKAAKLLDAFRGEAPADRDALYRCVIGAGRIGLDWD
FT                   AVSEIDINPVLVSADGRVKAVDALIVLNPDV"
FT   gene            151327..152805
FT                   /locus_tag="Dole_0138"
FT   CDS_pept        151327..152805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0138"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: pfu:PF0532
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65948"
FT                   /db_xref="GOA:A8ZSN5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN5"
FT                   /protein_id="ABW65948.1"
FT                   /translation="MTDPIEAHRLYGMTHPKSVAIFGASNNHSSMGTIILRAMMAFDFP
FT                   GKIYPVHLKEKEVQGLTAFDSVESLPEAPDLAVIVLPTRIVCETMEACGKKGIRNAIVV
FT                   SGGFKEVGPEGAEREKELAAIAGKYGISIIGPNCLGVTNAHARLNTTPHRYYGKPGFIG
FT                   LVSQSGSFVTQMFAYLDQLHLGFSTAFSIGNEVNTDLVDCLEFLGACPDTKVIALYVEA
FT                   IRRGRKFVETARKIVPHKPIVALYVGGSETGRKAALSHTGSMSGPDDLYSGIFRQSGVI
FT                   RVSSITELFDCCMAFGHLPQPAANRVFIQTHSGGPGAVAADACGRSGLVLPEPSAKTAE
FT                   KLKALVPATGSVKNPIDLTFTKDMTQFFADIPGVLLEDPGCDALMFYYYTPADMIKRVL
FT                   LQMGVPAAELDAKMDEVSQHISAQMQGLIKRSGKPVFCFSYQGRSETAVQSLSALGVPF
FT                   YQGPERAVRALAAMVAYGTLKEKIVRQSGIDPSA"
FT   gene            152951..153283
FT                   /locus_tag="Dole_0139"
FT   CDS_pept        152951..153283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0139"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: mms:mma_0858
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65949"
FT                   /db_xref="GOA:A8ZSN6"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN6"
FT                   /protein_id="ABW65949.1"
FT                   /translation="MDIDSLAASQGFTTEEFLEIVDVFIDVSRSDVVRMTEAIENQDAA
FT                   TAGDAAHSLKGAAGNLGFFDLFDAAKKAETQAKSNDLGQARETLSHVRDMVEAIARDVR
FT                   HKDAAP"
FT   gene            153335..154450
FT                   /locus_tag="Dole_0140"
FT   CDS_pept        153335..154450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0140"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: aba:Acid345_2946 response regulator
FT                   receiver modulated serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65950"
FT                   /db_xref="GOA:A8ZSN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN7"
FT                   /protein_id="ABW65950.1"
FT                   /translation="MQQLFTILVVDDNLLNLKLLSTTLENHGYKTITAVDGPTARQLAQ
FT                   TEKPDIILLDVKMPGEDGFEVIRQLKNDPATGGIPVLFLSGVIELESKLTGFELGAVDY
FT                   ITKPFHPLEVLARVRLHLKLSIATSSLISNQADKLRQITEAQTAMLTTPDNQPGAGFGV
FT                   YYCALEEAGGDFYDVLPISDDIYGYFVADFSGHDIKTSYLISSVKALLKQNCTPIYRPS
FT                   ESMKLINDVLVKILPEDKFLTSCYACLNRKTKNLTIISAGHPPVVYLPAKGEPSFIHLQ
FT                   GDVMGSFEDVSFGREAMKVKPGDRFYIYSDGLIESVQQKISWPEGSEKLLAACAAVADQ
FT                   PITSAPQRIAEKLKPESVAIEDDVIVLGIQV"
FT   gene            154594..155076
FT                   /locus_tag="Dole_0141"
FT   CDS_pept        154594..155076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0141"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: aba:Acid345_2515 putative anti-sigma
FT                   regulatory factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65951"
FT                   /db_xref="GOA:A8ZSN8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN8"
FT                   /protein_id="ABW65951.1"
FT                   /translation="MSEAKPLSVVHESRRLRIRFFSDMDAINRAEAETRIFLDRQGLSG
FT                   EAFSVCLVMREALTNAVKHGNRCDAQKRVRYVLGFENGLLTMEVEDEGDGFDWRTALDR
FT                   TPSPEAEHGRGIIIMQRYASECRYNEKGNRLTLVKRCNAASSPPADDAGNTADVSP"
FT   gene            155249..156262
FT                   /locus_tag="Dole_0142"
FT   CDS_pept        155249..156262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0142"
FT                   /product="Protein of unknown function DUF933"
FT                   /note="PFAM: Protein of unknown function DUF933; KEGG:
FT                   sfu:Sfum_4023 protein of unknown function DUF933"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65952"
FT                   /db_xref="GOA:A8ZSN9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN9"
FT                   /protein_id="ABW65952.1"
FT                   /translation="MKLGLIGKPGAGKKTLFEALTKSDPDSGHKGDLRIAAIYVPDPRV
FT                   DVLSAMYSPRKTIYAQIEYCLGRTAGDKDLQLKAVADCDALIQVVRNFPVPGMPDPSPY
FT                   KDIAAMDEDLMLSDFVVIEKRLERIAADAKRGKKADAQEMALLDQVKQMIENGTPVRTQ
FT                   PEIATAPLLRGFSLLSAKPVLVLINNDEDDTALPAGPPPGGIDLMVVRGKLEHEISRMS
FT                   DDEAAEFLKEFGIDEPAIHRALRRSYAMLGLISFFTVGEDEVRAWTIKKGALAPEAAGT
FT                   IHSDMQKGFIRAEVVAYDALMAAGSYAEARKQGTVRLEGKTYEMADGDIVNIRFNV"
FT   gene            156282..157124
FT                   /locus_tag="Dole_0143"
FT   CDS_pept        156282..157124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0143"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sfu:Sfum_2096
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65953"
FT                   /db_xref="GOA:A8ZSP0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP0"
FT                   /protein_id="ABW65953.1"
FT                   /translation="MIIDAHTHIFPDAVRSDRNPFFDSEGAFKLLYESDKSQLAGAGDL
FT                   VDCLDREGLDMAVTFGFPWQNPDLIRAHNDYIIESQQRYPTRLAGLCCVDIYTPAAPLE
FT                   VERCLDAGLYGVGELACYLSGIDDEALKHLAPIMELCRSRNKPVLIHTNEPVGHVYPGK
FT                   TPISALQMYNLAKTFPENRIVLAHWGGGIFFFNLLKREAKGVLKNLWFDTAASPYLYDP
FT                   AVYAIACQLAGNNRVMFGSDFPLLPPSRYFKEIDAAGLDSVAKAALLGGTAAALFGLS"
FT   gene            complement(157358..158896)
FT                   /locus_tag="Dole_0144"
FT   CDS_pept        complement(157358..158896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF1134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65954"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP1"
FT                   /protein_id="ABW65954.1"
FT                   /translation="MKIPIRFQSTRRSGQPFYRHHFILFLLAAVIMTLAPPAGHAANIP
FT                   LNPGGIYSARADDGSKIYLYRYAPYTTGKPQFRTGGTPVLIFTGICMNMNQYLSCTPPG
FT                   MEDVYDDVYVPPVSSAPAWALNADKTDYDPYIKADRMRYYSLAHFLWLQGFDAWFANYR
FT                   GAGHDPVASDGTNPNGITTLDTWATQDVPAAIARVKAITGKRMFIGGHSTGGLVSYEYL
FT                   QGAYMDYGRWSWWKEAYYKTCYAFGYMPHVKSSATLAATRNADVKGFIGLDPAGVPWLP
FT                   ADVLDRPLFWGLVGSRLYLPLDAMSEYLIQLLPDKTLLVGVMDTFLGLINDFAGSDGAL
FT                   GELLAYLNFWKVDDMDPCMEDWMLRYSIGGATIRGFGQYMDMGLHYTLREHYKNGAENY
FT                   LTTFEGPTPDPVRDGYYYYDANVSRMTVPLIVFSSSTGALVAPEETDLFIISKKTPTAY
FT                   DKWYVVNGTAHVDVAMGNRLPTAVFPNLSNWLKAVDALPANPPNTDTPASRNDI"
FT   gene            complement(159138..159731)
FT                   /locus_tag="Dole_0145"
FT   CDS_pept        complement(159138..159731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65955"
FT                   /db_xref="GOA:A8ZSP2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP2"
FT                   /protein_id="ABW65955.1"
FT                   /translation="MMIAWINFFSLIFVSLIFMVLYVRSVSPAAQEKIIGPGAYRRCYH
FT                   LRVAASVAELLVVACFAIYCFFPLPTPLPDRFPWPWWFSVVVAGIIGVPALALMLIGLR
FT                   DAGEEALRPKKEQALFKGIYRRLRHPQAAGEVWLFPVIAILLHSPFLALFSLVFFPIFL
FT                   VLCYAEEQDLLLRHGETYAEYCRNTGAFWPRRHR"
FT   gene            complement(159793..160650)
FT                   /locus_tag="Dole_0146"
FT   CDS_pept        complement(159793..160650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65956"
FT                   /db_xref="GOA:A8ZSP3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP3"
FT                   /protein_id="ABW65956.1"
FT                   /translation="MQEFNLDKKFKRLMKGCLVVFVAFLFLGLALPFFPGDGKGSTEGA
FT                   LILSIICTIVFGFFTILIWRTLKKLPCVDIIVDNDGLWYKHKQKKDGLVPWKKIGKIKE
FT                   RLYLQCLDILDSDGRKLIRIEYQLNNFEVLRNILNDKLSDWLPKSQQSSFSKNVLYHFF
FT                   YGACIIGFSWLGLYVGRHSNPWFGYIGMGILVIIILYEYLATAYRLDLIDNGLLIVYPT
FT                   SKKTIAYSDISSIKMADTFQKGARFPEVWVTVKNGSKPYKLKQLGVDANSLFITLKKAK
FT                   ELKA"
FT   gene            complement(160632..161135)
FT                   /locus_tag="Dole_0147"
FT   CDS_pept        complement(160632..161135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65957"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP4"
FT                   /protein_id="ABW65957.1"
FT                   /translation="MFRGACIRRWQDVRRTAYAEYDHRPNDKIPQLCFLALCVFVVCLF
FT                   CCDLRICCLEAAKRIVSGSRLINEWCDNYYDFCNGAARAQRDVKIAGSLLFWPDRVVGL
FT                   NRANHQMTLHDSQHETRDKLLVFINENTADGQFPYRPHTVNDSRGASRLCYQAAFKIQC
FT                   KNLI"
FT   gene            complement(161253..162740)
FT                   /locus_tag="Dole_0148"
FT   CDS_pept        complement(161253..162740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0148"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   gur:Gura_4178 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65958"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP5"
FT                   /protein_id="ABW65958.1"
FT                   /translation="MPKKTMKPYWMAGLLMAGLFAVLLGMRFGLFSGLMNPSLPGAAHL
FT                   ADQVLPEQDTWMSILQNDKKIGYSHSRLFKTADGYAVAETVFLNITAMGMRHAVKLNTS
FT                   AVLHPDLTVDTFSFKMDSGRLSFSAQGRVADGRAVVNTTADGKTQSFEIPLQEAPYLPS
FT                   GVLHAVTNSSMAPGESMTFSMFDPSIMATTPVTVTVVGKETITVLGVDRITTKIHMRMK
FT                   QAEQFAWLSEDGEVVKESGLMGLTLVKAEKYDAIAGLSEDAADLVELVAVDAGVRFDNP
FT                   SALKWLAVEISGIDINPDRLSSVRQSFDEQVLTITKESLYGRGDRVPAGRLAPFLLADP
FT                   FVQSDDPAIRELAARITKDHSEPVKKAQALIDWVYTEIEKRPVVSLPNALSTLRTRQGD
FT                   CNEHAVLLAALARAAGIPAGIETGLVYLDGKFFYHAWNSLYVGKWITADATFGQFPADV
FT                   THIRLAGGTGEGLLDLMGIIGKIQLKVVAFEPAGSQQ"
FT   gene            complement(162933..164750)
FT                   /locus_tag="Dole_0149"
FT   CDS_pept        complement(162933..164750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0149"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation; KEGG:
FT                   gsu:GSU2001 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65959"
FT                   /db_xref="GOA:A8ZSP6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP6"
FT                   /protein_id="ABW65959.1"
FT                   /translation="MAVIRILPEHLSNKIAAGEVVERPASVVKELVENAIDAGASAIFV
FT                   EIQNGGRSLVRVTDNGAGMGKDDALLCLERYATSKIADEKSLFAISTLGFRGEAIPSIA
FT                   SVSEFVLTTRPADADAGTRIRVSGGTITDVADTGAPPGTTVEVGRLFFNTPARRKFLKA
FT                   VATETGHIADTLAAFALCRPDIHFKLVQDGRTVKNWPRTADPLERITDVLGSQTRGHMA
FT                   PISCADDTVTISGWTSSPAVTRSTSQKIHLFVNGRIVKDRGLQYALFEGYRGRLVKGAF
FT                   PVAAIFINIPFDRVDVNVHPTKNEVRFADQRRVYQALKTAVAGAWAINAAPPWSDGQKP
FT                   SRPAPAFSLPGVRPAPKVSESVFQYATPLPLPSFANAGDEPPAPARPRLSGDAEPRPLE
FT                   TPVSSDGHQSFFRFSDLAVVGQVFNTYIVCQADAQVVLIDQHAAHERILFEALKQRGQN
FT                   RPLPGQNLLVPETVELTHKSAAAIEPLLDAFAAMGLEIEPFGPTAFVIKAVPAVLADTA
FT                   VGPMVAEIAEKQADTGFAPDPDTLTNDVLHVMACHAAIRAHQRLSEAEIKALLARLDGC
FT                   DNPRHCPHGRPTAIFWSTSEIEKAFKRIV"
FT   gene            complement(164810..164998)
FT                   /locus_tag="Dole_0150"
FT   CDS_pept        complement(164810..164998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65960"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP7"
FT                   /protein_id="ABW65960.1"
FT                   /translation="MTTVMPEGDRIKKAVAWVDEQRREHPEKPPLAIAGEATLMFDLSP
FT                   LEADFLEKFACGKAGGC"
FT   gene            complement(165014..166474)
FT                   /locus_tag="Dole_0151"
FT   CDS_pept        complement(165014..166474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0151"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: sat:SYN_00308 aspartyl/glutamyl-tRNA(asn/Gln)
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65961"
FT                   /db_xref="GOA:A8ZSP8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZSP8"
FT                   /protein_id="ABW65961.1"
FT                   /translation="MEPYALTIHEARQLLDKKEISSVELTRSVFDRIERVEPKVGAYIT
FT                   LARESALSAAAAADTRLQSGGIAPLTGIPLAVKDLICTTGLRTTCASRMLETFMPPYDA
FT                   TVIEKLKTQGAVITGKVNMDEFAMGSSTEHSALGSTKNPWNLACIPGGSSGGSAASVAA
FT                   DMCLGSLGSDTGGSIRQPASHCGVVGIKPTYGRVSRYGLVAFASSLDQIGVLAKDVTDS
FT                   ALLLSAISGHDPSDSTSVPREVPDYAASCEKGLSGLTIGVCREYINAEGLDPEVADTVN
FT                   RSIEHMKAQGAACVEVSLPHAQYAVAAYYVIAPAEASSNLARYDGVKYGFRDPEADSLL
FT                   EMYARTRSRGFGKEVQRRIIIGTYCLSSGYYDAYYRKASQVRSLIADDFKKAFETCDVI
FT                   VSPVAPTPAFELGAKTEDPLTMYLSDIFTLSANLAGVPGMSVPGGFSSTGLPIGVQLIA
FT                   GHFNEPALVRCAWNLEQAVNIANKKPAL"
FT   gene            complement(166507..166794)
FT                   /locus_tag="Dole_0152"
FT   CDS_pept        complement(166507..166794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0152"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: tte:TTE0606 Asp-tRNAAsn/Glu-tRNAGln amidotransferase
FT                   C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65962"
FT                   /db_xref="GOA:A8ZSP9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZSP9"
FT                   /protein_id="ABW65962.1"
FT                   /translation="MKITPDDIRHVAKLARLDIAETDINAFVSQIGEILDYVDTLNQVA
FT                   TENVEPMAHAISLTNAFREDTVREAGPVEKILNNAPAAADNMFCVPKIIE"
FT   gene            166953..168641
FT                   /locus_tag="Dole_0153"
FT   CDS_pept        166953..168641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH217 ABC-2 type transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65963"
FT                   /db_xref="GOA:A8ZSQ0"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ0"
FT                   /protein_id="ABW65963.1"
FT                   /translation="MLKTIKTLLAPRILSFKNRIFLSGKTRVAVFGAVGLVLWAGVFAG
FT                   AFRVLTYFESIEDLGDILANKLLSMLFVVMLSLLVFSSIITTLSKLYLSRDLDLVHSLP
FT                   VAARHLFFARWIESTADSSWMVVLFVLPVFLAHGIVYSAGPLFYLAVVLFLLMLCVTSS
FT                   AISATGIAFVVNLISASRLKTIFVFLGLLLFVLLYVAFRMMRPERLVDPEMFATTLVYL
FT                   RSLNAPAPAWLPSTWAYDGVTAALSGNTGALLFNLLLSGACAGSLVVFMLIVAEAVYFS
FT                   GFSRSSSGWADPVTPEDTARRIYRDRSWPAFLPAPARAFFVKEVRTFVRDQSQWSQLFL
FT                   IAALVVIYIYNFKVLPLETSPMPVVWVQNIFAFLNMGLAAFVLTAVTARFAFPAVSMEK
FT                   SAFWIVQCAPVSIRTFLRIKFFVYLVPLFVLTMTLIVVTNLLLNVAGEMMVLSLVTVSL
FT                   MVPAIVAMGVGIGAVYPDFSSENPAQAVSSFGGFVFMATSALYVIAVIVLEAGPASRLV
FT                   FAGLRGRSLSPESWAWIIGSFTTVVALSVLAVVVPLRLGERRLQG"
FT   gene            complement(168653..169213)
FT                   /locus_tag="Dole_0154"
FT   CDS_pept        complement(168653..169213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2341 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65964"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ1"
FT                   /protein_id="ABW65964.1"
FT                   /translation="MTSKTDPPREPSDELELDFSIADLSDAADMAEMEPPRPKPTAKAS
FT                   DNAVNRFIQTDRHGRDRRRWKRFTIEGAIVMIPQTAFWRMGKTSYIKLGPVKNISMKGL
FT                   AIHYVEKNQKLLGKAATLSIMFPGEGIIVDKIPFRIVGNVKVADLPDDKEVRNLCVAFE
FT                   RLLPMQKMQMEMFIDTYGNELGD"
FT   gene            complement(169341..169433)
FT                   /locus_tag="Dole_R0002"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(169341..169433)
FT                   /locus_tag="Dole_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(169445..169530)
FT                   /locus_tag="Dole_R0003"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(169445..169530)
FT                   /locus_tag="Dole_R0003"
FT                   /product="tRNA-Ser"
FT   gene            169729..172134
FT                   /locus_tag="Dole_0155"
FT   CDS_pept        169729..172134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0155"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   chy:CHY_1609 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA
FT                   hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65965"
FT                   /db_xref="GOA:A8ZSQ2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ2"
FT                   /protein_id="ABW65965.1"
FT                   /translation="MSRKIKKAAVIGSGVMGGGIAALLASAGVETLLLDIVPFDLTDEQ
FT                   KKDPAARNRIVKFGYDTIMMSRPAALMHSSDAALISIGNLEDDFDKLADCDWIVEVVVE
FT                   NLKIKQQLFKRIEPVRKKGSIISSNTSGIPLKAMSEGLSSDFKQHFLGTHFFNPVRYMH
FT                   LLEIIKGEETSEEVLRFMAAFGEKRLGKGIVWAKDTPNFIGNRIGVQGIVKAMQLMLEM
FT                   GLTISEADALFGPVMGRPKTAMFKTTDLVGLDTMSHVAKNTYDLVTDDEARDDFLTPDF
FT                   VSTMIEKKLLGNKTKAGFYKTDRSPEGKKLRLVINPATLEYESAGDVDFPCIADAKSKK
FT                   TLPEKMKAIVYGEDKGAAYAWKVVASGLIYAANRVPEISDTIVEIDNAMKWGYNFEMGP
FT                   FETWDAIGVAESVAKMEKDGLAVPEKVKKMLADGNQTFYKIEKGQTLFYDFASGSYKAV
FT                   PVSDVAVSLAILKGEGREVKSCKSASLIDLGDGVFCCEFHTKMNALNTELIAFMHEAMD
FT                   YVDANGAGMVLGNQAGGMPGAFSAGADLKEILTAVGNKEFDGIDTMIDSLQQAVQRERY
FT                   SHFPVVAAPYGMALGGGCEVCLGADRIVAHAELYMGLVEIGVGVLPAGTGCMNLWKKMT
FT                   SGIPAPVTDADLAKFFIPTFMAIAMAKVSMSAAEARANGFLGPNDRIVFNRDNLIGEAK
FT                   KEVLRMIDDGYAPPAKKPLKVLGEAAWGMVNAEIFNMQNGGYVSEYDAYLAKNIAYVIA
FT                   GGDARTNSELDEQAILNLERSMFIEFLKQEKTMARIEHMLKTGKPLRN"
FT   gene            172147..173331
FT                   /locus_tag="Dole_0156"
FT   CDS_pept        172147..173331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0156"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: chy:CHY_1608 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65966"
FT                   /db_xref="GOA:A8ZSQ3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ3"
FT                   /protein_id="ABW65966.1"
FT                   /translation="MRDAYIVTSVRTPGCKNRRGALKDTRPEDLISFIINAAMEKTAGL
FT                   EKKDVDDLMLGCSFPEAEQGLNIGRIAVQMAGFPDQVSGATVNRFCSSGLEAIALASLR
FT                   VMSGWSDVTLGGGVESMTYVPMGGNLPRPHPEWSRERADYYVSMGITAENVANRYKISR
FT                   EDQDAFAYQSQMKASKAKAEKQYTEIVPTPATKFVKQADGTVKKETFLQDFDDGIREAT
FT                   TVEGLAKLRPVFAAGGSVTAGNSSQTTDGAAVSVIMSENKVKELGLKPIAKLKIYTTVG
FT                   CRSDEMGVGPRYAIPKLLDKAGLKVEDIGLWEINEAFASQALYSIRELGIDKYMDRVNI
FT                   HGGAIALGHPLGCTGAKLCATLLANMQARGVKYGVESMCIGGGMGAAGLFELCD"
FT   gene            173580..174560
FT                   /locus_tag="Dole_0157"
FT   CDS_pept        173580..174560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0157"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: sfu:Sfum_2408 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65967"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ4"
FT                   /protein_id="ABW65967.1"
FT                   /translation="MAHQKVLLTGPTGFIGKRLLYQLDERGYQVRCLVRAGETLDLNLP
FT                   LRQEPEIVYADLLDPDSLPTALDGMDTAYYLVHSMGGRSIRQTRAFVEKDRTVARNFRE
FT                   AADRAGLSRIIYLGGLGDAGDRLSHHLASRHEVARILQAGKVKTTVLRAAVIIGAGGAS
FT                   FEIIRYLVERLPVLLGPRWVYTKSQPIAVENVLAYLCGCLETPETAGRTFDIGGPQILS
FT                   YADLMGMYARVRGLSRTIIGVPLVPIRLSAYWVHFITPVPVGVVLPLAEGLRNRAICRE
FT                   NSIRDLIPIHLTPMETAICNALAEETEGPGKLLSQQACFLPGDLA"
FT   gene            174557..175009
FT                   /locus_tag="Dole_0158"
FT   CDS_pept        174557..175009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65968"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ5"
FT                   /protein_id="ABW65968.1"
FT                   /translation="MIIKAVVQINAPRQRVWDVFADIQNWKAWNPVCRECRFEAGNALV
FT                   KGACISFELNPLILPLRIAPKVTHCKPGEKVVWEGFRLGIHAVHEFYFAEKNGGVELTS
FT                   IENFSGPLLIVARMIGVPSRLHALTTQLLEAIRQAAESSGAEAHPS"
FT   gene            175179..175652
FT                   /locus_tag="Dole_0159"
FT   CDS_pept        175179..175652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0159"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sat:SYN_03717
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65969"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ6"
FT                   /protein_id="ABW65969.1"
FT                   /translation="MAKKILIAMDESENSKRAVEFVGGNFDTRSSVTLFSVLQNTETMC
FT                   AMQAPELTPYFVAQQTSFCTLEDKKKELVAEAMEKAKKVLVKKGFAANRVDVKLVKRKK
FT                   GVARVIISEARTGKYDLVVMGKKGLSGVREFLFGSITQKVLHGVKNASVLLVD"
FT   gene            175844..176248
FT                   /locus_tag="Dole_0160"
FT   CDS_pept        175844..176248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0160"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: nca:Noca_2967 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65970"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ7"
FT                   /protein_id="ABW65970.1"
FT                   /translation="MKIMVCYDGGDGSQWALTLAIQHAKVFDAELYLVASLEKGTDAEQ
FT                   PLIDHLESELAKAKEKLEEQGFACTTHLLVRGLTPGEDMVAYARENNIDEIVIGIRRKS
FT                   KVGKLIFGSTAQYLILKAPCPVLTINHRPS"
FT   gene            complement(176276..177982)
FT                   /locus_tag="Dole_0161"
FT   CDS_pept        complement(176276..177982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0161"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: sat:SYN_01216
FT                   potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65971"
FT                   /db_xref="GOA:A8ZSQ8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ8"
FT                   /protein_id="ABW65971.1"
FT                   /translation="MKTMATQLSLLLQADRRRGNIRLLVKFCLMLACFFVLYSVLFHVL
FT                   MVYEGRSYSWITGFYWTLTTMSTLGFGDITFTSDIGKVFSVVVLLSGIIFLLVMLPFTF
FT                   IQFFYAPWLEEQNKARTPRAVAEALSGHVIFTHYDDITIHLIRKLEQHHIRYVLLVADL
FT                   QAALNLHDQGYHVVVGDLDDPDTYPRLNVDRAALVVVLNDDVVSTNIIYTIREISPDVI
FT                   TVTNADREESLDILKLAGSTHVLQMTRMLGQALARRVYGVSMTANVIGRFDELLIAEAS
FT                   AMRTWLQGKTLAESRLRQVAGVTVVGIWEQGRFIMPGPHSRIGESTVLVLAGTEEQLNL
FT                   FDRSIAGKMADSHQKGPVLVIGGGRVGTAVADTLKGREVEFRVVEKRSDIASRHAHYIE
FT                   GSAAEREVLDRAGLQETPAVIITTHDDNLNIYLTIYIRRLRPDVQIISRSSLDRNITTL
FT                   HRAGANLVLSYSSLLNSTILNLLQPQKMLMLSEGLNMFRAALNEKMVSQALADLSIREQ
FT                   TGCSVMAVKRAGELIVNPDPAIVLEAGDELLLIGLTEAEKTFMERYPPDKK"
FT   gene            178152..179702
FT                   /locus_tag="Dole_0162"
FT   CDS_pept        178152..179702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0162"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: pfu:PF1838
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65972"
FT                   /db_xref="GOA:A8ZSQ9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ9"
FT                   /protein_id="ABW65972.1"
FT                   /translation="MRTGKTDKKVWVMNERVEKMEKIFSPRSVALIGASNNVAKWGGIV
FT                   AINLILGGFKGKLYPVNPKEASVHGVPAFASVKDIQDEIDLAVIIVPAAGVPDIISDCV
FT                   DKGIGAAVVITSGFGELGEEGKGLQNEMLRRARAGGMVLVGPNGQGIAAPESKFYPWFP
FT                   TFRPDPGVIGIASQSGGISTELSEQLAEFGFGCSKVISTGNCADLSWPDYLAYFRQDPS
FT                   TKVVLLYMEGAQDGRAFFREAKKTALEKPVILIKSGRTQEGGRAASSHTGSMAGSDAVF
FT                   DGVCKQAGLIRAKTLEEAVVLAAAFVTTPLPRGRRVCVLTGGGGQGVLTADALAARGLT
FT                   LPPLSEATVKKLREQLPAWWHPNNPVDMVAGLGYGGPTEIIPILMESDDFDGIIFNGIG
FT                   WIYSMVDPVNNPQETNMVRKGAQRVIDKEVELSHVLAEYSGKWGLPLLICSKVARLAIR
FT                   REYEAILNLLQKDIMLYPTAHDVVNVFSALADRYEFLKREGALRANGEHSRPLVETAE"
FT   gene            179699..181978
FT                   /locus_tag="Dole_0163"
FT   CDS_pept        179699..181978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0163"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: sfu:Sfum_1838
FT                   RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65973"
FT                   /db_xref="GOA:A8ZSR0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR0"
FT                   /protein_id="ABW65973.1"
FT                   /translation="MIPATATALGISEKQVQAVAALLEDGATIPFIARYRKEATGSLDE
FT                   VAVARIRDTLHQLKELDDRRQAVLASLEKNGHLTDELKQRVLAADTLTVLEDIYLPFRP
FT                   KRRTRAVMAREKGLEPLALVLLEQKGTDPQAEALPFVDPEKGVASVDEALAGARDIIAE
FT                   MTSEDEAARSALRDLFFTKGMVSCRVVMGMEEAGAKFRDYFDWKEPVATVPSHRMLAMR
FT                   RGEKEGFLVLAIAPEEPDAIAILERLFVKGDTEDAVQVALAVKDSYKRLLSLSMETETR
FT                   LAAKKKADAEAIRIFAENLRQLLLAPPLGAKRVMGIDPGFRTGCKVVCLDRQGKLLCWD
FT                   TVYPHFSEGREQAAADRIKSLCDQFEVEAIAVGNGTAGRETEAFVKAVAFSRPVQVVMV
FT                   NESGASIYSASEVAREEFPDHDLTVRGSVSIARRLMDPLAELVKSDPKSIGVGQYQHDV
FT                   SPAELKQSLDDVVVSCVNRVGVDLNRASAQLLTYVSGLNAGIAKNILVYREANGPFASR
FT                   EALKAVPRFGPKTFEQSAGFLRIPDAANPLDASAVHPESYAIVEAMAKDLGKQVADIMH
FT                   QTDLRKQVDLSAYVTGTVGLPTLTDILDELAKPGRDPRQAFESVSFIEGINTIDDVQPG
FT                   MKLPGIVTNITAFGAFVDIGVHQDGLVHISQMADRFVKSPADIVKVQQRVMVTVLEVDK
FT                   ERKRISLSMKAERPAPTAAREETAGPSPRPDTPGKAKGKKPEKKEKRNIPANSALAEAL
FT                   RKSGLT"
FT   gene            182182..184158
FT                   /locus_tag="Dole_0164"
FT   CDS_pept        182182..184158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0164"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vfi:VF2264 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65974"
FT                   /db_xref="GOA:A8ZSR1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR1"
FT                   /protein_id="ABW65974.1"
FT                   /translation="MTNIDYFNLPWKDQWEWERVNLPTLTRKFLENAKKHANKDFQRFN
FT                   AALYNGDSNGKMTWAETAARVENYACGLMSLGLGKQEMVGLMSASGPYWTHADLALACA
FT                   NGVSVAIYPTLSFKEASYVVNDSGSKFLFLRGDTILEMMLNGFDHMPGLEKIIVMDREY
FT                   KSSDARVISMGDLEKAGIEWKKDSNHFDAYVARRDGVSLDDIYTILYTSGTTGRGKGVV
FT                   LTHHNCSARMNGVNEFFDYCGMGFKTEYTTLCFLPLAHIFDRGSCQGVAIFNGCTIAYA
FT                   DAPGTLLEDLQKYNPHWINCVPRLYEKIYIQLQEKMGQSGPKRKLFNWALKVGEAVFMQ
FT                   RYDAETGTYNMGHDFDITGNLSFGMRIKYKIADKLFSKVRALFGKNFKHSFSASASISP
FT                   ELLKFFYIIGIRVSEGYGSTESFNACSNMPLVACKPGSIGLESNGSRLRVSGIGELEIS
FT                   GAGIFKRYWNKPQETAESFTADGWFKTGDKVEVDRFGYYKIVDRIKNIICLSNGKNIAP
FT                   AKIEALFTTSPYIEQLFVVGDERAVISTLLVPSLTYFKDRFDKEGVEYDNSQVVIDTSA
FT                   GTPIVVKVGPDFIEKGNIKGLIAEEVARANKELEGFEKIKQYTILRERFTEQNGMLTPT
FT                   QKTKKRVILDTYAAEIEKMYARK"
FT   gene            184295..184627
FT                   /locus_tag="Dole_0165"
FT   CDS_pept        184295..184627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0165"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: mag:amb1332
FT                   regulator of competence-specific gene"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65975"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR2"
FT                   /protein_id="ABW65975.1"
FT                   /translation="MPVSNEFLIFVLDQLAEWGGVTARKMFGGAGLYRDGRMFGLIAGD
FT                   VVYLKVDDSNREAFVRAGSSAFKPFADKPVSLSYYEVPPDVLEVPEELIDWAARSLAVQ
FT                   SRKKKK"
FT   gene            184693..186132
FT                   /locus_tag="Dole_0166"
FT   CDS_pept        184693..186132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0166"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: maq:Maqu_2108 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65976"
FT                   /db_xref="GOA:A8ZSR3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR3"
FT                   /protein_id="ABW65976.1"
FT                   /translation="MNEFKVNTVCEDALGDSDATALAGRLEKGEITPTDLVEAAINRAK
FT                   RANPELNAIVTETFDAARKQSKMPRKGKLGGIPTFIKDNVEVEGVPTLFGTRALPRHPA
FT                   HKDHAFIRQFKSLGMISLGKTALPEFGIPPTTESLLHGATANPWNIQYSAGGSSGGSAA
FT                   MVASGVVPMAHGNDGGGSIRIPAACCGLVGLKPTGGRLITAPELKMLPINVVFEGVITR
FT                   TVRDTALFMAEAETYYANHRLPSLGLIAKPGKKRLRIAVITEAINNVVVDEEVLEAVHA
FT                   TAALCEKLGHRTEALDLPFTDQIGDDFTLYYAFLFFMLHRFGKKLLSPDFDPARLEHLT
FT                   LGMSRHFTKHLFSFPFATRRLRKAIKVTQSFYKKYDVALCPVLAAKTVRNGTLLDPTLP
FT                   FDTVFEGIRNYAPFTALQNITGEPAISLPLGMSKEGLPIGVQFAAPMGQDQTLLELAFE
FT                   LEQAQPWPQFPVIDTEQAGPG"
FT   gene            complement(186392..187033)
FT                   /locus_tag="Dole_0167"
FT   CDS_pept        complement(186392..187033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cac:CAC3687
FT                   transcriptional regulator, AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65977"
FT                   /db_xref="GOA:A8ZSR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR4"
FT                   /protein_id="ABW65977.1"
FT                   /translation="MTISKNKARIPVQKRSIETKEKILNAAWELFAEKGYFKTNTNELA
FT                   ERAGIATGSFYGYFNNKKEVGIELMMRFYKEVSKKALSNFYIQIGDNVAENLDTGRKLV
FT                   RFIIKSLKESHAINPLLHKETTALILLDEDVRNISSEEDKKIIAFLITLLQQHKQLIRV
FT                   DDIEAAAVLLFRTSDEIIHRIMIHKDAIDEDRLLKELEDMICSYLFITVS"
FT   gene            187230..188261
FT                   /locus_tag="Dole_0168"
FT   CDS_pept        187230..188261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0168"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   btk:BT9727_2708 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65978"
FT                   /db_xref="GOA:A8ZSR5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR5"
FT                   /protein_id="ABW65978.1"
FT                   /translation="MVYKYLKTRKENYTLWVEINNPPVNFLTGAMLEELFALVKQVSKD
FT                   DSVRVFILTGGIEDVYIMHFSIPELLQLSKDNKKLLLNLFVKSKITGAFLKYFTTCTNW
FT                   LMDWFGWYETLVLKLAKIMSGYSSSLYLWFIMQRTYFAIERLNKITIAAINGNCNGGGT
FT                   ELSACFDLRFMVGDQGFTLGQPEVLINIVPGGGSTQRLPRLIGRAKALEFMLRGNQWGA
FT                   QEAWRIGLITDFFNKVEFKNKVQEFADLMSKRPLTAVDAIKKCVHDGMETTLRHGLSIE
FT                   MEQNIRCLDTEDMINAMQAYIRYLDEHINPIDRQKITTEDLNHIVQETVEHMEKGKLYK
FT                   FKH"
FT   gene            188285..189154
FT                   /locus_tag="Dole_0169"
FT   CDS_pept        188285..189154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0169"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: ttj:TTHA0241
FT                   oxidoreductase, short-chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65979"
FT                   /db_xref="GOA:A8ZSR6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR6"
FT                   /protein_id="ABW65979.1"
FT                   /translation="MNKSILVTGASTGIGWATSLELAEKGWRVFAAVRKEADAKKLRDA
FT                   SSGKITTVIMDIVDYESVKHGAQEIEKALGGAGLDALFNNAGISVQGPLEIIPIELFEQ
FT                   QIRVNVFGHVFVTQTFLPLLRKAKGRIVFTSSESGRMTLPLMAPYSASKFALEAVASAL
FT                   RIELRPWKIRVSCVELQTIKTPMWEKIDISTEKMIASLPQKARDLYRNELKTLSVFPKW
FT                   QAEMGISMKKAVRVIIRALSARSPKARYLVGYEARLLVYSHAITPTWMMDWFASKSMVL
FT                   LGKFIKPK"
FT   gene            189216..189542
FT                   /locus_tag="Dole_0170"
FT   CDS_pept        189216..189542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0170"
FT                   /product="DNA-binding protein"
FT                   /note="KEGG: gsu:GSU1390 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65980"
FT                   /db_xref="GOA:A8ZSR7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR7"
FT                   /protein_id="ABW65980.1"
FT                   /translation="MARIEKEELSGSVTIKTMRRIADGLDCVFVYGLVPRTSQGEAVAR
FT                   QAKQVAIKRLSQASQTMSLENQSLSRRENEQALSALVDELIQTLPSTLWDIGNYIPLLE
FT                   FAKS"
FT   gene            complement(189575..191494)
FT                   /locus_tag="Dole_0171"
FT   CDS_pept        complement(189575..191494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0171"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_0431 putative ATP-binding component of a
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65981"
FT                   /db_xref="GOA:A8ZSR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR8"
FT                   /protein_id="ABW65981.1"
FT                   /translation="MALISMQDVRWGFGEPYLLDGISFNIEKGERVGLLGRNGVGKSSL
FT                   FRLLTREILPDSGEIVIGQGIQVAALEQEVAAGRPCPSKMSPEVKETVFEVVARGLGPA
FT                   GQNLADFYRVCSAMASSHEPRLSDERERLQHALDTGGGWVLQQQIENILSRTDLDPKRP
FT                   FADLSAGMKRRALFARSLALSPDLLLLDEPTNHMDIDSIVWMESFLLRHVKTLLFITHD
FT                   RVFLERIATRIMVLDRGRLFSYACDYKTYLQRREAELAAEAEHQRNFDKKLSKEEAWIR
FT                   QGIKARRTRNEGRVRALQEMRAKVRQRRAKTGQVRLALQEAERTGKLVVQAEGLTYAYD
FT                   QTPIVQNFSTTILRGDKVGIIGPNGVGKTTLIRLLLGALAPDSGTVRHGTHLEPAYFDQ
FT                   LRTQLDEQKTVVQNISMDNDFIVFNGQKRHVIGYLQDFLFSPERCRTPVHVLSGGERNR
FT                   LLLAKLFIRPANLLVLDEPTNDLDAETLELLEELLFSYDGTLLLVSHDRSFLNHIVTST
FT                   LVFEGNGQVVEYAGGYDDWLAQRPQPVAPEAAVPKQAQPPRQAPPAKPKKLTFAQNREL
FT                   KELPAMIEALETEQRLLQAAMADPAFYRQAKEEIKARQKRLQEVEDKISACYRRWEELE
FT                   DLTP"
FT   gene            complement(191515..192492)
FT                   /locus_tag="Dole_0172"
FT   CDS_pept        complement(191515..192492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0172"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hch:HCH_00189
FT                   predicted hydrolase of the alpha/beta-hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65982"
FT                   /db_xref="GOA:A8ZSR9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR9"
FT                   /protein_id="ABW65982.1"
FT                   /translation="MNSFAPPVLFRNPHLQSIAASIKLRRPLVRGRAAAMLRAGREMIV
FT                   DAGDGVRLQGFYSPQPDGPNKGLVILIHGWEGSSDSMYLVSSAGHLYNQGLNVFRLNLR
FT                   DHGESHHLNPGLFHSCRIDEVTGAVKRICADLSGGGKTFLAGFSLGGNFALRVALRAPG
FT                   RGFGLDKVVAVCPVLHPPTSMASLEKGWFVYHHYFIRKWKQSLRKKQALFPDIYDFGDA
FT                   AIFKSLSSITAHMVERYTDFPDMLTYLKGYAITGDVLTGLTVPAHIIASLDDPIIPSLD
FT                   YKNLARPQSLTLTLTDQGGHCGFLTGPGMRSWVDMTMAGLICRG"
FT   gene            complement(192500..193378)
FT                   /locus_tag="Dole_0173"
FT   CDS_pept        complement(192500..193378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0173"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: swo:Swol_0919 oxygen-independent
FT                   coproporphyrinogen III oxidase, Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65983"
FT                   /db_xref="GOA:A8ZSS0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS0"
FT                   /protein_id="ABW65983.1"
FT                   /translation="MRYEGQIYRPFSEANSYLLQCTVGCSHNGCTFCGMYKDRRFRVRS
FT                   TDEILEDIRMAGNHYGDVEKVFLCDGDAVCMETETLLAILKALYDTFASLRHVGTYVGP
FT                   QSTLEKSMADLARLRGAGLTKAYLGVESGDDAVLTDINKGVTAAQMLEAGRRLVEAGFN
FT                   LSSMVLLGIAGTGEPARRHAALTADITNRMKPRYLAALTYTPVPHTALFKKVESGKFVL
FT                   PDPFETLEEMKVMFENITIDNLTFVGAHASNYLPVSGKLQKDKAAMLQTVNAVLTSRNM
FT                   NALRPDAMRGL"
FT   gene            193732..194274
FT                   /locus_tag="Dole_0174"
FT   CDS_pept        193732..194274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0174"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   sfu:Sfum_2710 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65984"
FT                   /db_xref="GOA:A8ZSS1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS1"
FT                   /protein_id="ABW65984.1"
FT                   /translation="MTTVKNGLFVSVKYKGTLGNGEVFDSSEGRPPLEVQVGAGQVFEG
FT                   FEAALMGMSLNEKKTFTLEPEEACGQRNEDYTQTFSRDEVPPDETPEEGQVIILSSPEG
FT                   QEIPARIVEVTDEKVVVDLNHPLAGETLTFEVEVVGISETATQSFAGGCGCDDDGCGCD
FT                   DGGGCGCDGGGCSSDLG"
FT   gene            complement(194367..195065)
FT                   /locus_tag="Dole_0175"
FT   CDS_pept        complement(194367..195065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0175"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hne:HNE_2447
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65985"
FT                   /db_xref="GOA:A8ZSS2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS2"
FT                   /protein_id="ABW65985.1"
FT                   /translation="MKKTIGPGQKKPAKNTVPGKKGDDTRKMILAAARQIFAAHPYNAA
FT                   SIRMIATQGDFYHGLIRYHFPSKAGIFEAVMEDACRSLVQANKEWLVEISTFPPEKALS
FT                   TYLDRFIEYFQKQPAVLRIIINNLSHENPATLPGYHHLTGFLADTRRDFEAIFPNLFAT
FT                   GDVSRFLSSLNALILHFLGAGSIEAQIMGFPSQSRDYLQWVKETLFFIFLPVLETAVRQ
FT                   SSESALDTGK"
FT   gene            195263..196111
FT                   /locus_tag="Dole_0176"
FT   CDS_pept        195263..196111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0176"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mem:Memar_0454 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65986"
FT                   /db_xref="GOA:A8ZSS3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS3"
FT                   /protein_id="ABW65986.1"
FT                   /translation="MITAETIKKTITESGVDLVAVADAQNLVPAYPPRPATALMPTARS
FT                   VIVMAVAHSLGAVYAPDIMLWTRNKMQTSRILDEVAEKIGRMLEAEGFLTLPVSADKPV
FT                   EIHKIDPQTGKKFPQTRVVGHLSLKHAAVSCGLGEIGANNLLLTPEFGPHQRLGGIITE
FT                   APLAFDPPKTMNLCKKCGACRKACPSGALTDKGYDVDPCFNYWAYGFKRRFPQKLREIP
FT                   GFLKMLARHNKRRDMLIETGQTYITDVDNCIECMRVCPIGSHWKHIRPDHMSAQQSFGT
FT                   E"
FT   gene            196133..197182
FT                   /locus_tag="Dole_0177"
FT   CDS_pept        196133..197182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0177"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mac:MA0667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65987"
FT                   /db_xref="GOA:A8ZSS4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS4"
FT                   /protein_id="ABW65987.1"
FT                   /translation="MKFEEPIREFLAERGALRVGFCTRETLAGGPPSADLTYVLPSARS
FT                   AVTFALPLDRDIMRQCLAKKSQFAFEQHNIDVNLKAGRIAKELALWLEEKGYKSVRIHA
FT                   NNVYRKDEPNWQLAMRPDVSHRYLAVRSGVGSFGWSGNVGIKGYGSAIILGSVVTELAL
FT                   EPTPPLPPEEGFCDRCKLCVASCPSGMFHDSRETSVTLGGQTFSYSERISYLPCQLVCG
FT                   GFTGLSKNKKWSTWSPGRYVIPDPADENSQMETLVRAVGNYTKWPRRSDGDGGFENNAF
FT                   GGLNIRLTCGNCQMVCRGDREETKENYRLLTTSGCVIQREDGTIEVLGAEDAAREFERM
FT                   PPEHTTLYR"
FT   gene            197194..198024
FT                   /locus_tag="Dole_0178"
FT   CDS_pept        197194..198024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0178"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   afu:AF1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65988"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS5"
FT                   /protein_id="ABW65988.1"
FT                   /translation="MTLTDFQQLGKELYEKLHLPTYPVAITYIKSEDEIPAKAMRPSAM
FT                   GQKMCICQTFTYARSWGAHVAITAEENFCVPGSAGHKWVDVTDEEFIESQVTQGWHKSR
FT                   EAEINRINGYNMLFAGPEGQARLARAKARIGLVASPLHQALMVPDTVLVFGNGVHITHI
FT                   IQALCYDYKAPIMSVFEGFGESCMMGGMIPFLTGQPQIVIPGMGDRAFAGITPDEIGIG
FT                   IPAAKFPVVLEDLFKTGGPMNIGMPFKTMIPTNLTEDITPGFAYLKKIVDEKSR"
FT   gene            198054..198575
FT                   /locus_tag="Dole_0179"
FT   CDS_pept        198054..198575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65989"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS6"
FT                   /protein_id="ABW65989.1"
FT                   /translation="MAASREQVLETAFNAAKQYEMKSGGCPQCTLAGIFDALEVQNDDV
FT                   FRAATGLADGVGLTGEGHCGAISGGVLAIGYLFGRKKKDFGDMFKLVEANLLSKKLLDR
FT                   FMEKYGTCRCADLQTAFFGRFFNLLDPNDLNAAMEAGMLERCSTLAGEVARMTTEIILE
FT                   AREKKELSTK"
FT   gene            198631..199026
FT                   /locus_tag="Dole_0180"
FT   CDS_pept        198631..199026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0180"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: reh:H16_A0833
FT                   putative translation initiation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65990"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS7"
FT                   /protein_id="ABW65990.1"
FT                   /translation="MSGTKHLINPPGTEGIYKSMQFSQAVKSGNTIYVSGQVGVDENFK
FT                   PGSGIEEQANLAFLNLQHVLAEAGATLEDIVELVTYHTSMKDILGFSKVKAKFIPKDYP
FT                   AWTAVGVTELVLPDLLVEIRATAVISG"
FT   gene            199141..200208
FT                   /locus_tag="Dole_0181"
FT   CDS_pept        199141..200208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0181"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_3864 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65991"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS8"
FT                   /protein_id="ABW65991.1"
FT                   /translation="MTRDIYRELQERLDLFSIGFPPAPSGVEITILKRLFSEEDADLFL
FT                   KLTPLLTPAEKIAETLGLLADEARTRLADMAGRGLLFSKTKGDTTLYAATPFVHGIFEY
FT                   QVNRMDKELAELMNQYGMEALGLNMLQHGGSFLRTIPVNQALTPDNQVASYDDALEILK
FT                   SKRTIVVTECICRKKQTILENACGKVVEACFMFDTMAEYYLAHNLGRQVTVDEAVDILG
FT                   KAREQGLVTQPATAQNPDGMCNCCGDCCGVLQAINFHPKPAEAVSTNHYAVLDRDACTG
FT                   CETCVDRCQTNALAMDDDGLAVLNPDRCIGCGLCVITCPSEALSLQAKSPEQQYQLPKD
FT                   GMDQMVALAQKRGIL"
FT   gene            200407..201270
FT                   /locus_tag="Dole_0182"
FT   CDS_pept        200407..201270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0182"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ppd:Ppro_1081 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65992"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS9"
FT                   /protein_id="ABW65992.1"
FT                   /translation="MFDEQWFVNEIKQKIATHAENRLEYPYPTEPIFDEPLVGFVKGDD
FT                   PIFQELKTVIGPHHYTPREIMAWQAKKNHVPPPPAEELSVVSYVMPITRATKQQNAKRT
FT                   DWPAERWAQTRLSGEIFSQEFTREIVSFLMSRGVLAIAPDVTPLFNKKRYPNVGWASPW
FT                   SHRHIAYAAGLGTFGMHDFLITEKGCAHRLGSFVVHRRLAPNRRRPDDIHAYCLQYQGK
FT                   QCLKCARRCPVGAISKENAHNKETCYKHVAASLKYCLKNYHIFIYGCGICATGVPCESG
FT                   IPVKQK"
FT   gene            201532..202692
FT                   /locus_tag="Dole_0183"
FT   CDS_pept        201532..202692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0183"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0095 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65993"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST0"
FT                   /protein_id="ABW65993.1"
FT                   /translation="MPKAADPYKKLNNILNMFDLKVPKSRKFTKLLKLLYTPEEAELLG
FT                   HFGTPYMHMEPIGTTVRITGRNKEDVEALFENMVKKGTLFFQKGDNGERLYSLPPFIPG
FT                   IYEFYTMSENDPFETKKDILKLLDDYFFETFVPEAFNSSNYPWFRVLPAEHPVKRTISI
FT                   EKSVDARTRILPFEIASEYISSAQYIAVGDCACRDHAAMQDGKPRCDKPKDVCLVFESV
FT                   AEYWVEKGIGRRITHEEAVNVLQRSAEAGLVHCTTNNRVFGERMSGMICNCCPCCCFIL
FT                   QGVLRTRGQQGIAKSNFQPVIKTEECNLCMACVDKCPVNALYHHKPHKDDGSDNFIALN
FT                   ESECLGCGVCVMACDNEAIQLVKVRDTVPEIDVLHMGDRHNKERRH"
FT   gene            202839..203846
FT                   /locus_tag="Dole_0184"
FT   CDS_pept        202839..203846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0184"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sfu:Sfum_3459
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65994"
FT                   /db_xref="GOA:A8ZST1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST1"
FT                   /protein_id="ABW65994.1"
FT                   /translation="MSKKNVILEKSGGRKFDLYAEVGKYFSSAGQLDEIAFKQALHEKL
FT                   KALKDGNPPDGFIQPATEWLSGYLNEILNYLREKGISEPALKLFKIAINESSLYGLENI
FT                   SVSVDCLQHIVSELPEPQKTPVEKKGAADEMRQRIFAAAIDVFAEDGFHRATIDKVSET
FT                   AGIGKGSVYRHFKSKEEILDELLRKAFQEVVERISTITSKDIDILQMVQEMIESWILFI
FT                   SNNHKLYRIIQTQAMYGQTGRTVMFYDYVISRLPLFKERLVSLNRDKELKTTNLYTVFY
FT                   GIMGFIDGVVQKWFRCGMDYSLIDEVPVILEVLFNGFVGEKTTRTVFFIPPEKD"
FT   gene            203920..204675
FT                   /locus_tag="Dole_0185"
FT   CDS_pept        203920..204675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0185"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01176 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65995"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST2"
FT                   /protein_id="ABW65995.1"
FT                   /translation="MKINATLFELFEKKAKKTTVTHLCMGLGYTVVTTSDGGIGIAYTF
FT                   FENKTACTVQKSYENPEGAPAIGLVEHILSDSPILRTQALAAINALNYSAAASLAQGPD
FT                   NADLLAQMGVEKGTHVAMVGAFKPLIKVIREKEAELSLMDAGKGIGDEQDFYEKLGTWA
FT                   DVLILTATTLLNNTTEAVLGHAGPGVRTVLLGPSTPLVKEAFAGLPVDFLAGTVPMDAQ
FT                   GTIQAIRHGTGTPVIQRFGRKVVMAMGEG"
FT   gene            complement(204860..205612)
FT                   /locus_tag="Dole_0186"
FT   CDS_pept        complement(204860..205612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0186"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: pla:Plav_1547
FT                   putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65996"
FT                   /db_xref="GOA:A8ZST3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST3"
FT                   /protein_id="ABW65996.1"
FT                   /translation="MPRKPKTVKASPPPRVMKMKELSEATGVNSATIRYYINQGLLPQP
FT                   HKTHKNMAYYDERYIALVNLVKKLQKEYFLPLDVIKQAIEEVGHERAPYMIQEIVEKLV
FT                   QEKEGTWSEVAPPNHEAGMTRAELVAASGLSTEDFDAAVEAGFLLKDGNDRFDRENIQV
FT                   AMLLAQIRSHLTREKGFSTEFFIMHFKTLETLVNKELSLFMNNIQSGNLSIEEVNQYAN
FT                   RSFDLFHKISPILHKRLISKKIKDSLNL"
FT   gene            205948..206940
FT                   /locus_tag="Dole_0187"
FT   CDS_pept        205948..206940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0187"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sfu:Sfum_1905 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65997"
FT                   /db_xref="GOA:A8ZST4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST4"
FT                   /protein_id="ABW65997.1"
FT                   /translation="MKPNLLTDRFGRHLSYLRVSVTDRCNLNCLYCRRWDFSEYFPSSE
FT                   ILSYEEMLRLIHIGAGLGITKIRITGGEPFVRKDACSFIDRVAAFDGISDISVTTNGLL
FT                   LGRYLDRLRQAGIRRLNISLDSLKREKYRLITGRDVFHTVWDNIMAALDAGFDPVKVNV
FT                   VVMREVNDDEISRFADLTFRFPLHIRFIEYMPSCKYHLDSYRQMFTPEIRERVEANGAL
FT                   IPIETADSSNIAHRFKYHGAKGEIGFISPMSSHFCAACNRLRLTADGMLRPCLLSDRFV
FT                   NIKTPMRNGLTDREIEGLFHLAVLYKPRSSGINQACGARLPELMSAIGG"
FT   gene            207128..207331
FT                   /locus_tag="Dole_0188"
FT   CDS_pept        207128..207331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0188"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: dps:DP2621 similar to sec-independent
FT                   protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65998"
FT                   /db_xref="GOA:A8ZST5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST5"
FT                   /protein_id="ABW65998.1"
FT                   /translation="MFGLGMPELVIILVIALIVFGGRKLPELGSGLGSAIQNFKKSVSE
FT                   VKHEGKTALEEGKKEKEATPSA"
FT   gene            complement(207371..208126)
FT                   /locus_tag="Dole_0189"
FT   CDS_pept        complement(207371..208126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0189"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: pth:PTH_2704
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65999"
FT                   /db_xref="GOA:A8ZST6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST6"
FT                   /protein_id="ABW65999.1"
FT                   /translation="MEKKTKQPAAKTPPAPLSMTGLAKASGVSPKTVRTYIDAGLLPPP
FT                   EKKRGTTAYYDARCVNMINMIDRFHSKYSLPLPIIRQVIDEIGHEKALEESGELTKKLN
FT                   RAKKMPWFEHIVDANSKPFLTKKALILATGLSPKDLDKAIAQKLIMPDKNGLFCKNDMD
FT                   LALLLSQLKGTGAGKEKILLDFLNMQLQMTESLVEKEFNAFFKNIINKNITVEDANELA
FT                   EKAIDVLTTLLPLCYRQLLNRKIEELRKT"
FT   gene            complement(208138..208707)
FT                   /locus_tag="Dole_0190"
FT   CDS_pept        complement(208138..208707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0190"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: sat:SYN_00638 tungsten formylmethanofuran
FT                   dehydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66000"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST7"
FT                   /protein_id="ABW66000.1"
FT                   /translation="MICGRTPDELIRDIEGFHGFVAPGLVIGAFMVDLAREHIGQNTEA
FT                   DAVVETRHCLPDAVQILTPCTVGNGWLKIADLDKFALTLYDRHTFAGFRVWLDLNKAKA
FT                   HPNVYNWFMGLVSKKDLPKEILIPAIFDAGRDILSVKPVTVRAEFAKREKKSKIAVCPA
FT                   CNEAYAAAQGTPCLACQGKDYYHTGS"
FT   gene            208961..209368
FT                   /locus_tag="Dole_0191"
FT   CDS_pept        208961..209368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66001"
FT                   /db_xref="GOA:A8ZST8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST8"
FT                   /protein_id="ABW66001.1"
FT                   /translation="MIVSILGAVGYSVLITAIYAVAANICYFLFHGENMFANLHGYVWV
FT                   EYVISAGIIFGAVFFFELTRRLLADGVRAVGYGVVAAFLYLAIAANVVHYFFFTEMMFR
FT                   SVAHWAIVIGLLVVTVVVVEGVRAVSGKSNG"
FT   gene            209441..210022
FT                   /locus_tag="Dole_0192"
FT   CDS_pept        209441..210022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0192"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   sus:Acid_4388 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66002"
FT                   /db_xref="GOA:A8ZST9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST9"
FT                   /protein_id="ABW66002.1"
FT                   /translation="MSSRVTTSESISLPGQKDASAGGFSRREFLGKGLAVAGWGVMFAS
FT                   LGAGLYQGIRFLYPAVVFHPPSTYVIGQLKDFVTDERADQYGVIFVDPKFKKDHRFFVV
FT                   REAGRIYSLFARCTHLGCTVNWFEELNIFKCPCHGSEFHSNGVEFAGPAPRPLDRHHIA
FT                   VDNGGNIIVDTARVYSKDEFEEQKIFIEVG"
FT   gene            210022..210387
FT                   /locus_tag="Dole_0193"
FT   CDS_pept        210022..210387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_3885 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66003"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU0"
FT                   /protein_id="ABW66003.1"
FT                   /translation="MTGSVAAIQEAPAALPKKARAPKRQAMILDWCTGCGGVPVCRIYC
FT                   KFDALQLVDDPDNYPFKRMTVNRVRCVGCGACISSGPDGLVLTGCPWNAIRLVPVENNP
FT                   HSDSEKEETRGADQPAV"
FT   gene            210524..213505
FT                   /locus_tag="Dole_0194"
FT   CDS_pept        210524..213505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0194"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: eba:ebA5790 ethylbenzene
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66004"
FT                   /db_xref="GOA:A8ZSU1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU1"
FT                   /protein_id="ABW66004.1"
FT                   /translation="MKEVKISRRTFLKGTSATVALLSLNSLGFLGGNTIANATEKIFED
FT                   WKYAGWENLHREEWTWDKVTYGTHLVDCYPGNCLWRVYSKDGVVFREEQAAKYPVIDPS
FT                   GPDFNPRGCQKGASYSLQMYNPDRLKYPMKQVGGRGSGKWKRVSWDQCLAEIAEGIVDG
FT                   LEAQGPESIIFESGPGNGGYVHVMAVHRLMVSLGATVLDLDSTIGDFNRGIYETFGKFM
FT                   FMDSVDGWYFGKLLLIWHMNPVYTRIPSYHFISEARYNGAEIISIAPDYNPSCMHADEY
FT                   IPVEMGSDAALGLAVCQVLMNKKWVDYPFVKEQSDLPLLVRKDTDRFLSAADIEKGARD
FT                   DQFCFWDSKNNKVVKAPLETLKLPCDPALEGVYKATLLDGKTVEVEPVFNKLKALLDSE
FT                   YTPEQASEMCRTNPDTIRRMAEKCYKASGGIQVMVGWNSPKYYHGDLIERAMCLVLTLT
FT                   GSLGKKGCGIRGWNESLFEGAFTQIFKQKIGLMNLTRQLPLMRRVWESFKKEDPTISDE
FT                   MASIKQERVIDRNMVNYTIPAFLYYNHSNYKKAWDNKAWHCPTMKREFKEYYDEAVNSG
FT                   WWDGYVKPEKDQTPTVYCWMGTNPARKNRGWEKNILGSLWDKYKTIFGFETRWTTTLLY
FT                   GDYALPCAGFYEKLDTRFPTPHVPWLTLTDEAVKPIGECKTEWEICLMLAKKIEEAAKK
FT                   RGKTNFVPRTPVQEEYMPFLNQFSVRDAKGNVEISKLHDWQLMGSSGKDFDEIMEDALQ
FT                   SSVMLGNLPPGTNLKYMREHGIVRFVDVSIFDPVTMNLATDIKPDEPIIPLTWHTGEKK
FT                   VPYPTYNRRIQFYIDHPWFLEAKEELPVHKDNPKIGGNYPLRLTSGHQRWSIHSIWVSN
FT                   EQLLRTHQGRPFMFMSPEDAEKRGVEDGDLVRVFNDFASFKIHVKVTPAARPEKGAAKP
FT                   GQVIIYHAWEPFMFPEWKSYDIAIPGMIKWLDLVNNYGHLHYWRWNWCAQPIDRGISVN
FT                   VEKA"
FT   gene            213550..214215
FT                   /locus_tag="Dole_0195"
FT   CDS_pept        213550..214215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0195"
FT                   /product="gamma-subunit of ethylbenzene dehydrogenase"
FT                   /note="KEGG: eba:c1A62 gamma-subunit of ethylbenzene
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66005"
FT                   /db_xref="GOA:A8ZSU2"
FT                   /db_xref="InterPro:IPR017838"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU2"
FT                   /protein_id="ABW66005.1"
FT                   /translation="MEKVICKKIATATKELLNCDSSVWQSGKAVLETAATPLANQPSPY
FT                   IKGVYDETKIGAVKKITIKAVHNGKDIVFYCEWESGKPNKEIGDINVFPDGVALLFPFK
FT                   DIDKTPINEMGTQDYPTNAWYWRPDFEEKPKNQVSHGLSTSLYTEKSSISSYSRWANGK
FT                   WCVVMARPMKATQPGEETVDLMPGKAIGFGIAVWEGSNGERGGIKAFSKEWRELVIEA"
FT   gene            214273..215442
FT                   /locus_tag="Dole_0196"
FT   CDS_pept        214273..215442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0196"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: eba:ebA5791 ethylbenzene dehydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66006"
FT                   /db_xref="GOA:A8ZSU3"
FT                   /db_xref="InterPro:IPR017839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU3"
FT                   /protein_id="ABW66006.1"
FT                   /translation="MAVDEKVLTDREKELAAAFEETKEMLRKSNRQIGMVMDLNKCIGC
FT                   QLCSMACKTLWTSKEGREYMWWNKVNTMPGKGSPKDWEKMGGGYKVKFGGKVMEPVQGK
FT                   HPTRKEFGDMWDYNWNDVVNNKAGAVHLQAKNQTDGSVPDWSMNWDEDQGAGQYPNGFY
FT                   FYLPRICNHCAYPACVDACPRNAIYKRDEDGVVLIDQDRCKGYRFCLEACPYKVIYFNF
FT                   LTDTSMKCIFCYPRLDEKVANACARQCTARVRWIGYTEEPESIIYKLTKVWKVALPLHA
FT                   EYGTNPNVFYVPPLAPHRLAPDGKIDPSKPRIPREYLRYLFGPEVDASLDIMQKELDKV
FT                   RAGGRSELMEILKAKEWKSMFGEFTKDPAVMDRKPPKGVTFVRDGIITK"
FT   gene            215484..216233
FT                   /locus_tag="Dole_0197"
FT   CDS_pept        215484..216233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0197"
FT                   /product="delta-subunit of ethylbenzene dehydrogenase"
FT                   /note="KEGG: eba:c1A60 delta-subunit of ethylbenzene
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66007"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU4"
FT                   /protein_id="ABW66007.1"
FT                   /translation="MNQAAVDMANGYDDAQMAAFRSAELTSDADKQAAARSDMYALMAD
FT                   LFRYPDKEFQAFVRNGELRDALVGITENLPFACALSDGETEKLQFSPLLDEDGVEAGFI
FT                   RLFEAGPGDPPCPLIEGKYVKDSNRRAIFEDLIRFYNHFGLSYAEGAHEDRPDHVIYEM
FT                   EFMHYICFLTLRAGQQEKSIEDLLLAQRDFLKHHLLKWAGKLAERVAEVVNDIPEDYAG
FT                   TFYTNVARLLARFIEADYAYLNEAQTR"
FT   gene            216247..217002
FT                   /locus_tag="Dole_0198"
FT   CDS_pept        216247..217002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0198"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: sus:Acid_4387
FT                   cytochrome b/b6, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66008"
FT                   /db_xref="GOA:A8ZSU5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU5"
FT                   /protein_id="ABW66008.1"
FT                   /translation="MKFKKLRESALWRSVFRHSLADTPRNRALAVTSNIFLHVHPVQTK
FT                   ADAVKFRFTFCLGGLTLLMFIIETVTGVLLMFYYRPVTEYAYLDMKLLEHTVLFGMFLR
FT                   NMHRWAAHAMVILVMLHMLRVFLTGSYKPPREFNWVVGVLLLVITLLLSFTGYLLPWDQ
FT                   LAFWAITVGTKMAGATPFLGNEGPFHQLLGIHPYNDLQYLLLGDSVVGGNALLRFYVLH
FT                   CVLLPLACVVLMAVHFWRIRKDGGISRPL"
FT   gene            217025..217768
FT                   /locus_tag="Dole_0199"
FT   CDS_pept        217025..217768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_4386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66009"
FT                   /db_xref="GOA:A8ZSU6"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU6"
FT                   /protein_id="ABW66009.1"
FT                   /translation="MAEEEKGRKTKPEPPEAAGRGYVFTVPDLVAREFVAILLALIVLC
FT                   VWSIEIDAPLRAMADPNWTENPAKAPWYFVGLQELLVYFDPWIAGVVVPGIIMVGLMVI
FT                   PYIDTNPRGVGVYNFKDRKFAVSMFMIGYTMWFVLIVIGEFFRGPNWHFYWPWESWETE
FT                   KLAEEQLVNIPNTLGYALMGAYVALGFIRLPAFIRQGRHREPGFLIRYATTVMLFLLMF
FT                   GVIIKIVLRLFFHVKYIIATPYFSI"
FT   gene            217765..219996
FT                   /locus_tag="Dole_0200"
FT   CDS_pept        217765..219996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0200"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: sus:Acid_4385
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66010"
FT                   /db_xref="GOA:A8ZSU7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU7"
FT                   /protein_id="ABW66010.1"
FT                   /translation="MNAKKTIQASFGIRVLFVVVSAALLIVTAWVIMGEKEDLQQWQQH
FT                   QAAYNDQYAAMLAEKLAGAKAAEDEEAVKKWAKLKDGHDRSMDIKMRAVFLPDAQVRDL
FT                   CQSCHMGMENSLFATAEHPLKAHSPEILADHKITRYGCSLCHHGQGAGLNPEKAHGFEE
FT                   NWEKPRIPLKYIESACFECHENVYGLKGAEKAAEGKTAFTEMGCYGCHDANVIEGLPKF
FT                   SVPFSGMARKISSKKWVYKWIEDPQATRPGTLMPTFRMEPQELAGIVEYIWSLEDPDLR
FT                   LPAFNTRSGSAKTGKAVFTDKGCIACHSPDRNKAGQSRRVPMLSDAGQKLTALWMAKWI
FT                   EDPRSINPDTWMPKLDITPEDVKNLAVYLTTVKDGEVGTRLDFDMADGKKEDGKALVQA
FT                   RGCLGCHIVKGAEDPSKVGVSVADVADKRMEELPFGNSDVPFTKWDWLDNKIRKPDIYK
FT                   TDDMPMYMPDYVMTDEEREHLVIFYLYNRLLDLPENYIVRASRQQVVNERGDWMIRHFN
FT                   CKGCHEILDGEKPRIDTFIAKKSMVPPRIVNEAEKTQPTWLFNYLRRPSAMRPWLEMRM
FT                   PEFNFTYDDVPMVIEHLHALMPEKSRRVSPIPYEPALVQTDYDEETIEMGKYRFRNDKC
FT                   MQCHPVSFTGELPEGKQLEDLSINLMISKTRLRFEWIKNFMRDPNTYAGVGTKMPYVFY
FT                   TPDKVPRIPDPEAWLDRTALFLMFMEEVPEAVQEEEKQREVEEFDFSNY"
FT   gene            220159..222813
FT                   /locus_tag="Dole_0201"
FT   CDS_pept        220159..222813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0201"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gsu:GSU2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66011"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU8"
FT                   /protein_id="ABW66011.1"
FT                   /translation="MFFRAHISASVVRLTAVVLFMVMFLPACSLYRVTHLDKYENFAEI
FT                   SNTLWAKLYFVFKDVDLPGYDAIIYADTRWRVSDSPVVIDKNTFILPGVYLTIDPGVEV
FT                   RLAKDILVTNRGVIVARGTPEAPIRFTWQTEGENWNAIENLNCVGRTGKSSEVVYEHCI
FT                   IEHGQGLAINSSLGRVESCVFRHNIDSALKFQYAEGAILNSTFYQNSSERQAESGNGAA
FT                   INVYSDKSVRVENNDVYDNYSHGGRDGGGGIYAFAYNDGVVEVVNNRVRNNRSDRKAGG
FT                   IFAYAARVSSNTVIDNEAAMTGGGIHVIEGGLEKNVIAGNRAPNGGGIYSEAGRLKGNL
FT                   VRANQSDNGAGLYHLGGGEILGNTFVENTCTGKETCATITLSGSPVISRNNILARTGYA
FT                   LSFKSHSLSPDLKAHENYWGTTDKQAVEQLVSDWLEDSRVGLVNWNAYLSAPAPDACPI
FT                   PENADTTVLVDVPSMPANAIRGLVEADTLLGKDGIRSYSVVGNLLVLDGNTLTLAPGTT
FT                   LKLNPDVTIRVRGTLNAEGTAKQPVRFTGDRKTPWGQLFFENRSTGPAQTEDETTRPPD
FT                   SRLRHCIVENGGGIMMDGHGADLYDCVVRNHRGTGARIKEVSVSVKNCDIYGNVSDSDG
FT                   GGLYVYGSRTVFIEGNRIADNRAADGGGIFAYGYQSNAAVDIRNNRIEGNISEGDGGGV
FT                   WMSRSALVNNLIIRNKTEAKGGGLYAGFALIEDNRISENRAAEGGGVFAEANCSFKRNV
FT                   ISHNTATSPRGGGVYLNYWGLSQHNKEFLGNRVENNTAAGARPTGGVMMNGQMDFRQNS
FT                   LTGNNGIQLYNLNAADVKDIVAPSCYWGTVSEKAVDGLIYDGKDNDRLSVVDFRPLAKT
FT                   REAAITNAESKPE"
FT   gene            222953..224179
FT                   /locus_tag="Dole_0202"
FT   CDS_pept        222953..224179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0202"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein domain I
FT                   and II; MoeA domain protein domain IV; KEGG: ttj:TTHA0110
FT                   molybdopterin biosynthesis MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66012"
FT                   /db_xref="GOA:A8ZSU9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU9"
FT                   /protein_id="ABW66012.1"
FT                   /translation="MPAFDRRLLDYETALDTCLSAVTESLPAETVGLEKSLGRVLRRSV
FT                   ESAISVPPFDKSTMDGYAVKSADVAGALDTAPVALEVIDEIPAGRVCGKILRSGQAARI
FT                   MTGAAVPQGADAVIKLENTAPAGSEQVHILSGVEENNYIIYKGQDLLPGSRVAEAGATV
FT                   TPSLLGLLANCGTPNVSVSRKPAIGIISTGSELTAPGTPLAEGRIYDVNSYLLYGLCIE
FT                   AGGDVAMLGTVEDKSDALLALLNRHTDADILILSGGVSVGDYDIVHETLQRAGVEEIFW
FT                   RVKVKPGKPLFFGRRGSTLVFGLPGNPISSANNFYLFVLPVIHKLLGRSAWGLKTGHAT
FT                   VCNSMIFRPGRRKFLRAQLRQGPEQGVWIFPEQRSGVFGPMVDAEVLVEVSEAAKMVRE
FT                   GDPVKIYYL"
FT   gene            224226..225737
FT                   /locus_tag="Dole_0203"
FT   CDS_pept        224226..225737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0203"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   csc:Csac_1797 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66013"
FT                   /db_xref="GOA:A8ZSV0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV0"
FT                   /protein_id="ABW66013.1"
FT                   /translation="MISRSQTKALLEREPKFDDMMGSLRATGKQPKGVIGEVRKLMAVA
FT                   RRFNDSYTSGYWRELDLKMHEDPDYLPWEVVKKANELNFYSLFIPKIFGGKGYSISGIG
FT                   PFLEEIGSVCASVANLIGVHYLGFVGLAASWNMRLTDMVCREVVNGEKTGEPCLMSFAM
FT                   TEPDAGTDSQNVEFMDTGSLACHAEKVEGGYKVNGTKIFISCGHLSTWHILFAYTDPAK
FT                   GSESMVMMAVKNGTKGFSFGKKEKKMGQKASLASELVFKDCFVPDDMVLLDKTQSAGLS
FT                   RSPRDITELILANIWAASRVGVAAFGSSAAKGAFEQALRFASETEVDGRPLVTHEWCQA
FT                   MLAEMYKNAAVARMAYSEGAYINGMDGMVKMLNIKPLYYMMKYTPVSLLDPIMKPINKM
FT                   GFTTWISRKIAFDWVDDAAVDRTDGWGSLVKFTATDMGMQNGRMALELMGGAGVRHSEH
FT                   AEKILRDAKLFQIYEGTNQINRINVFKRLVARTCPGTECFCSANL"
FT   gene            225801..226913
FT                   /locus_tag="Dole_0204"
FT   CDS_pept        225801..226913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0204"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ttj:TTHA1916
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66014"
FT                   /db_xref="GOA:A8ZRZ6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ6"
FT                   /protein_id="ABW66014.1"
FT                   /translation="MYASDNKELSLLDKSSAEFAKKILAPGREENDHYPFGPFFDPVVQ
FT                   KAFDLDFFHILLPEDLGGVGQGIEALCIVLANICREDSSLGGIMFTNAFAQNLLLAAGC
FT                   TGELKDLAAGAKKPSDFLIACPVLCNPVQQPLRLSARKEGDGYVLSGTAEYVVLGGMAN
FT                   HALLPATLADGHAWFLVNLPDGAISVSDPVVSHGMHACPATDMTLKDAAARLVGAEEEG
FT                   PAYFKKVADTMQLAAAAMAAGVMRGSLEEALAYCRERRQGGRKIKDWSELQMLLSSMAV
FT                   QVHVAEMLVSRACRALSEDAKNWRLSVQAAALHVISALAPVVTDGIQAMGGVGYMKDFG
FT                   QEKRFRDAGHIQTLLGYLPMKKLNFIRQLL"
FT   gene            227044..228987
FT                   /locus_tag="Dole_0205"
FT   CDS_pept        227044..228987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0205"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dps:DP0495 similar to
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66015"
FT                   /db_xref="GOA:A8ZRZ7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ7"
FT                   /protein_id="ABW66015.1"
FT                   /translation="MALGFITKSYRNRVMALTLPVVVGAVVLVTILAYIFILSNMVNFQ
FT                   RENMETALVGMADGLDTRISEARNAISVLSSRPVHRSDGAAVLELAHAAAPTFFALFLS
FT                   DPGGGLAMAVGEAIPEQVVLPPFETFDMAPGPDGRRSVFVGSVERIPPSMTPVFLVAAP
FT                   VRLVDPSGGEADGVVGGYVDINRLFDSCVASFVPLRTSHVFLADAAGKTLARSGEDVAT
FT                   AVFLAKKTGVKESESLFHKNAAGTRYLSVVRPCLDGWWVVGLSVPLKALFTDLPRLIFY
FT                   SVLLGLATIFLVSLMAWVITGMMVKTINRLTDNLKNIVEGKGDLTQRLTVKGEDEIAGL
FT                   AMWFNRFVEKLGRMITTITKKATRVGEAARALQEFSGEMTHTAGSLKDLSKIVVASTDD
FT                   VNINMASVATTMEQYSHNLDTMASATEQMTATIDQIAQSSGVSMKRTNQAVSYTQTVHE
FT                   SVKDLGDAMEAIGGITDAIARISGQTNLLALNATIEAARAGEQGKGFAVVAGEIKTLAG
FT                   ETDTATKSIHDRVCGIQTSSRSTIDSIDKIADIIRAIDEVVSNTATALEQQSTSTREIA
FT                   ANIMQASEGIQDVHRRISQSTAGLSGMAREIKTLDDRSKIIFQKSGDIDRRAAELAAIA
FT                   EELTTMVSQYKV"
FT   gene            229297..229776
FT                   /locus_tag="Dole_0206"
FT   CDS_pept        229297..229776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0206"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: dar:Daro_1782
FT                   molybdopterin-guanine dinucleotide biosynthesis MobB
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66016"
FT                   /db_xref="GOA:A8ZRZ8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ8"
FT                   /protein_id="ABW66016.1"
FT                   /translation="MKIFHIVGRSKNGKTTLILELIAELRKRGLAVGTLKHSGHAHELE
FT                   TPGKDSWRHREAGAVPSAVTTTDQMAVYLPRKVDENPFDRLGHLFAECDIVLVEGYANG
FT                   PGANIEVWRAANGKDPLFPERDDILAVVTDDPVETGLPVWPRRDVAAIVDAMMRL"
FT   gene            229858..230220
FT                   /locus_tag="Dole_0207"
FT   CDS_pept        229858..230220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0207"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: wsu:WS1811
FT                   molybdenum-pterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66017"
FT                   /db_xref="GOA:A8ZRZ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ9"
FT                   /protein_id="ABW66017.1"
FT                   /translation="MANDNKKRTKAYRLRGRIWIEGPDGTFLGYGRVVLLERIRDYGSI
FT                   SAAARSMQMSYRHAWKLVEFMNGQSQMPVVEKSTGGIGGGGAVLTPAGERAIACFWSAY
FT                   KEFKAFLAQGSAELEL"
FT   gene            230312..231187
FT                   /locus_tag="Dole_0208"
FT   CDS_pept        230312..231187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0208"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: pth:PTH_0841
FT                   ABC-type molybdate transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66018"
FT                   /db_xref="GOA:A8ZS00"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS00"
FT                   /protein_id="ABW66018.1"
FT                   /translation="MRKTVFFLLVGLGLTLFGGGQATVKAESDSITVFCGSANKPAMEE
FT                   IAAKFKQEKNINVNMIFGGSGTLLSQIELSKKGEIYLPGSPDYIIIAERKKLIVENSAR
FT                   IVAYLVPAIITPAGNPANIHSLKDLARPGVRVGIGNPETVCLGLYGIELLEKNSLLAPV
FT                   LKNVVTFGGSCSKTANLAAMNQVDAILGWRVFHYWNPDRMAFVPIDPDQIPRLSHIPIS
FT                   IPIYTKDIKLSEAFIEFVLSPVGREAYEKYGYLASLDKAQVFAPQAPVGGEYTLPAAYF
FT                   DIMKDLRQQK"
FT   gene            231184..231960
FT                   /locus_tag="Dole_0209"
FT   CDS_pept        231184..231960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0209"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nis:NIS_0019 molybdenum ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66019"
FT                   /db_xref="GOA:A8ZS01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS01"
FT                   /protein_id="ABW66019.1"
FT                   /translation="MNRVFDAIIWGTAGLLILAFIGLFAGMLVELGQEKVLSSPDLGRV
FT                   LFAVKLSLFTATIASVFALAVSVPVAYLFSRHTFFGKRFFDTLLDLPIVLSPIALGAML
FT                   LIFFNTPLGKQLNHYFGPFVFEVKGIILAQFFVVVGLSLRLLRATFEGIDEEYENLART
FT                   LGYSKMRTFFRVVLPMAGKGIISSFLLVWGRSIGEFGATVTLAGAMTMKTETIPVAIYL
FT                   SFESANITGALIYITLLVTMSLAILFFVRTLKVGTI"
FT   gene            231957..233048
FT                   /locus_tag="Dole_0210"
FT   CDS_pept        231957..233048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0210"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tko:TK0021 ABC-type sulfate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66020"
FT                   /db_xref="GOA:A8ZS02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS02"
FT                   /protein_id="ABW66020.1"
FT                   /translation="MNHAHLQVDGLTLSLGGFCLRDIHLLCAKGEYHVLLGPTGSGKTS
FT                   LMRCILGFYRINQGALYLNGKEITHTLPEDRHMGYVPQHYSLFPHLKVEGNIRFGFRSG
FT                   KYPSQNADRTVDRLCDMLQIQHLRKRDVRHLSGGEKQKVALARALAIQPDIILLDEPFS
FT                   SIDEGAKRSLWINLKAIINEISITAFHITHNLEEAYSMGERLSVLLNGELHQSGPKEDI
FT                   FERPATQEVARYLNYRNLFSGVAHAHPEGARIDTDCFSVVLSKKISPGTRVNLCVRQQD
FT                   IKIVKQDNAVKPAMRHNILHGHIVSLFPFPEYCLVWFRVEGSTREYDLEIKLPPYLRER
FT                   YKLFAGKQTDVAFWEPSIIVFPD"
FT   gene            complement(233101..233361)
FT                   /locus_tag="Dole_0211"
FT   CDS_pept        complement(233101..233361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66021"
FT                   /db_xref="GOA:A8ZS03"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS03"
FT                   /protein_id="ABW66021.1"
FT                   /translation="MKSKKFSAASKVEFSFRSGRRPFDVDGFLFLRRKGETYAKDCFFT
FT                   FARSVYAFFCDLCVFAVKLNFSVVSLATFLPKPDRTILRPC"
FT   gene            233500..234420
FT                   /locus_tag="Dole_0212"
FT   CDS_pept        233500..234420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0212"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: smr:Smar_0071 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66022"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS04"
FT                   /protein_id="ABW66022.1"
FT                   /translation="MAVEFMDHAAAAFVAREKGWFTEAGLDVTAYESYATGMALAAALA
FT                   RGDIDAAFICLVPAVNSRFNAGVPVKIVAGTHKHGYGVVVNKKKIKTARDLERPDICVG
FT                   CIRQGGAVDVMLNKAVDVFHLDREAVLPKIRRMPPEKQLLALQTGQLDAVVLPEQWATM
FT                   AEAGDFEMLFTSRDVWPNMQGSVLVVKEDLIDKRPAVVRQLIAVLEQSTAWMNSHPREA
FT                   AEIVSRQLQTMGGGDGPDLGAGTRTVITPAVVERSMTRMDFTTAINPAEVQRAIDFMAR
FT                   LGYLKKAAPAAEILDLRFLEAGGGE"
FT   gene            234410..235168
FT                   /locus_tag="Dole_0213"
FT   CDS_pept        234410..235168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0213"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mta:Moth_1982
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66023"
FT                   /db_xref="GOA:A8ZS05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS05"
FT                   /protein_id="ABW66023.1"
FT                   /translation="MESKLKPAWGFLPVAIFLVAWEVVARAGILPGRFFLPPFSEVMAE
FT                   FYRLTVTGVLGKSFAASLGRVLIGFFAGSVAGIVVGTAMGWRRLIDKTLSPIISLFYPI
FT                   PALGWIPLLMLWIGINEMLPITLIFICSFFPVLYNTVTGIKQVDADYILVARTLGASEG
FT                   RILFAVVLPLALPNIFTGLRLEAGMAWRTVIAAEMVAIPTGIGALLMRAESLMRIDIII
FT                   VCLIVLAVMCLVFENLFAWLERRLTGGWKS"
FT   gene            235165..236256
FT                   /locus_tag="Dole_0214"
FT   CDS_pept        235165..236256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0214"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tko:TK0021 ABC-type sulfate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66024"
FT                   /db_xref="GOA:A8ZS06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS06"
FT                   /protein_id="ABW66024.1"
FT                   /translation="MSPTFLQIASLNLALGKFCLKDINLSCGRGEYHVLLGPTGSGKST
FT                   LMKCILGFYPSHGGAVFLNGQDVSRRRPEERRIGYVPQNYSLFPHLDVEKNIRFGLHGA
FT                   GGADADRIVDRLCDILGINGLRSRAIANLSGGERQKVALARALAIAPDMVCLDEPFSSI
FT                   DEGAKRLLWVEMKKIIQEIGITAFHITHNLEEAYSMGERLSVLLDGKLHQSGPKQAIFE
FT                   RPATCDVARFLNYRNIFTGTAHTHSDGTRIDTDRFSVVVSKKITPGTRATFCVRQQDIK
FT                   ILKPDKTLKPALSHNRLSGRIVSVFPFPEYCMVCFQISGSPQIHDLEIKLPPYLRERHD
FT                   LYEGKEISVAFWEPSIILFDGSN"
FT   gene            236378..237106
FT                   /locus_tag="Dole_0215"
FT   CDS_pept        236378..237106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66025"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS07"
FT                   /protein_id="ABW66025.1"
FT                   /translation="MSTKLYDQIKERFASICDQYDLMDQDVTVKARTLSTEEAIGDPEA
FT                   DDFPLQQGRERLMQADFSGSLGQAFTDRFGDFKGPLREILAMPLENNYRRAIFVATINA
FT                   VMRHLGLADKTIHCRDKGPADCAAALAAFLAEEYGDIKILQVGFQPAMVEALAKRFDYR
FT                   IVDMDPDNIGTEKRGARIEGPDATADAIKWADLLLVTGTTVVNGTIEQFLTDTPVLFYG
FT                   TTIAGAAELMGWPRFCACGT"
FT   gene            237312..237557
FT                   /locus_tag="Dole_0216"
FT   CDS_pept        237312..237557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66026"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS08"
FT                   /protein_id="ABW66026.1"
FT                   /translation="MYDKQTLCDKIRKIYPDIGECGIDVKVDYDEGQKAWTVLLKKGNH
FT                   ELKTYLEPEDADTCMDGKQCIGLGIQIAQLKDNVGL"
FT   gene            complement(237669..238706)
FT                   /locus_tag="Dole_0217"
FT   CDS_pept        complement(237669..238706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0217"
FT                   /product="lipid-binding START domain protein"
FT                   /note="PFAM: lipid-binding START domain protein; KEGG:
FT                   plt:Plut_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66027"
FT                   /db_xref="GOA:A8ZS09"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR028347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS09"
FT                   /protein_id="ABW66027.1"
FT                   /translation="MLQKCGAAVLVLWFSLVVSAVASDPLEAGGWKRVMDKNGIKSYSR
FT                   QYQGTGIFEFKAVTVVDAPIYVVSELVRDVETYTDWMPYCSHGSSMDFINRDDKKVRIV
FT                   LDLPWPLSDREIIIHATITYDMDRGRAFFSLQNVDQWPETEARLIRVPMFSGHYTFEFI
FT                   TPDKTGVIYQYNVDLAGSLPDTLSKMIANRFLFDKLSNMQKKAVTEKYIALGEQSLDKA
FT                   LCDRILADKTRTQQIASARLAEIIQSKAVIDLMAGHMPLYDLVTTQNGIVSQKLLYAWG
FT                   SDAARKEAVKILIGAYLKSRTSDPAIVEKILSDDRLIHAIQTGSAVDNRPANVVLEAYL
FT                   NGYAG"
FT   gene            238924..239370
FT                   /locus_tag="Dole_0218"
FT   CDS_pept        238924..239370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66028"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS10"
FT                   /protein_id="ABW66028.1"
FT                   /translation="MKKALSYRLFRLGAIPKKLRPELESEGIVVADEGMAGRFVAKNVK
FT                   GPGRRYRGRVELFSGCLAVTQKRVACFTYGKRQIHIAADDPKLSDLFVDVPAPDTLLIS
FT                   FEAADFRDDWRGVLAFRFKTQKARRFFDVLTALGAGRGRPASGA"
FT   gene            239438..241240
FT                   /locus_tag="Dole_0219"
FT   CDS_pept        239438..241240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0219"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cte:CT1777 bacteriochlorophyll
FT                   c8 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66029"
FT                   /db_xref="GOA:A8ZS11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS11"
FT                   /protein_id="ABW66029.1"
FT                   /translation="MSAPYFVVYNPLTYKLMDLMPAKDITPVEVISYLSGRNARELDEE
FT                   NFLAFIDFQLEKQRVTMVDTLAIEMYSGVYIQNQLAKLAKDHLVIMLDGKRRRFSQVIG
FT                   EKKRLPRAVFITSMSSNFPAAAAAALVLNHAKIPVVLGGIHISTMPEDVDTFIRAYAPH
FT                   PEIISIVKGSGDSATLAELLEDLDSHRLKPEYTGYRLIEDGIWGEFPNVEPLEPLKIGM
FT                   LNKLPGIRWTALKDFRINPVAPYTGCPFSCKFCSISTLPKKQRAVRLRDPDDFIEELRL
FT                   AQKGPVNFKNRYFFFTPDNLLLGKKNLHNLLDKIIASDLCINYAVQISIDVANDEALLK
FT                   KIRRSGGTHFFIGLESLDLRNLKYIDKHIVGDIEKRGITASDYYAERIRKIHAQGISVH
FT                   GSFIVGLPYDYFHSISDNTGIDIARFCSKNRIGAQPSTIVDLPGSVFFNESQENNRFLY
FT                   GRRGTMDYFVSLSITDLAETNKMPPDSLYNSPLVIAAMVYEIASRVGSPMTAAKNSAII
FT                   FTRSFFRPTKNGRGFRVRQRFLDALCSAVSQTAVSLYKEQGEYLVRSAHGVRGIMERLY
FT                   DEEKNPEVRRMFARYVTRFTEQPG"
FT   gene            241252..241419
FT                   /locus_tag="Dole_0220"
FT   CDS_pept        241252..241419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66030"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS12"
FT                   /protein_id="ABW66030.1"
FT                   /translation="MVDVKLSKERNKKGEIISATVSIDRNGAIERRRFATEEEAKAFIR
FT                   RMREEAARDQ"
FT   gene            241716..245924
FT                   /locus_tag="Dole_0221"
FT   CDS_pept        241716..245924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0221"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: sfu:Sfum_2063 pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66031"
FT                   /db_xref="GOA:A8ZS13"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS13"
FT                   /protein_id="ABW66031.1"
FT                   /translation="MTLKSKALEVNLASYHVDVSIEDRYMVLRDVMADFQGLAERLDTF
FT                   LKELSHPYRNWRFIVSEARTFSLDYFYQLRNHAKGPQAADLYVKIFAGAISAAQQMQVK
FT                   VDAADNLLLFLQKAAKEGGADMAPVLQAGIDTIARLEGESFSFFINSYYQLTDVAAAML
FT                   KGGAADLLDAARLGRLLEKYLVAVCRCWQQEKDSLAWLKKEIGWTAPATPAQEEVVALV
FT                   SGVSHNAISQMLVRIRQLETKTPDSRERCRQLAQLPGYEFFVSAYRNLPDALYAAGVDT
FT                   GNGHQWKLLALFLVLNMSSLSGLHEEALREINTTLTYLISSSDIKKSREWIKRTFQVLQ
FT                   DQTARFPATALNCVRNVGESVYKTGDAELVSYFIDGVIGLGFHAPMVEGVDNDWKIKAN
FT                   KAHIQNIRAWLALIRENPQRSSRLLSALIVHLTLEGVFIRDTDLFPRDITELLNSDIGP
FT                   VYNMVKQFARLLPVFFNDIGAEGALRDISTELDEICHRKDVLVHFLRKQGHVEGSNRLI
FT                   PFMEAAIAFWLTKDKTGLRAFLPPDMYEQVRESGPYVDQMHALFSHLADSGVDLPRGLL
FT                   ALDAEAVAALCEKVPAAPDRERRRVVLVTEFYKLLDQKYTINPSDVEGYVARLNTVDFP
FT                   DLKELKRAFAESKAKNKATRLITYLEQLKALILSDERFEIEQNIYEKRHIAVDIPSMYG
FT                   SYRETKFDALGLTFRLEALLNVLFEEIVNDIDLGLITKTTFFQIYNCLRLFVRALAVDG
FT                   FSTKEIELQLDLLSQGINTRGFSFTQFLDIFKRFATAVKHIIADHFHNRHAKNLRTILS
FT                   GQPSGVVLPKYLPGDGSRSADMDHDKLTHRVSEIFFREKIALSLGLPQLDLLLTRVLNV
FT                   LFHQANTLPAERLERLLNYDPARTIAAIDVRETKKYGIIHLGNKGFNIIKLSGYGYPVP
FT                   PGFIITTEVFRCRDIMDAYAPAEEIFRQQMAHHLKHLEKSAGRKFGDPANPLLLAVRSG
FT                   AAISQPGMMDTALNVGMNEEITQGLAQQTRNAWFAWDSYRRFLQYYGMAFGLKRDDFDA
FT                   IIREHKARRSIPLKRYFSGDQMRQVALDYKKMLEDCKIKVAENPFDQLYVTVKNVFASW
FT                   YSQKAENYRKIVGISDDWGTAVTVQSMVFGNLSRQSGSGVFFTHSPRMPGDTPRLWGDF
FT                   TIGNQGEDVVSGLVNTLPISVMQKEAEQRRTDITLETHFPEIYAALKQWVDELIYEHGW
FT                   NPQEMEFTFEGPTKSQLYFLQTRDMTIRESKNITIFDPDDVLESDRFLGQGIGVSGGAM
FT                   SGRIVFSLEEIDKWAMVEPDTHLILIRGDTVPDDIREISGTDGLLTARGGLSSHAAVLA
FT                   HSLGKTCVVGCGALVCDEVKKTCRFHDVVLNAGDYISLDGAEGSVYSGFLKTRKVEAYL
FT                   "
FT   gene            246005..247258
FT                   /locus_tag="Dole_0222"
FT   CDS_pept        246005..247258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0222"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /note="PFAM: glyceraldehyde 3-phosphate dehydrogenase;
FT                   KEGG: sfu:Sfum_2062 glyceraldehyde-3-phosphate
FT                   dehydrogenase (phosphorylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66032"
FT                   /db_xref="GOA:A8ZS14"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS14"
FT                   /protein_id="ABW66032.1"
FT                   /translation="MKKQDAVKIGINGLGRIGKLTLWHHVGRKYFQEIVVNIGRSAGSS
FT                   MNDIAHYIERDSTYGHLHSYLHGCSSTPVIEEVDEVAGTMVIDGVNVRFLRKERNPADI
FT                   GWRNFGVKLVVDTTGSFLDPTVPADAPKGALRGHLVSGAEKVVLSAPFKIKDKQAAMPD
FT                   DAVTTVMGINENDYDPRRHVLVSNASCTTTCLAHMIKPLLNHFGPRKILSASMATIHAA
FT                   TASQEVLDRLPKAGKTDLRKNRSVLNNIILTTTGAANALRLVIPEMRQIGFIAESVRVP
FT                   VTSGSLIILVVNLQEELSGDPIRRERINNIYRQAAAGSPNGYLLYTDKQNVSADIIGAP
FT                   RAAAVIEGSETHTRTAEVAIDLHNVPGLDDRILSAVENATIRVPVTQTVIFGWYDNEMA
FT                   SYVNILGDRCVSVAEILN"
FT   gene            247351..247746
FT                   /locus_tag="Dole_0223"
FT   CDS_pept        247351..247746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0223"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_01292 response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66033"
FT                   /db_xref="GOA:A8ZS15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS15"
FT                   /protein_id="ABW66033.1"
FT                   /translation="MIDKKILVIDDEGAQRDVMERFIPKLGYAVRVADSAETALAVLKE
FT                   EAFPLVITDLNMPGMDGLELCRRIKQLDAGIIIYALSGYIASFDEAKLDACGFDGYLSK
FT                   PANARVLHQAIEGAFEKIFRRAREEQE"
FT   gene            complement(247845..249020)
FT                   /locus_tag="Dole_0224"
FT   CDS_pept        complement(247845..249020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0224"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: vco:VC0395_A2533 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66034"
FT                   /db_xref="GOA:A8ZS16"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS16"
FT                   /protein_id="ABW66034.1"
FT                   /translation="MEECVFIDGVRTPNGRAHAEKGWFRKLRPDELLTATYDALFERNK
FT                   AVKPEDIDAIMVGCANITGMQNDIGRLGWLAGGYPESVPSNTITNQCPSGMAATMHAAR
FT                   AIITGEADIMIAAGAEDMEKVPMAANMDFPPRLFSRYNLADFPMGSTAEKVAEMYKISR
FT                   EDMDNMAIWSNKKAAAARDAGKFKNEIVPIKGLDDAGNEFLVEHDQWIRDKVDPAKMAS
FT                   MKSPFKPDGNVTAATSSPLTQGACCMLMMSRKKADALGLSYTYKYSYGVLGGCDPTIMG
FT                   MAPVPAVQKLFARTGLGPQDIGAVELNEAFASQALACIRELKLDKDNAPFDKVNMWGGA
FT                   IALGHPLGESGARIIVTLLNVLKTDAPDAKYGLASLCGAFGNGGALLVEKV"
FT   gene            complement(249046..250896)
FT                   /locus_tag="Dole_0225"
FT   CDS_pept        complement(249046..250896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0225"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   chy:CHY_1731 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66035"
FT                   /db_xref="GOA:A8ZS17"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS17"
FT                   /protein_id="ABW66035.1"
FT                   /translation="MPWFKEYKVFGIPQSLEPYPNKSVGDILDDTAARFKKTGLIQNNF
FT                   KMTYPEAKDHADRLATALAAMGLKKGERVATILPTSIQFVIADYAIAKAGLVQIPSSSL
FT                   EPPSTLEHKFSKGSPRALICLDEYLDIAVEVMKSTGIEHLIVSSLDDYSLNPPATHKAL
FT                   DIPNAVWMADLIANTPPNPPRVDFDVEKDLELLLFTGGTTGLPKGCMLTHRNIYANSMQ
FT                   SCWAQGAAHKILKGAISVLLGLPLFHSYGHMIMHVMTMLGVNQILITDARDSKVMVEMI
FT                   KEYRPLMQMGVPTQFLKIAQEELQGMGMLGVSGSAPLPPSTQEKFEKQSSGAIMEGYGL
FT                   SEMSPCTHLNTSFLLRLAGGRIPQRLNSTALGLPGSAFLLNRGMRLIGPKAVGKAFGGF
FT                   VSFTVNRTGKTKEKKKPSIEKRGTSGIPFPDTEILLVDVDTGAILTPEDIIAGKRGEMC
FT                   LKGPQRMLGYWPDPGSGMDADGYIHTGDVVTVDKDGYFYIVDRTKDMVNVSGYKVYTRE
FT                   IDDILAGHPGVEMGATVGIPDPEREGSERVVAYVQPTDAYKEKLTPEEIISFLRERVPK
FT                   YAVPKAVKIVDAMPLTEVQKLNKKEIRKLAEQEFSGSLNN"
FT   gene            complement(251032..251592)
FT                   /locus_tag="Dole_0226"
FT   CDS_pept        complement(251032..251592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0226"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   rrs:RoseRS_2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66036"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS18"
FT                   /protein_id="ABW66036.1"
FT                   /translation="MDIPAGISVKELLLDFSPNLAKKTIAESGAATELAGTEFTMVVEV
FT                   SGDKFAYVVKDGTEFDVKEGDLDNPLVRISITAEDLQKMIETNSLDMLLGIQSDLNKRK
FT                   YNTLQTLKGSFMAQLANDDGSAVSIKTVFNGADTPAATFKMKTADSIALVKKETNPVNL
FT                   FMSGGMQIEGDMAFAMQTQPLFT"
FT   gene            251659..251907
FT                   /locus_tag="Dole_0227"
FT   CDS_pept        251659..251907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66037"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS19"
FT                   /protein_id="ABW66037.1"
FT                   /translation="MFSVNKNLVQTRHTRSEGGLFQNVVFSIGPPFVSGYRQPVKKGRL
FT                   TMFSVWSKETDMSVLLLTTMHVKNKKRVLLFYKKGVA"
FT   gene            251955..252572
FT                   /locus_tag="Dole_0228"
FT   CDS_pept        251955..252572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0228"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aae:aq_281
FT                   transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66038"
FT                   /db_xref="GOA:A8ZS20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS20"
FT                   /protein_id="ABW66038.1"
FT                   /translation="MKAEKRKDLILACSKKLFAKQGFYRTQISDIIDEARIARGTIYQY
FT                   FKNKEDIFVSLLEGAYAQWEQAVSQAVAAIDLKTIKPVDYFRLRIQTTLEFLLADPDIC
FT                   SIVLSMGFGLPEDLEKATRKLESKIRDIAVNDFMLGIHNNHVRKNINIDHAAEMIAGAA
FT                   FRSAYYMQKKAKTGDRADIDTMTDEIVNLLAPGIFLPESLKL"
FT   gene            complement(252624..253778)
FT                   /locus_tag="Dole_0229"
FT   CDS_pept        complement(252624..253778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0229"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   dde:Dde_3621 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66039"
FT                   /db_xref="GOA:A8ZS21"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS21"
FT                   /protein_id="ABW66039.1"
FT                   /translation="MILHVDMDAFFASVEQLDHPEWRGRAVVVGRSSGRGVVAAASYEA
FT                   RVFGVHSAMPMSRALKLCPDAIVAPPRMERYKEVSARVMEILDAVSPLVEQVSIDEAYL
FT                   DISGCERLHGTPETIGKNIKKQVFDTLGITCSVGVAPIKFLAKIASDMNKPDGLMVILP
FT                   EAADRFIETLPVHKVPGVGSVTKKQLALMGIETLGDVVRLPDGVLSKKLGKFGRRLKEL
FT                   SRGIDDSRVVPWHPAKSVSEETTLSRDTAEKQELRHHLLRQAGDVCRHLQKLNARARVV
FT                   FIKIKYADFSQTTRQTTLDAPVQSSDTIYRQASALLEKQTLAQKVRLIGVGVTELVVTS
FT                   GGVQMELFDGEARRDSRWEQVDRSVSAISEKFGKTMVKRGSLDE"
FT   gene            complement(253885..254403)
FT                   /locus_tag="Dole_0230"
FT   CDS_pept        complement(253885..254403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66040"
FT                   /db_xref="GOA:A8ZS22"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS22"
FT                   /protein_id="ABW66040.1"
FT                   /translation="MHDNRLQTALARLCNAWEARGLFSRHRLITVGKQMAQWRQDKNIP
FT                   GLWPRPPVLATATLDDGIGMGLDLIELYAGVAGMRIERWGLLMEPDALVEKCKTGCPDL
FT                   LGLTVLREDAMDLLDKGIAPRMPGATTILAGGPVFRMLPLSEQKEKPYVILPDLSAFVR
FT                   YVLGLNRIC"
FT   gene            complement(254396..255181)
FT                   /locus_tag="Dole_0231"
FT   CDS_pept        complement(254396..255181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0231"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   gsu:GSU0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66041"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS23"
FT                   /protein_id="ABW66041.1"
FT                   /translation="MCLILIANRYRADYPFILAANRDEFYDRPTAVLDFWEDAPRVLAG
FT                   RDKKAGGTWLGVTTTGRFAAVTNFRDPRLANPAAPSRGALVSDFLSGTTAPDQYLLDLQ
FT                   QENRPYSGFNLVAGTLDDGLFYYSNREQQVRRISPGLHGLSNHLLDTPWPKVETGRNRL
FT                   KGLLSKGKAFSPDDLLEILHDTTMPPDNRLPDTGVGIAWERVLSPMFIRSPDYGTRSSS
FT                   VILIDGEGRGLFVERTFEPGAGDRLKTQDKRISFQVGHA"
FT   gene            255397..255472
FT                   /locus_tag="Dole_R0004"
FT                   /note="tRNA-Asn1"
FT   tRNA            255397..255472
FT                   /locus_tag="Dole_R0004"
FT                   /product="tRNA-Asn"
FT   gene            255885..256868
FT                   /locus_tag="Dole_0232"
FT   CDS_pept        255885..256868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hne:HNE_0289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66042"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS24"
FT                   /protein_id="ABW66042.1"
FT                   /translation="MKNLPHDFEDYVKKVAGLSVTWGAPVPRALPQYLARQYALHEVIV
FT                   GKRIFLGILLKDNSEFKPAAFVKHLRQLLADSGGQEGYCLFARDLPGYIRRRLVERQIP
FT                   FVTPGQQMYWPALGLAAQARKTGKMPVPVEALSPAAQAVVIYALNGKITGPVTPKVLAG
FT                   VLGYAGMTMSRALDEIEANNVGRVARQGRERLLDFPGERRDLWQAALPYLRSPVRKTTR
FT                   IREKAWPVKSRIKAGQTALAELSMLVAPAEPVYAIGRQAWKKQAKSIERIPVEDEGTCR
FT                   VEIWRYDPALFAEGGRVDPFSLYLSLREEQDERVESAAEKMVEQVL"
FT   gene            256865..257626
FT                   /locus_tag="Dole_0233"
FT   CDS_pept        256865..257626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66043"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS25"
FT                   /protein_id="ABW66043.1"
FT                   /translation="MIIGLDKFAAHFSGYRDRYLLIGGAAVWLILEEAGIEPRATRDLD
FT                   IVLCLEALDPDFGAVFWDFIKAGGYKIQEKSTGKKNFYRFVKPSQPDYPVMLELFARRP
FT                   DALTLHDDSHLTPIPTSEEASSLSAILLDDNYYDFLHRHKRAIGGISFVSEYGLIPLKA
FT                   RAWLDLTQRKAAGENIDSRDIKKHRNDVLRLYQILSPEIKIDAPEAMRRDLDTFLRQTQ
FT                   PALSQEILKSLGVRDVNVVDVIQTIRIVYGI"
FT   gene            258242..258874
FT                   /locus_tag="Dole_0234"
FT   CDS_pept        258242..258874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0234"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: btl:BALH_3328 LexA repressor (SOS response
FT                   repressor); TIGRFAM: LexA repressor; PFAM: LexA DNA-binding
FT                   domain protein; peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66044"
FT                   /db_xref="GOA:A8ZS26"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS26"
FT                   /protein_id="ABW66044.1"
FT                   /translation="MRDSLTARQQQVLEYFQHEIAETGASPSLRQAADALSVSHTAISQ
FT                   ALKLLEKKGYITRHGRYSRDIHVLNPMNQSAGMHRWREIPVIGAITAGLPMYAQQEWEG
FT                   TLVLDRSCFPGDNLFALRVKGDSMKDAAILDGDLVICEPRQFAENGEIVVALVNGEEAT
FT                   VKRFFKRQDHIELKPENPAYAPLKLMFGDVLIQGKVIGLHRDQQGLV"
FT   gene            258905..259720
FT                   /locus_tag="Dole_0235"
FT   CDS_pept        258905..259720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0235"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   mta:Moth_0268 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66045"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS27"
FT                   /protein_id="ABW66045.1"
FT                   /translation="MVASGAQILVGTCGYSYPEWKDAGFYAEDTPSGKMLEAYARRFSV
FT                   TELNYTWYQMPKAPAVERMCRNVPETFRFAAKLNRKLTHEVEPNQWRQEAAQYRAGISP
FT                   LVQSNQLAAVLVQFPPSFQRTPANRSYLAALLDEMGDLPLAVEFRHVSWATDKVYAAFT
FT                   EKKVTLVAVDVPDLAWLYPSVDVVTNPDLFYVRFHGRNAKGWNAGSMQQQFDYDYTAAE
FT                   LSPWADQRIPRMAAQAGAGLVFFNNHVRAQAPNNALQLIQMLIRQGLFQ"
FT   gene            259717..260922
FT                   /locus_tag="Dole_0236"
FT   CDS_pept        259717..260922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0236"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   sfu:Sfum_0928 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66046"
FT                   /db_xref="GOA:A8ZS28"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS28"
FT                   /protein_id="ABW66046.1"
FT                   /translation="MIHRFLERSIIHINVAHFAVTVEQTLDARLRDRPVLIAPAGAART
FT                   PVYDMSQEAFASGIRKGMPVAGALKACRDCKVVPLYPARYERAMQTIAKYAGAYTPVVE
FT                   QGSGDGHLFLDVTGTSRLFGPPPDIAWRLERQIKKDFGLAPAWSVAANKLVAKVATRLV
FT                   KPVGEYIVCPGDEAPFLEPLPLGILPGVERSDLDAFAMYHIGRVNQLRPWSLAQLQVAF
FT                   DTRAQFLFDTIRGIDLSAVTSGREKEPTVAMEHEFSEDTNQRDQMEQVLYGLVEKGGRA
FT                   LRARQRFARIAGVVVDYSDGRRCARQVSIAPPTANDPALFEAARRALSLAVVRRVRVRY
FT                   IRLVLRRLLFPPVQLDLFDHDRQERQTRLLTAMDNIRSKFGDSAIYPGRMEAPGLQQLF
FT                   YA"
FT   gene            260928..263939
FT                   /locus_tag="Dole_0237"
FT   CDS_pept        260928..263939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0237"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sfu:Sfum_0929 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66047"
FT                   /db_xref="GOA:A8ZS29"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS29"
FT                   /protein_id="ABW66047.1"
FT                   /translation="MIPLTVRSGYSLMWGTAPIKEVCRVARQQGYDRLALTDTDNLYGL
FT                   WHFLDACRRNDITPVVGAELTDPATTDRAVLLVKNPEGYKNLCRLITARHLEPDFKLET
FT                   AIARHADGLAVLTRNPCHLKQWHESGVAVYGAMPRRPMSLSSPLCQTARYLNVPLVATP
FT                   GSFFLSPQDMDAHRMLRAIDLNTTVDRLGPLEAAPGEAWLASPREYEKRFEACPEALAN
FT                   TRRLSETLTFTGPEFGLVMPPWESKTGTDPGSALRQAAYRGAQARYGRDLPEPVARRLE
FT                   HELSIIIQMRFAAYFLVVQDIVRLSPRICGRGSGAASLVAYCLRITNVCPIKHNLYFER
FT                   FLNPGRKDAPDIDVDFAWDERDTVLAAVFERFGDHCAMVCNHVRMQPRMAVREVARVYG
FT                   LTEAEISRVTKKMPWFWRQDTAGLDILRELSERPESRDLDLPAPWPGIMAVARKICGAP
FT                   RYLSVHPGGVIITPRPVCEYVPVERAAKGVRIIQWEKDQAEDAGLVKIDLLGNRSLAVI
FT                   RDAIYNLRSNNHLLDESTWAPEDDFATQEAVSQGKTMGCFYIESPATRLLQKKSRVGDF
FT                   EHLVIHSSIIRPAANDYIQEYLRRLHGASWDPIHPLLADVLDETFGIMVYQEDVSRAAV
FT                   SVAGFSHADADGLRKVMSKKDKDHVLADFYRRFADGAAKNGVTPEKIREIWRMMMSFSG
FT                   YSFCKPHSASYARVSFQAAWLKTHYPAAFMAAVISNQGGFYSTFAYVSEARRSGITILA
FT                   PDVNASDIRWQGNGNTIRVGLSAVGHLSLKTMEKTLAHRKAARFTGLEDYMDRVRPDEP
FT                   EAQALIQSGAFDALCPGRSRSMIRWQWACWKNNRPPASSSPLLFDTAPGPVVPPPQITE
FT                   DPLERYRQEFSVLGFLCDTHPMTLYKTELEGRQTIKAKHLGRYAGKRVCVAGWLITGKV
FT                   VRTKNGDPMEFLTFEDETDIFEATFFPKTYTRFCHMIDRGSPFLLWGTVETNWGAVTLT
FT                   VEKIEGLPDYNNRL"
FT   gene            264050..265327
FT                   /locus_tag="Dole_0238"
FT   CDS_pept        264050..265327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66048"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS30"
FT                   /protein_id="ABW66048.1"
FT                   /translation="MSIQILNKDHGQSAGKLIKEFAQTLDRKKQRRHELWILSCYIDLD
FT                   LIEKYVDYLLKSIRLTEVFLAFNFAEIYKAAPIETEDKLNSIKKNLNDININFEWRVLA
FT                   SSKLVHSKGYSLIQRSGDKVSGGVVLITSANFTKPGFKGDNIEIGYASNRKTDVQNFEK
FT                   TYDYLWENLGVDIGAAIFRQEKYLLQFALLSSGLFLHKWSGSLSQDVGIKYKLTELAKE
FT                   KGTIAPELAAVGFETGDTFTRQVLQLGDLPQKEVPRSFITRFTIETYWGRWCPSDAWNT
FT                   LSATFEGAKQFVAQFKEATKKSILSKIKKEALEIQNDLIHKKLIKPVKPEHLDNWILRI
FT                   QELRNNYRRLERFFTGYEAHDLPYSIEQKSDVIDLFESIEESIELTKATNIAKEKIVFA
FT                   LDDANPDLIRLTDEEKQIIKDMSSSA"
FT   gene            complement(265545..266537)
FT                   /locus_tag="Dole_0239"
FT   CDS_pept        complement(265545..266537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0239"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: dvl:Dvul_2599 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66049"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS31"
FT                   /protein_id="ABW66049.1"
FT                   /translation="MPRKKSDKTYGENLIWLFAELYFTGRRRSLVDLAKEMDCSKQTVI
FT                   RMVDHISRAYVPIEETKDGRKSYYHIQRPEKLPGALSMSPSEMVMLQMCLAFTRHLLGK
FT                   DLLMESERAIQKSSTLAAGATGADLFDAFLPGTIDYTPRQQDIRVLMKAMEEKTVCKIT
FT                   YKNPMESRGKTFYIKPYKLFAHNNALYLHAGMARYPGSKKTEFEFDPLLAVHRLKAVEP
FT                   TDRKFVFPKTYNFEKHFNQAFGVIKQETFQVEVSLTGYAAAFAEERRLSPDQKIEQKRD
FT                   GIVLTFTASSEPEVVSWVMSFGAEVKVLSPDWLVEEVKVAAENIRKRYQ"
FT   gene            266668..268929
FT                   /locus_tag="Dole_0240"
FT   CDS_pept        266668..268929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0240"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: hit:NTHI1638 predicted serine/threonine
FT                   protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66050"
FT                   /db_xref="GOA:A8ZS32"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS32"
FT                   /protein_id="ABW66050.1"
FT                   /translation="MAIPKQFRRKRSMNMGMNQAFFFSRPQVEDKNGRFVVRKCCDYML
FT                   RLMGKRFSLDAETVEFICWLVGEQRREIRKFILTRLPEDEQEYFDEFLSPDTHDDGMFG
FT                   ITIVQTLQISKDRSIAADCFQFFSQILQRRRKALAGNGNSGLQKSFDQLQSIFRLTDLE
FT                   TELCLFLFIISAYDTPEKFFDDHLHTDRFQGRGFLCTALNASKHEINQAIGKTLTAAGL
FT                   VEISGGFKSTIRLTDEVQNILFDPACDILQKTNLKDAKKQPALPLSYHFVPEADISHIL
FT                   SLLCGKTDTATHILLYGPPGTGKTSFAYGLSRKLNDPVYEITHDNSQENDSKSRRLSLT
FT                   VSINSMNRGQGAIFIVDEADNLLNTERHWMISGEVQDKGWLNKLMDKPGLRIIWIVNAI
FT                   HSIEPSVARRFAYSRHFEPFTCKQREQLWDNVIRKNRCKRFFTTEDLRQLAREFDASAG
FT                   VIDMAVKKAKEAGHAGRAPMLQAVRQGIEAHQALVNGGHKKPPKEAIDHRYSLDGLNIS
FT                   ADIRQVMFQAEQFSRHLKNTTNMTHYNFNLLLHGPPGSGKSEFARYLAQHLDRELHVRR
FT                   SSDILSPYVGVAEKNIRQSFDQAAHQGAILLIDEADALLFPRANASRSWEISHTAELLT
FT                   AMERFRGLLICTTNRLNGIDSAAIRRFNHKIRFDFLTPDGSWIFYNKMLTPLAKLAPDD
FT                   RNIKTVKNLRRLTPGDFKIVRDRFAFYPKEEITHTMLVDALGQEATVKQQQTGEKPIGF
FT                   "
FT   gene            269095..270585
FT                   /locus_tag="Dole_0241"
FT   CDS_pept        269095..270585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_3050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66051"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS33"
FT                   /protein_id="ABW66051.1"
FT                   /translation="MHNHTPRISKSQYLRGLQCPKSLWYYRHRPDLAPETPPGRQALFD
FT                   AGHEVGVLAQQYFKTGIEITEDYLATDKAICSTQKAVADGHIHIFEATAAAPDGAFSKI
FT                   DILKKVGKSDAWDLVEVKMSTGVKDYHVDDMALQRHAFTGAGYNIRKSILMHINNQYVR
FT                   SGDLDLLALFTLADCTEQVTSRLADVDGHVARLLDVIRQQKEPDVAPGDHCFSPFECDY
FT                   TGHCWPTHPPRSVYDLFPTGPKLNALLARDITLISEIPDDFRMTNRQQVLVQACKTGQV
FT                   QLDPAKIQKFLLSLKYPLYFLDYETINNAVPLFDRTRPYQQVPFQFSLHVQNEKNGPVN
FT                   HVEFLSTEKTDPRPAFIEKLIAHCGTKGSVIVYNKAFEKRINDELGRDFPQFKPALNRI
FT                   STRMVDLLVPFRSRHLYHPDMNGSASLKSVLPAFVPHMRYDTLEISDGGAAAQLYLSCL
FT                   KDALPAEEQQKVFDNLRVYCGQDTLAEVKLLEVMYGLV"
FT   gene            complement(270853..271938)
FT                   /locus_tag="Dole_0242"
FT   CDS_pept        complement(270853..271938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS34"
FT                   /protein_id="ABW66052.1"
FT                   /translation="MNLFKCYTSHSKKEIKTILEVPFPVLWNDNKERRRSDVTVFDESQ
FT                   HPLLIFEVKMEDELSEDQLDDYIKYALAMNAGFILITKYPAEDWICKTLKTKMSRQYDI
FT                   VTINDLYKNLRRLKSKGLFQQEFIKYLEESCMIYNQILPQEVGLFLQSLFLRTSQQNRA
FT                   TTEKITRGIPYALEIINSNLEFLGNSVREKIEVRYKKRMVVSVLNVFEPFVTKETLEKL
FT                   LKVATKDEDHEVRVKKYSNEIYGYYWFFCSLQLNDNIKYVGLEFGYVATVEKGISRRDV
FT                   VFKNYVQLNPDPDGASYLESPHPLKYKQNKGWDAGDEIKAFDWFYKSIKVAAERYLKHY
FT                   KMNKNQKFKIACKKVEMLLDD"
FT   gene            complement(272158..273219)
FT                   /locus_tag="Dole_0243"
FT   CDS_pept        complement(272158..273219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66053"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS35"
FT                   /protein_id="ABW66053.1"
FT                   /translation="MSNRKNKTTKSIEMDPSRGELLVYQGKDGDMKLEVRLYDDTIWLT
FT                   QAQMSELFATDRSVITKHLRNIFNSGELEKDAVCAKFAHTAEDGKQYQAQFYNLDAIIS
FT                   VGYRVNSIRGTQFRIWATQRLREYIVKGFALNDERLKEPEGGRYFEELLARIRDIRSSE
FT                   KVFWRKVLDIYATSIDYDPTVETSQSFFKQVQNMMHWAAHGHTAAELIYERADAARTNM
FT                   GVTNYPGNKLIKRDVEVAKNYLNEEELDLLNRIVTAYLEVAEIQALNRNPMTMADWIER
FT                   LHQFLTMTGRDLLSHAGKISHEEALRKAHEEYEKFRVRQLAEPTEAEKHFVEAEKKLNQ
FT                   IEIANKSGGRKKL"
FT   gene            complement(273252..274013)
FT                   /locus_tag="Dole_0244"
FT   CDS_pept        complement(273252..274013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0244"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   dno:DNO_0219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66054"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS36"
FT                   /protein_id="ABW66054.1"
FT                   /translation="MNENIRIGNISIAVTRKKIKNVHLSVHPPNGRVTMSIPVGTRLDV
FT                   ARAYAISKLAWIRDKQEKLAGQARETPRKFIERESHYLWGRRHLLAVVERSAKPSVSVD
FT                   HKRITLFVRPGSDQAKRASVIHEWHKSLLHETVPRLIGKWESRLGVKVNAYFLQRMKTK
FT                   WGSCNCTKRHIRLNTELVKKPKDLVEYVVVHEMAHLIEPSHSDRFYALLEKHYPFWREA
FT                   RAELNELPLTAEEWKSDYTSKVNPVIRRIYR"
FT   gene            complement(274010..277126)
FT                   /locus_tag="Dole_0245"
FT   CDS_pept        complement(274010..277126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0245"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: dno:DNO_0220 type I site-specific
FT                   deoxyribonuclease; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   protein res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66055"
FT                   /db_xref="GOA:A8ZS37"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS37"
FT                   /protein_id="ABW66055.1"
FT                   /translation="MPEKPRPERITQNRVIALFTDKSRPDCLGYQYLGDWSKRDNNRPV
FT                   EAEYLRANLKKRGYSDAHISAALLQLEIAAGTTGVTLYQANLRTYNLLRYPVKVLLAPG
FT                   QPHEDVHLIDWEHPENNDFALAEEVTLKGGYERRPDLVLYINGMAIGVIELKRSSVEVA
FT                   DGVRQLITNQEKIFNEGFFSTVQLVFAGSDSQGLRYGTTGTPEQFFVQWKDEEGDSALA
FT                   PGTLLDKPLAQMCNKKRLLDLIRNCIIFDAGQKKVPRPHQYFGFKAAQERIRRREGGVI
FT                   WHTQGSGKSILMVLIAKWLMEHDPDARILVITDRDELDKQIVDVMRNAGVVGEDAPSPR
FT                   ITSRAQFVEKIGATTPRLLCALIHKFETTDLKGNPPPIHGRFYIFVDECHRTQGGDMNR
FT                   QMKRWMQDAIFIGFTGTPLLRRDKLMTRDVFGTYIHTYKFHQGVADKVILDLKYEARNV
FT                   PQRLTSQKAIDAWFEQKTKNLNNFQKAIVRKTWATMEKLMSAGERKQRIIADIIQDFSL
FT                   KPRLNNDRGTAILVTASIYDACHYFRLFQNTGFGAYCGIITSYEPNANAISKEPANSNE
FT                   RYKFDTYKQCVLDAFTTTEKYEAETRRRFIEEPANCKLLIVVSKLLTGFDAPSCTYIYL
FT                   DNEMHDHTLFQAICRTNRLDGDDKEYGHIVDFKELFGDVQQAIAVYNSDELDIDEGGGG
FT                   ENNIHLKDWLKEGKKKLDDTREALKYLCAPVPEPREMEQYLFYFCGNADNPNALTDTEA
FT                   LRVSFYKSVATFVRAFAAVSQYLAEAGYSAAEIATLNNEVKFFSDTRAAIKKHSGEELD
FT                   IKPYEADMRHLLNTYIQADPADPLGEMDRYSLVELIIKTGIHDAIAKKLNEKGKLSKTA
FT                   VAEGIIHNIRKTIIREQLADPRFYEEMSKLLDDLIKQRQDDTKSYEEFLKQAEALVKKM
FT                   SKGQPGKNIPQELHGRPEATVIYNNLPDILMHLASEDMVQDPVTGFGATRLGLALEIDR
FT                   AMREHAPAGWKGDDTREKQVLNALFPLLKRNRKATMAAFELIKNMSGYA"
FT   gene            complement(277119..279092)
FT                   /locus_tag="Dole_0246"
FT   CDS_pept        complement(277119..279092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0246"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   tfu:Tfu_0065 similar to uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66056"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS38"
FT                   /protein_id="ABW66056.1"
FT                   /translation="MKISTILDHIDSGHMALPEFQRGYVWNRDQVRALFDSLYRRHPVG
FT                   GLLVWATESRSATHRGDGPLAAGVVKLLLDGQQRMTTLYGVARGKPPKFFDGNLQVFTG
FT                   LRFHLESEIFEFYQPVKMKDDSLWIDVTGLMKNGSAGLGKFIATLSTNPELAPKIGDFA
FT                   GRLSQLLGILEIELHAEEVTGADKPLDVVVDIFNRVNSGGTKLSKGDLALAKICAEWPA
FT                   GRDVMRATLKKWADADYNFNLDWLLRSVNTVLTGEAKFLYLHEKSADEIKDALSRATRH
FT                   IDTCLNLISGRLGLDHDQVFFGRFGVPVMARYLDQRECNKLGSMNEKERDKLLFWFAQA
FT                   AMWGRFSGSTESFIDKDLEAIADGDGNLDPLLEQLRLWNGGLRVEAGHFTGWSLGARFY
FT                   PVLYLLTRMGGSRDWGTGLPLKANLLGKMNRLEVHHIFPKARLYKAKALDFRKPEVNAL
FT                   ANFCFLTKDSNLKISDRLPEEYFPEIEAAHPGALASQWIPDDPVLWTLDRYRDFLVARQ
FT                   KLLAAELNHQMETLLHGDTQWLSSGVSPKLEPAIVVGGISSENEEAELDKLNAWIESLG
FT                   LPSGVMSYDYADAQSGRQIAVFDLAWPLGLQEELSQPVAVLLNEEPATIALASQAGFRC
FT                   FTDGQAFRKYVEREMMAGDAHA"
FT   gene            complement(279465..281609)
FT                   /locus_tag="Dole_0247"
FT   CDS_pept        complement(279465..281609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0247"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   fjo:Fjoh_2693 protein of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66057"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS39"
FT                   /protein_id="ABW66057.1"
FT                   /translation="MRTGRYSIAELFGNRHIEQLVIPEIQRDYVWKAEQVQGLLDSILK
FT                   NFNDWKQAKGTPRFKVVPEEPQDIEKHPSLENDFTAFYAQRYHGTNIGFVYAYSDGDLP
FT                   GQYYLIDGQQRLTTLYLVLLAVASRNDDLKERFRARYCLQSTDANPGAKAIPTKLDYRL
FT                   REHITDFFHHCVPYLLENPEHAETLQQQSWYRKRLDEDKTVKNLINNFTKIYSHLENEL
FT                   DSDCSDDAFKYLDDLVDCWYFDTNESVQGEELYIYLNARGESTATNENKKAELLKSLSD
FT                   EKKEDWGKKWEEWQDFFWQKRRKGLEDKHNNPNADRGFNSFLACIKNLEKLKNKGGNEC
FT                   EETSLEVIEKYLSALKWLGDNKGSFKKLYSYSGWVDSWFNEIWSVFNNPAMTDWDANFK
FT                   DDKKPTERNKMVLIWGSLLSIFSYFERNDWEPVRINIDDIERIFRTIRIFWLRYKNYNR
FT                   SVASLPAAVKDILFNDSPEFIGSESKEEALKWNLLKNTGDEERRHFEAVIWEIEDHPFN
FT                   IDGRDLDNQNISHLVDLNEQLTLETLNNVKETFYRLFPKDNKKQEERTIAQILLYYGEF
FT                   WHHISPWYHKNYDFSDWRRTIRGKGNVEQNVAASTTVFRLFFQDFMKKNKSPNEFLKMK
FT                   QDEWPESIDPVSETSLRKALIWYSQKLQDNFLKEGMYVVIDRPQYEESDANFPKLSPIW
FT                   NTSGSFKGRNKKMSEQKENG"
FT   gene            complement(281606..283453)
FT                   /locus_tag="Dole_0248"
FT   CDS_pept        complement(281606..283453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0248"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   sbm:Shew185_2195 protein of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66058"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS40"
FT                   /protein_id="ABW66058.1"
FT                   /translation="MSEFIYTVEEIFDSSTMKGCLTQHGCSAFRIPSYQRGYKWGSETN
FT                   QPVERLLSDLIKAWKAGAKEYLLQAITVKKNSSGNKNYFLEVIDGQQRLTTLFILLYVL
FT                   ERQIEPEVFGKTIAADKLLYSIRHEQQSLDDLIKNCVDTTKEKAIPFEELKEKQRVEEE
FT                   TQQDVYYLKCAFFRCVCELDSISVENNGGHDKLNGLKNFVLTKTKLLVNAVEPHIRGED
FT                   IFCNLNSNRVFLTETELIKGLLLTRVARESATARPRQYREILEKRIHLGRKWDEISRWA
FT                   NQPNIRSLYFTAFKNSGDDHMHDILELVALQMKNSYEQTSKGSVAENPLFEYFLEQGEQ
FT                   GRWEPIFLLLNNTYATLDEWYECTEDYHLLGYCLVEKNETEQKVLLKDLLGKSTKVEVR
FT                   KCLLEQRNEIIKSDSEKQILAYGEDNQRIKSILLALSVFRGREIGGRFDFFAYQHEDWS
FT                   LEHIFPQTPFGKEAKLTHEQEKTAFDVLINNEGNILSEEERKNIEIARASQENAETMMA
FT                   KVNEILIKVPLLHQLGNLCLLSRKDNTAMGCLMFDDKRKVIRDRIARGSFVPSHTYEVF
FT                   SKMIVGKDTSLQVWSKSDIESHQKEIVKRVKELIEEKSS"
FT   gene            complement(283450..284631)
FT                   /locus_tag="Dole_0249"
FT   CDS_pept        complement(283450..284631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0249"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: sbm:Shew185_2194 restriction
FT                   modification system DNA specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66059"
FT                   /db_xref="GOA:A8ZS41"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS41"
FT                   /protein_id="ABW66059.1"
FT                   /translation="MKSKENSQFSTRHSPSVPPGYKQTEVGVIPEDWEVKPLAFVVKYT
FT                   NGKAHEQSITDSGNFVVVNSKFISTEGIIRKFAQMRFCPAEKGDVLMVMSDVPNGRAIA
FT                   KCFWVDCEDTYTVNQRICVLNPCGIDGKLLYYKLDRNPFYLTFDDGAKQTNLRKEDVLS
FT                   CPLSIPNTEAEQRAIAAALSDVDALLDGLDRLIAKKRDLKQAAMQQLLTGQTRLPGFKG
FT                   EWEIKRLGDVLMVRHGKSQRGISVSDGKYPILASGGEIGRTNTCIYDKPSVLIGRKGTI
FT                   DSPQYVDSPFWTVDTLFFTEISTEANAKFIFSKFSIIPWRTYNEASGVPSLNAKTIENI
FT                   EIFLPSPTEQTAIAQVLSDMDAEIAALEQRRNKTRDIKQAMMQELLTGKTRLV"
FT   gene            complement(284628..285779)
FT                   /locus_tag="Dole_0250"
FT   CDS_pept        complement(284628..285779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0250"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: tdn:Tmden_0947 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66060"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS42"
FT                   /protein_id="ABW66060.1"
FT                   /translation="MKESQTIVNPYPSPISYKGEYHYRSGSTKQQLKGAALETFLLRKQ
FT                   GRHWDSVPTPYAKEEDLDANAFKQFRRAAAKSGRMDASVLEDSPRRILENLNLIEGGHL
FT                   RRAAVLLFHETPERFITGAYVKIGFFRTDADLIYQDEVQGNLFDQARKTLDLLLTKYMK
FT                   AYIRYEGITRVERFLFPPEALRELILNALVHRDYGSGAPIQIRVYEDQLWIANDAIIPP
FT                   DFTVEHLLSRHVSKPHNPLIAGAFFRTGDIESWGRGIEKVRTACEENGTDFPSFRFEPT
FT                   GLMVMFKGRIPVEEATPTETEASGKRRENVGKVSGKILDACRENPSITIPEMAELIGIT
FT                   ERSIQRNIQKLKTDGFLCRVGGRKEGHWEVTGENGELKMENGE"
FT   gene            complement(285776..288202)
FT                   /locus_tag="Dole_0251"
FT   CDS_pept        complement(285776..288202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0251"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: dno:DNO_0223 type I
FT                   restriction-modification system, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66061"
FT                   /db_xref="GOA:A8ZS43"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS43"
FT                   /protein_id="ABW66061.1"
FT                   /translation="MALKKSELYSSLWASCDELRGGMDASQYKDYVLFMLFIKYISDKY
FT                   AASDDYAPPVTIPRGASFQDMVKLKGKSDIGDKINTQIIQPLIDSNSRLARSDFPDFND
FT                   PNKLGEGKAMVDRLTNLISIFQKPELDFSKNRADHDDILGDAYEYLMRHFAQESGKSKG
FT                   QFYTPSEVSRIIAKVIGISPQKAVASTTAYDPTCGSGSLLLKVAAEAGKHITLEGQEKD
FT                   VTTAGLARMNMILHDFPTANILNGNTLASPKFKDGEKLRTYDFVVANPPFSDKTWSTGL
FT                   TSENDPYQRFEWGVPPAKQGDYAYLLHIIRSMKSTGKAACILPHGVLFRGNAENVIRKR
FT                   LVRSGYLKGIIGLPANLFYGTGIPACILVLDKENATARKGIFMIDASRGFIKDGNKNRL
FT                   REQDIHKIVDTFRKQAETPRYARMVPFDEIADSKNDYNLNLPRYIDGTEPEDIQDIDGH
FT                   LRGGIPDRDIDALSDYWAILPTVRAALFKPLRPGYAQLAIPHSQLKQAILGHDEFTAFK
FT                   KTVTKIFDKWQKANTPALKGFDKKGHPRALIEAIAEHLLTAFRGAPLLDAYDVYQHLMD
FT                   YWAEAMQDDCYLIAADGWVAKPHRVMEEVKAGKKKGEMKDKGWACDLIPKPYIVARYFA
FT                   KEQAELDALQSELESVTARITELEEEHGGEEGAFADLDKINKGEVNRRLKEIKGNSDYA
FT                   DEEKILKQWAKLEQQQSGLKSKIKEADTALDKLAYEKYPRLSKDEIKTLVVDDKWLTTL
FT                   AVAVQGELDRVSQTLTSRIRQLAERYATPLPRLVNEVTDLSGRVDAHLKKMGYQP"
FT   gene            288729..289730
FT                   /locus_tag="Dole_0252"
FT   CDS_pept        288729..289730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66062"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS44"
FT                   /protein_id="ABW66062.1"
FT                   /translation="MHPNLFHFATSELSQDAVLCWLLSWAENNHRQHYPHLHKVAKNLL
FT                   DSIYQRSGAKAPAAFSSIEIRKQDGGIDILCIINHEMAILIEDKAGMKQHSDQLARYKE
FT                   YVFKKLGFAADKVIQVYIQTGDQSDYSEVEKHGYQVLRRLDLLDIFEDEAGLAARSQSD
FT                   IFRDFSDYLRQEENEVQSYLVSPPSQWSWNAWKGFYAEVQQQLQDGNWDYVPNPAGGFL
FT                   GFWWHFVGTDEYEIYLQLEQENLCFKIFVENAEKRRHLRQHWYEKIILKCSEHGLKARR
FT                   PGRFGNGRYMTVAIMDQDYRAVDDKGIIKMAETLKTLKAAQSVMDGCMMGKR"
FT   gene            289727..290275
FT                   /locus_tag="Dole_0253"
FT   CDS_pept        289727..290275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0253"
FT                   /product="Cell division GTPase-like protein"
FT                   /note="KEGG: jan:Jann_2750 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66063"
FT                   /db_xref="GOA:A8ZS45"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS45"
FT                   /protein_id="ABW66063.1"
FT                   /translation="MSTGIGETDFMIAVAGGAGINCANRLMERKLNRSWFMAVDTDVSA
FT                   LARCAAFRKITVNSRETGADFEQRVSPLLGHRRRLFVIAGLGGEAGSSFALWLAEYGSR
FT                   RQMSVECFVFLPFLFEGARNQRADETLEKLEPIVYRLHVFKNDDLRNRNLNAMTMTQVF
FT                   DVLHDAVFCRLAPCLEQGG"
FT   gene            290333..290890
FT                   /locus_tag="Dole_0254"
FT   CDS_pept        290333..290890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66064"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS46"
FT                   /protein_id="ABW66064.1"
FT                   /translation="MNARLIINNREVLLGHRHLEEFVFTLDDDPAMREIFHELAKSPSS
FT                   EIRKDISGNQYLSEETRRLLIADTSLEVMRAIILSDEAQALMTQSDLERYLATGDAEIL
FT                   RALAINLKELARKYKVCDLNWLCENLIRHPDPATRYNLAANIYTPAAFLKKLAGDDDVD
FT                   VARKAAETLREVGNGFDPDDDE"
FT   gene            290877..291491
FT                   /locus_tag="Dole_0255"
FT   CDS_pept        290877..291491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0255"
FT                   /product="Tubulin/FtsZ GTPase"
FT                   /note="PFAM: Tubulin/FtsZ GTPase; KEGG: gvi:gll0298 cell
FT                   division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66065"
FT                   /db_xref="GOA:A8ZS47"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS47"
FT                   /protein_id="ABW66065.1"
FT                   /translation="MMMNRPTIAIVGVGGAGLNMVNYLKRTGINDPDRAQYIAVNCDRE
FT                   SLSRCEADILLPIGVKSFDGPGAKGNVRLGRDCAIESRDTIMPALEAFQLVFIVAGLGG
FT                   GTGTGAAIEIARMGRDLGAITVALVTLPFSFESKKRMQNAEKGLAVLGQFTDALIVLPN
FT                   NRLRRLASLQLTIKELFDLSSEHIRQAISGFIPLLYQAEGL"
FT   gene            291527..292033
FT                   /locus_tag="Dole_0256"
FT   CDS_pept        291527..292033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66066"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS48"
FT                   /protein_id="ABW66066.1"
FT                   /translation="MEQTKVLVYFNQKKGVFSVETLEGENKGRVIAHVQKITLTECRFS
FT                   KNKDKTAGIIGMWQERFRDMDPSRAVGHYFEAEEDADGFSPVYYGELFKYDSRSERYIV
FT                   DDDGDFMAFSHETSQELQNDPNFEQATLDKPALVCMDLWEDEDPKAEDVRGIAYYWRKK
FT                   SKKLS"
FT   gene            292089..292511
FT                   /locus_tag="Dole_0257"
FT   CDS_pept        292089..292511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66067"
FT                   /db_xref="InterPro:IPR019908"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS49"
FT                   /protein_id="ABW66067.1"
FT                   /translation="MSEKDTITGVKPCPFCGQADISVRSETIPVLGGTGDLQEVTIYQV
FT                   CCKTCNAEGPSLMVKTTAKHAESEAAVLEQWNQRLGRHKDAPPNLKNCPFCGEQPEVLR
FT                   DPEPAPILVEIFCSDCGATGPANDKDDLMVLWNKRA"
FT   gene            292508..293143
FT                   /locus_tag="Dole_0258"
FT   CDS_pept        292508..293143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS50"
FT                   /protein_id="ABW66068.1"
FT                   /translation="MTDTIMEYKIQADPEQLQPWPALKKKLSTSAPEIPGGGFRQSRRV
FT                   QGMIDCHSLARGYSQLFIYIQKGLGAYAVEISKMIKTIYSIKDSDIRLRLYLAAFGDPE
FT                   LTVHPRPYTTYGYKTATRTIVENLAGEGIKTPCLLDTLDMNPYLKAGQYRRADRGLIII
FT                   FASALEDVRFSETAMEKLSRQKNSYIVAVSGEEVKGALLRQPNFEQEG"
FT   gene            293145..294113
FT                   /locus_tag="Dole_0259"
FT   CDS_pept        293145..294113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS51"
FT                   /protein_id="ABW66069.1"
FT                   /translation="MQTLVRDVEKLWNGKKASFEQRIAGWVNDVNKNKAKTEEARKRFH
FT                   QWDPLRVYTSVSRIKNAPAYFSLRFFGQEVAVIQANGKQAVQLSIEPKHVNWTERDFDK
FT                   NFRSKFNAGKIPWDSARAKRFRELFKAIKNPTPHSREHLVETEIINSMKKFPSKSGISN
FT                   IQPVFFADCPLQVPLPIKGSSGVPEESRGGNMDILARRGKGGRNARLSVWELKKPGMPN
FT                   AALIKAIKQSIIYASTLRMVLRSQSGPEWYKLFGFNGRLPKNLKIEAVLTIAHKDKDEF
FT                   EQAKKTLSPWTPLCMGNDSILPHVAYYNDATYKVQQIIPIN"
FT   gene            294125..295450
FT                   /locus_tag="Dole_0260"
FT   CDS_pept        294125..295450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0260"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dvu:DVU1700 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66070"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS52"
FT                   /protein_id="ABW66070.1"
FT                   /translation="MQIIPHKGTHMIGGTCVELRAEGQGLLLDMGMPLVNPNGTEFDEN
FT                   TVKRPIEKLMADDILPRVPGLYDKSECNLAGIVLTHAHRDHFGLSQFVKPDIPIFAGQT
FT                   TADLIGAIRLFFPDQLDPARLTIIKAHWQPVTVGPFTIKSHPVDHSAPGAMAVEVEAAG
FT                   KKVFFTGDLRAHGYKYRTFENLLKNPPKNVDAMLMEGSSLGRGPTEYAYPDESSVKEAL
FT                   INEIKDDPNLVLLFCSSQNVDRVVSACRAAQATGRELVMDYYTAYILYLLKNTSRNIPQ
FT                   FFWDEVRLLSWPWHVHALEENGHKGFVITLNNKGGTVKPEEIFNNPDKFLVLAKPNRTL
FT                   PTLTKGLGADQITCMWSMWSGYLKDPEKNFAAFLRTKNIPDGQIKHIHTSGHATIKDLG
FT                   RLVKAVNPGLLIPIHTFHPDDYDQFIDPARVKVLNDGDVWEI"
FT   gene            295666..299319
FT                   /locus_tag="Dole_0261"
FT   CDS_pept        295666..299319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0261"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sfu:Sfum_1225 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66071"
FT                   /db_xref="GOA:A8ZS53"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS53"
FT                   /protein_id="ABW66071.1"
FT                   /translation="MTTVPDQFVHLHVHTCYSLLDGIIRPDDLVARAVEYKMPAVAITD
FT                   HGTMFGVIQFYMEAVRAGIKPIIGCECYVAPRTIADKTPADHAGLSHLVLLAETMEGYR
FT                   NLCRLATIAQQDGFFHKPRIDKALLQKHAKGLIGLSACLKGEIPHLICRGRQDEADAAA
FT                   RQYCDMLGDRNFFLEVQNNGLPEQETVNNALLDMSRRLSIPLVGTNDCHYLDPEDSRAH
FT                   EIALCLQTGQTIHDTDRLKFDTNQLNFKSTGEMCVFLEPFPRAAANTVAIAERCQVAFD
FT                   FSARHFPVLETPPGKTMADMLEDSAMAGLKKRWQHICKQSSHADKSVYQQRLAYELAVI
FT                   NEMGAPGYFLIIADFIAYAKNNGILTGPGRGSAPGSLVCYCLGITGVDPIEHGLLFERF
FT                   LNPERNVMPDIDVDICINGREKIHQYLMDKYNRDDGEDYAACIATLGTMRSRAALREVG
FT                   RALIMPLDDVNKVAKLIPPGARSLDDALKKEPALRALIDSKPEFGELMDVIRKLEGLPF
FT                   HILMNAAGIVLSDKPLTCYTPLYRFKGEMITQLDARSLETMGLARLDLLGMRDLTVISD
FT                   TLQLIKNQGRQTPDLSRIDTTDAATCQLLSKGDTFGVFQLASTGMKELLVKARPRSLSE
FT                   VAVLIALYRPGLLENGMVADYLGRKQGLKDTTYPTAKLEPILKETCGLPVYQEQIMQAV
FT                   QVLAGYTPGQSDDFRKAMGKRIAEKIADHRQRFINGAAAKGIDKATALQLFEQLEYFGA
FT                   YGFNKAHSIAYAFIAWQMACLKAHFPAEFMAVWLDISFGCVDRIARLIGECRDSNIPVL
FT                   PPDVNQSARQFTVVNGQIRCGLACVKKTDKGLIDAIIAERTAAGPFVSLSDFCNRMSAG
FT                   RPELLQDRKALENLVKAGAFDSTGATRSQMMAVLDEILKPSLDLQQPRKPAVPALPEVG
FT                   EWSPHLRRALEKRAMGICLTPAPPAYCHAKLKRPTTTPLCSIYENPQGGRVAVDGIWKA
FT                   VEYKQGKDGCPMALAELEDNNAAIEVVIPAEIYESARHALLPGRPVIVEGRYECDEVRI
FT                   SPLQAERIIPLTDITFPGLPQGKKEDLPRSLACPFCGHAQTWLRMEYAPPEDLKTSTDM
FT                   EIACQLRCGYCRAVGPVTTVGITADRVQVEIAAIGQWNQRAGHGTDDTRKLKPCAFCGH
FT                   HPPDIEYVIDPDPLEEIETGVINQITCPQCGAAVHSMCFCDPCLTKWNLRQ"
FT   gene            299412..300380
FT                   /locus_tag="Dole_0262"
FT   CDS_pept        299412..300380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66072"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS54"
FT                   /protein_id="ABW66072.1"
FT                   /translation="MTTTRTISRCDFLLNALAACAGTVLPLSLSAPSPTDSLAPSPRPI
FT                   EIKRLAPMTHPDDSFKTTVFCMGRPGLYAVSRMVHRFGHIDRNVDYLFVDTHDTEDTNL
FT                   YLPEATRTLLTDLLAESHLALIVADTERGIPEALRTQFAEWRRQSSNMTVTFCLAPAAP
FT                   ANARQPVWTRQPNDVIVNVPATPADTTALMPYAIFGLCHPVYYPGLVGLDLDDIKTVLS
FT                   RTGGIRFGMATAVGENRPATAMRKALKQVYAGIPPSAVQTGLLAFITTNDEDDLSFEDL
FT                   TEAADLLHEALRPFDNAEYTWAHRVTPSVKKGEVLVTVYAG"
FT   gene            complement(300384..300938)
FT                   /locus_tag="Dole_0263"
FT   CDS_pept        complement(300384..300938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0263"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sde:Sde_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66073"
FT                   /db_xref="GOA:A8ZS55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS55"
FT                   /protein_id="ABW66073.1"
FT                   /translation="MAKLTLHSNSIVLRGRMIRIAKKDDLEGIMAIFKSWPKSYDYESA
FT                   QSYYKNFFDGKHDADVVFVLEKEGEIVGTAGYCLEQSEGVKGIYWLNWLYTSQHHKCKG
FT                   YASTLLDFVIEQLKKKNARKLFVNTSSHKFYKNAIRLYVKFGFEEEGCLEKFYSESEHQ
FT                   IIFGLDFKMIQKIPFDSSLSA"
FT   gene            complement(301074..301667)
FT                   /locus_tag="Dole_0264"
FT   CDS_pept        complement(301074..301667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66074"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS56"
FT                   /protein_id="ABW66074.1"
FT                   /translation="MTLGEKQTIIEKEVLLPKQSRKEKARDLQLLQENLELILKHQDMI
FT                   LASPELFHSGPVDAVIGLIYMGGHRAPIGVLLRLWQQDLLMALCPHCAGRLYIFSAGGS
FT                   PLSGINRATGICASCKQFVRTGLPSIGMVLKALKELKASLNRQRILRTRGQYFSFKDGL
FT                   AGEPVPDVILEPGITPVSFEELLCRLKQHDTEKQ"
FT   gene            302163..303782
FT                   /locus_tag="Dole_0265"
FT   CDS_pept        302163..303782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0265"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   esa:ESA_00407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66075"
FT                   /db_xref="GOA:A8ZS57"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS57"
FT                   /protein_id="ABW66075.1"
FT                   /translation="MENRHKIEHYEGCLLGGAVGDALGAPVEFMSLDDILRRFGPSGIV
FT                   DYAPVSGKTGAITDDTQMTLFTAEGMLRSVTRWRHKGVCYPPAVVYYSYQRWLMTQDSS
FT                   VDKDGDVSWLMDIPELHSERAPGSSCLSALRSSRQGSMKEPINDSKGCGGVMRIAPVGL
FT                   TQALEIVFETGCEVAALTHGHPTGYLAAGCLAQIIRHIIDGYSLIQAIEATQAILAEQR
FT                   DCEECRDAIGAALLAWRRKQPSFETVETLGEGWIAEEALAIGIYCALVGGDDFERGVTL
FT                   AVNHSGDSDSTGAITGNIMGALLGVSAIPQRYLDQLELKDVITELADDLYTGFKEGDGW
FT                   WNKYPGSGLYFRSKEEDVEHYTVPFDRCYWVVPGKLMAGCYPGGLNKEEARKTLQGLLD
FT                   HGIRHVVSLMEPDEKDHAGKPFISYEPLMQSLAIAAGKAVTFARFPIKDQNIPTEDEMV
FT                   GILDHIGREIDASIPVYVHCWGGKGRTGTVVGCYLARHGLASGKSALRGIQELRRDVAD
FT                   AHHASPETDPQKKMVISWARGQ"
FT   gene            complement(304254..305339)
FT                   /locus_tag="Dole_0266"
FT   CDS_pept        complement(304254..305339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0266"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: rde:RD1_0535 amine oxidase family, flavin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66076"
FT                   /db_xref="GOA:A8ZS58"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS58"
FT                   /protein_id="ABW66076.1"
FT                   /translation="MSAEQESVDTIIIGGGLSGLYTAFMLTKKKKSFVLLEARPRVGGR
FT                   ILSPAHNGFFTDLGPSWYWPARNPRVNALVKALDLAGYPQFESGLCRFQARDGQTETIP
FT                   GYPMNPPGWRLDNGMISLVNGLCSRIPGDRIRLNHPVCKIKRLDNGARVTVGCLDQVPQ
FT                   CRLEASSVILALPPRLAAGSILFTPDLPHDLTQAMLRASTWMAGQAKFFALYDKADWRR
FT                   SGLSGQGFSLCGPLGEIHDGSGKTDSPYGLTGFVGIPALRRKDSQTMIQAILGQLALLY
FT                   GHTAAQPVSVYYQDWAQEPFTATEYDQRTAHNHPEFLPPSGKTSTWNNTLHFAGSETAD
FT                   DFGGYLEGALSSAERAVLSLG"
FT   gene            305854..306462
FT                   /locus_tag="Dole_0267"
FT   CDS_pept        305854..306462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_4047 cytochrome c, class III"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66077"
FT                   /db_xref="GOA:A8ZS59"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS59"
FT                   /protein_id="ABW66077.1"
FT                   /translation="MKRFLLMFGIFFVVSSFVLTGCGKPPDSKSKPPKGYVAKPVSRPA
FT                   PKAEKPAPATPAQQEAPSVAEAPAKPAPAAPAAGEAGDVIEMKNTKAFDPHKMGIVMFT
FT                   HTKHFSAKPDGYGIACGDCHHDKEGKPLALKVGDSVQGCMECHDKPGKTPRKPAGISPA
FT                   EWDAMQLEYYYGAIHINCIDCHKAGGAGPVKCTDCHIKP"
FT   gene            306709..308604
FT                   /locus_tag="Dole_0268"
FT   CDS_pept        306709..308604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0268"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: sfu:Sfum_0160 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66078"
FT                   /db_xref="GOA:A8ZS60"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS60"
FT                   /protein_id="ABW66078.1"
FT                   /translation="MLQFMRQKASSIIIKGVLSLVILAFIFLGIGNFREQQEVTAATVN
FT                   EEIVTGREFQYTYQRLLDTYRQQFGGALNDDLLKMLNLKEQAMNQLISEKIILQQADKL
FT                   GLNVSDSELAATISSIPAFQNNGRFDKTRYNRLLQSNRMTAAAFEQSQKQGLLVDKLRT
FT                   LITDSVLVSDNEARQWFDWENARVKITAAVFAAEGRTDVDPAEAAVAAYYEEHKDQYKT
FT                   PEKRKITYVRVAPARYLSEVKVTEEEIADFYQANQDFYWNEETVEARHILISLEQDADE
FT                   ARVEEARQKAADIYVMVTDGGKDFAETARQYSEGPSAGEGGYLGAFTREDMVAPFSEKA
FT                   FSMAPGEISEPVRSQFGWHIIKVEKVNAAFTTPLDEVRADIEKQLLDQKAGEYAYEEAL
FT                   TLFDMALDTDSVEQAAASRNLTAVTTDAITQNDTLADVEAGRTMVRQAFDFVEKEISDV
FT                   ITEGNTHFLFQVTEVMPAAVPPLENVQARVIEDLREQMRKEAAQAEAESVLEKVKAGQP
FT                   LEAACAGTQAEIVATGFFGRTGAVPDIGNEPALSRAAFDLTKNQPVAPNVVEGRTGYYV
FT                   VVLNDQKAPEASEFEEKRDAVVKRLTAQKKNEVFMSWLKTMRQESDITIDEAFLR"
FT   gene            308652..308903
FT                   /locus_tag="Dole_0269"
FT   CDS_pept        308652..308903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66079"
FT                   /db_xref="GOA:A8ZS61"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS61"
FT                   /protein_id="ABW66079.1"
FT                   /translation="MFGKRTSSGKGRGDEPVYRSYKQCPDCLARMPLNATRCPECNQRV
FT                   GEIQADGKALKPTDWKSYIVTAILFALFYFFVRWAFFT"
FT   gene            308974..309252
FT                   /locus_tag="Dole_0270"
FT   CDS_pept        308974..309252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66080"
FT                   /db_xref="GOA:A8ZS62"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS62"
FT                   /protein_id="ABW66080.1"
FT                   /translation="MLNSKNFWYANMAGAVAGWAFIIFGAAAPFSGLLYGLWVVVTLLW
FT                   VIGHPLELAMAIPVAMKAGYSPAAAVVYTLVFGITWWIPVKWGVFKP"
FT   gene            309555..310406
FT                   /locus_tag="Dole_0271"
FT   CDS_pept        309555..310406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0271"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   swo:Swol_1485 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66081"
FT                   /db_xref="GOA:A8ZS63"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS63"
FT                   /protein_id="ABW66081.1"
FT                   /translation="MEVKTIMVIGAGQMGNGIAQVAAQAGYTTFMNDISEDLVDRGMTA
FT                   IAGSLDRMVKKEKITADDKTAILGRITPAVTLDPASECDLVIEAVVEKMSIKADIFSAL
FT                   DRLAPGHAILASNTSSLPITGIAAHTGRPEKVIGMHFMNPVPVMKLVEVINGLATTPEV
FT                   TATVRAVAEAMGKIPVECRDVPGFVSNRVLMVMINEALWELYEGVATAEGIDQIMKLGM
FT                   NHPMGPLALADLIGLDTVLAILGVLQDGYGDPKYRPSPLLKSYVAAGWLGRKTGRGIYE
FT                   YK"
FT   gene            310421..310597
FT                   /locus_tag="Dole_0272"
FT   CDS_pept        310421..310597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66082"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS64"
FT                   /protein_id="ABW66082.1"
FT                   /translation="MPTIDELKAQLAALEEKLEEARARMPAHSTKPLTMRTLLDLEDER
FT                   DALLGKIEKAGKE"
FT   gene            complement(310875..311600)
FT                   /locus_tag="Dole_0273"
FT   CDS_pept        complement(310875..311600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0273"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gur:Gura_0899 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66083"
FT                   /db_xref="GOA:A8ZS65"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS65"
FT                   /protein_id="ABW66083.1"
FT                   /translation="MEHLADPNIWLALTALTALEIVLGIDNIVFIAILAGRLPEDQQAA
FT                   GRRVGLALALITRILLLFSLTWIMRLTAPLFSVLDNPVSGRDIILIAGGLFLLAKSTVE
FT                   IHAAIEGEADRHAERKGGIAPSFFSVVTQIMVLDIVFSLDSVITAIGLAQQIWVMVTAI
FT                   VIAVGVMIVMADMVSAFIEKHPTVKMLALSFLLLVGLALIGDGVDLHIPRGYIYFAMGF
FT                   SVFVEVLNLRIRGRKKSAA"
FT   gene            312270..314300
FT                   /locus_tag="Dole_0274"
FT   CDS_pept        312270..314300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0274"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66084"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS66"
FT                   /protein_id="ABW66084.1"
FT                   /translation="MAYKTRREEPSAIMASPESSVKPDHIKIIKGSTDILLIAPHACIR
FT                   DGKPKDDENTGPITEMVAHQIGCSAIINTHFHKPDSKKYPRGMGKGNLDLNVIADAEMV
FT                   PGYLDAIRAVVEAPGKTTVIWIHGADNANAIEVASEATYDFPGDEIHAFIGYGQGGSRP
FT                   KSGCKNLFTAKPETVERFRDALISNRMNAVLTDKDAVNYRGRRTKGMNQWFLNQEYTLD
FT                   QVESIQLEIRKAGFRDLHHNIEKTAGILIEALSQEALVPVIPEETVADEHLVDIAFNHL
FT                   RGIFAKHIHEAMLQAGRYLVRTFYGTYEKARKKEKIRKQSFAKLEERLNNGTGDVPKKT
FT                   WIYDAVKVAVDDHFFRKESKAFFLTYGKLGHSQKVLLTQVKDTNQKKELVEKAVETPQT
FT                   VKQFRESIQAIKKKKRKSKRKGGHSDWTKPENNVSFCSGCENDCIYCYGRYFAANRNQI
FT                   APNHWSKMKIREHHVTKKRTLHAGLIGFPSTHDILPSNLDATLLVLGKLLRAGNKVLIM
FT                   SKPRLDCIKRLCSACEFFKDTILFRFTIGAMDDDILGFWEPNAPTYEERKECLAYARNQ
FT                   GFQTSVSMEPMLDTENLDALIKALRPLVSDKIWLGTMEYLGWIGTRIKADSKGELERLE
FT                   QGQTPDKLVSIFNRYEDDPMIEWKTVALKIIEAHKQQERKP"
FT   gene            314319..316082
FT                   /locus_tag="Dole_0275"
FT   CDS_pept        314319..316082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0275"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fnu:FN1787
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66085"
FT                   /db_xref="GOA:A8ZS67"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS67"
FT                   /protein_id="ABW66085.1"
FT                   /translation="MDMNRMTISILLVVSILTFNSAFLCADSKFLDSSKTPEKEMDYKF
FT                   IAPKTTIETGVIMTKDGQNIVARKISEDNNVIVYYLGHIAHGITVDKVLSIANTSGSGL
FT                   IGFSEGDRRDSLNGSGFQAEPKTSITKVENLDDVNFIDGGKFFEKGNYTEAIQAYSLYL
FT                   RYYPKSPTGYSNLGLCYLQKGNFKEALKYHTKAIELDDNRANLYIARSVSYWKMGLNDL
FT                   AFADIEKAIELNPNNKDAYLKKGKFLFNKEEYKNAIKPFLKYLELGGNNWEALSALGWA
FT                   YHKTDNDRDALKYLMIAHQSNEGSYDNNIRMADVYRGLKEYENAIKYYTLALNTDKKDI
FT                   FLYLYRGISYMEKGDYSLAELDFKKALELKENDPVVLCNYAQLYIYQDKDRKAIPLLKK
FT                   VLEVSKDEECNIWSKFTLEEISKSRKKTRNVIALFLIFIALIFLILLGVLKLKKSAGLM
FT                   RVNVTKKLKYISTATVLMCGVMFFILSQQTEKSTERAKAEPAIRQALQAVDLGRYSIAS
FT                   DFYHKAIEFDPDRKEEFDRRINAMMDRRLQELWSGQYDFGKMRRYPEWEAARKADAFVQ
FT                   KEIQKFHRDFK"
FT   gene            316441..318150
FT                   /locus_tag="Dole_0276"
FT   CDS_pept        316441..318150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0276"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: syf:Synpcc7942_1060
FT                   type I restriction-modification"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66086"
FT                   /db_xref="GOA:A8ZS68"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS68"
FT                   /protein_id="ABW66086.1"
FT                   /translation="MNNFQDKANFIWQVADDILRGTFKQHEYGDVILPFVVFRRLDCVL
FT                   NGKKDEIIDTYKKFQKKLDDPSAVVLQATGGLKFYNVSLYDLQRLTQDAGNIEANFNNY
FT                   INGYSKNVREIIDNFSIEKIIAKLAKNELLFMLVDKFTEIDLHPDKVKNHEMGYIFEEL
FT                   LRRFSEMSNETAGEHYTPREVIRLMVNLLFAEQKEELKGKGIVRSVYDPACGTGGMLTI
FT                   TKEHIQKHINPKLEVILFGQELNEQTYAIAKSDVLMTGGEPDNIKLGTSFSNDQFRDKR
FT                   FNFMLSNPPFGVSWKKEQSFINNEAEDPGGRFHAGLPRVSDGAMLFLQHMISKMEPTGS
FT                   RIAIIHNGSPLFTGDAGSGESNIRKWIIESDWLEAIVALPTELFFNTGIATYIWIVTNR
FT                   KPAHRRGKVQLVNAVSFAQKMRKSLGSKRNFITTEQIQQITDIYTGFKDGEFCKVFDNE
FT                   DFGFTKVTVERPEMKKDKIVKDKNGNPKPDTSLRDYEKIPLKVDIDEYFKREVLPHVPD
FT                   AWMDRSKDKVGYEINFTKYFYKYQPLRSLDEIKADILALEKETDGLLSEVLS"
FT   gene            318150..319391
FT                   /locus_tag="Dole_0277"
FT   CDS_pept        318150..319391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0277"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pha:PSHAa2093 type I
FT                   restriction-modification system, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66087"
FT                   /db_xref="GOA:A8ZS69"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS69"
FT                   /protein_id="ABW66087.1"
FT                   /translation="MKRYPKYKDSGVEWIGEVPEQWEVKRLKFLAKNVNEQTNTKKQDE
FT                   IYIALENVESWTGRISPQDNEITFESQAKCFCSNDILFGKLRPYLAKVARPNKSGVCVG
FT                   EFLVLRVLDNEVLPEFLEQKLRSQWFIELVNSSTFGAKMPRADWTFISNVKLTYPSPKE
FT                   QNHIASYLDHKTRLIDTLIEKKQKLVELLQEQRTALISHAVTKGLNPKTKMKDTGIEWL
FT                   GKVPEHWATASLRWYLRIGSGEFLSNNDFLTEASDQKNIPVIGGNGVMGYTSKTNIQEP
FT                   TIAIGRVGALCGNVHLVNPPAWITDNALRLSNIKDFLIDYLSLFLGVLDLNRLANQNAQ
FT                   PLITGSMIKSQKVPIPPIPEQKDILQYCSKFSQTIDHGINTLHKQIAVLQEYRTTLISD
FT                   VVTGKIDVRDEVIP"
FT   gene            319388..322357
FT                   /locus_tag="Dole_0278"
FT   CDS_pept        319388..322357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0278"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   protein of unknown function DUF450; SMART: DEAD-like
FT                   helicases; KEGG: mba:Mbar_A1014 type I
FT                   restriction-modification system restriction subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66088"
FT                   /db_xref="GOA:A8ZS70"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS70"
FT                   /protein_id="ABW66088.1"
FT                   /translation="MSPGYLEQDFEEHIEQHLLKSGYHKRKPEEYDKEACLIPAEVLKF
FT                   IQSSQPKEYKKLQGYLKSETDQKILSRLSAEVAKSGALSVLRKGFKTRGCTFKMAFFKP
FT                   TSGMNPETQKVYKDNRFAIIRQLKYSVKNENSLDIALFLNGVPIITAELKNSLTGQFVE
FT                   NAIKQYKQDRDPREQLFKFKRCLVHFAVGNEKAFMTTRLQQDKTTFLPFNLDTENPVNP
FT                   GGHKTAYLWEDILQPDTLLDLIQNYLHIQKVKEQYYDKASGKVKSQEHEVFIFPRFHQL
FT                   DAVRKILAAVREDGAGNNYLVQHSAGSGKSNSIAWLAHHLASFYKTSKDTARMFDCIVV
FT                   VSDRKVLDKQLQDTIKQFEQVKGVVQPIDKTSGQLKEALEKGKSIIITTIQKFPVISKT
FT                   MTELKGKRFAVIIDEAHSSQSGETSKHLKKVLSVNLEEAEEEDTVEFDLEDEIVEEITS
FT                   RGRQPHISFFAFTATPKGKTLELFGRKNSAGKFVAFHTYSMRQAIEEHFILDVLENYTT
FT                   FKRYFKLAKKVEGDKEYEKKKALRLLMSYVDLHPHEIEMKSRIMLDHFLEKTANAVQGK
FT                   GRAMVVTRSRLHALRFYLNFKRLMKEMNLPFKPLVAFSGTVKDPDSGDEHTETSLNELP
FT                   SSQIVTAFKTPIYRIMIVANKFQTGFDEPMLHTMYVDKKLGGVNAVQTLSRLNRTMRGK
FT                   SSTMVLDFVNDTEAIRLAFQDYYQTVFLEEETDPDKLYDLQAEIEGFSLFISKEVDAFA
FT                   EIFFHPSEPMEKLQPILDTVVKRWKAIPDDNTKEDFRSALQSFIRLYGYISQIITFQDV
FT                   ELEKLYVFCRNLNRKLPKRKGQLPYEIQDAIDLASFRMQETSSGWIRLEKTDGEAKGIS
FT                   LGTPQHTNDEKDLLSNIIKTLNDTYGIELTDDDRVDIGKMQEKLQQRDDLREVMTGDNT
FT                   LENMRYKFDKVVDELLLDFVHTKLNLYKKLSDEKVNPLFKSKWFEGYLRDSRTDVHQRV
FT                   "
FT   gene            322487..323608
FT                   /locus_tag="Dole_0279"
FT   CDS_pept        322487..323608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66089"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS71"
FT                   /protein_id="ABW66089.1"
FT                   /translation="MGTCTAKDTNPEYWSDYSNLQHVKHKIIQNYLNGWFPKLGRWSGR
FT                   ICYFDTHAGRGRHKGGQEGSPLVALGCILNHKHRESHLSGCEIKMFFIEADDQNCCALQ
FT                   NEINRLGPLPKQVQVHTITENCFDTLQSILEHLNESGNSLAPAFIFVDPYGFKVPGAVL
FT                   RKLMAFDRVELFVNVIWRELSMAIAQGETQPGMANTLNEIFEGEQWHGLVGMAFDEQAN
FT                   ACINLIRKNTGAKWATHIRMLGPNGATRYMLMHLTNHDSGRNLMKDCVWKACPENGYYA
FT                   RAKDDPKQQFLIRPEPDLKPLEDWVIKILSSGPTKWKDLLEQNLSEIWRDTHLNKVIKQ
FT                   CRKSGRIGARNYEGRFALTNNPELFIYKRGFFQ"
FT   gene            323605..324348
FT                   /locus_tag="Dole_0280"
FT   CDS_pept        323605..324348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0280"
FT                   /product="Gp37Gp68 family protein"
FT                   /note="PFAM: Gp37Gp68 family protein; KEGG: sus:Acid_6594
FT                   phage Gp37Gp68 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66090"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS72"
FT                   /protein_id="ABW66090.1"
FT                   /translation="MKSKIEWTESTWNPFTGCTKISSGCQNCYAEKMARRLKAMGNPKY
FT                   KNGFKFTIHRELFEFPQQHRKPLTIFVNSMSDTFHEKADDDVVVSLFDSMAKAPWHTFQ
FT                   VLTKRSMRAKDIAAQIEWAKNVWLGVTVESTENLFRLDHLKDIPAAVRFLSLEPLLGPL
FT                   PNLDLNGIDWVIVGGESGPKSRPMEEDWVLEIKELCLQAKVPFFFKQWGGINKKRAGRL
FT                   LENRTWNNYPRTNRKIYRGHRTQLV"
FT   gene            325517..326140
FT                   /locus_tag="Dole_0281"
FT   CDS_pept        325517..326140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66091"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS73"
FT                   /protein_id="ABW66091.1"
FT                   /translation="MNREILEKPFGPEQIKQREGNFGKMLAYIEGHVVIQRLNDAFDAD
FT                   WSFTILHHEILKDTDEVIVIGELKAGGVVKSQFGSSRITRARETGEILSLSDDLKAATT
FT                   DALKKAATLLGVGLHIYGGNGQQQGKPLAAGDNGDHSQGPSNGNGGGNGRITGNQYKYM
FT                   IRLNEDQGRTLEDLNQQCLTMYGAVAQHLSKADASSVIKQLLAN"
FT   gene            326227..327066
FT                   /locus_tag="Dole_0282"
FT   CDS_pept        326227..327066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66092"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS74"
FT                   /protein_id="ABW66092.1"
FT                   /translation="MSRNLALQDFNQEIHISHNQIFTYCNCSLKYRFQYVEHRKPERVN
FT                   IALPFGSAIHAAIEMYYRTLKNHGHEESVTAICERFQTCLELDLDNTDVPVIFKKDLPD
FT                   RKAAVEMGHAMLRAFHENTVQTAQTAQQIVAVELPLTSTLYTEEGHATEYKLAGILDLV
FT                   LRDESGEIVVVDNKTAARPMAQGTANHDNQMTAYATLLASNRYVLPKAKVKCRFDILRK
FT                   LKKPKLEQVNTTRNAEQRKRFAKIANAVLAGIDAGIFLPQPSWMCGDCAYSNACREW"
FT   gene            327183..328139
FT                   /locus_tag="Dole_0283"
FT   CDS_pept        327183..328139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66093"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS75"
FT                   /protein_id="ABW66093.1"
FT                   /translation="MKTTTTTLERVIEKVHEASAGHYDEVVPVQEMEFDSLSRMWIAGQ
FT                   QTEILPGAQRLLSNRLRVPFSYLSRCPANLQAENLNFWIEQERLNRETFFCRFDGHRLR
FT                   AVFTERYKPLDNMDVLSQLLRHGFDPDTQVQYAIDDGMFLVRIPEYARAFGVNPGYGKL
FT                   DEIVPGVSFANSEVGLLAFSIEAFFYRLVCTNGLISKTSSTFSRFKHISNRGLENFPET
FT                   IAGVIEDSVRKQEQFKLSRQSPVENPIRSIETFARQFGLAHLETEVVCKAYLLEQGATM
FT                   FHIINAFTRAAQDKHLDTLQSYRLESAGGQILSLVRP"
FT   gene            328213..328404
FT                   /locus_tag="Dole_0284"
FT   CDS_pept        328213..328404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66094"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS76"
FT                   /protein_id="ABW66094.1"
FT                   /translation="MTKEKKACYGEPEQLGEILMRVLEGRKFRLECGHYVTFGSHLGND
FT                   ITIYNGKKFKIICSQCGY"
FT   gene            328431..328598
FT                   /locus_tag="Dole_0285"
FT   CDS_pept        328431..328598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS77"
FT                   /protein_id="ABW66095.1"
FT                   /translation="MDDFCDDFDGIDWEDWMIIGPLSEDIAREKREQDRIQNELDDEGD
FT                   EYWDIINEKW"
FT   gene            328964..329290
FT                   /locus_tag="Dole_0286"
FT   CDS_pept        328964..329290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0286"
FT                   /product="HIRAN"
FT                   /note="PFAM: HIRAN"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66096"
FT                   /db_xref="GOA:A8ZS78"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS78"
FT                   /protein_id="ABW66096.1"
FT                   /translation="MKNKFSPIQTRLTGVTFDDCQANIRKWGYPDIGTYALVREPENPH
FT                   DPNAVRVSLFGIYEMGYLPRWLAKDIASQMDAGKAFLAEFICRNEYEAYKNIGLTVRIV
FT                   EATE"
FT   gene            329447..330964
FT                   /locus_tag="Dole_0287"
FT   CDS_pept        329447..330964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66097"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS79"
FT                   /protein_id="ABW66097.1"
FT                   /translation="MKVSSRTRQTKALRAVLLNLINAHHLDRPVRYSRNKNRYTRDRRY
FT                   GQHHYTYDRLIPIIDALERLGYIEQSSYYKDPDDDRYGLQTRMWGTELLWARCRRYRVT
FT                   HYFGLALNPPEEKEVIVLRNKEKQDRPYRETHQTRQMRDDLERYNGFIDRNFISVRLTG
FT                   DSIVDNRWLVENLYQNISKSETWIQSVILNNSHSKYKYTTPIPTFTKHLLPFHTNPYRI
FT                   IQSTRDRIPINNPIPITNTKRGKVLLDVLLQRFWSEAHFFEKDLYKRSIEIGRIPLDKR
FT                   RKVLDVKSPLQDIGVDELVFVLDHEHLRRIFNRESWEYGGRAYGALHQSMLRRPMRKNV
FT                   LIDGEPTVEIDYSAFHIRMLYHREGIDYTDDPYLECEGHEMRDIYKAVGLIAINSTERD
FT                   ACGAIRDELENRGLAPPDREKPYASLVSGFKQTHPAIAHHLFSDVGIRLQNIDSIIMNA
FT                   ILVRLMDNGILGLPVYDSVIVQQQHGTFTREVMTEEYRKQTGFNPKF"
FT   gene            331373..332584
FT                   /locus_tag="Dole_0288"
FT   CDS_pept        331373..332584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0288"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   prw:PsycPRwf_0726 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66098"
FT                   /db_xref="GOA:A8ZS80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS80"
FT                   /protein_id="ABW66098.1"
FT                   /translation="MEDKLMAKKQDRYLQKRDNTFYFRKKHNGKVFKRSLNTTDKRTAR
FT                   DLRNFYLRNLVEYGQLDAPEKVDYDVITFGEVAKEWASIHKKEVRYSTWPDYVSSMNGH
FT                   ILPNFKDMPIAEITYGDVLKFRSGLKVGAKRANNILVPMKSVFDYADREGIIQDNVMRK
FT                   IKRLSEEAPEIHPFSYDEVNRLLDAVHPWYQPYLIVAFFTGMRAGEQNGLCWSDFLEDM
FT                   QPEPRIFIRKTYVYKKDGIPKTKKSKRYIKCLPQVLEALSEQRKLTGKNKHIFLTIDGR
FT                   RMTPDHIRKEVWIPALEKAGIEYRPPIQTRHTFATMMLSAGEDIGWVQNMLGHSSLQMI
FT                   FQRYYAWVPEKTRSDGHAFMKYVGCLSVTQKQDAGSAGEIKVKTDEGCTNLVPLDKYRH
FT                   KKRG"
FT   gene            complement(332613..332689)
FT                   /locus_tag="Dole_R0005"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(332613..332689)
FT                   /locus_tag="Dole_R0005"
FT                   /product="tRNA-Met"
FT   gene            complement(332755..333066)
FT                   /locus_tag="Dole_0289"
FT   CDS_pept        complement(332755..333066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0289"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   sat:SYN_00105 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66099"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZS81"
FT                   /protein_id="ABW66099.1"
FT                   /translation="MIPVKEHAHTLCFPLLVAPRSSKNMVVGAHDNALKIKITAPPVDG
FT                   RANEMCVAFLSRLLGIPKTSITIAAGAASKRKEVCLALSPNAAGKQEAARIKALLAGY"
FT   gene            complement(333067..333672)
FT                   /locus_tag="Dole_0290"
FT   CDS_pept        complement(333067..333672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0290"
FT                   /product="phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein"
FT                   /note="TIGRFAM: phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: pau:PA14_41830
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66100"
FT                   /db_xref="GOA:A8ZS82"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS82"
FT                   /protein_id="ABW66100.1"
FT                   /translation="MNIVCCDLEGVFVPEIWINVAKKTGIDELRLTTRDISDYDVLMKK
FT                   RLAILADHGLKLADIADVIATIDPLEGALEFLTWLRKQTQVIIVSDTFTQFAGPLMEKL
FT                   LLPTLFCNTLTIGDDGAIVDYNLRQKDGKRQTVLALRTLNYHITAMGDSYNDTGMLAEA
FT                   DLGILFRPPENVVREFPQFPVATDYDTVRELLADSLAK"
FT   gene            complement(333695..335011)
FT                   /locus_tag="Dole_0291"
FT   CDS_pept        complement(333695..335011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0291"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; amino acid-binding
FT                   ACT domain protein; homoserine dehydrogenase NAD-binding;
FT                   KEGG: gme:Gmet_1629 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66101"
FT                   /db_xref="GOA:A8ZS83"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS83"
FT                   /protein_id="ABW66101.1"
FT                   /translation="MKQINIGILGCGTVGSGTARILLEKQKLISDRTGINVHLKSIADI
FT                   DPTRGKDLPLADGVMTTDAGAVVDDPEIQIIVELIGGKTLAKELITRAIDNGKHIVTAN
FT                   KALLSAHGNTLFPLAAQRGVDLAYEASVGGCMPIIKSIRESLVGNAIGSIRGILNGTCN
FT                   YILSRMTAEGCAFDEVLADAQANGFAEADPTLDVDGFDAAHKLAILNAIAFGMTINLED
FT                   VYVEGIRRITPMDIEFAADFGYTVKLLAISKQTNGAVEARVHPTMISHDNILASVNGSL
FT                   NAVTVSGDCVENVLLYGHGAGKMPTASAVVSDIVDIARNLVFGAPGRIPALAYRPEAIR
FT                   TIPVLPIDRLHTRYYLRFTAENQPGVLSKIAGALGSHNISIKSVNQKGRFYGDHTPLVM
FT                   MTYKACEADMKKALADIAALHIVADDPIVVRIEEDNGGL"
FT   gene            complement(335021..336196)
FT                   /locus_tag="Dole_0292"
FT   CDS_pept        complement(335021..336196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0292"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sfu:Sfum_1219 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66102"
FT                   /db_xref="GOA:A8ZS84"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS84"
FT                   /protein_id="ABW66102.1"
FT                   /translation="MDMTKKFGRLDRLQPYVFATVNAIKMEARRAGRDIIDLGMGNPDL
FT                   PTPNHIIEKMVEAARKPHNHRYSASMGIRKLRLAISDWYKRRYDVPIDHEEEAIVTIGV
FT                   KEGFSHLILVTINPGDLVFTPNPTYPIHPYATIIAGGNVRGIPVGPGQDFLKNLIDGTR
FT                   QSWPKPKVLVISYPHNPTTEVVDLNFFKEIVAYAKKYDVMIIHDFAYADLVFDGYEAPS
FT                   FLQVEGARDVGVEFFSLSKSYSMAGWRVGFCVGNPHIVAALRRIKSYLDYGIFQPLQIA
FT                   SIIALNEDQQCVADIRETYRSRRDTLVNGLNRVGWEIEKPKATMFVWAQIPEKHRHLGS
FT                   VEFSKMMIREAQVAVSPGLGFGEYGDDYVRFALIENEMRTNQAVRGIKKIL"
FT   gene            336565..337605
FT                   /locus_tag="Dole_0293"
FT   CDS_pept        336565..337605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0293"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: gur:Gura_2153
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66103"
FT                   /db_xref="GOA:A8ZS85"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS85"
FT                   /protein_id="ABW66103.1"
FT                   /translation="MSSLTYADAGVDIDKANALVDNIKKIAKQTRRQGVMGDIGGFGGL
FT                   FSLNLSDLKNPVLVSSTDGVGTKLKIAFMAGRHDTVGIDLVAMCVNDIAVQGAKPLFFL
FT                   DYMAVGKLNTEIATQVITGIGEGCKQAKCALIGGETAEMPGFYKDNEYDLAGFTVGIVE
FT                   SDAIIDGSNIHVGDAIIGIASSGLHSNGFSLVRKICFDVLKLKIDDHIDDLGKTLAEEL
FT                   LTPTIIYSETVHSLLKLFPIHGIAHITGGGLAENVVRVLPQACVATIRKGSWDVPPVFS
FT                   FLQKAGKVEDREMTRTFNNGIGLVVVVPAKKADDAMASIRAVGEKPFLIGEITPRKADE
FT                   PQVQLV"
FT   gene            337944..339026
FT                   /locus_tag="Dole_0294"
FT   CDS_pept        337944..339026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0294"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: sfu:Sfum_3311 putative metalloendopeptidase,
FT                   glycoprotease family; TIGRFAM: putative
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66104"
FT                   /db_xref="GOA:A8ZS86"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS86"
FT                   /protein_id="ABW66104.1"
FT                   /translation="MFLQRFSFAFLFRFRSRFRHGQPDMKLPRTILGIETSCDETGAAV
FT                   VADGRRVLSSVVSSQVALHSPYGGVVPELASRKHIEHILPVVRQALAEAGLKTGDIDAV
FT                   AATQGPGLVGALLVGFSFAKAFAYAANVPMVGVNHLNGHLASLFLTDDPPAIPFVALLA
FT                   SGGHTAIYHVTGPVTSTLMGQTRDDAAGEAYDKVAKMMGLGYPGGAVIDNLAAQGDPAK
FT                   YAFTRPYLDKAAFDFSFSGIKTAARRFIQEAGDALAPESPHIAAGFQEAVADVLCYKLV
FT                   HAAKVKKCGHMALVGGVAANRRIGEKLRHAAKQEGLVVHIPPPAWCGDNAAMIGAAGFF
FT                   QLAAGAEPVDLSADVYSRVA"
FT   gene            complement(339512..340543)
FT                   /locus_tag="Dole_0295"
FT   CDS_pept        complement(339512..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0295"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tte:TTE0215 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66105"
FT                   /db_xref="GOA:A8ZS87"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS87"
FT                   /protein_id="ABW66105.1"
FT                   /translation="MAATDKRPFSLSGFSDDMLAGQRLVAGFEGTTLNDDLKYLIDTLK
FT                   VGGIILFAVNLEHPDQIRDLCASAQAHAAACRLPPLFVAIDQEGGQVARLKPPFTRFEG
FT                   NPSITTDDQARHFARITASELAGIGVNMNMAPVLDVADGVTDSVMAGRAFAGGPREVAR
FT                   LGGVVIEEMQKNGIMAVGKHFPGIGRTTADSHIDQPWLAADPAEMETTDLVPFKTAIER
FT                   DVAGIMLSHIRYTALDPDLPASMSTPIAKTLLREKLGYEGLVMTDDLDMGAIRNHHVMD
FT                   QVVRCADRAGIDMVLVCHKGPDRKKAVESFRELLETSDTHRKQALCSVERILRAKARYL
FT                   CRI"
FT   gene            complement(340580..341374)
FT                   /locus_tag="Dole_0296"
FT   CDS_pept        complement(340580..341374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV2762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66106"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS88"
FT                   /protein_id="ABW66106.1"
FT                   /translation="MYSFDRDIALEQQARQLFSATVTPNWSVNRNPDGGYLMALMANGV
FT                   LQHAEKQWITIFTANFVSRCVPGPVSLAVDLLGTSSRFERWQASLEQEGDTKVFALCTL
FT                   TDNAVEDPETRYEADPPVLASRQDCLEFPAVPGYTIFEQMDVRLDPACTGWLTSGALTD
FT                   RSEQKGWIRFKDDRPFDMLSLLLAADAFPPPVLASHGMTAWVPTLEMSVNIRQKPSSPW
FT                   LRCVFRSRFIHNGIVEEDGQVWDENDRLVAVSRQVSQFRKNT"
FT   gene            complement(341403..342242)
FT                   /locus_tag="Dole_0297"
FT   CDS_pept        complement(341403..342242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0297"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   bcz:BCZK4981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66107"
FT                   /db_xref="GOA:A8ZS89"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS89"
FT                   /protein_id="ABW66107.1"
FT                   /translation="METAVVNFTYRHKTGKRRFSMEGPNEKDYIINYIDEKKSFYEIDL
FT                   LEYMDFITRHENRSGAVCIDVGANIGNHSVYMGAFIGKKVVSIEPNARLYKALYHNLEN
FT                   NVADYHVIECAVGEQKTEGRLVFPVDSEGSMGLARLESPEDSAPSENRLLKGDTVAVDT
FT                   LDVVVSRHVDNHDRILLIKIDVEGNELSVLKGAVHTLEHHHPHLFVEVCRPELKNDLDR
FT                   YLAERHYLPISRWAGTPVYHYVYRPTRGQSVKASLFRLKYVLITRHIKSIKRRLHWP"
FT   gene            342744..343412
FT                   /locus_tag="Dole_0298"
FT   CDS_pept        342744..343412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0298"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: ppd:Ppro_2781
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66108"
FT                   /db_xref="GOA:A8ZS90"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS90"
FT                   /protein_id="ABW66108.1"
FT                   /translation="MKEIKVVRRVLDVNEMMADQNRRRFAESNVFVLNVMSSPGAGKTT
FT                   LLEKTLELLMPDVRCAVIVGDICTTNDADRLAKSGVDVVQVNTDEFGGDCHLAAHVIEN
FT                   AAANFDLAGLDLLIVENVGNLVCPAEFDIGEDARAVVLGVTEGEDKPLKYPLMFRVCDV
FT                   ALLNKVDLLPHLEIDIDRAEANILQVHPDMPVFRTSSKTGEGLEPWLQWIRKKVAAKKG
FT                   "
FT   gene            343453..344301
FT                   /locus_tag="Dole_0299"
FT   CDS_pept        343453..344301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0299"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   pis:Pisl_1105 protein of unknown function DUF52"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66109"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS91"
FT                   /protein_id="ABW66109.1"
FT                   /translation="MDIRPATYAGSWYPDTAAECRRQIKAFLAEKTLTPPDREPCGAIV
FT                   PHAGWIYSGGIACRALALLKGSQVPDTIVIYGHHLYPKSSPRILSEGSMATPLGMLAVD
FT                   EALAAKLMDRFTFQAESVHHFAPDNTIELQLPFIRYLFGDVKIVPVGVPPDAMAVEIGR
FT                   FTVQAARDLGLSVKVVGSTDLTHYGAHFGLSHYGLGEAAHRQVRANEDRRIIDRMLTLD
FT                   PHRVLDEALSSQNACCAGAVAAALAAGLEMGTDTAMLTEYATSYDKSPGDSFVGYAGIL
FT                   F"
FT   gene            344402..345388
FT                   /locus_tag="Dole_0300"
FT   CDS_pept        344402..345388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0300"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="KEGG: dvu:DVU3143 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66110"
FT                   /db_xref="GOA:A8ZS92"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS92"
FT                   /protein_id="ABW66110.1"
FT                   /translation="MPDTISRRNFLKAGLITAGAVAASGTGLASMAGAASGEPLCTLLD
FT                   LSRCIGCEECVYACREVNGHKFPELKGAIPEMIPREKVKIADWSAPEKQAVSDRLTPYN
FT                   WLYIQRAYGEHNGEPFELNIPRRCMHCENPPCSKLCPFGAAYQQDNGIVAISPDICMGG
FT                   AKCKAVCPWHIPERQSGVGLHLNLMPQYAGNGVMYKCDRCFDRVAEGELPACIEVCPVD
FT                   VQQIGPKSRIIEKARQLAKETNGFIYGLEENGGTNTIYVSPVPFDVLNGSVEKGPGKPH
FT                   LQPVADAMTTPNRMFAALAIAPVAGIVAAVARFGLLAGNKDHEKENM"
FT   gene            345388..345852
FT                   /locus_tag="Dole_0301"
FT   CDS_pept        345388..345852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dde:Dde_0656 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66111"
FT                   /db_xref="GOA:A8ZS93"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS93"
FT                   /protein_id="ABW66111.1"
FT                   /translation="MIGITDRLLLWLYRVGVGVAIFTGFGNMPLYGRYYVGNVPGFGWS
FT                   SNFMVNVQVHYVAGAVLVALAVYAAIVYTGLRVRGLRLTTSGVLRVVFLVLALLSGLVM
FT                   AVKNLPGVSVDFPMMPVLNFFHLFASMIFMFFSLGCVITRARWINSSSPD"
FT   gene            complement(346015..347349)
FT                   /locus_tag="Dole_0302"
FT   CDS_pept        complement(346015..347349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0302"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: dde:Dde_3709
FT                   ferredoxin, 4Fe-4S, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66112"
FT                   /db_xref="GOA:A8ZS94"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS94"
FT                   /protein_id="ABW66112.1"
FT                   /translation="MAETAEKEKKVIIDEGLDTGARRLTPERIKTVYNKMLGKAMGAKV
FT                   RTYVDTCVHCGLCSDACHVYLSNDKDPKYSPAGKVKRTLGELIKKKGNVSPDFIKEMSE
FT                   IASTECNVCKRCAMYCPFGIDVAYLMLVARRFCHLCGVTPLYIQATAHSHAATMNQMWV
FT                   KEDEWIDTLQWQEEDGREEMPNLRIPLEKEGAEIMYSVIGPEPKFQPTLIYNAAIIMNT
FT                   AGLDWTMPATPGWDNSDMAMYTGDNEIMGRVKRAHFEAAARLKVKKIVMGECGHAFRSV
FT                   YDMGNRQLGWKMPPIPIVHAIEFYYDLLKSGKIKIKEKYKKSVTLHDPCNVVRGRGLHE
FT                   KARYVVNQICENFIEMHPNREHNYCCNAGGGVINCGPPFKNKRVISNSVKAKQIADTGA
FT                   EILITPCHNCHSGMEDIISYYEVGMHTKFLSEIIYEVMEKPEPAE"
FT   gene            complement(347399..348076)
FT                   /locus_tag="Dole_0303"
FT   CDS_pept        complement(347399..348076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66113"
FT                   /db_xref="GOA:A8ZS95"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS95"
FT                   /protein_id="ABW66113.1"
FT                   /translation="MNTPDTFDVIYNFVSGPLVWAAFILFVGGSIYRLWKMLALVNKKD
FT                   RFIFTYMSLYHSLRSIAHWIVPFGTTSWRMHPVMTVATFAFHICLLVLPIFLAGHVVMI
FT                   AFSWGVSWPTLPAGVVDVMTVIVIACCIFFLVRRIVQKEVKYLTTPSDYVLLLITAAPF
FT                   VTGFFAYHQWLDYRTWILLHILSGEIMLVAIPFTRLSHMLFAVFTRSYIASEFGGVRCA
FT                   KDW"
FT   gene            complement(348093..349361)
FT                   /locus_tag="Dole_0304"
FT   CDS_pept        complement(348093..349361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_2712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66114"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS96"
FT                   /protein_id="ABW66114.1"
FT                   /translation="MSDPAKWDWDTGEKLVSDINQWQSDYKWVEEPYASPDGEKVAAIV
FT                   NVDEGEFNVCVNGEAWEREANFEKAWYLRFSPDGRLTVIASEDMAWTVVVDGESWEESF
FT                   DYVWDTRFSTDGSVIAAATQADGEYAIAVDGVAWENRYGNMNCMHLSADGKNSAAAVQT
FT                   EPCGEPEIFKFQEGVYTAAVNGEPWDRNFTSVWNMAFNADGTRLAAEVRLNLYDYTIAV
FT                   NGKPWDKVFGCVWEPIFHPVKGTVLAPVMADGGWTLAENGNLIWDKRFIQVWHQMVSPD
FT                   NRKIAAIVAPSFGRWTMAVDGEPWALTFGDMVTDAVFSPDSRRLACLGKENERYTVAVD
FT                   EKAWNTTFDMAWKPVFSPDSSMVAAKVASNGKYTIALDGKTWGRSFDALWDPVFSPDGK
FT                   KLLCRCVENGKYFRRVVPVTEIK"
FT   gene            complement(349426..350103)
FT                   /locus_tag="Dole_0305"
FT   CDS_pept        complement(349426..350103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0305"
FT                   /product="cytochrome c class III"
FT                   /note="PFAM: cytochrome c class III; KEGG: dde:Dde_0653
FT                   high-molecular-weight cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66115"
FT                   /db_xref="GOA:A8ZSV1"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV1"
FT                   /protein_id="ABW66115.1"
FT                   /translation="MMKKKNRVLMLSVMVVVACVCLGGLYGLSTGADAAEDVSILQIDA
FT                   MQPFAPLERPVVRFYHDTHTAAPSGQDCTVCHTADGFTFIEMPGDASARATMDAWHKAC
FT                   MDCHKGLVKKGEATGPMTCGECHPKGARKLLPEMPATGFYDAYHDFHMDALSGGCELCH
FT                   HDYDPATGELYYAEGMETACIECHGDTADGDTPSVKDASHLSCIKCHLDMAVGPVACGE
FT                   CHQ"
FT   gene            350375..351739
FT                   /locus_tag="Dole_0306"
FT   CDS_pept        350375..351739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0306"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Respiratory-chain NADH dehydrogenase domain
FT                   51 kDa subunit; KEGG: cbe:Cbei_2449 electron transport
FT                   complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66116"
FT                   /db_xref="GOA:A8ZSV2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV2"
FT                   /protein_id="ABW66116.1"
FT                   /translation="MGLKLAGFEGSGTFAKGVHPPGHKNFSQDVPIEVVPTPAKVVVPL
FT                   MQNIGAPSECVVKAKQDVTFGEMIAKATGFVSVPIHSPINGKVQKVLNVTLPNGRHVPA
FT                   VPIKADGDQLEGAALMEEILGGDWPKDAADKHDPKAISEAISAAGIVGLGGAAFPTHVK
FT                   IMPNDKRPVDALLINGCECEPFLTPDYRIMVEAADAVICGALLAGRAVGAKQIVVGIEA
FT                   NKPKAVEAMTRAAQGTAVKIAVLKTKYPQGSEKHLIMAVMKRKVPPGKLPLEVGAAVSN
FT                   VGTVVAVARAVLRKKPLTHRVVCVTGGGIVQPKNLLVPIGISYGELIEFCGGLRPEAAR
FT                   IVSGGPMMGFAFTDMEMPVTKGASGVTVLTRDDVKKAEETACVRCGRCVDVCPLNLVPS
FT                   KLAVASRNKNLEVAERYNIFTCLECGCCAYTCPASLPLVQLIRMGKAAIMATRKK"
FT   gene            351770..352783
FT                   /locus_tag="Dole_0307"
FT   CDS_pept        351770..352783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0307"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   pca:Pcar_0262 electron transport complex protein RnfD"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66117"
FT                   /db_xref="GOA:A8ZSV3"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV3"
FT                   /protein_id="ABW66117.1"
FT                   /translation="MNENADKKAEARETTAGPVLQTAPSPHLSNESFTTRRMMADVLIA
FT                   LIPVVGMAVYVFGMFAVKQLVICLVSCLAAEAIFTRMRKRPIPLGDGSAAITGVILALS
FT                   LPGPAPWYVGVIASFVAIGIGKVIFGGLGMNIFNPAMVGRAFVMIAFAGAMAASGYMTA
FT                   GGAVDAVSQATPLTLFQQEGVVTPLFKLFIGTTNGSLGEGSALACLIGGAYLCIRRTAS
FT                   WEIPAGVILAVVVCAVLVSLANPDSEWTVLHHLFGGALLFGAFYIATDPVTSPLTSGGK
FT                   FVFGLGVGAIIMLLRIFSGYPEGVMFAVLLMNAMTPLINRWMIPKPFGTVKVEEAA"
FT   gene            352828..353427
FT                   /locus_tag="Dole_0308"
FT   CDS_pept        352828..353427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0308"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: cbf:CLI_0442
FT                   electron transport complex, RnfABCDGE type, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66118"
FT                   /db_xref="GOA:A8ZSV4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV4"
FT                   /protein_id="ABW66118.1"
FT                   /translation="MKNNYIVQAWLVLLLAVFYGGALAGVQLTLSPKILENKINETRQQ
FT                   VPGLVLGADRADEAIEMESTTLALEKNGRQVFYDVYKAMQNGEPAGWVIKSSGQGYADK
FT                   IELLVGVNPDLSAITGLFILNQKETPGLGNKIIEDDWRNQFLQKKTDKSLAVVKTGAKA
FT                   GNEIDAITGATISSRAVCTIINSTLNDVKGQLSTVD"
FT   gene            353467..354090
FT                   /locus_tag="Dole_0309"
FT   CDS_pept        353467..354090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0309"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   cpe:CPE1063 probable Na-translocating NADH-quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66119"
FT                   /db_xref="GOA:A8ZSV5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV5"
FT                   /protein_id="ABW66119.1"
FT                   /translation="MSTEPTPMERFLQGIIPENPVYRQLLGLCPVLAVTGNMQSAMTMA
FT                   GAVLFVLFCANVMISLIRNILKPHLRIVIFTLTIATFVTIVDRFLAAYMYNMSKALGPY
FT                   IPLIIVNCIIICRCEVCASKQSVFHAGADAIGQSLGFALALASIATVREILGTGMFFGL
FT                   PVLPDVWPDWVIMALPPGAFFTFGLLLGLVNWFTANRAKKEKNS"
FT   gene            354109..354876
FT                   /locus_tag="Dole_0310"
FT   CDS_pept        354109..354876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0310"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   ctc:CTC01023 rnfA/nqrE"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66120"
FT                   /db_xref="GOA:A8ZSV6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV6"
FT                   /protein_id="ABW66120.1"
FT                   /translation="MNYIIDIFLIAMSAALINNFVLYYFVGICPFIGVSRNISMAFGMG
FT                   CAVTFVITIAAFISWAITTFVLIPGAPLTAFVAGFFLPGEQAAAVDLTILSYIVYIFAI
FT                   SSSVQFVEMYVRKFFPPLYKSFGVFLPLITTNCAILFACLTIMSNVAVDNPAEAWDLGR
FT                   ALVLAIFGGVGFTIAIVIMAGIREELDMCDVPKPLQGAAITLVTAGILAMGFMGFTGVD
FT                   SGLKKALKPEPAQEMSINLQDAAPVLARVTIEN"
FT   gene            354914..355825
FT                   /locus_tag="Dole_0311"
FT   CDS_pept        354914..355825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0311"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   cbh:CLC_0431 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66121"
FT                   /db_xref="GOA:A8ZSV7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV7"
FT                   /protein_id="ABW66121.1"
FT                   /translation="MSAVTIGLAAGTLVGMAVILTYILGWANVAFYVEVDPRVDAVSKA
FT                   LPGANCGGCGFVGCGEYAEAVVMQGAPVNKCAPGGANCAAAIAQIMGVEVGEALPYRPI
FT                   VHCGAHTKDKHGISDYRGEQRCVTANIVADVQGCTYGCLGFGDCVEACAYDAIHVINGL
FT                   AVVDYTACVGCGACAKACPRNIITMTPFKADRVFAVLCSNKDAGKEVKKVCDVGCLGCK
FT                   ACERACGLFAIKDNLSCINYDDYDPEHLEDIFKAIDKCPQKGIVLVGKPSEKDMAAVAD
FT                   KEAPSVVTPDFKTTVDDTEWRG"
FT   gene            356308..356538
FT                   /locus_tag="Dole_0312"
FT   CDS_pept        356308..356538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66122"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV8"
FT                   /protein_id="ABW66122.1"
FT                   /translation="MDAASQKAMTDQIKKLIDLFKNWKGQKPDLDNPDFSRYHQTEAEY
FT                   QAEQKEWLASVKKKKIVKSGSEKKDRRRTSG"
FT   gene            356639..358735
FT                   /locus_tag="Dole_0313"
FT   CDS_pept        356639..358735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0313"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: pth:PTH_0579 anaerobic dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66123"
FT                   /db_xref="GOA:A8ZSV9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037949"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV9"
FT                   /protein_id="ABW66123.1"
FT                   /translation="MATTKVKTICFECHSRCGLVLEVEGGRVTAVHGDKDHPHSHGYSC
FT                   PKGRACMEIIYHPDRITTPLIKVGERQGTRFEKASWDDALGLVAERLLASREQWGAESV
FT                   VFGSGTTRGMAPYINRFLALFGSPNFMAPSNMSGGPLALGSATTTGFGLVDPDYANTRC
FT                   MLLWAHNPENSWPGLYLYDINQGLKKGATLIVVDPRGTRFAKKADHWLRLRPGTDVALV
FT                   LSFIHVIIENGLYDKAFVEQWTSGFDRLREYVADFAPEKVESITWVPAGQIKTAATVFA
FT                   TARPSVVGPGMGGVCQANDAFDLTRGLTILAAITGNLEVPGGNLNCTPPTRKRSCYGSD
FT                   YDAPRNLPPDQAAKKLGADTYPLFGLVPIPCPPQAVWPAITDGKPYPVRALGLFANNSV
FT                   CAYPHSARVRSVLQRLDFLFCVDYFHTPTTELADVILPPAHWSERDDVEDLLMKNHLFC
FT                   QPKAVEPVPECRDEKEILIGLAQKMGLTEYWKSVTEILDYRLEPVSMTFAEFKKTGVFA
FT                   NPVEYKRYEKTGRFRTPSGKVELYAEYLTGLGIAPLPVFREPDEGPVSRPDLYREYPLI
FT                   LTTGGRNIVYYHSSHRNIPSLRKKAPDPELQIHPDTAADLGVSEGEWVYLATPRAKVEI
FT                   KIRLFADIDPRVVHAPHGFWYGVADGWRRLNINMVTNDEPLCPVTASVPIKSLLCRLEK
FT                   MAPR"
FT   gene            complement(359227..361020)
FT                   /locus_tag="Dole_0314"
FT   CDS_pept        complement(359227..361020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0314"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sen:SACE_5343 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66124"
FT                   /db_xref="GOA:A8ZSW0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW0"
FT                   /protein_id="ABW66124.1"
FT                   /translation="MAIKDYKNIHEMLKETIDARADQTAYRWFREAGVTDSITWAGFYD
FT                   QVRQAAKSLIALDVNKQDKVNILSYTCYQWVLCDMAIASCNGVTVGIYQSNLPHDCKYI
FT                   INHSDAVVIFAEDQKQLDKLLSIRADIPNIRKVILFKGKGTGDGWAISFDEFLALGKDV
FT                   ADEKLKERIDAAGPSDPAAIVYTSGTTGVPKGAVLTHDNLTFTAQSARECADIHEGDNT
FT                   FLFLPLAHVFARLCVYFSVLTGTCTTFARSIDTLVDDLKASEPDWFASVPRIYEKVYAK
FT                   VISGAEAKGGLALKIFRWACTVGNEISDRRLNKQPIPAGTAFKYKIATKLVFSKLQAAL
FT                   GGRVRWCISGAAPLNPDIAKFFHAADVLILEGLGMSENTSFTNVNRVDNYRFGWVGQPG
FT                   PGIEQKIAEDGEVLFRGRNVMKEYYKMPEETAKTIAPDGWQSTGDLGEIDDQGFLQITG
FT                   RKKDLIITAGGKNIAPSAIEGVIATSKYIAQVTVIGDRRKYLTALVVMDPETVAEYAQS
FT                   NNIAFTDINDLGQKPEILKLIETEVAEKNKAFASFENIKKVTIVPEFTIDNGLITPTFK
FT                   IKRNVVMERFAEKIDAMYPKD"
FT   gene            complement(361148..361930)
FT                   /locus_tag="Dole_0315"
FT   CDS_pept        complement(361148..361930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0315"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: gsu:GSU2489 deoxyribonuclease,
FT                   TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66125"
FT                   /db_xref="GOA:A8ZSW1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW1"
FT                   /protein_id="ABW66125.1"
FT                   /translation="MIQLFDSHCHLDDRSYADDLDKVLDRAHVAGVAAAMVVGTTLESS
FT                   NRAAALAAQHEGLFASVGVHPHDAARCTEHQIKSLGRIAAENPKVRAWGETGLDFNRMY
FT                   SPEGDQEKWFERQIAAAQKAGLAMIFHERDSQGRFLQLLKSCFSNTQKGVVHCFSGTRA
FT                   ELSAYLDLGLYIGITGVLTHKTRGQDLRDMMGHIPDSRILIETDAPYLTPAPERNRFRR
FT                   NEPAFVKSVFDTLAAIKNRDPADLAAVLWNNTCRLFDI"
FT   gene            362111..362950
FT                   /locus_tag="Dole_0316"
FT   CDS_pept        362111..362950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0316"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mta:Moth_1518 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66126"
FT                   /db_xref="GOA:A8ZSW2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW2"
FT                   /protein_id="ABW66126.1"
FT                   /translation="MFKIVKRQEMAQGTVVLNEIEAPLIAAKAKPGQFVILKANETGER
FT                   IPLTMADTDPEKGTITIIFMIVGKSTALFATLKEGDAYMDVIGPLGAPTHIEKLGKVIC
FT                   VGGGTGVAVLHPITRALKEAGNHVFCVIGARNKDLLILEEQMKAASSDLRVCTDDGSYG
FT                   HHGFVTDVLKSILTENNDIKLVVAIGPVPMMKACSNLTKEFGVKTMVSLNPIMVDGTGM
FT                   CGGCRVSVGGETKFACVDGPEFDGHQVDFDELALRLRAYTADEKESHACFLNKAKQG"
FT   gene            362964..364373
FT                   /locus_tag="Dole_0317"
FT   CDS_pept        362964..364373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0317"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sat:SYN_00606 glutamate synthase
FT                   (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66127"
FT                   /db_xref="GOA:A8ZSW3"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW3"
FT                   /protein_id="ABW66127.1"
FT                   /translation="MADTEKKEKTPRQPMPEQPPKVRAKNFDEVPLGLSPEAAVAEASR
FT                   CIQCKSPACVEGCPVRVDIPGFIRLVKDNDFTGAISKIWERNGLPAVCGRVCPQEAQCE
FT                   GKCILGKKGDPVAIGNLERFAADHERANRKAPVPERAPATGKKVAVVGSGPSGLTVAGD
FT                   LLLKGHDVTIFEAFHRPGGVLVYGIPEFRLPKEIVFSEVDGLETLGGKVETNVVVGRSV
FT                   TVDELFEQGYDAVFLGVGAGLPMFLNVPGENFAGVFSANEYLTRTNLMKAYRFPEYDTP
FT                   VIRGKNVVTVGGGNVAMDAARTALRLGAENSYIVYRRSKTELPARAAEVHHAEEEGVQF
FT                   KLLTNPTQFFGDDNGRVIGMEALQMELGEPDASGRRRPVEIKGSEFRIDCDLVIIAIGA
FT                   GANPLLTQSTEGLELNKWGYVVADEKTGKTTRKGVWAGGDIVTGSATVILAMGAGRVAA
FT                   DSIHDYLTIGW"
FT   gene            complement(364570..364887)
FT                   /locus_tag="Dole_0318"
FT   CDS_pept        complement(364570..364887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0318"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   sfu:Sfum_0579 nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66128"
FT                   /db_xref="GOA:A8ZSW4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW4"
FT                   /protein_id="ABW66128.1"
FT                   /translation="MAHSDGHGAKTGECGDTVEMFIKKGTDSIIEQVLFDIRGCRNTHA
FT                   SANAVAVLAEGKKIEAAWEITPEAVIDLLETLPPDHFHCAELAVGAFYLALADCRNQHE
FT                   S"
FT   gene            365131..365466
FT                   /locus_tag="Dole_0319"
FT   CDS_pept        365131..365466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66129"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW5"
FT                   /protein_id="ABW66129.1"
FT                   /translation="MNASIDTILTTIGDTYKDRIDPRARHYLEINIGKQAEIMGLSGLP
FT                   DNLGAATAIVPLKAPAAGMKVRVDGRTFVDYAQFDSGVATPGYLARESGLAHAMFVPND
FT                   SMILNFA"
FT   gene            complement(365851..366351)
FT                   /locus_tag="Dole_0320"
FT   CDS_pept        complement(365851..366351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66130"
FT                   /db_xref="GOA:A8ZSW6"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW6"
FT                   /protein_id="ABW66130.1"
FT                   /translation="MVKRKYWIAALVLAGAGIGLALVLVDWEARAVKKRMTAIEKELQW
FT                   APEDNDLVVAARIKRVGAMVTDPCRIDMPTYQVARSFSQKDVAPYLMMARRRYTQVAVA
FT                   FHDMSVEFSGAGTARVVATARVRAVASDGLRDDEVMEIALVLQNREKQWYITSVEEQVV
FT                   LER"
FT   gene            complement(366345..366842)
FT                   /locus_tag="Dole_0321"
FT   CDS_pept        complement(366345..366842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0321"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: sth:STH2445 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66131"
FT                   /db_xref="GOA:A8ZSW7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW7"
FT                   /protein_id="ABW66131.1"
FT                   /translation="MNKNRLQRFLFPALSRRYMLRVVLVAAGAFLFFGYVCIPFRIQGH
FT                   SMAPTYENGAVNFCFALRYLFSDPSPPDVVAVRLAGTRVMLLKRVVATKGQAVAFRNGF
FT                   LFVDGRKVAEPYVEKKSDWSLPSRTVKPGHVYVVGDNRSVPIENHQFGQTPTTRIVGVP
FT                   LW"
FT   gene            367112..368317
FT                   /locus_tag="Dole_0322"
FT   CDS_pept        367112..368317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0322"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: aba:Acid345_3936
FT                   serine/threonine protein kinase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66132"
FT                   /db_xref="GOA:A8ZSW8"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW8"
FT                   /protein_id="ABW66132.1"
FT                   /translation="MKRILTCLCLVGFLLAGFAGCSLYVKGDYKFQTKDYDGAIADFTA
FT                   YLEQKPDSFQATYMLGRAYLEKGELDKSVATLKKALEMNPGDPEAILFLGVAYVAKADY
FT                   ENAIATFESFEDPSRPLLEKAVGKQITLLKIDYNKKLAKEAVASEKKLATVKPPVETYA
FT                   VFYYEDKTPGKNMAAFQKALAAMTISNLSHINSIQVVERLRLQALMEEMALGRTGIVDS
FT                   KTAPRLGRLVGAEHLIVGTLSKDIRTDTALASTTRRKVIGNAALTVKRDNFFQLPGAIA
FT                   AGVAEMKGIKLTPAEQSAVGKVHTKNIDAVLYYGQALDAMDQADWKTALELFNKALQAD
FT                   PQFELALLGRESCPDDSSSGTGGMGQVTPESLKNSFAAAVNDQAAADKAKKDSLSGGSG
FT                   GH"
FT   gene            368475..369113
FT                   /locus_tag="Dole_0323"
FT   CDS_pept        368475..369113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0323"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   aba:Acid345_3544 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66133"
FT                   /db_xref="GOA:A8ZSW9"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW9"
FT                   /protein_id="ABW66133.1"
FT                   /translation="MACVLPVGPAGASPDGDRTLAILPFENNSVTTPETYDPLKSGLSV
FT                   MLMTELANSEAAFTLVEREKIRALLDEITLGQTGVIDASTAVKMGKMLGAQAIGFGAFM
FT                   VMGKNVRIDMRMVEVETGALIMAESITGKTDDFFTLERDLAQKIAGSMQAKEAVAQASS
FT                   KSSIEAALLFARGVDALESGDGRGADAFFKKAIKLDKSYQPQVDRLKGL"
FT   gene            complement(369395..369853)
FT                   /locus_tag="Dole_0324"
FT   CDS_pept        complement(369395..369853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0324"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: mca:MCA1020 phosphoesterase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66134"
FT                   /db_xref="GOA:A8ZSX0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX0"
FT                   /protein_id="ABW66134.1"
FT                   /translation="MKRVGVISDTHGLLRESAAAALHGCDMILHAGDIGHQGIVDTLAS
FT                   IAPVVAVRGNMDRGEWADRLPVFETVTVAGADIYMLHDLLALDLDPAGYFAVVIHGHTH
FT                   APSGTTRDGVLYFNPGSAGPRRSSLPVSVGLLTIDDASVKGTWVMLDA"
FT   gene            370335..371519
FT                   /locus_tag="Dole_0325"
FT   CDS_pept        370335..371519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0325"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: psa:PST_3859 GGDEF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66135"
FT                   /db_xref="GOA:A8ZSX1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX1"
FT                   /protein_id="ABW66135.1"
FT                   /translation="MIALAIIILLWADGTRESVLRFSETIFIATLVPALFFSLRLGRSN
FT                   HFFTVLVLAGLAGAAALLVPATFSSATAQQRFYYHAAAVLAPLHFVLFAWWHERGLLNM
FT                   WGLSRLIWIGLVPAAAAAACRVPDIIHHPGLARFVFHRALSGFPDVPLVPLIAALLALM
FT                   LLLVMYLRDPSPARDGFFWATAIVSAGFLFQKGPVVLQLAASGAIVVLLVSMVETGHFF
FT                   AYRDELTGLPSRRALNEKLQALGRTYTIAMVDVDHFKRFNDRYGHDVGDEVLKKVAAAL
FT                   KRAGGNAYRFGGEEFTLVFPGKALAQGKAAAEAARNAVSRSAFTIRSPARKKKDGSAPE
FT                   KATPGKRKRVSVTVSIGLAQRSSRHTTPDAVIKAADRALYRAKKNGRNRTETAP"
FT   gene            complement(371538..372149)
FT                   /locus_tag="Dole_0326"
FT   CDS_pept        complement(371538..372149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0326"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   sfu:Sfum_2110 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66136"
FT                   /db_xref="GOA:A8ZSX2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX2"
FT                   /protein_id="ABW66136.1"
FT                   /translation="MPLRAHYKHFLRSALSPVCSDAVRRSMAVQLRCPYGHTTNRPFPA
FT                   FLFIRNHPAVAAGIRLPCLVKYETLLKFTAHGFDTDTDSDPDFDFDFDFDFDAWKGENI
FT                   MLAKIIIKRRFRQGATDEILALLHDLRFAAMSQPGYVSGETLMQNDDPRKLVVIGTWQD
FT                   MESWHRWKNNPRRNEFEVMLNVYQEGPTVYEEYVLGTALR"
FT   gene            373133..374032
FT                   /locus_tag="Dole_0327"
FT   CDS_pept        373133..374032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0327"
FT                   /product="exopolyphosphatase-related protein"
FT                   /note="KEGG: rru:Rru_A1207 exopolyphosphatase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66137"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX3"
FT                   /protein_id="ABW66137.1"
FT                   /translation="MRIVTRPDFDGIVCAVLLYDVADITAPIAWVEPSQIQKNEVSIKK
FT                   GDILANLPFHENCSLWFDHHHSNRVDVPFEGLFRVAPSAAGLVYEYYKERLSRDFSELV
FT                   AQADKIDAADLSADEVARPEDHPYILLSMTIVNHDWSEAPYWNLLVDLLGRLPIDRVMA
FT                   HDAVQARCRQTIEDNRNLAAHLKKHTTLYGHVAVTDFRALDVAPTGNRFLAYSLFPEAV
FT                   VSVKIRHPAEDRSRVIVSVGHSIFNRGCNVNVGEMLSQFEGGGHRGAGACTFLADKADD
FT                   YIPRIIDVLVKNEENDTA"
FT   gene            complement(374161..376653)
FT                   /locus_tag="Dole_0328"
FT   CDS_pept        complement(374161..376653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0328"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: pat:Patl_2358 Ig-like, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66138"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX4"
FT                   /protein_id="ABW66138.1"
FT                   /translation="MTENKREHAKMRILFSHGIKLCAVLAVLLLVAAGCSSSGGETGTT
FT                   PVVPTGSDPAAVALSATPGTISAGGTATITARVTDEDSAIVVGATVVFSAESLYGTITA
FT                   TADTDASGVATATFTSSGQTGTTTIAASVGSSVTGSTTLTITPVAAYLSLSTSQTSILT
FT                   DGVDAADITATVLNASRVPIEGIAVNFSVAAGQLSVANVMTDGSGQAETSLTSGTYDKT
FT                   NQVVTVTVTAQDLIATIPIQVTGTTVSLSIDETVLASGGTQSTPLTVTVKDGGGTEISG
FT                   AEVTLTQSGSGTVTLTPASGTTATNGTLAITVTGQNAGSVTITATALGASASQAVTVSG
FT                   TPFEITSPAASSVSQETGTALPITVRSPDNHDVKFVTTMGTWDINNQVSATLAAGTGTV
FT                   TSTLNVGINAGIATVRVEDNTDSSISDTLQVAIYAPSDEATRLTLQVSPSTIAPSSGGV
FT                   TNNTTIKATVKNGDGQVVGDAPVIFTLFRTTGGGEYISPPIVYTSSNPESGVPIGVATT
FT                   DFYSGSLVSNTQGVLCLGRIDGAAIAGPAKVFDFDLATGTITRSDTGGSFIADGFKEGD
FT                   TIRVSGSEENDDTYTITTGGLAAGSLTVDDSLKADESPGNPVVIATAEDTDVVSVVISG
FT                   EGSSVAIGGATVIEEVENNPAAYKYPMSVLVNDSGGNAVPGVTVTLSLWPTKYATGYTD
FT                   PDAGPIITGEFWNEDLNRSDSLDIGEDTDGNTWGGVFPPRYFGVLGEGAYDTALNGIID
FT                   PAKSCAGAVPVTVVTDENGLAQFDHVYLKNNAAWVKVEYRATALVYGSETVSTLNMWLP
FT                   FIEDEKANLPNSPWGPYP"
FT   gene            complement(376692..379655)
FT                   /locus_tag="Dole_0329"
FT   CDS_pept        complement(376692..379655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0329"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: gme:Gmet_0975 type II and
FT                   III secretion system protein:NolW-like:secretin/TonB,
FT                   short-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66139"
FT                   /db_xref="GOA:A8ZSX5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX5"
FT                   /protein_id="ABW66139.1"
FT                   /translation="MHRMNAKKAAKVRGTLYFLSAILMVAMIAGCTPSAGVRQGTEATA
FT                   PEATSDTGQLARRITGISVKDTPDAVVVSIQTNHLADYTLAEPPLEQAVVLYFPEAGLA
FT                   TTTADPAEPNDLVGTVTAAELIAGGPSKVVIPMQQPGLAYEAMRGQDNSLNILFNKTAV
FT                   SPAPEAAWGQEEAAETVAAAETKEDASSVVEDATPAAPATLMEDITVTGDADALDITIL
FT                   ADGAITDHKLRILKAPPRIVYDLPGIRSTHAGEQRIAVDSAIAGRVRHFAHPDYLRVVV
FT                   DLKDDLYLGKARAYSLSNGLLIHVGEKETPALAAARKTGPVTTEARTSVAEAASVEPVD
FT                   ASPAVAPAPAEQEAEPAPAVAVKRSGKPAMVNRIDFMEEMDGRSAIEIGTTRPVDYEML
FT                   TISGNQLFLKLDNTDILSYRQRPLITTRFESAVDLILPVQTKKMKEQRFSAVNIDLREA
FT                   VPYTIKQMDNTIRILFEPSSVAPNPAKEVVIPTELAIESLVTDTAGAPDIETAVTEPAP
FT                   ASEAPVTPPETDVPAPIGTVAAPEAAVPQTAPAFEAPTGMRTEPDAPAPSLFGKKKNFT
FT                   GEPIALDFYKTDIRNVIRILKDVSGKNFAIDDDVSGSVTLSFVNPVPWDQVLDLILEMN
FT                   NLGMVEADGIIRIATQATLVQQKESEKAALTAQQDMKKAEETLASLVTEYFSISYANAG
FT                   EDILPHIEGLLSDRGHAKVDNRTNQVIMTDVEEKVEKAREIIAKIDKVTPQVMIKARIV
FT                   ETSSSFSREFGTEWGIDNRYNSPNINIGTDGAYRDEMGGTYTYDVALNSLSSPVQNLIG
FT                   INFARIIGTPFSLDAKLSLMESTGDVKIISTPKVVTLDNKTATISQGIDYPYTVVEDGE
FT                   ADVKWKTIDLNLDVTPHVTPDDRISMKLNIQKNDVGEIINGEQSFNTKRASTELLVNDG
FT                   DTVVIGGIIKEREGAGERGVPWISKIPVLGNLFKYKTRSDEKSELLIFITPNVVRLD"
FT   gene            complement(379659..380639)
FT                   /locus_tag="Dole_0330"
FT   CDS_pept        complement(379659..380639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ang:An01g09380 hypothetical protein Pfam:
FT                   Extensin_2 Troponin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66140"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX6"
FT                   /protein_id="ABW66140.1"
FT                   /translation="MMRVRKNLIICLVCVCLAAGVGCKKGADNPPEQAEPARQTISMEQ
FT                   PAPAPPAEQPTAPEVMVVEEEAPGPMVVTGTPQVPAETTPPASGPATETEPVAKKAAEG
FT                   PSAEEQQAPSDMPPTPAEEPPAPPVEAVSDSPALTDTADPEETDIALPTSEVEAGAGTV
FT                   DGTAMETTDEMEEAPADDVASEIKIVIDLMGEEDLDAEEAAKTTAENQALAMFSPFTPL
FT                   FQKDASEDDMFLEQDSQRKRAFLTPLERISLGQLQLSGIIRAASGNRAIVTDATGKGYV
FT                   VKKGTYIGLNSGQVEEIVDDRVIVVEMVGGRRAVTELKLQKPAGE"
FT   gene            complement(380636..381271)
FT                   /locus_tag="Dole_0331"
FT   CDS_pept        complement(380636..381271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0331"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="PFAM: Pilus assembly protein PilO; KEGG:
FT                   gur:Gura_1812 pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66141"
FT                   /db_xref="GOA:A8ZSX7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX7"
FT                   /protein_id="ABW66141.1"
FT                   /translation="MKNRFEKYSESMKPVFEAVSSLTMIQRILIVVVVFALLIGSFVFF
FT                   SYMPKYKDIAKIDKQYETVAKELNVAKQKAAQLGALQEEWAEKEEKFKLVMAALPDKKE
FT                   IPSLLSEISRAGNSAGLEFTRFVPQQESIRDFYAEIPVAISITGPYHSISLFFEKIAEM
FT                   SRIVNVRGINISASKNAEDTLSTQCTTVTYRFLSPAEQAKTQPKGKKR"
FT   gene            complement(381283..381825)
FT                   /locus_tag="Dole_0332"
FT   CDS_pept        complement(381283..381825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0332"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   gur:Gura_1811 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66142"
FT                   /db_xref="GOA:A8ZSX8"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX8"
FT                   /protein_id="ABW66142.1"
FT                   /translation="MIKINLLPYRAARRKENIRRQISVFLLFFIFVAMGLTYYHIVLSG
FT                   KVSAAKDRLQRTQSELKSYQAKVKEVDELKAKLATLDKKLDVMARLNLDRKAPVLLLRE
FT                   IAELTVKGRMWITRLEESGNTVFVSGIAMDNKTVATFMTRIEESSLFSGVDLSNLVHEE
FT                   RSGLKLKRFELRCSKAA"
FT   gene            complement(381822..382877)
FT                   /locus_tag="Dole_0333"
FT   CDS_pept        complement(381822..382877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0333"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   afw:Anae109_0686 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66143"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX9"
FT                   /protein_id="ABW66143.1"
FT                   /translation="MLFGKKDHLVGLDIGSSVVKVAEVAVSSSGRSLLRFGTLEMPAGA
FT                   IVEEGIKDPEVVAATIKELFSLYNIKEDRVAISIGGYSVIVKKINVQSMSEEQLQEVIA
FT                   VEAEQYIPFDINNVNLDFQILGDNDQNPNQIDVMLVAAKKETVNDYLNVIDIAGLTPVI
FT                   IDVDAFALQNIYEVNYEAEENCVALIDIGANKTSLNILKGSKSVFMRDVSFGCNQINHH
FT                   IATKINCSLEEAEELKLSDKQERISTDELNSIISSVVSDWTTEIRRALDFFYSTYSNDH
FT                   LKCIYLSGGGSNIPEFRQMLASQTSSELEILNPFSNFDVKDDRLDSAYLKQIAPQAAIC
FT                   MGIAIRRVDDK"
FT   gene            complement(382887..383039)
FT                   /locus_tag="Dole_0334"
FT   CDS_pept        complement(382887..383039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0334"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: gur:Gura_1809 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66144"
FT                   /db_xref="GOA:A8ZSY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY0"
FT                   /protein_id="ABW66144.1"
FT                   /translation="MSKSELARKANVSPITIARIEAGMPCRMETQRKILKALGFELSER
FT                   NKVFD"
FT   gene            383454..384140
FT                   /locus_tag="Dole_0335"
FT   CDS_pept        383454..384140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00762 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66145"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY1"
FT                   /protein_id="ABW66145.1"
FT                   /translation="MNRLTAQVLLAWAMALLLAGCFTAGPRHKPSPAIQLPGATLCVMP
FT                   FIKGRHALQSGAPLDLTLTCPVSDLCVTQEDFPEDANRVLTRLAWQAAANRWGEAVTPM
FT                   HTAADTWAAMDKDPAVDTLLLLARRVGAALNVDYVMAGTVWRFREREGYAASASRPASV
FT                   AFALYLVDVKQGTGVWSGGFDRTQQPLSENLLNVVGFFKQGAKWLTAEELAAAGMEDVF
FT                   DALPSE"
FT   gene            complement(384318..385310)
FT                   /locus_tag="Dole_0336"
FT   CDS_pept        complement(384318..385310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0336"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sfu:Sfum_2018 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66146"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY2"
FT                   /protein_id="ABW66146.1"
FT                   /translation="MIKTFLDNNTLEQQENKPLDPVHPLKRRMSRKENKMTQQRFGKLV
FT                   FIPGTNSGKYPFCNSLYIDDEMRGIIDPASDAETLKALAAAGPMDLLINTHYHEDHFSF
FT                   NFLFPGASLCVHDKDADCLASMDALLSAYGINDPDTIALWRDFLVEGFNYRERTPDRRL
FT                   TDGEILDFGKTRLQVVHTPGHTPGHCSFYCEQEGVLFLGDLDLTPFGPWYGDAVSSIPD
FT                   TIASVRRLMEIPARVWITSHNMGVLTQGVAEAAARYLAVIDEREQKIVDFLSTPRTLNE
FT                   IAAQWFVYKKPREPEMFYAFGERGMAAKHLEYLMEKGDVTKEGGRYRRM"
FT   gene            385983..387716
FT                   /locus_tag="Dole_0337"
FT   CDS_pept        385983..387716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0337"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   afu:AF1772 long-chain-fatty-acid--CoA ligase (FadD-7)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66147"
FT                   /db_xref="GOA:A8ZSY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY3"
FT                   /protein_id="ABW66147.1"
FT                   /translation="MSIQPWPTTNWPKGVSREIADFEHPLFSFLDDAARDYPDNVYTIF
FT                   NGGTRTFAQVKQAADRVANFLAASGIKKGDRVAIFLPNLPHYPEIYFGILKAGAVCVTC
FT                   NPLYTPSELNYQLKDSGSKVVFCMDHPQFYPTTVQAIQETGVETVVICNVKAFLPPVKR
FT                   ILGALLNKIPKAESHEPGHVMYDEIMASYPAQAPDVEINPSEDLALIIYTGGTTGVPKG
FT                   AALTHANFVFDVKAMDEWVYLSQEPGAPPEKIRKGGFHCYIGVLPWYHSFGMTMCMLTS
FT                   CASGSRLICVPDPRAGNPPFTEVLKLVQTYRPTILVGVPTIFSAFENHPLLDKYDLSSL
FT                   ICCASGGAPLPVELAKNFEAKTGSIIFEGYGLSETSPVITGNPSDKDLRLFGSVGFPVS
FT                   NTDIKIVDSETGITVLPQGEDGEIAVNGPQVMKGYWQKPDADKEVFREIDGKRYFLTGD
FT                   IGHIDENGYILITDRKKDLILVGGFNCYPREVEEVLFQHPKVAQAAVVGVPDPRSGEAV
FT                   KAYVQLREGMTATEQEILDFCKEKLAGYKRPRAIEFRDALPTSPVGKVLRRVLKEEAKQ
FT                   K"
FT   gene            complement(388370..388780)
FT                   /locus_tag="Dole_0338"
FT   CDS_pept        complement(388370..388780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66148"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY4"
FT                   /protein_id="ABW66148.1"
FT                   /translation="MEALSLYKKAHLVVAAIRVLTYLNNKPPTAEDVEGLLGTSSEEVL
FT                   LVCRKLEKKGIVEAVEGAYGARLFVLDHTAIEEISRDLPTSGMEEEIEKFKKTQQERDK
FT                   KIEEIKAKEEERKRKLFEQLNQGLKQGKPVSE"
FT   gene            388984..390264
FT                   /locus_tag="Dole_0339"
FT   CDS_pept        388984..390264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0339"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: dar:Daro_2364 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66149"
FT                   /db_xref="GOA:A8ZSY5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZSY5"
FT                   /protein_id="ABW66149.1"
FT                   /translation="MIEIIEVQAREILDSRGNPTVEVDVTLSGGATGRAAVPSGASTGT
FT                   REALELRDTRKKRYLGKGVEKAVENVNTLIGPVLYGMPADEQFMVDSTMIGLDGTANKS
FT                   KLGANAILGVSMAVARAAADAYELPLYRYLGGIHAKHLPMPMMNIVNGGAHAANSLDIQ
FT                   EFMIIPVGGKTIAECVRMGAEVFHTLKKLLKAKGFATAVGDEGGFAPDLESNEAAIGFI
FT                   MEAIKKAGYRPGRDVGIALDAAASEFYEKGKYVLKGEGKKLSSKQMVDYYENLIDKYPI
FT                   LSIEDGLAEQDWDNWVMMTDRLGNTTQIVGDDVFVTNPAIFEKGIREGLANSILIKLNQ
FT                   IGTVSETLQAIDMAKQAGYTTVISHRSGETEDAFIADLAVGVNGGQIKTGSLSRSDRIA
FT                   KYNQLIRIEEALGAGAVLSNDFTAVVR"
FT   gene            390277..391122
FT                   /locus_tag="Dole_0340"
FT   CDS_pept        390277..391122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66150"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY6"
FT                   /protein_id="ABW66150.1"
FT                   /translation="MTPRFKPAFMLLILVGTCLWGVLPAAGYVPPGELILDRMTSTLGR
FT                   TGKFSVVHTTAVADTACPPLHEATATETAWYDPPDRFRFESVFKKVKRIYVATPEAALT
FT                   IVDGHVVSTAQSPLMRYREPLLCRDRKLLAARLVGMGIDTTVSSLGRLDGTVAYVVGAR
FT                   FPDASASQLWVAKETFLPFRLIINDSRERTQVEARYSQWHKEGAFWFPMHIEIYRNHRL
FT                   IQTICSHTVTKKSVFESGLFDITALQRRYPPADAAEGRPPDSSTDEIQQAIDNFNKLYE
FT                   "
FT   gene            391138..392799
FT                   /locus_tag="Dole_0341"
FT   CDS_pept        391138..392799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0341"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: dps:DP0766 probable CTP synthase
FT                   (UTP--ammonia ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66151"
FT                   /db_xref="GOA:A8ZSY7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY7"
FT                   /protein_id="ABW66151.1"
FT                   /translation="MTSKSKFIFVTGGVVSSLGKGLASASIGALLESRGLTVTIQKLDP
FT                   YINVDPGTMNPFQHGEVFVTDDGTETDLDLGHYERFTHAVMGRNNNFTTGKIYHSVISK
FT                   ERRGDYLGGTVQVIPHITDEIKRSIRMVENDADIVITEIGGTIGDIESLPFLEAIRQMR
FT                   TDMGKENVLYIHLTLVPYIPTAKEVKTKPTQHSVKELRSIGIQPDILLCRTSGLLSDEL
FT                   KAKIALFCDVSKDAVITAKDVDNIYEVPLNFNREGLDDKIVELLHIWTRAPRLDFWENL
FT                   SSAIKAPEHDVTIAIVGKYTNLTESYKSLNEALYHGGFANKSRVNLQFIDSETITKENV
FT                   AEVLKDAHGILVPGGFGPRGIEGKIAACEYARTRKVPYFGICLGMQIAVVTFARHVAGL
FT                   AGAHSTEFDKNTPDPVIYLMREWFDERLNTIQKRDVDSDMGGTMRLGAYTCAVAPDSLA
FT                   HTAYGRTTISERHRHRYEFNNDYKATLQEKGLIISGTSPNGELVEIVEAGDHPWFLGCQ
FT                   FHPEFKSRPEDPHPLFREFIKAALAYKTGNPADNPD"
FT   gene            392810..393523
FT                   /locus_tag="Dole_0342"
FT   CDS_pept        392810..393523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0342"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; FeoA family protein;
FT                   KEGG: gsu:GSU1379 ferric uptake regulation protein Fur"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66152"
FT                   /db_xref="GOA:A8ZSY8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY8"
FT                   /protein_id="ABW66152.1"
FT                   /translation="MFPLKKSAMTKLHDREKSQFKKLFRNEGVDRFEEMMTVLEVFLET
FT                   EGHITANELIDRLTEHGFDFDPSFVRDSLRLLTQFGFAKKLRFDDGKIRYEHCHLGDHH
FT                   DHMLCRKCGKIIEFVDDALETIQAEVAAAHGFHMLGHRMDIYGICADCLKNRIRVIPLS
FT                   RARQGEHLVIEEFTGGTNARMRLMSMGLKTGDPVEVITSDPRGQVVIASGNKRYAIGRG
FT                   LAGKVMARHTDDPAA"
FT   gene            393693..393929
FT                   /locus_tag="Dole_0343"
FT   CDS_pept        393693..393929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0343"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: efa:EF0475 ferrous
FT                   iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66153"
FT                   /db_xref="GOA:A8ZSY9"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY9"
FT                   /protein_id="ABW66153.1"
FT                   /translation="MLLSQLKEGESARVVRVGGQGPFRRRIMEMGIVQGTDLHVEKYAP
FT                   LKDPLEILVKGYHVSLRVEEAALITVEKIPDNG"
FT   gene            393936..396110
FT                   /locus_tag="Dole_0344"
FT   CDS_pept        393936..396110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0344"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: pgi:PG1294
FT                   ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66154"
FT                   /db_xref="GOA:A8ZSZ0"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ0"
FT                   /protein_id="ABW66154.1"
FT                   /translation="MEKKRFTIALAGNPNSGKTTIFNSLTGTRQKVGNWSGVTVEKKEG
FT                   LIYRRGYEIQLVDLPGTYSLTPFSIEEIVARDFIIDEAPDVVITIIDASNLERSLYLAT
FT                   QVRELDCKVLFALNMADLARAKGMTIDADTLSRLLDVTVAFTVGNKNDGVETLLDLAID
FT                   LAESGKITVPERRVKYNRDAEAAISRIREKIEQAGPPIYNSRWMAIKLLENDQIVRQRL
FT                   VNAYEERSRSILDTVDACRSHLTDIFDDDPEIVMTDERYGFIAGLIKEVVHVSPRARAD
FT                   ISRNIDLVLTNRYLGFPIFIFFIWLMFQATFSLGAYPMTWIESGFALLAAGVDGLLADG
FT                   LVKDLIIDGALAGVGSVAVFLPNILILFFCIALFEDTGYMARAAFLMDRIMHLIGLHGK
FT                   SFIPMLMGFGCSVPAIMATRTLDNRKDRILTILITPFMSCSARLPVYIVLAGTFFPKNA
FT                   GTVIFMIYLLGIVVAMLTGRLFRSTLLKGADAPFVMELPPYRMPMAKSLVIHMWDRARM
FT                   FIRKMGTYIFVGAIVVWALSAFPRNVAYSVDYESQLQKVEAAYTQRIAATENAQALTAI
FT                   GAEKENAITAIRNARSRERSEQVYMGRIGRFVAPVFEPIGIDWRGSVALLTGFVAKEIV
FT                   VSTMGVLYAVADQDGRALGKALRASGMTPLSALSLMVFVLLYIPCIATVTSISREASWR
FT                   WSMFTVAYTTLVAWCASFVVFNAGKIIGIG"
FT   gene            396241..396867
FT                   /locus_tag="Dole_0345"
FT   CDS_pept        396241..396867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0345"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sat:SYN_00526
FT                   calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66155"
FT                   /db_xref="GOA:A8ZSZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ1"
FT                   /protein_id="ABW66155.1"
FT                   /translation="MGKIFAVGDIHGCYKKLRVLMDRIPINYKEDTLVFLGDYIDRGDE
FT                   SFEVVAYLAELRKKHPGIVFLKGNHEELFFNYLSGEDEVSFLFNGGEQTLKGYMSPDGD
FT                   ISVPKEHLNFFNALQLYYETDDYIFVHAGLKDGVPLEQQKPEDLLWIRKPFIESSYDFG
FT                   KIVIFGHTPYPEVVVKDNKIGVDTGAVYGYKLTCIELPARKFYEA"
FT   gene            396889..397338
FT                   /locus_tag="Dole_0346"
FT   CDS_pept        396889..397338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0346"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; SH3 type
FT                   3 domain protein; SMART: SH3 domain protein; KEGG:
FT                   dps:DP2276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66156"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ2"
FT                   /protein_id="ABW66156.1"
FT                   /translation="MTNLRLFQSFCMVFICALLVAAPAFSQERLSVTATTANIRTGPGT
FT                   SYDKAWQAEKNYPVVVVEKKDGWVKFKDYEGDEGWIYGALVSATSTVIVKKTRVNVRSG
FT                   PGTNHPVVFEAEKGVPFEVIKNDGDWLQIKHADGDTGWIYRPLVW"
FT   gene            complement(397460..398983)
FT                   /locus_tag="Dole_0347"
FT   CDS_pept        complement(397460..398983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0347"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: gsu:GSU2681 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66157"
FT                   /db_xref="GOA:A8ZSZ3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ3"
FT                   /protein_id="ABW66157.1"
FT                   /translation="MNQNRLFKRLRQACQLLFLALFLALFRLTDYSGADTIPYAVNIFF
FT                   RWDPLVAASVMLAGRAFIFLLLPSLAVIGLTLVFGRVFCGWICPLGTLIDAGGKVIQPV
FT                   RRTPLRWRAAKYMVLTAVLVSAAFGVQWVGFVDPFALLVRGLTIAVDPMLNAMVAAGFD
FT                   AVYFHGPSWAVPSSEAVYDVFRDFILPYKQSRFLLPFFTFFMLAAIFAMELLGRRFWCR
FT                   TLCPLGAMLALVSRFSFFRRIPLSSCKGCDACRQQCRMDAFTENREMMAEECSLCMDCL
FT                   DFCPRTITTFRFSRPVNKTGPDLGRRHLLAAGLAGLALPFLSRIDAAASAPLQRVIRPP
FT                   GALVEEDFLKTCVRCGECMKVCIQNALQPVFLEQGVEAMFTPKLLPRLGYCEFNCTLCG
FT                   QVCPTGAISRLTLDEKHAFVMGRAVIDKNRCLPFARSVPCIVCEEHCPTHDKAIRFETV
FT                   QAVDTGGNTVTLKRPYVVEALCVGCGICETVCPVAGRAAIYVVAEKRGW"
FT   gene            complement(399063..399977)
FT                   /locus_tag="Dole_0348"
FT   CDS_pept        complement(399063..399977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0348"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   gsu:GSU2682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66158"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ4"
FT                   /protein_id="ABW66158.1"
FT                   /translation="MDRRQFLKHLALWYAGMVATAPVFRLPAEALALPSEKPEIVVGRG
FT                   QDYPALVKAVIRQAGGMERFVKKGHRVVIKPNIGWDRTPEQGANTHPLVVRTLVELALG
FT                   AGAASVSVFDRTCNEERRCYQNSGIKPVLDAMGDRRVRCEFIDDRRFVPVTIARGKALT
FT                   EWPFYKEALAADCYINVPVAKHHGLTGVTLGLKNIMGIIGGSRGQIHHRIDQNLADLNS
FT                   VLRPDLTVVDATRILTKNGPQGGSLEDVSIRHTVFVSTDPVAADAYGTTLFDLAPDAVA
FT                   PTVAAYKMGLGEMDMDKCRIIEV"
FT   gene            complement(400007..401977)
FT                   /locus_tag="Dole_0349"
FT   CDS_pept        complement(400007..401977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0349"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   protein of unknown function DUF1365; Methyltransferase type
FT                   11; Methyltransferase type 12; KEGG: mmw:Mmwyl1_4070
FT                   cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66159"
FT                   /db_xref="GOA:A8ZSZ5"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ5"
FT                   /protein_id="ABW66159.1"
FT                   /translation="MNSKIFCVDLYHRRYEPVAHEFHYPLYIYVIDLEELAALDREVPL
FT                   FGYNRKALVSIHDRDYLSDAAGTIKDKLFRLLEQEGLRETVHTVYLVTAARYAGYVFNP
FT                   VSFYYCLGADDAVACIVAEVNNTFGERHIYVLKDHLPAPEGWAASFRTTKRFHVSPFFP
FT                   RQGEYEFFFSPIGETMDIRINYYREGRPQLKTRLKGHCLPLTRRTLAMTVVRRPIQAVM
FT                   SIPRIFYQAIILHYKKGLPINSKPAPMDPRTMEKAPSPVLQRIYRSAVGGVLSTLRQGS
FT                   LTLVLPDGRRQVHGRLGKQQEGVIEVHHHAFFKKLFFSADIGLGEAYMAGDWSSPDLAG
FT                   AIKVLACNIEALDQRTSVLPAFTRIIDFARHRRRANTVPGARQNIGAHYDTSNAFFSLV
FT                   LDPTMTYSCGLFERPTDDLHQSQLNKIARICEKAGIQATDHVLEIGTGWGGFAVEAVRQ
FT                   TGCALTTTTISQEQHDYVTRMVSRLEMEDRIEVLQQDYRHLRGRFDKIVSIEMLEAVGH
FT                   EYYRDYFSICASLLKPGGRMVVQVITIPHKRYHAYRRRADWIQKYIFPGGMLPSREILE
FT                   ETINRWTSLQVAEVTALGSHYVPTLAAWRNNLLARRAQIEKLGFDDRAFRMWEYYFASC
FT                   EAGFSAGIIDNIHMVLEKPAP"
FT   gene            complement(401974..403245)
FT                   /locus_tag="Dole_0350"
FT   CDS_pept        complement(401974..403245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0350"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: ppd:Ppro_0129
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66160"
FT                   /db_xref="GOA:A8ZSZ6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ6"
FT                   /protein_id="ABW66160.1"
FT                   /translation="MQTEKDIKTVAVIGGGVTGIVAAYLMDRKYKVTLFEKNDYLGGHT
FT                   NTQLVADGSGSQVPVDTGFIVFNDRTYPHFTTFLKQLKVAAADAPMSFGYYNRAKDVQF
FT                   CSRVPGGLFADRKNLFRPWYWRMVGEILRFNRQARRDLYGGRLGDMTLGDYLSVNRYSP
FT                   AFQDYYLLPMAGAIWSSPAGHINRFPCESFFRFYDNHGLLSATDHPQWKTICNGSVQYV
FT                   RAFEKVFTGQVRLNASVLNVARTAEGVMVTTTDGPPAVFDAAIIASHADQALAMLEDPD
FT                   ETEKTVLGAWTYSRNTTVLHGDRSLMPPSVRAWAAWNYMDDGTPASRVALTYYMNMLQG
FT                   LPGGRDFFVTLNAPWPIKPEAITYQVLYEHPIYDTAALVSQKHLPLIRPERNTYFCGSY
FT                   CGYGFHEDGTRAAVTVARHLGVEL"
FT   gene            complement(403266..403676)
FT                   /locus_tag="Dole_0351"
FT   CDS_pept        complement(403266..403676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hne:HNE_0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66161"
FT                   /db_xref="GOA:A8ZSZ7"
FT                   /db_xref="InterPro:IPR018687"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ7"
FT                   /protein_id="ABW66161.1"
FT                   /translation="MSVIKLSMVYVGMLAGFLVIDLVWLGVVARSMYRKHLGYLMAPQV
FT                   NWGAAIVFYLVFVFGLFFFAVLPGIETKALAKTLVSGCLFGVLCYATYDLTNLATIKQW
FT                   PLAITLIDMVWGAVLSTCVTAIGFALAKWLSP"
FT   gene            complement(403690..404475)
FT                   /locus_tag="Dole_0352"
FT   CDS_pept        complement(403690..404475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0352"
FT                   /product="protein of unknown function DUF1295"
FT                   /note="PFAM: 3-oxo-5-alpha-steroid 4-dehydrogenase domain
FT                   protein; protein of unknown function DUF1295; KEGG:
FT                   pla:Plav_2902 protein of unknown function DUF1295"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66162"
FT                   /db_xref="GOA:A8ZSZ8"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ8"
FT                   /protein_id="ABW66162.1"
FT                   /translation="MDVFVDIFLVNLAAATGLMGAGWVFSLAKKNVTIADSLWGLGFVL
FT                   IAWLTFFRADGVLFRKAMIVAMVTIWGLRLFIHLSVRNRGKGEDPRYAAWRAQHGNSFW
FT                   WVSLYKVFLVQALFQWTIALGVQYGQVAATPAALTWTDCLGVAIWTAGILIESAADWQL
FT                   ARFLADPANRGKIMNRYLWKYSRHPNYFGESLIWWGLFVVVLSVPWGAWTIISPALITF
FT                   TLLRLTGVTLMEQTIFKDNPDYQEYVRKTSSFILWFPKK"
FT   gene            complement(404494..405888)
FT                   /locus_tag="Dole_0353"
FT   CDS_pept        complement(404494..405888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0353"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: rru:Rru_A0726 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66163"
FT                   /db_xref="GOA:A8ZSZ9"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ9"
FT                   /protein_id="ABW66163.1"
FT                   /translation="MRHLTVTRKLAYSGPAFSLAVVGIPVYVYIPKFYTDVIGVPIGAL
FT                   GLILLLVRLFDAVTDPAMGYISDRLKTPFGRRRPLIAAGAVLTVAAMALLFNPPAGLGT
FT                   AAATAWFAVMVAALFLFWTVIIVPYESLGPELTYDYNERTALFGMRDGALIAGTLVAAA
FT                   SPAIVKALWHIGETAEDFREVFHVLSLLYGPLILASAAWCVLSFRERTTVRPETAAPFF
FT                   SGMASSLQNRPFRILLISYTISAIGSNLPATLILYYVEYVLHSPRADLFLLIYFVTGIL
FT                   LLPLWVAGAKRFEKKNMWLAAMAVNTGAFFGVFFLGPGDEWAYGVLVAISGMGFGASLA
FT                   IPSAMQADVIDYDQLQTGLRREGVYIGFWSVAKKLAAAVGVGAGLALLGVSGYDPTINQ
FT                   SPAVVTTLRVLYTLVPCLCNLVAMAVAWRYPLTREVHQQIHRQIQRRLAGEPFVDPLAS
FT                   AGKASA"
FT   gene            complement(405885..406475)
FT                   /locus_tag="Dole_0354"
FT   CDS_pept        complement(405885..406475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66164"
FT                   /db_xref="GOA:A8ZT00"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT00"
FT                   /protein_id="ABW66164.1"
FT                   /translation="MRIMPKQRFINRLVTTWVLIFCFTTGLYGAQVNGADFEKAVYVSE
FT                   KRLTLRGAGLLRYLVVIKAYAGAFYLEAGLPPDRALENVTRQLVLHYFHAIPAEDFATA
FT                   TTTMIEKNVTPDQFARLAPLVDRMNALYRDVAPGDRYTATYIPESGTELALNGQALGTV
FT                   PGAAFSRAFFSIWIGENPIDKGFRNDLLKGLAP"
FT   gene            406920..407231
FT                   /locus_tag="Dole_0355"
FT   CDS_pept        406920..407231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dde:Dde_0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66165"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT01"
FT                   /protein_id="ABW66165.1"
FT                   /translation="MDVKDFCSGLEQELVAWKAKLFDVVAKADRLGSAERERVLANFND
FT                   MKIIVQDLEEKINQLKTECPSDWSPQKKAIEKGHVDMRSKYEEAMEFIGKAAPVSIPG"
FT   gene            407493..408407
FT                   /locus_tag="Dole_0356"
FT   CDS_pept        407493..408407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0356"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: dde:Dde_3135 regulatory
FT                   protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66166"
FT                   /db_xref="GOA:A8ZT02"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT02"
FT                   /protein_id="ABW66166.1"
FT                   /translation="MHIIKYLKAISDETRLRLLFLLLHYELNVNEVVAVVEMIQSRVSR
FT                   HLKILTESGLLQFRRDGGFVYYSALTDEANGPVVRLVADALADDPVCEADLGRAEALIR
FT                   ERKSRTKRFFESVADTWEVRKHDVLGDLDLNRILADRVGNCPVAADLGCGTGALLAALN
FT                   GQVPTVIGVDSSPGMLEQARLKTAAMAGVNLRLGELEYLPMRDREAHCAVMNMVLHHIS
FT                   EPVKVLAEAYRILHPGGTFFIADFDKHNKVAVREKIGGSWFGFSQNEMDAWLAGAGFVP
FT                   AGLERFAVNYGLTVNLFVSKKQQ"
FT   gene            408827..410095
FT                   /locus_tag="Dole_0357"
FT   CDS_pept        408827..410095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0357"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: mja:MJ1388 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; Acetohydroxy acid
FT                   isomeroreductase catalytic domain protein;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66167"
FT                   /db_xref="GOA:A8ZT03"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT03"
FT                   /protein_id="ABW66167.1"
FT                   /translation="MNMAKGDHYEVKDMSLAAQGKNNLELAELNMGALMEVKKRFKKEK
FT                   PLKGVRIGMALHVTKETGILVRTLLAGGADVYITGCNPLSTQDDVAAALAKEGVKVWGY
FT                   KGENNEDYYRYIKYVIEAKPHITIDDGCDLVSEIHKNHPQLIKNIICGCEETTTGIIRL
FT                   QAMAKAKALKYPMIAVNDNKTKHLVDNFYGTGQSSIDGILRATNLLYAGKTFVVCGYGS
FT                   CGKGLADRARGLGANVVVTEVDNFCALQAHYDGFRVMKLADAVKIGDIFCTVTGNKHVI
FT                   RVEHMKKMKNGAILSNSGHFDIELELSRLNKVADSKRRVRPFMDEYVLAGKKIFVLGEG
FT                   RLVNLSAAEGHPSEVMSTSFCGQALACEYGVKNKGKMPVGVVQLPGEIDDTIAGLQLTA
FT                   MGIKIDEMTAEQKRYMDTWEEGT"
FT   gene            410474..411991
FT                   /locus_tag="Dole_0358"
FT   CDS_pept        410474..411991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0358"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: plu:plu1308 apolipoprotein
FT                   N-acyltransferase (ALP N-acyltransferase) (copper
FT                   homeostasis protein CutE)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66168"
FT                   /db_xref="GOA:A8ZT04"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT04"
FT                   /protein_id="ABW66168.1"
FT                   /translation="MVLASLSGILFTVAFSVKPLWWVSFAALFPLLLSLDRARTWRAAA
FT                   VRMSLFSIVFSFGMGYWVFHALVGHYQLPAGTAVSFFILALVLPVWLMHLTIALFYRFL
FT                   NNRTPVFYALVVPCLWVLGDYVKGMIPLLVPWGDIGYALVDWGAYFQMADLGGVYLVSF
FT                   LVVMFNSLLVCLMECRPQTNDLFRRRPMKGRAGTAVLILLVLILLVPLCYGSVRRYRMP
FT                   VLSLAGEKTPAVIAQGNFSHKDRWGGLGFYQRLKTYIELSGDPSDMGKAGVIVWPETVL
FT                   NHPEALTGPFFADLARILGKENLLIAGGLKRDSQSQGVYNSVYVIEDGQLKRYDKHILL
FT                   PYSERGPAVGPLFRFYNAPDRFIPGTTPACLSTSHGRVGLSVCFEILYPGYVRLSVKQG
FT                   AEFLVNVSNDAWFGDSAMPRAHLRAARARAVETGRWLLRASNSGISAVIAPNGSLTAGS
FT                   DLFRTQRISGSFTRLTTTTVYTRWGEWLFFFCLAVPAISLLRAGVRR"
FT   gene            complement(411968..413062)
FT                   /locus_tag="Dole_0359"
FT   CDS_pept        complement(411968..413062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pae:PA2863 lipase modulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66169"
FT                   /db_xref="GOA:A8ZT05"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT05"
FT                   /protein_id="ABW66169.1"
FT                   /translation="MGVKGRMIFTIAGLLLLGLLVALYTRQPAPEEAAYIFDRDTGPAI
FT                   EQVAQSKEQMATIRAHQKPVQDDETGPAESDALIKDLFSQIIIGSGTTLHYFTWLGHEF
FT                   RRATSREDHLAQVKDRIFSQFPAEEAGRLYATYQRYLDCEMAVADLAARFGPITTTESG
FT                   LELLREVQEFRRDFLGTELADRLFGEQVKEKEYSLRRAAIVSDPDLYAEEKQAAMDRLT
FT                   QEMWGEAAGTEISLQPPTAYARYQDALAIYQKDLDEIAEEDDRRAAIEDIRNRYLPPDA
FT                   VERINAMEQQQAEEQQAEEAYFAAEKGIAEDTTLSEDQKAEQIESLRQEMLGDQAGAMK
FT                   RRQAIENAREAMLNQIGSTPDTRP"
FT   gene            complement(413137..414036)
FT                   /locus_tag="Dole_0360"
FT   CDS_pept        complement(413137..414036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0360"
FT                   /product="hydrolase of alpha/beta superfamily"
FT                   /note="KEGG: cac:CAC1028 hydrolase of alpha/beta
FT                   superfamily, possible membrane associated lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66170"
FT                   /db_xref="GOA:A8ZT06"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT06"
FT                   /protein_id="ABW66170.1"
FT                   /translation="MKKLVALLIVGLFVSISLTGLGLAGGTAPYKCDTRYPVVLAHGMG
FT                   ASTKILGIVDYWYGIEDALKAEGASVYFTSVNAMGSTVDKAADFKQQFMEILAVTGAPK
FT                   ANIIGHSHGTLYTRYAISNLGLAPYVASYTSLAGPHRGSAVASLIMYDLPDWLLAAGGD
FT                   VLNFVYTFIFGDTNPDSLQNALDLCPDYMVNTFNPNTPNIPGIYYQSWAAKAKTSCPSV
FT                   ILEPTWLIMLIEEGANDGLVSVESAKWGNFRGVEDAAWYSAGCDHLNIVGQLFGVTPGF
FT                   DAPQFFVDIVEDLKGRGY"
FT   gene            414248..416293
FT                   /locus_tag="Dole_0361"
FT   CDS_pept        414248..416293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0361"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: gur:Gura_1282 putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66171"
FT                   /db_xref="GOA:A8ZT07"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT07"
FT                   /protein_id="ABW66171.1"
FT                   /translation="MTFEQDALARRNHQQVLEKTPYVALEDIYQRLRHAFPIDRIYVVQ
FT                   LDPDRRLMRVLAEASETGAEKTNFLFDAIPDLILDPFEKGYVPETYIINEPATDVIGSY
FT                   IYKRGKAANWSSVNLNFSDASVGYGTVFFTVAGTNRINETYAGQVADVRGPLHLIFENI
FT                   VKDHQQTDTLPSLKEPMENTDEIFRQVTRRLCGNLDLQTGVSHCLQYLSRFMPGQTIIV
FT                   HHWEEGLRSFRVLAETYGFIAGKIEPVIPWGQEKLLAEDILRLGTTRLINQPGRDSTME
FT                   NYVNHFGTDWSVLVMLLIDKDMPIGVASLGSEGNSMLTEDHLRLFSQLHDPFFIAFSNH
FT                   MKHREIIRLNKLLEEEKKFLQKELHHPVTGSIVGGNFGLKGVMEMSRLVAGQDSPVLLL
FT                   GETGVGKELVANFIHQHSARKDGPFIRVNSGAIPETLIDSELFGHEKGAFTGAVGRKTG
FT                   RFERAHGGTIFLDEIAELPLRDQVRLLRVLQHKIIERVGGTESIPVDIRVIAATNRNLE
FT                   EMVAEGRFREDLWFRLNVFPIKIPPLRARRSDIPALVDHFIEKKSRELKYRKPPTLAPD
FT                   AIVRLKNYSWPGNVRELENVVERELILGTGGLLLFQNITQQPAEDSLPDIHPDDQEALA
FT                   IDDAMRRHIQHVLNLTKGRIHGPKGAAALLKINPSTLRNRMKKLGI"
FT   gene            416327..417550
FT                   /locus_tag="Dole_0362"
FT   CDS_pept        416327..417550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0362"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll2640 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66172"
FT                   /db_xref="GOA:A8ZT08"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT08"
FT                   /protein_id="ABW66172.1"
FT                   /translation="MNSPLPDNPPSPPARMRFLGVLPTGIWVLGLGSMFMDISSEMIHS
FT                   LLPVFMVSVLGASMVTVGVIEGIAEATAAITKVFSGVLSDYLGRRKRLLVAGYALAALT
FT                   KPVFPLANAIGWVLAGRFVDRIGKGIRGAPRDAMVADITPPQLRGAAYGLRQALDSLGA
FT                   FLGPLLAVVLMLWLAGNIRAVMWVAVVPAFITVGLLVFYLREPERASIASPVSPLAGAQ
FT                   RLPGRFWMVVLLGGVFTLARFSEAFLVLRAQDVGLALAYVPVVMMIMNVFYAGFAYPLG
FT                   AAADRVNRRTLLLAGLGLLIGADLVLAVAASPLTVFIGAGLWGLHMACTQGLLSKLVAD
FT                   TVPADLRGTAFGIFNLISGGALLLASIIAGALWSAFGPGATFTAGAAFALLAACGLIAY
FT                   GVKPQAAK"
FT   gene            complement(417621..420425)
FT                   /locus_tag="Dole_0363"
FT   CDS_pept        complement(417621..420425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0363"
FT                   /product="Parallel beta-helix repeat"
FT                   /note="SMART: Parallel beta-helix repeat; KEGG: rba:RB4375
FT                   probable extracellular nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66173"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT09"
FT                   /protein_id="ABW66173.1"
FT                   /translation="MKRFLNSSLILLMFVFVLGAPAAVCADTTVGGAITSNTTWTAANS
FT                   PYLVTETIYVYSSARLTIEPGVTVRFDSGTALWIAHYNNDGSNTYRGSLTAEGTSESKI
FT                   IFTSSSGSASGWQGIIFGPRSDDYVSSNMQYCVIENAGETNELGAQANVHLSYTGSGGA
FT                   VAFDHVEIKNSGGSGLFSSYSTLNLLNCTLSGNTGHGLYAEYSVIDATDTDAVENGETG
FT                   YCISVSTGDIDGGNASDNDGHGIMAENGTVATFSNMTMADNAGYGIYTDDFESYLTICH
FT                   NTFDNNTDYPARISAQSAIYENTFSNSQKTGIEQIGGTVTTRHIRWYLPGSGDAQPYIH
FT                   SGITAVRSSRYLMIDPGVTVRFKSGAGLEIAHYNSDGSNNYRGGLMVNGSTEQPVMFTA
FT                   YSGEAGGWRGVILGPRSDDLMTSTVSGLTIEKAGESNSNGVSANLMLYYAGGNNTSFTD
FT                   CCFNGGTGHGVACDYSSFSWAGGGASDNGENGLFIDSTSFSGSDLTVSGNQAEGVHCQS
FT                   SSGGITDSTIADNTGYGIFLNASSLTVTGNTISGNGSYAIYYDIAASNPVIQDNTLSNN
FT                   IDPGIQISGGEMMGNHTLYEQAGEAFYTVNDAHLSVRNARQLTVEPGVTLKFASGLGLW
FT                   IAHPSNDGSNTYRGSLIAAGTPEARIVFTSATGDEDGWQGIVFGPRSDDVSVSTMQYCV
FT                   VENAGQTNILGKAANLHLSYTGNGFTFDHIDISGGGTGLYSYFSSIDGDYWYIFNNSDN
FT                   GSVYESSSGTLTNSIVMNHPDAGVYISNTPLSVENCYIADNGSGLNVVGPSLPTVTGNV
FT                   ISGNSGSGMTAASVAAAVNASGNYWGDATGPYDPSDDSASGGWYNPDGNGDRVSDLVEY
FT                   FPWTESIADSDGDGIPDFVEAILGTDTADTDNDDSAETSLIPQGGGSGGCFIDTVLPLC
FT                   LNRG"
FT   gene            complement(420485..421813)
FT                   /locus_tag="Dole_0364"
FT   CDS_pept        complement(420485..421813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0364"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   chy:CHY_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66174"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT10"
FT                   /protein_id="ABW66174.1"
FT                   /translation="MKKHTVSVVKYEKPLESVRKAVDLAGGLDHLPPKAKVFLKPNIVF
FT                   WSKAVAFPKWGVITTSRVIEDMVVLLKERGIDDITIGEGIVCDPKDKETPVHAFKTLGY
FT                   ETLAKKYGIRHINVFDHDFEPVDLGDGVEFSFNTDMLHSDFVVDLPVMKTHNQTVVSLG
FT                   IKNLKGVMDIPSRKKAHSPDAVKDLYFSIARLPDKLPPMLTLIDGIYTLERGPGFDGKP
FT                   RPSNILVASTDVLSADMVGAKILGHDPAAIAYMVHAAANHNRPTDLSDVEVAGEPIDSV
FT                   AAFHEYDFAYHEDADRCIPAPLVKDGIKGLYYRKFDSTMCTYCAAMNGIILSAIRYAWK
FT                   GEPWDNIEVLTGKKMAPTPGMNKTILVGKCMYQEHKDNPVIQEMIPIKGCPPEPKTILK
FT                   ALLQAGIDANPALFEQIDQLPAFFMQKYAGNPEFDEAFFQVAP"
FT   gene            422177..423046
FT                   /locus_tag="Dole_0365"
FT   CDS_pept        422177..423046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_0717 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66175"
FT                   /db_xref="GOA:A8ZT11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT11"
FT                   /protein_id="ABW66175.1"
FT                   /translation="MHYEGNMIRPPSEAYSILLQATVGCSHNKCTFCAAYKGERFKIKS
FT                   DDIIMSDIEFAARHCRNQDRLFICDGDALIIPQKRLLAILKEIEQKLPWVNRVGVYANT
FT                   KGIAMKTSEELAELRAHGLKIAYMGLESGDDETLKAVNKGADSQKMIDMGKKIRAAGVA
FT                   LSITVLLGLAGRERSEIHAQKTGEVLSAIDPEYVGALSLMLIPGTPLYDEYAAGRFPIL
FT                   TPEETLVELRTMITHTNLSNGLFHANHASNYLPIRAKLPEDKASTLRLINQALAGKIRL
FT                   KPEHMRGL"
FT   gene            423151..423582
FT                   /locus_tag="Dole_0366"
FT   CDS_pept        423151..423582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0366"
FT                   /product="S23 ribosomal protein"
FT                   /note="PFAM: S23 ribosomal protein; KEGG: rba:RB10686
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66176"
FT                   /db_xref="GOA:A8ZT12"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT12"
FT                   /protein_id="ABW66176.1"
FT                   /translation="MALGHEKLDVYRLAIRYVAWVYENAGHLNGVHRSAREQWLRASQS
FT                   IPLNIAEGNGKTAGADRRRYFEIARGSALECAAIQDVLVVGRGLQEEESRERKLELDRI
FT                   VAMLSRLGGRGYCVGEEAEPYGHDENDPDPDSDPDGNRP"
FT   gene            423656..425671
FT                   /locus_tag="Dole_0367"
FT   CDS_pept        423656..425671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0367"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: gvi:glr2297
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66177"
FT                   /db_xref="GOA:A8ZT13"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT13"
FT                   /protein_id="ABW66177.1"
FT                   /translation="MATRKTAGNKPIDERCINTIRCLAMDAIQQANSGHPGAPMGLAPA
FT                   GYVLWTKVMKHNPKNPQWFNRDRFVLSGGHASMLLYSLLHLTGYELSLKDIQQFRQLGS
FT                   KTPGHPEYGHTPGVETTTGPLGQGFANAVGMAMAERHMAARFNRKGATIVDHFTYVMCG
FT                   DGDLMEGLSYESASLAGHLGLGKLICLYDDNDISIEGHTDITFTENVAARFKACNWHVV
FT                   PVKDGSSVDQILDALKAAQAETEKPSLIILKTHIAHGSPNKQDSADAHGAPLGKEEIVL
FT                   TKRNLGFPEDVVCHITEDALKVFRKCMEKGEKAQGKWRAIVDRYAEKFPDLAAQWTAAI
FT                   THRLPKGWDKNLSGFLPSDKPMATRSASGKVLNKLAEAIPAIIGGSADLAPSNNTFLAC
FT                   SGEFQKGTYDQRNIRFGVREHAMASIMAGMYLHGGLRPYGGTFLIFSDYMRPAIRVASL
FT                   MKLPLIYVFTHDSVAVGEDGPTHQPVEQLASLRAMPGLTVIRPADATETVDAWKVAVTN
FT                   TAGPVALALSRQNLPVLDAAITAGKLAKGAYVLEECSGRPDIILISTGAEVHVTLEAAK
FT                   LLAQKNIAARVVSMPSWELFEKTDATYRESVLIPGVPCFAVEAGSPMGWERYTKDSHAI
FT                   LGIDRFGTSAPGGTVLKEYGFTPENIVKKVTAVLGK"
FT   gene            425698..426462
FT                   /locus_tag="Dole_0368"
FT   CDS_pept        425698..426462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0368"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: noc:Noc_0154
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66178"
FT                   /db_xref="GOA:A8ZT14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT14"
FT                   /protein_id="ABW66178.1"
FT                   /translation="MTSTPYQITFPKGPPADAGQGDQCFCVTTPDGNRQTIRCHDYGLI
FT                   YSLPGLYEQVFCDRLACVSPQKVADVLEKVVGLCDVRVADLRVLDLGAGNGLVGEALSA
FT                   KGVGRLVGADIIPEARMATERDRPGIYDAYYVTDFCRLSQEETAAFQSWSFNCLITVGA
FT                   LGFDDIPPRAFVAAYNMVETGGWVAFNIREDFLDKTDTSGFAGLVREMLFSRHMTVHHL
FT                   ERYRHRLSTDGRPLFYLAVAGRKRAHLPETAL"
FT   gene            complement(426552..427478)
FT                   /locus_tag="Dole_0369"
FT   CDS_pept        complement(426552..427478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0369"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: Prophage CP4-57 regulatory; KEGG: pca:Pcar_0674
FT                   periplasmic molybdate-binding protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66179"
FT                   /db_xref="GOA:A8ZT15"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT15"
FT                   /protein_id="ABW66179.1"
FT                   /translation="MAQLLSTKELAQLLGIHEKKVYKLITEQRMPATKVTGKWLFPKHL
FT                   VEQWIAANTINHPGEASCLIDTPSLLVVAGSNDILLDRAMALFMKHHPEITVVFGNLGS
FT                   MGGLRALGRGVCHMASSHLVQEDEAEYNFSFAAKEMENMPAVVNFCFREQGLVLPKGNP
FT                   KTVAGMADLARKKLTIVNRAHGTGTRLWFDRKLKEAGVSPGTLKGYDHDVQRHLDVGLE
FT                   VLSGRADTGPAIRAVAQLLDLDFLPMHWERFDLLIPRSLFFDKKIQAFLSMLTDPAFTG
FT                   LAETLAGYDLSKSGKMVYPQDQKKESA"
FT   gene            427693..428667
FT                   /locus_tag="Dole_0370"
FT   CDS_pept        427693..428667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0370"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; KEGG:
FT                   sfu:Sfum_0851 phosphoesterase, RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66180"
FT                   /db_xref="GOA:A8ZT16"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT16"
FT                   /protein_id="ABW66180.1"
FT                   /translation="MSVSNTERVRLFYSRFSGTDHVLVVINADPDAIGSAMAVKRLLWK
FT                   KAASVTLSNINVIDRPDNLAMVRLLGVKLVHIDTIDVSRYTRVVMVDSQPDHNERLAGI
FT                   TADVIIDHHPVAVKSTASYADIRPDYGATSTMLIEYLKAARIKPSRKLATGLYLGIKTD
FT                   TSNFERHATPEDVRAFQYIFRYVNVHLARRIEQAEIKPEFLAYFSKALNRKVMRRKKAF
FT                   IHLGRVVNPDVCVLVADFFMRVSSVQWSIVSGVYDDRLIVILRNDGIRRDAGQAAKKAF
FT                   EQMGSAGGHRSMARAEIPIGAVYKEVKKKEEKEIARWVIRKLK"
FT   gene            complement(428881..429621)
FT                   /locus_tag="Dole_0371"
FT   CDS_pept        complement(428881..429621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0371"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   gme:Gmet_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66181"
FT                   /db_xref="GOA:A8ZT17"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZT17"
FT                   /protein_id="ABW66181.1"
FT                   /translation="MSGHNKWSSIKHKKGAADAKRGKVFTKLIKEITLAARTGGGDPDG
FT                   NPRLRTAIAAAKDENMPKDNIERAIKKGTGDLEGVNYEENTYEGYGPGGAAVLVESLTD
FT                   NKNRAVSEIRHIFSKHNGNMGENGCVAWMFDKKGYIEVEKSAAEEDHLMEVAIEAGAED
FT                   VRESDDTFEVITEVEDLETVRQALDGASIQYAFAEITMLPQTMVDLDDKTSEQMIRLLD
FT                   ALDDCEDVQKVYTNASLSDSVGEA"
FT   gene            complement(429608..430231)
FT                   /locus_tag="Dole_0372"
FT   CDS_pept        complement(429608..430231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0372"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: sfu:Sfum_0997 ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66182"
FT                   /db_xref="GOA:A8ZT18"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZT18"
FT                   /protein_id="ABW66182.1"
FT                   /translation="MKRDPTKGRKTPDHYARKAKTEHYPARSVYKLQEIQKKHNVLKPG
FT                   NAVLDLGCFPGSWMMFAAETVGRGGKVTGIDLKKVATHMPAQATSLQEDIYEIDREALA
FT                   GTLGPLDVVLSDMAPDTMGNKFTDAARSFHLAAAALDLALFLLKPGGHFVCKVFQGEDF
FT                   QNFVNMVKAEFERHKVFKPETCRKDSKETYVIGFSKKESTHVGS"
FT   gene            complement(430413..431771)
FT                   /locus_tag="Dole_0373"
FT   CDS_pept        complement(430413..431771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0373"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66183"
FT                   /db_xref="GOA:A8ZT19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT19"
FT                   /protein_id="ABW66183.1"
FT                   /translation="MKTVFCCQSCGYQAPKWMGRCPECEGWGTFVEEPADGSASAAKSG
FT                   RGVKPAEAVALDAIELADERRIHTAIGEFDRVLGGGIVAGSLVLVGGDPGIGKSTLMLQ
FT                   AAQKLSENGCTVLYVSGEESLRQIKMRSRRLCPSLSSSLLAAAETDIERVTALARSAKP
FT                   DVMVIDSIQTMSSGDFSSAPGSVGQVREATMRLMALAKKTGICVFLIGHVTKDGSIAGP
FT                   RIMEHMVDTVLYFEGDKNQVFRILRAVKNRFGSTNEIGVFEMRTEGLGEVANPSAVFLS
FT                   EMPEKTPGSVVTASMEGTRPILVELQALASRTSLGMARRTILGLDANRVALLVAVMEKK
FT                   LGMELTGYDVFMNVAGGVRVSEPAVDLAVIAAVASSFLDRPIPTGTVVLGEVGLTGEVR
FT                   AINHIDTRVGEIKKMGFTACLLPQGNLKRMSRDKEIKVTGVGTVAEAMEVLFQ"
FT   gene            432109..432783
FT                   /locus_tag="Dole_0374"
FT   CDS_pept        432109..432783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0374"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   sfu:Sfum_0691 non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66184"
FT                   /db_xref="GOA:A8ZT20"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT20"
FT                   /protein_id="ABW66184.1"
FT                   /translation="MNPQRTLVIATRNKGKTKEIRDLLAGRNVEIKNLDDFGPIPEIEE
FT                   DGATFDDNAYKKASFAARILGFTALADDSGLVVEALDGAPGVHSARYAGPDATDADRCE
FT                   KLLSEMAGQTNRKAAFECVISIAVPMGAALTYEGRCQGEITEKPMGDNGFGYDPVFYYP
FT                   PLKKTFAQLTTEEKNRVSHRGKALQEVAAEFDKILIWIDQNMPIFEKTACLSHDDDTAN
FT                   ND"
FT   gene            432755..433345
FT                   /locus_tag="Dole_0375"
FT   CDS_pept        432755..433345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0375"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: sat:SYN_01293
FT                   oxygen-insensitive NAD(P)H nitroreductase /
FT                   dihydropteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66185"
FT                   /db_xref="GOA:A8ZT21"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT21"
FT                   /protein_id="ABW66185.1"
FT                   /translation="MTTTQPTTIEDLVRKNRTCRRFYENQPVDRDTLCQLINLARLSAS
FT                   AANRQPLKYILSWEKKKNQVIFPCLAWAGYLTEWKGPRAGERPAAYIIITGDTTITDNF
FT                   WCDHGIAAQSILLGAREMGLAGCMIGAFNEKKLRTGLAIPDHLALLLVIALGKPKEQVV
FT                   IEEVGPDNDIRYWRDRSGIHHVPKRKLEDIILP"
FT   gene            433422..435371
FT                   /locus_tag="Dole_0376"
FT   CDS_pept        433422..435371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0376"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   dps:DP1093 probable phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66186"
FT                   /db_xref="GOA:A8ZT22"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT22"
FT                   /protein_id="ABW66186.1"
FT                   /translation="MAEIDIAQKIGGIDSVDAARKVFEKKMDKESLAKIDKIKTEKALI
FT                   KIANAIVMGDPDAVFVNTGSAEDKQWIRDHALEKGEEKKLPMDGHTIHYDLKEEQGRIV
FT                   DRTYYIADPEEDISSLAQKMLRNDAVGVVKTHMTGIMRGKTLIVGFYSRGPVGAPASNP
FT                   AIEASTSAYVLHSAEILYRNFFADFDREVAAGGHFFTNIHSEGKNRPEDLPNARVLMDR
FT                   KDRTTYSFNCTYAGNTLLLKKGNHRFAVDKAVYEHRGEQLAEHMFITGMQGPGNRQTWC
FT                   VGAAPSGCGKTTTAMAGNFFVGDDLAQMWIAEDGSIRSINPECGIFGIVEDVNMEGDPL
FT                   LMTNLRNPGAEVIWTNVLIDDNGVPHWTGHGEPMPDHGMNFQGKWEKGMTDEKGKPIPP
FT                   SHPNARCTISSTALANYSNRAEDPAGVETRVVTYSGRDSDTMPPVWVARNSDNGVVIGA
FT                   CIVSAATATEVGASGVKRAPWANAPFIPGALGDYMAAQFEFFASPKIAADKRPVMAGLN
FT                   YFLTDEARGGTTKKLLGEKKDVKVWLSWLERMAHNDVSFIETPIGNLPKYEDLRQLFSD
FT                   LIDKPYPYELYEKQFSLYIDNIIARIDLQTAAYKKDERIPEKLFTILAEQKKGLEALKA
FT                   KFGPIVTPKQLEEK"
FT   gene            435563..437083
FT                   /locus_tag="Dole_0377"
FT   CDS_pept        435563..437083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0377"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mpt:Mpe_A0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66187"
FT                   /db_xref="GOA:A8ZT23"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT23"
FT                   /protein_id="ABW66187.1"
FT                   /translation="MNKNRRNSVLSSPYVWTFTTYFAEGFPYTVIRTLSSLFLRDMNVR
FT                   LESIGLTSLFGLPWILKFLWGPQVDRFSTKRTWMLTCQFLLVGMMLLTAAFAPFSWGVS
FT                   AIVLLFFAGSFIAATHDTAIDGFYMEALDSEGQAKFVGYRVMAYRIAMMTGTGVVATIG
FT                   TTLGWPLAFACAALMMGLVFVYHFFFLIRVEQQGRPANELVKSALRLKNLALVTGAALL
FT                   VLGLRAFLASRPYALIREQYPVLQKISFPHWVGLFLLLSLISLLVLRKRIWARIAGKPD
FT                   TFYARAFITFTDREKIGTIFAVIILMRTGEFLLTAMVSPFFVDVGIKVHYGWLSSVVGL
FT                   PLSIAGALVGGFCISTFSLKKVIWPFLLLQNLTNLVYMVLALHLAPFVAINTGAAVAQP
FT                   VGALNLFWVAVVHGFDQFSGGLGTAVLMTFLMRICAKEFKAAHYAIGTGLMNVSGLFAG
FT                   ILSGFLAGWLGYGYFFGISFLLSVPGMIAVLFLPADIYVEPSKPAPKN"
FT   gene            437232..438944
FT                   /locus_tag="Dole_0378"
FT   CDS_pept        437232..438944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0378"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01910 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT24"
FT                   /protein_id="ABW66188.1"
FT                   /translation="MTRQPAIIKEKLAAVAAQRQKALSLPAKEAMDLILGSPDAPAIVH
FT                   SMADQDFYFLVNDIGPEDALELLALGSGSQWEHITDIECWHKDRISGPEMLRWFDLLMR
FT                   ADKNRFVQWMAADKHELLELLLYYTTQASAREHDQEPSEFDESFFTFDDVFYVRFTKRW
FT                   PQDPDLPETLEADHEKMLYAFLKHLAEIDFIAYRDLLFYTANVLPTEAEEEVFRQRSIR
FT                   LAEKGLLPFDEAVGIYQPLPQGRKPVKKPARRPAKRSRLPVPVVHHRLLKKTTLFAQAL
FT                   ERVDSPAALEELSTEFAALCNSIVVADGARLSAKKELAHVVNKACGYIAIGLFRLAESK
FT                   ETLNPSKAAALMTTHALGDIFRSGYGAAMEIKRTADRWHSTSWCSAKQLPVSFWGEERA
FT                   GILAGLLIKRPLFFDAQTGLPREFESMEDIDRTRAVLDEIMTIDGLLKKADVDPAPVSG
FT                   TVLTATNLVLTLWARSVLDLPETVEFIPVNQFGPFLSGLFKKAEGKEDGRIQDDKKESF
FT                   LQWLSGRTGVEPHDISAQAGHVLERMFAEAEAELGAVAPKDLDPKFVQVFLVS"
FT   gene            complement(439399..440295)
FT                   /locus_tag="Dole_0379"
FT   CDS_pept        complement(439399..440295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0379"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: sfu:Sfum_1600 quinolinate synthetase complex,
FT                   A subunit; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66189"
FT                   /db_xref="GOA:A8ZT25"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT25"
FT                   /protein_id="ABW66189.1"
FT                   /translation="MIQQRISDLKARRNAIILVHNYQPPEIQDIADFCGDSLELSIRAA
FT                   ETDADVIVFCGVHFMAETASIVCPDKTVLLPDFNAGCPMADMITPQALAAKLKELGDMP
FT                   VVTYVNSPAAVKAMSTVCCTSANVVKVVNSLEEKEILMTPDRNLATYAQGYTDKTLHLW
FT                   PGWCPVHDALRPEDIETARRDHPGALVMAHPECRPEVTALADAVLSTSGMLRHAAESDR
FT                   TEFIVATENGILYPLQKACPDKRFYWASESMVCPDMKKIGLADVAACLETLAPEVKVPR
FT                   EIQQKALAAVQRMLEIV"
FT   gene            complement(440292..440981)
FT                   /locus_tag="Dole_0380"
FT   CDS_pept        complement(440292..440981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0380"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: sfu:Sfum_1599 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66190"
FT                   /db_xref="GOA:A8ZT26"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT26"
FT                   /protein_id="ABW66190.1"
FT                   /translation="MRSSHIKVITLACLLCVTLWIGLAGAQASDMQLPVEEILSRVEAR
FT                   YDCDTFAADFFQTSTLKAMDITDTAEGSVLFKRPNRFRWSYEKPEKQYIISDGDRLWIF
FT                   KPDENQVTVGSAPALFGDGRGASFFTDIKRLRTDYEIGLSPDTDGETYMLKLAPKKKTM
FT                   DVAAIYLVVNADTFEVTAVETVNAYDDATRIEFTNRRFDLPAADTLFVFDIPVNADVIQ
FT                   LNSENDG"
FT   gene            441315..441731
FT                   /locus_tag="Dole_0381"
FT   CDS_pept        441315..441731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66191"
FT                   /db_xref="InterPro:IPR024208"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT27"
FT                   /protein_id="ABW66191.1"
FT                   /translation="MLRICVIDGQGGGIGAAAIKKIQEAFGETVEIIALGTNAIATAQM
FT                   LKAKANRGASGENAIVRTVAEADVIVGPIGIVMAHALMGEVTPAMAEAVSGCRAAKVLI
FT                   PLSQERVEIVGVAQEPLPHLLENLIEHHLKPKKR"
FT   gene            441735..441929
FT                   /locus_tag="Dole_0382"
FT   CDS_pept        441735..441929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66192"
FT                   /db_xref="InterPro:IPR019300"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT28"
FT                   /protein_id="ABW66192.1"
FT                   /translation="MCEANAYIVDEKGDNTLVMEAVDLVEPEEDGVKLISIFGEQKFLK
FT                   AKIHSLSLVDHKIFLKSDG"
FT   gene            442006..443739
FT                   /locus_tag="Dole_0383"
FT   CDS_pept        442006..443739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0383"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: sat:SYN_02454 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: UbiA prenyltransferase; LytB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66193"
FT                   /db_xref="GOA:A8ZT29"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT29"
FT                   /protein_id="ABW66193.1"
FT                   /translation="MKVSIAKTSGFCMGVRRAVDMVLDASNRYTEPIYTFGPLIHNPQV
FT                   LRLLAEKKISVMETIPEQGNGIVLIRAHGVPPRTREKLEAAGFTVIDATCPRVVKVQTI
FT                   ISRNAAEGCAVIIIGDKDHPEVVGLLGYAGDRGVVADSLEALKALPAFEKAIIVAQTTQ
FT                   STRLFDEVGAWAAAHHPHYQVFNTICPSTKNRQAETEALARQTDAMVVVGGYNSGNTQR
FT                   LAQVSKKSGHPVFHVETSEELDTNALAKSDHIGITAGASTPNWIIKKIYRELEAARFRS
FT                   KGPLARTLFSAQRLLLLTNIYLAIGAGLLCYSASLLRQGEHFAPHILIAMLYIFSMHTL
FT                   NRLTGIAEDHYNDPYRAAFYDKNMTVLALLAVGAGGLGLAVAFSLGVFPFLMLLVMSGL
FT                   GLSYNLYLVPKGVTAIPFRRIKDIPGSKTLLISAAWGVAVCAFPAAATDSLNFSSMFTA
FT                   LWLAGIVFVRSAFFDLIDMQGDRIAGKETLPVLMGADRALRFLKQMLAGLFLFLLAATL
FT                   LGVVSSLGYLLLVLPVTGYMLLALYQRDTLQSGLVLEFLVESQFVLAGLLALTWTMMTA
FT                   L"
FT   gene            complement(444062..444691)
FT                   /locus_tag="Dole_0384"
FT   CDS_pept        complement(444062..444691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0384"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   gme:Gmet_3020 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66194"
FT                   /db_xref="GOA:A8ZT30"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT30"
FT                   /protein_id="ABW66194.1"
FT                   /translation="MDGQTILKIFLCTAGAFVLGSVPVGLVLTKLFSSKDIRTQGSGNI
FT                   GATNVARVAGARLGLITLALDLLKGALPVAAAGLMVPSTGEPAMALAGLAAVAGHCYPV
FT                   FSGFTGGGKGVATACGVFLVAAPWACLVALVVFLAAVAGFKRVSLGSILAALSLPAGTW
FT                   FFYGTGPVAAAAATVGLLVVARHRANISRLLAGTEPPFFKKPGQDR"
FT   gene            444930..445187
FT                   /locus_tag="Dole_0385"
FT   CDS_pept        444930..445187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0385"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: afw:Anae109_4369 Smr
FT                   protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66195"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT31"
FT                   /protein_id="ABW66195.1"
FT                   /translation="MDLHTFAPSEVGDLLKDYLAECQKAGIFSIRVVHGKGTGVLKKRV
FT                   WAALAKNALVDRFHEAPPEAGGWGATIVEIKKVSPDIRHT"
FT   gene            445209..445601
FT                   /locus_tag="Dole_0386"
FT   CDS_pept        445209..445601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0386"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rci:LRC474 putative phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66196"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT32"
FT                   /protein_id="ABW66196.1"
FT                   /translation="METPIISAVNKDRFVKEIGIELVTVSAGYAKTRMTVEPRHLNGLD
FT                   LGHGGAVFTLADYAFAAASNSHGVDAVAINITMSYFKAARAGDELTAEAKEIALSRKIG
FT                   TYAISVFNQNQDTVAFMQGTAFRKTP"
FT   gene            complement(445891..446073)
FT                   /locus_tag="Dole_0387"
FT   CDS_pept        complement(445891..446073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT33"
FT                   /protein_id="ABW66197.1"
FT                   /translation="MYRYEIINEEGRAEGIELLSLMYGALWESTLNRLSHDCDGWLLTL
FT                   FLEGRRYYIYRLLPS"
FT   gene            446410..447612
FT                   /locus_tag="Dole_0388"
FT   CDS_pept        446410..447612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0388"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="KEGG: rso:RSc1031 probable nicotinate
FT                   phosphoribosyltransferase (naprtase) protein; TIGRFAM:
FT                   nicotinate phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66198"
FT                   /db_xref="GOA:A8ZT34"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT34"
FT                   /protein_id="ABW66198.1"
FT                   /translation="MTIINSLLDTEFSKLTMAQIVLHMHPDVIVRYRFESKNKKKIGHI
FT                   QEINQEIDHLCTLRFKDDELDYLDSLNVFKKDFIEYLRLVQLNRKYITAEIDNNRRLQI
FT                   EIKGPWISTIFFSVPVLTIVSEIYSKYQSINEKGFHSVEDTLDTGEQRLAKKIEYLTTL
FT                   LKTGQLSGFKFADIGTCFRYSHYWQGVVIEKLKKQLRSYLFVGTSNPYFAMKHKLAPMG
FT                   TMNHEWLMAYQQLGTRLQLSQKTALRDWIAEYHGEPGICLSDVVGFNAFLRDFDLYLAK
FT                   LFDGCQHNSGDPTSWCVKLIEHYDKLGIDPKTKTAMFCDDMNFETAIEIHETLSEMIDI
FT                   TAGIGRDLMHDLGIPPLDISFNMVECNGGPVGSIGDDAGKTRCDDPRHLAALKDVFHID
FT                   T"
FT   gene            447704..448603
FT                   /locus_tag="Dole_0389"
FT   CDS_pept        447704..448603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0389"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: sfu:Sfum_3035 membrane-bound lytic murein
FT                   transglycosylase B-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66199"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT35"
FT                   /protein_id="ABW66199.1"
FT                   /translation="MRFFSFILQLLLPALLLGVAGCTAPPAPPVYVDFETAAPFDRLCA
FT                   KLEKDGFDGQVLRRYYTHPDVAFEQAGTALFFHHSESKLNYDQFLKTASLNRAREYLQA
FT                   QGRWLTAAQNTYTVDKEVITAILLVETRFGAYLGTRPAFNILSSMASLADPAMEAEFWQ
FT                   SIEKTTTFTPEAYNKRVRDKSKWAYNELKAFLAYVEKENIENPVSLKSSYAGAMGISQF
FT                   MPSNILKLGVDGDNDGRVDLFTHPDAIFSVASFLAHHGWKPGLDHQAAYKVLLNYNYSR
FT                   PYAETVLKIRERLKAGPS"
FT   gene            448625..448843
FT                   /locus_tag="Dole_0390"
FT   CDS_pept        448625..448843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66200"
FT                   /db_xref="GOA:A8ZT36"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT36"
FT                   /protein_id="ABW66200.1"
FT                   /translation="MSPITITIIAVGLLAWLLTCWALIDVAGRDFGGIEKKAAWGFVAF
FT                   IPFVGWLIYLVIGRPKSTPPKAGPDPS"
FT   gene            448840..449562
FT                   /locus_tag="Dole_0391"
FT   CDS_pept        448840..449562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0391"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: bce:BC1537 biotin operon repressor /
FT                   biotin--[acetyl-CoA-carboxylase] synthetase; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: biotin protein
FT                   ligase domain protein; biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66201"
FT                   /db_xref="GOA:A8ZT37"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT37"
FT                   /protein_id="ABW66201.1"
FT                   /translation="MKIQQATLHHLATTESTMDVARNLALQGCPHFTVVVADTQTGGRG
FT                   RMDRTWHSDPGGLYMTLVLKPDMPAADGLKLTFLASLTLAQTVRRCCDIDAGVKWPNDI
FT                   LVKEKKLAGLLSEMQATGSRIDFVNIGIGINVNNDPARFEPGATSIKAATGATFSREGL
FT                   LDEFLGALKTGLQNTSLPSVIQQWKTLAVSLGRPVTVVTPRETVTGIAEDVNESGALLV
FT                   RMSDGDLREICYGDCFHR"
FT   gene            450466..452979
FT                   /locus_tag="Dole_0392"
FT   CDS_pept        450466..452979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0392"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: mmr:Mmar10_0677 exporter of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66202"
FT                   /db_xref="GOA:A8ZT38"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT38"
FT                   /protein_id="ABW66202.1"
FT                   /translation="MHMKSAKAAIEAGFERWALALYRRPRVTLLVLAALTGFFLFQMPR
FT                   LDFDTSSESLLHADDPYRLAYDRFREDFGQDRNIILGITGPNIFSSEFLGRLQALHREI
FT                   EETVPHVKRVKSLVTARHVTGENDFLHVGELLESWPEEPMDMGQLRQQVMENPFYRNFL
FT                   ISEDGDLTAIVIETDAVIASAPASNDEVLAGFSDDAPAGKTGSGASDTEERFIGAPEIR
FT                   EIVDAVTRLIPRYQAPDFQIRFSGSPVVVDLFNRAVATDMTRCALYTLVVITLAMGLLF
FT                   RRVSGVCLPLIVVTASVISALGIMAMAGVKIKIMTAILPVFILCVGVADSVHVLTIFFR
FT                   EYRPGASRAEAVAHAMGHSGLPVLLTSLTTAAGLLSFSFAEISAIGEMGIFSAVGVFMA
FT                   LFYTICLLPPLLALLPLRPGRASAGHSRAMDRVLSGLARFATTHPKKIVAGGVFLMILS
FT                   LALLPRLRYVDHVLNYFSDRMQVKHDMVYIDRELRGIISFEVIVDTNRENGLHEPDQLR
FT                   RIDDAARQVKAESAAMGPEFAVAKIFSLTDVVKEINQALHNDDPAFYTIPEERRLVAQE
FT                   LLLFENSGSDELEPVVDTTFSKTRVSIKVPWLDSVGLYRLSEQIRRVFEITFAGHADTS
FT                   LTGMSLILARTLPATLSSMEQSYLLAAVVISVLMVLLAGDIRIGLLAMFPNLLPILAVM
FT                   GALAAANIHLDMTVLMIGSIAIGLVVDDTMHFIHHFRRHLDRVGDPAAAVRLTLLGAGR
FT                   ALLITTLVLAGGFLALTAATMPHMVRFGLLLTLVLVLALAADFILAPALMVLTAKKPPV
FT                   PHYEIITPVPVQKDEPPDRKTGTHD"
FT   gene            453039..453884
FT                   /locus_tag="Dole_0393"
FT   CDS_pept        453039..453884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_1771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66203"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT39"
FT                   /protein_id="ABW66203.1"
FT                   /translation="MLFKSKPIVSALVPVEKISEDLIREMHSLFIEYYENADYDTFKQD
FT                   LGAKTGSFLWRERKTGRLIAFANIRLMKLPYKKRHVHVFFCGDTVCHRDYWQRNASGNS
FT                   PMAATVYGFLLRFMMKHPFSTYWFMISMSFRTYLVIANNMVHHYPHYERTDAKVQKLKE
FT                   ICHLVAGHMYGDKFDPETGRVDFGRKDENQTIKSDVAPVTPEMLEKYPKIRFYESLNPD
FT                   NQKGVELACIGAIDIDSITAYCKKFLRRTWDGLTARGKVTTLPSTAALDRNQEKKKKAA
FT                   "
FT   gene            453936..455579
FT                   /locus_tag="Dole_0394"
FT   CDS_pept        453936..455579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0394"
FT                   /product="GH3 auxin-responsive promoter"
FT                   /note="PFAM: GH3 auxin-responsive promoter; KEGG:
FT                   aci:ACIAD3676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66204"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT40"
FT                   /protein_id="ABW66204.1"
FT                   /translation="MDMLTNIAHQAAMAVSQKGYRTYTSGLADIRPHQQRILASILRAV
FT                   RGSASGRYYGLTGEESIERFRAKVPLTEYAHWEKQIERQKKTGEPVLSTSPCERYQPTS
FT                   GSTSDIKWIPYTRQFLSQVDAFISPMIYRMYRQYPGIRKGVHYWSLSWIPTELRSHISP
FT                   NINDDLKLLPWWKRMFMSLTMAVPDSVAHAPTSEASMFATACYLCAAENLSLVSVWSPT
FT                   FLLSMLDLISDHRREMASVLASGAWGEARQSLAYLPCPRSRHGADILANREAELSPKTL
FT                   SRLWPGLRVISAWDTWTSTPWASKIKELFPFAVLEGKGLLATEGIVSMPFDGQYPLTYQ
FT                   CHFYEFVDWHSGDILNAWELKKGQVVQPVLTTGAGLLRYLLHDRLEVTGFLQSCPCFLF
FT                   LGRSDGVDLVGEKMSPEAAGRVLNRISDTYSSVRPVSLLAVPSSHSGATDGYVLLCEGD
FT                   ETAPAGDIAERAEKELRGIYHYNLARDLGQLAHLKCVVSPAATAIYQSRAAARGMVAGN
FT                   LKIEPVVLWNCALPGPLCNAFAGPVDARVN"
FT   gene            455692..457065
FT                   /locus_tag="Dole_0395"
FT   CDS_pept        455692..457065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_2820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66205"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT41"
FT                   /protein_id="ABW66205.1"
FT                   /translation="MNFNPDKTEYPSVAPQGDDGAVETEMPTMKISDFAAQFGCVPLTP
FT                   ADNPKIQAFYNSMAMTSEKFSVHTKKEPDYFRFLAYAADNHHVFGYPNAQGELEGMVSL
FT                   IVRPCYIGGRPDRVGHFLDLRFKRRKERTIKGDWKELGLGFTRSGSRVEETEGCRIYHG
FT                   SYITTNIYATASIGKDAHAKAGQKKAEKPAPAPERKAPPVPPEKTPAAPAPAPEAFRVS
FT                   NLAAYQAINIYARKPWKILSLGSFGKSREKLVVTQGTEKDLEPLKAFLDRQNQPKTFGY
FT                   IYAGPSGELERRLRRWDGLSMSSFFIARDLSGKILGAFGAFDPGRGRQLYIDALPPEKE
FT                   RLAKLGAMAGLKVPRPNENIDILYLTSLELDHDLAPDLRLSVFDRLLSALFRSGLPRRY
FT                   HIVSFCDYNKQSLLEVVSGGYMYDATPVLLYQLHSPDATEVYRESDMVLPPGHEMVLM"
FT   gene            457317..458156
FT                   /locus_tag="Dole_0396"
FT   CDS_pept        457317..458156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_1316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66206"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT42"
FT                   /protein_id="ABW66206.1"
FT                   /translation="MRYFCHFTACFSRSLVYAICLAALIGGLVSPALAADDPKARAIME
FT                   KVDARDDGDSMISDMKMILIDKNQQTRERTMRSFSQDRGEDTYQLIFFSGPPAVKDTGF
FT                   LTYDYDDPDKDDDQWLYLPALKKTKRIAAGDKTDSFMGSDFSYADMTKSELDNYNYKLL
FT                   KEDTVDGHKTWIIEAVPRTQKVIDTFGYTKSIVFVRQDNYVMVRAVSWVADSSNLKYLD
FT                   VKQLENIDGIWVAMETHMTTKRDKTTLHKTILLRENVKFNQPMDENLFTVRRLEKGL"
FT   gene            458313..458954
FT                   /locus_tag="Dole_0397"
FT   CDS_pept        458313..458954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afu:AF2236 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66207"
FT                   /db_xref="GOA:A8ZT43"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT43"
FT                   /protein_id="ABW66207.1"
FT                   /translation="MITDATRQALDGLRDLNMIKWYAIPLLAIVLYVYAREIKEARKNG
FT                   DWNAVFAGVTLFGADFLNETVNGWIMHLSGRSALWTTPGDTALRVMVGWNIEIIFMFLI
FT                   AGIIFYHSLSENRTRTEMWAWAVAFAAFCVFVECLLNMGGHLVWEYPFWERTFWGVWLI
FT                   FFFGYFAFFCWIILVITRKTTKAKLAIIGGLYAVPAIMNILALGLLGWRY"
FT   gene            complement(459063..459893)
FT                   /locus_tag="Dole_0398"
FT   CDS_pept        complement(459063..459893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0398"
FT                   /product="oxidoreductase of the aldo/keto reductase
FT                   family-like protein"
FT                   /note="KEGG: pai:PAE2929 aldo-keto reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66208"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT44"
FT                   /protein_id="ABW66208.1"
FT                   /translation="MEQTIQTAHGSFAKGVLGRTGLSVGRLGLAASYGAPPAAFEEAFE
FT                   RGCNYFYIGSGRRRANMKTAIRNICENGHREHLVVAVQTYARFGLLTETLFRRNLRSMG
FT                   LAHADILMLGWHNRRPAQRLMDMALRLKQNGLCRFIGMSGHSRGLFVQLTKEGVFDLFH
FT                   VRYNAAHRGAETETFPFLKGDSRPGVVSYTATRWGHLLKSEKMPEGEPPLRASDCYRFA
FT                   MSHPAVDVCLCGPSNMEQMREALTALDLGPLSEAEMERARRVGDHVHRHGGGFF"
FT   gene            460029..461102
FT                   /locus_tag="Dole_0399"
FT   CDS_pept        460029..461102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0399"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: mem:Memar_1711 geranylgeranyl
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT45"
FT                   /protein_id="ABW66209.1"
FT                   /translation="MKIIIVGGGPAGLITALCLARMHGAEICLHEKQGPPAYTSSLCAE
FT                   GISRDMLQRLERHTGFDSTPFISRAVCGIQVHFPGGKCGYLHQPGATLERTAWQQAMAE
FT                   FAGRRGVEVFWESRVSGIDELDADVVVGADGPASRIRTAIGGTVDMVPAVQYRMNLDRP
FT                   REFLEFFIDERFYHGKHNDGYAWIFPKKDSFNVGVKGSFEQLDLFLSAFDIRGEITHRG
FT                   GAPIAVHGTRFEGTLDRRKVFLIGDAAGLTNAATCGGLNPIIACADFLRQAVGWQEEGA
FT                   YTRLIKTHHYDPAYWKAVRHLFYPPDATLRALGEILNNGPVNPTPAMAARVTFHPGLWV
FT                   YCGRLLRHLKPLKQVAW"
FT   gene            461188..462096
FT                   /locus_tag="Dole_0400"
FT   CDS_pept        461188..462096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0400"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   sfu:Sfum_0024 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66210"
FT                   /db_xref="GOA:A8ZT46"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT46"
FT                   /protein_id="ABW66210.1"
FT                   /translation="MVQPEQAMTRGMKKILFALVFFCLPALPAGAAEKLPVFVSIAPQK
FT                   YFVERIGGDHVAVSVMVAPGASPATYEPRPGQMRALSAAVLYFAIGVPFEQVWLPRIAA
FT                   ANPAMKIVRTDRGIEKRAMTHHAHDDGHAEAAVSHGGADPHIWLSPSLVKLQAATIANA
FT                   LKEADPAHAADYQVHADAFFAELEALDKELRNLFADATGARFLVFHPSWGYFADAYGLV
FT                   QVPMEVEGKEPKPGQLRDLIEHARKNRISVILVAPQFSSRSAQVLAEEISGTVAVADPL
FT                   AENWPDNLRTVARTIRGAVNR"
FT   gene            462093..462866
FT                   /locus_tag="Dole_0401"
FT   CDS_pept        462093..462866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0401"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dps:DP3061 related to Mn/Zn ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66211"
FT                   /db_xref="GOA:A8ZT47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT47"
FT                   /protein_id="ABW66211.1"
FT                   /translation="MTAIVDMHNVSFTYGGPAVIENVTLSVSEGEFVALIGPNGGGKTT
FT                   LLKLMLGLVKPQKGTVRVLGRPPEKASHHIGYVPQDIHLNLAFPVTALDVVLMGKLAPG
FT                   KRWIGRPARHKTDALAALAQMGMEASAHTRIGELSGGQRQRVFIARALVTQPKLLLLDE
FT                   PTASIDTRGQADFLELLHDLNQQVTIVMVSHDLLAISHHVTSVACVNRGLHYHRRSELA
FT                   GSLINTSCPCTVESLCPVEMVARETPHLFIRNRKP"
FT   gene            462871..463692
FT                   /locus_tag="Dole_0402"
FT   CDS_pept        462871..463692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0402"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: dps:DP3062 probable Mn/Zn ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66212"
FT                   /db_xref="GOA:A8ZT48"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT48"
FT                   /protein_id="ABW66212.1"
FT                   /translation="MIEALHYDFMQNALAAGLLAAVICGIMGSLVVVNRIVFLSGGIAH
FT                   AAFGGIGMAFFFGWSFLAGTLGFALVAALIMAGITLRAKHRADTIIGVIWAVGMAIGVV
FT                   LLDLTPGYNVDLMSYLFGSILTVPEKDLWIMAGLGLGISVLVVFFYNDLLAISYDEEFA
FT                   RVRGVAVGPIYFMMIGMLAVSIVMVIQVVGLILVIALLTIPPFIMEKYARSLARMMIGS
FT                   SLLGILFTLAGLWLSYAFDLTSGAAIILVAGAAFFLFLLIEKVRLMARQRL"
FT   gene            complement(464078..464404)
FT                   /locus_tag="Dole_0403"
FT   CDS_pept        complement(464078..464404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66213"
FT                   /db_xref="GOA:A8ZT49"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT49"
FT                   /protein_id="ABW66213.1"
FT                   /translation="MKKCPFCAEAIADEAVKCKHCGEFLDAEARAFFEKKKQPWYFRTS
FT                   FITIAVLCVGPLALPLIWWRPETSRVYKISLTIIILVVSWLAFDITMKSLESLGEYYRL
FT                   LDTL"
FT   gene            complement(464425..465897)
FT                   /locus_tag="Dole_0404"
FT   CDS_pept        complement(464425..465897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0404"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); glucose inhibited division
FT                   protein; KEGG: sfu:Sfum_1152 methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66214"
FT                   /db_xref="GOA:A8ZT50"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT50"
FT                   /protein_id="ABW66214.1"
FT                   /translation="MAAVKKQRTSAGESRHTQREMARLLARSGIVLSDAGLKQLWSYHC
FT                   LLRKHNPELNLTRIHNFENMVLKLYVDSILPGTLVDLPSPLLDLGTGPGMPGIPLKIAF
FT                   PELTVLLAEGRGKRVAFLNTAVQELGLYGVSVIGRAIAPDFQEPVAGVITRAVEAMAAT
FT                   LERVDGCLSSGGKIFFMKGPSCDDEIADAQAKFGARFRLTDDIAYSIAHTPHRRRLVIF
FT                   ERLDASRRQQKAAAMNRHRVHVIESENNARFKELKKLLGGRGVKKQNLALVAGVKPVTE
FT                   ALAAFPDQCRAWITRQDQTPPPENAPSHLAWEQLAPALFEALDVFGTRAPLLLFEPSSM
FT                   GVWRPDEGFSPGCTLLLPFQDPENAGAAIRSAVAFGAAKIVLLSECAHPFHPKTIRASA
FT                   GAVLHAPLFEGPSLKDLPEDLPIVPLSMEGAPITGFSFPAAFGLLAGIEGPGLPDAWRS
FT                   RAVSIPVTGAVESLNAATAIAVALYAWSQAGK"
FT   gene            465921..466697
FT                   /locus_tag="Dole_0405"
FT   CDS_pept        465921..466697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0405"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: sfu:Sfum_1153
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66215"
FT                   /db_xref="GOA:A8ZT51"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT51"
FT                   /protein_id="ABW66215.1"
FT                   /translation="MTAPTPDFFIPQWPVLYEDNHLLALYKPAGLLVQGDSTGDPTLLE
FT                   LGRCWLKIRYNKPGKVFLGMVHRLDRPVAGVVLFCRTSKAAGRISAQFRDGVTAKQYVA
FT                   VVEGVIPENEGRLANHIFRRGPTSHIIDVPTPKSREARLAFHVIDRTDSRTLVKIDLET
FT                   GRHHQIRVQFAHLGFPVVGDLRYGAPAPLPGRQIALLARRLTVTHPTLGHALTFTSSFP
FT                   WGWPWPGDHANSDAPPWNWSEIQETVMPLLPPEAPC"
FT   gene            466691..467569
FT                   /locus_tag="Dole_0406"
FT   CDS_pept        466691..467569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0406"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_02451 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66216"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT52"
FT                   /protein_id="ABW66216.1"
FT                   /translation="MLNIAPAGAASDLDGKTPGGVYLCQVGPAISCGACCGLYNIQHLS
FT                   RENLTHLLKGRTQRFARVPRTIEAIDRFGEETLGAEGRHRPMKNFHHCPFLGLIGPQQT
FT                   TVGCLLHPRADGNKGIDWRGLSYYGAYACATYFCPTCRELAPRYKRMVRQAVDNWYDYG
FT                   LMITETGMLKTFFEQVEKRLERTVDATDLEGRPAAMAVVQRFLAIKHTWPFADPETFRP
FT                   ANFFFNQKEYAPPAIDFKAPGAETSRWAPVLTALWSNLADWQALCAAESFLDRMAGDLS
FT                   AALAAPPLPPR"
FT   gene            complement(467448..469235)
FT                   /locus_tag="Dole_0407"
FT   CDS_pept        complement(467448..469235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0407"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sun:SUN_1632 Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66217"
FT                   /db_xref="GOA:A8ZT53"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT53"
FT                   /protein_id="ABW66217.1"
FT                   /translation="MFLPATPEEVHALGWEAVDVILVTGDAYIDAPSVGVAVIGRVLSD
FT                   AGYRVGVIAQPDLSGDDIARLGEPALFWGVTGGCVDSMVSNYTATGKKRKSDDLTPGGV
FT                   NNRRPDRAVIAYANLIRRHFKQTRPIVLGGIEASLRRISHYDCWSDSVRRSVLCDAKAD
FT                   FLVFGMGERTVVKLAHALKNNLPTADIRGLCYMSREKPDTCVELPAHEAVAQDKELFAT
FT                   MYAEFYKQSRTPRGKRLCQLQDTRYLVINPPPQPLSTEELDHVYGLAYQRSVHPTDKAA
FT                   GEVRAIETTQFSIVTHRGCFGECSFCAITVHEGPIIMSRSEASILREARQMRDHPDFKG
FT                   TIYNVGGATANMYGAGCGRKKTGGVCAGRQCLWPEICDNLVVDHHRQRRLLEKIGKLAG
FT                   VRHVFVQSGIRHDLVLHDAGGGQRYLEALLTRHISGQMKIAPEHSEPHVLRLMGKPGAD
FT                   VWTRFVREFNTTKKRLSKRVFFTCYFIAAFPGCTLADMRRLGAIVKKTLAFTPEQVQIF
FT                   TPAPSTPATAMYHTEKDQNGNPVFVEKDPAKKEAQKRVLTEAAKEVPPVRPTDRRPSGP
FT                   KKTRPRKGPANRPGSTRGR"
FT   gene            469645..470103
FT                   /locus_tag="Dole_0408"
FT   CDS_pept        469645..470103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66218"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF4"
FT                   /protein_id="ABW66218.1"
FT                   /translation="MPEDKKKEKVLHARISQDLEEQIRKEAGSLGVSVSNLVRNILSNT
FT                   FDLVENIVTDSADISRSARRRSASPVDGTRPSGPVAPDPVSESGRVVAWQEAIMNLNAV
FT                   CSQCNTILEKGSRAAIAVVEGTGPRPALCLTCLKEITHEDQNRSDNNE"
FT   gene            470225..471601
FT                   /locus_tag="Dole_0409"
FT   CDS_pept        470225..471601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0409"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: gvi:gll4412
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66219"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF5"
FT                   /protein_id="ABW66219.1"
FT                   /translation="MGDILRDSFAVAGEAEAVYARAWDRAASVNAAIRSAPRFTRLFSD
FT                   LVRIVASYRIHSVKSRFLSDAEAAQALEALHQKNARRIYDLCVEMRGGLIKIGQFASTY
FT                   TNALPPAYIEYLGRLQDRVPPVPYKAIARRIESEFGRPAEQVFARVDPEPIAAASLAQV
FT                   HPAELHDGTRVVIKVQMPDIENTAEIDLTAFTIAADLTNDLFPALGLSEISRALADSVK
FT                   KELDYRQELANILRFNRQTVDDPRVVAPKVYPGLSTQRILTMEKLEGEHLIPFLEAAAP
FT                   DRRNRLLALIAESFCSQIVTHGFFHADPHPGNMFVLPGDRLGLIDFGCVEHFSAGTYAL
FT                   YMEMISAILSRDAESMARLFESMGFSAGAGAGAPLREMATDFIELLMLDPDQSLADVDT
FT                   TQKLTRGLELIKKYPGIRVPRHFVLLGRVLLTLGGIMMRYNPDINVFMLMVDQMGKNKL
FT                   "
FT   gene            471818..472009
FT                   /locus_tag="Dole_0410"
FT   CDS_pept        471818..472009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66220"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF6"
FT                   /protein_id="ABW66220.1"
FT                   /translation="MRTTLNIEDGLIDKASKMTGIKEKTALVKLGLEALIARESGKRLA
FT                   RLGGTQKQLEAVPRRKGA"
FT   gene            472016..472393
FT                   /locus_tag="Dole_0411"
FT   CDS_pept        472016..472393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0411"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gur:Gura_3863 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66221"
FT                   /db_xref="GOA:A8ZTF7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF7"
FT                   /protein_id="ABW66221.1"
FT                   /translation="MVLVDTSVWVAHFRDGSPGLAALLNDGRVMCHPLIVGELACGNLK
FT                   DRAVILTHLQLLPMSTEAEHHEVLAFIENHHLMGKGLGYVDMHLLASAALTGVPLWTFD
FT                   KKLAQASDILGIKFTSPKNPS"
FT   gene            472786..474171
FT                   /locus_tag="Dole_0412"
FT   CDS_pept        472786..474171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0412"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: aci:ACIAD2835 putative Mg
FT                   transporter (MgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66222"
FT                   /db_xref="GOA:A8ZTF8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF8"
FT                   /protein_id="ABW66222.1"
FT                   /translation="MTVKNPLVVPELRELIAAGDAQALQAFCKTGHPAVVAEMISALPG
FT                   TEAWEVLRHADFPLRSDIFSHMDEDLQIEIIGSLRRMEVARLLADMPPDDRADLFKELP
FT                   DEMQESVLPALAQAEREDIRRLTAYEEGTAGAVMTSDYVTLPPHLTASQAIDHLRKVAP
FT                   DKETIYYGYVVDEKRKLQGFVSLKDLIVARRESKVGDIMHPEVIFARVEEDQEDAARKI
FT                   QKYDLLALPVINGGDTLVGIITHDDALDIITQEQTEDMEKLMAIAGSHEAGVYMKTSAW
FT                   AHLKNRSPWIVMLACLSMVSGFIVQSHEGMLLQFAILASFMPMLADTGGNTGSQAAALI
FT                   IRALALKEISTRDILRVLAKEFQVGLGLSLMLALVAFGRVMFFGEASTMPESYSLVSIA
FT                   VAISAALGLQVVSATLIGVFLPMFAALLKKDPAVVASPALTTMVDITGLLIYFTTIKLM
FT                   LGI"
FT   gene            474524..475873
FT                   /locus_tag="Dole_0413"
FT   CDS_pept        474524..475873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0413"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dde:Dde_2418
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66223"
FT                   /db_xref="GOA:A8ZTF9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF9"
FT                   /protein_id="ABW66223.1"
FT                   /translation="MFNHVPRLLRLAFPLILSSSAVMTMQIIDTIVLSWHSAEAVAAMG
FT                   PSSLAVILFQGFLYGIAAYAGTFVAHSHGRGDSMGVKKSTWMGIHAALFSGLAALIAAW
FT                   PLARLFLLMGHDPLVARYEMTYFWICMAGSFFPVAGGALAGWLSGIGRTLAITWVMLFA
FT                   FTINAVLTWALVLGRCGLPQMGIAGAAIGTVTAEMISASLFTILFARAGGFGEAAARRF
FT                   EWPAFRHFLLLAVPVGLRISGELVAWTLFLVIIGRLGVAELAASSIAFRINGLAFFPAI
FT                   GLAQAAGILVGQARGAGKDHDVPAIAWQSLAVGEAWMLAMALLFALAPAPLMSVFAGFG
FT                   PESAQIVAAGILILKFVALYCILDAANIIIGWVLAAAGDTRWLAWAYCASSGVFLALLW
FT                   LVDRTMPGLVTEWTLATIFIGTTAVIWMVRFQSGAWQKARVLRETVVPTV"
FT   gene            476184..477779
FT                   /locus_tag="Dole_0414"
FT   CDS_pept        476184..477779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0414"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   pca:Pcar_0583 probable peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66224"
FT                   /db_xref="GOA:A8ZTG0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG0"
FT                   /protein_id="ABW66224.1"
FT                   /translation="MKTENKISQRQINRRRTFGIISHPDAGKTTLTEKLLLFGGAIQMA
FT                   GAVKARKAGRHATSDWMAIEQERGISVTSSVMKFDYRDYEINLLDTPGHQDFSEDTYRV
FT                   LTAVDSAVMVIDSVKGVETQTRKLMEVCRMRNTPILTFVNKLDREGLSPIDILGDIEDK
FT                   LQIECAPLSWPIGMGKRFKGTYNLHRGELVLFTPGQERLTGDTVTIQNLDDPLLDQVLG
FT                   SQADQLREDVALLEGAATPFDLDYFLKGGQTPVFFGSAINNFGVRELLDTFVEIAPGPQ
FT                   PRAAVTRTVTPDEPAFSGFVFKIQANMDPAHRDRIAFLRVCSGRFVRGMRVRHHRIGKE
FT                   IQIANPIIFMAQDRAFVEEAWPGDIIGIHNHGTIRIGDTFSEKEPLAFTGVPNFAPELF
FT                   RRVILRSPLKAKQLQKGIDQLVEEGAIQVFRPLANNAIILGAVGVLQFEVTMARLKAEY
FT                   GVDAVYEPVDYSVARWVHCDDRKLLSLFEKDRQANLARDAEGNLTYLAQNEWQFNYMAE
FT                   KWPDIGFSKTRECQ"
FT   gene            complement(477923..479095)
FT                   /locus_tag="Dole_0415"
FT   CDS_pept        complement(477923..479095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0415"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dde:Dde_0970 fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66225"
FT                   /db_xref="GOA:A8ZTG1"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG1"
FT                   /protein_id="ABW66225.1"
FT                   /translation="MKRELQGRYVTISTVGETAKAFVPSPLPPRPPINWTLELRSKFDK
FT                   ALLALGRLDSVSTLLPDTSLFLYMYVRKEAVLSSMIEGTQSSLSDLLLFELDQAPGVPL
FT                   DDVREVSNYVAALEHGLRLLEEGLPLSLRLLREIHGVLLTKGRGSMQAPGEFRRSQNWI
FT                   GGTRPGNAAFVPPPAEEVLECMSKLELFLHDQPEPTPVLLKAALAHVQFETIHPFLDGN
FT                   GRLGRLLITLLLCEQKVLREPMLYLSLYFKTHRQYYYELLNNVRLTGDWEAWLDFFAEA
FT                   VVVTATQAVETAQQLLDLSRQDRGKIRDLGRAAASTLQVHRGLMEHPIATSGSLVEKTG
FT                   LTPATVNKALGHLEKLGIVKELTAQKRNRLFSYAGYIEIMSRGTELPGTN"
FT   gene            complement(479304..480314)
FT                   /locus_tag="Dole_0416"
FT   CDS_pept        complement(479304..480314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0416"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: sfu:Sfum_3863 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66226"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG2"
FT                   /protein_id="ABW66226.1"
FT                   /translation="MKTNYQPPCTITPEIVNRVAEISEAIGRLSVITDQAKALRLRRVN
FT                   RIRTIRGSLAIEGNTLSEAQITAILEGKRVIAPPREVREVKNALAAYDRFDTWKPEAEK
FT                   DLLEAHRILMSGLIDEAGLYRHGGVGVMEGQQVIHMAPAAKRVPRLMGDLFSWLAVTDT
FT                   HPLIASSIFHYEFEFIHPFADGNGRVGRLWQSLILSRWNPLFAHIPVESMVFEHQVEYY
FT                   EALQESTRKADSSPFISFMLRMILDTVTTSTPEVTPEATPEVRLLSVLAGEMTRQQLKE
FT                   SLGLKDDEHFRKAYLLPALESGLIEMTIPDKPRSSKQKYRLTDKGRKRMTQHGKG"
FT   gene            480667..482046
FT                   /locus_tag="Dole_0417"
FT   CDS_pept        480667..482046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0417"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: rba:RB9119 magnesium
FT                   transporter Ykok"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66227"
FT                   /db_xref="GOA:A8ZTG3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG3"
FT                   /protein_id="ABW66227.1"
FT                   /translation="MNAIVTDKTDKPWEKLHELITGAGTEEILAFFDFLGAAETARTIS
FT                   RIHPEDQVRLFSILTPADAADIIEEISDTQAADLIEDLPPEMAAAILEELDSDHVVDVL
FT                   GEISDHRAEAILDEMDIEGAREARQFLEYPPDSAGGLMVSEFLAYPEGLRVSDILKDLQ
FT                   KNRETYTGYNVQYLYVTEKDNRLAGVLRMHDLLFPSKDAYLRDLMIKNPLKVSVDTPLE
FT                   KLRHFFEEHRLFGVPVVDGDGRMQGVVLPEAVEEASRKRSVRQFLGFSGIVGGEEFRSM
FT                   PLLVRSGRRLSWLSLNIVLNVIAASVIAMYQDTLSAAIALAVFLPMVSDMSGCSGNQAV
FT                   AVSMRELSLGLIRPNELIRVLLKEAGLGLINGAALGLLLGILAFMWKGNFYLGLVVGSA
FT                   LAANTVVAVMLGGILPLLLKRMKMDPALVSSPLLTTVTDMCGFFFVLSFATAVMAKLSG
FT                   V"
FT   gene            482231..482539
FT                   /locus_tag="Dole_0418"
FT   CDS_pept        482231..482539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66228"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG4"
FT                   /protein_id="ABW66228.1"
FT                   /translation="MRGCKTRFDQSGHQTPHSGLSWSTRQKKKQGIVDDVQFGRKYLNV
FT                   WWDRACKNLGVEDVNLYGGTGQTTNKVFDRYFQPQKQEHVKVVTAIQKLKEDARSRS"
FT   gene            482627..483076
FT                   /locus_tag="Dole_0419"
FT   CDS_pept        482627..483076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66229"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG5"
FT                   /protein_id="ABW66229.1"
FT                   /translation="MKKVLIAFIICIAATAFALEDTPSNRQKEAARYLKTTPPADMMKD
FT                   MAQKVSMNLPPENREEFKALLTKHLDLEAFTKIMKDSMEKHFTADELKALADFYGSPVG
FT                   KSAMNKFGDYMGDIMPAIQAELLKAHAEAIKENAEANRQKQNAEE"
FT   gene            483154..483702
FT                   /locus_tag="Dole_0420"
FT   CDS_pept        483154..483702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_3039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66230"
FT                   /db_xref="GOA:A8ZTG6"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG6"
FT                   /protein_id="ABW66230.1"
FT                   /translation="MKKMRNILSNALILVAFALLVAGLILSFLGKSTNLATYGAAFLCF
FT                   IFSQLHRFESFEGLGLKAKVRDIEETVDTLISSSASDTEEKIDTPVSIEDLTKELNLSH
FT                   SSEAALDTILRRLQDSKFSFRSISGLAKDTRMTRHTVESVLARLYDLGYLHKAHSKSKG
FT                   LLWSLSEKGKAVRLLKYEE"
FT   gene            complement(484267..486432)
FT                   /locus_tag="Dole_0421"
FT   CDS_pept        complement(484267..486432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0421"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: mta:Moth_2203 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66231"
FT                   /db_xref="GOA:A8ZTG7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG7"
FT                   /protein_id="ABW66231.1"
FT                   /translation="METVQEKRFRVQNLDCAACAAKIERELQNTEGVEAAVVDFANLTL
FT                   HLRAADISKALAAVARIEPDVKIESTLQDSEGDAHESTEAGNFRKQVGIIVIAGIIFAI
FT                   HLFFEDQLHQRPWAWVEYPIVIAAYLLAGWSVLIGALRTLRRGQFFDENVLMVIATTGA
FT                   MAIHALSEAVGVMLFFKVGELLQDMAVSKSRRSVRGLLAARPNRALLKTEGGLKETSPE
FT                   KVKVGEIILVKPGEKVALDGTVIEGVSQVDTSPLTGEPVPVQTRPGDTVLAGSINTASA
FT                   LTVRVTKPFEASSIARVLELVESAAARKAATEKFITTFARYYTPVVVAIAAAIALVPPL
FT                   LINDAQFSTWIYRALVLLVISCPCALVVSIPLGYFGGIGRASRSGILIKGSMFIDALSK
FT                   VKTVVFDKTGTLTRGVFTVDRVVTDNGFSSDQVLQMAAAVELHSDHPIGKSIVEAMTSK
FT                   GLAIDESLVSNHVAISGKGVKAVFDGKSIAVGNDALLHERQIDHGKCDFDSTVAHVVVD
FT                   NQYAGHILIGDQLKPDAKLAMERLRSDGVSKLVMLTGDNACAAASVAKALNLDQFHAEL
FT                   LPEDKVRIFEQILAETKEDGKVAFVGDGINDAPVLARADVGVAMGALGSDAAIETADVV
FT                   LMTDAPAKMADAVSIAKNTRKIVLQNIVLALTVKGIFILFGSFGLATMWEAVFADMGTA
FT                   LLALLNATRAFRGYPSLKEVHVKNASV"
FT   gene            complement(486450..487250)
FT                   /locus_tag="Dole_0422"
FT   CDS_pept        complement(486450..487250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0422"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sfu:Sfum_2718
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66232"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG8"
FT                   /protein_id="ABW66232.1"
FT                   /translation="MSEKARTMRIAVISDIHGNLEALVRCLDDIDRSGVDRIVNLGDAV
FT                   GYGPQPEEVLVLLEKMDIANLLGNHELAVIDKVHRSDFSPEAIISLEQTLKYLTSASLL
FT                   YIKNLPYYREMIGALMVHGCPPDSPTVYLNHMSLPEIKETFASNSFDIAFSGHTHRLML
FT                   IGYDGKDLQFDPLQQETIKLEPDYRYIVNVGAVGQPRDGDPRAKYAIWDSHRNALEIRR
FT                   VAYDISRTANLIIKRGFLRRDADRLFSGDCPKQYKLTRAAANDR"
FT   gene            complement(487247..489253)
FT                   /locus_tag="Dole_0423"
FT   CDS_pept        complement(487247..489253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0423"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rxy:Rxyl_2282 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66233"
FT                   /db_xref="GOA:A8ZTG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG9"
FT                   /protein_id="ABW66233.1"
FT                   /translation="MELKAHDMTTTCKTTLKVGDVLNNRWVILGFIDKGGMGEVYRAHQ
FT                   TNLNRDVAIKVVSREWLESIDEGDEEAETLVQRFRREVQAMAQIRHPNILQVFDHDAIT
FT                   VKKGDQDKSMEYIAMEYIPGGSLRDTMSDEGFYPEEDLIKTWVRRYFLPVLAGVMALHE
FT                   NGIVHRDLKPENIFMDQDTPKIADFGLARSSRLKPVTQSMDVKGSPHYMSPEHFFDFKR
FT                   ADQCADVYSLGKMLFEAVEGKITSVTTPFKRAKLAKAESPFFQELDRIIQMATAESRDE
FT                   RTESVRDLLGQLERVIHGLASQKPGAKFPWQQSASLFSKPRWVWTGIIVAVLSVISMAA
FT                   WHFMGEPGLGPPKGSLSTSPSQHQTQTVPGNETTARPADAEKDSFASEHLGKQHLIQGG
FT                   PFSIPAVLDGSSDQSIQVEPFYVDEFFVTNQQFVDFLNHNLSQISIESGVVKGSGANWF
FT                   LMGEVRAGYEPIVYRSNEFHVSDPAYASSPALRVTGYGASAFANYFGRRLPTEVEMLFA
FT                   MVKGEDGSKVNAEPSAEVNTQPMGGMMRMMGDWQGETENWSSVSPDPSPSAKDQAEPKR
FT                   SDFLLSAASFSPNLLGIKGLNHEIGEWVYTEGLVQPSANASTTNRYAVIGGVEGAPKDK
FT                   NSLPAVVVRFPWEGFEEIGFRTVKSAVVSNSAG"
FT   gene            complement(489253..489558)
FT                   /locus_tag="Dole_0424"
FT   CDS_pept        complement(489253..489558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66234"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH0"
FT                   /protein_id="ABW66234.1"
FT                   /translation="MELGEKRKDVEIKSERPDEKDPLTKYFDGMGTATARIIIKRHLDD
FT                   DQWEKYGLKDLKNTGRYYIARLVEKDGTVIDEVLIDKQSGTIQSLRGRIGAEGQLR"
FT   gene            complement(490042..490413)
FT                   /locus_tag="Dole_0425"
FT   CDS_pept        complement(490042..490413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0425"
FT                   /product="zinc-resistance associated protein"
FT                   /note="KEGG: stm:STM4172 zinc-resistance associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66235"
FT                   /db_xref="InterPro:IPR020365"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH1"
FT                   /protein_id="ABW66235.1"
FT                   /translation="MKKTILVIAATAFIALFSTQAFACYWDGYWGGPAGGPTDGFNGDQ
FT                   HQGFYDKTAQLRQDLAAKRGEYNALMAAPNPDSNRASELSREIAVLHDQLRVQARSYNL
FT                   PMSNNGYCGHGRMGRHGCW"
FT   gene            490723..492519
FT                   /locus_tag="Dole_0426"
FT   CDS_pept        490723..492519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0426"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: dde:Dde_0110 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66236"
FT                   /db_xref="GOA:A8ZTH2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH2"
FT                   /protein_id="ABW66236.1"
FT                   /translation="MIPNTRRRNRTNLHTSPWIIIGSVGILLIVVVVLAYQNYSREKKY
FT                   MSQILSEKGAAIIKAVEAGARTGMMGMMWGGQQVQSLIEETAQLSDVFYITVVNRKGLV
FT                   LASSNRGLIGTQMNSGFPEKGLDQPEEINWRYKRIDDQRNTFEVYRLFMPITDQERQMG
FT                   DRMCQMKQGRKMMMRSDNDWCFPTSSGDSDQIILVGLNPQPFEEGRKEDIRNTAIISGI
FT                   LILLGLAGFISMFWMQGYRSAKKSLQDTSAIKDQVVTSLPVGLIATDKHGKIAFYNSAA
FT                   ERITGLDLAQARGKEPDTVLPRHLCGLKESLDLGESIFEKEMECEFTENKIVPVSISAS
FT                   KIINEEGQFVGQVLIIRDLGEVRRLQDEIRRKEKLAAIGELAAGVAHEIRNPLSSIKGI
FT                   ASYYKSKFEDGSEDKEMAGVMIEEVDRLSRVISELLEFARPTKLNRKLSDMNELLKHST
FT                   RLVEQEAAAKKVDIQLNLTSESIEADVDPDRLTQCFLNLFLNALQAMESGGRLTVSSST
FT                   GANGNVAIDIKDNGSGISAEDLSKIFDPYFTTKPKGTGLGLAIVHKIIEAHQGQIKVRS
FT                   TIGQGTVFSIALPLGDSEMRLS"
FT   gene            492516..493892
FT                   /locus_tag="Dole_0427"
FT   CDS_pept        492516..493892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0427"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   ypi:YpsIP31758_2820 transcriptional regulatory protein
FT                   ZraR"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66237"
FT                   /db_xref="GOA:A8ZTH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH3"
FT                   /protein_id="ABW66237.1"
FT                   /translation="MTIQNPSHILIVDDDLNHLKTLQTIVRSWGYQVSTADDGVKAVDT
FT                   VKERPFALILMDVRMAQMSGIEALKQIKQYNPAIPILIMTAYSSVDSAVEALKSGAYDY
FT                   LTKPLDFEVLKISLARALEHSGLKAENATLKSKMSADYELENIIGRSRPMKELVDMMSM
FT                   VAPSEATVLITGESGTGKELIAKSIHHNSQRKDRALVVVNCAALTETLLESELFGHEKG
FT                   AFTGADKRREGRFKQADKGTIFLDEIGETSAAMQAKLLRVIQEREIQRVGGEETLSVDV
FT                   RILAATNRNLEEDVKNGKFREDLFYRLNVVTLRIPPLRERQDDTPLLAQHFLEKYAKKN
FT                   HKQVKGFSPLAMDMLLKYAWPGNVRELENVIERAVILLPDEHITEKELPVTITSSYAEK
FT                   SEWVAPPPPVAANRPLEEVEKEAILATLDDSGGNKSETARRLGINRKTLHKKLKDYGID
FT                   "
FT   gene            493970..494632
FT                   /locus_tag="Dole_0428"
FT   CDS_pept        493970..494632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0428"
FT                   /product="peptidoglycan-binding LysM"
FT                   /note="KEGG: noc:Noc_1342 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66238"
FT                   /db_xref="GOA:A8ZTH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH4"
FT                   /protein_id="ABW66238.1"
FT                   /translation="MLAEWLRPSKKMLNHALHAATGIILAVVAVEVMPAALAGAPAWLL
FT                   ALAFMGGGGTYLLIESGVKRWQEGKQAGAGAGAWMVYLAVATDLVGDGLLIGTGSAVSS
FT                   QMALILALGQVLADIPEGFATIANFRDKGVGRVKRLLISASFLLPVIGAAALAYFAFRG
FT                   RSEVLKMAGLVFVAGLYMLAAMEDMMREAHESAEDSPWSALSLLAGFTIFLVISGSL"
FT   gene            494943..495416
FT                   /locus_tag="Dole_0429"
FT   CDS_pept        494943..495416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0429"
FT                   /product="zinc-resistance associated protein"
FT                   /note="KEGG: stm:STM4172 zinc-resistance associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66239"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH5"
FT                   /protein_id="ABW66239.1"
FT                   /translation="MKRNTKGIMTLAVLAVFGFSTLAFAGWGDGYGHMMGPGMMGPGWQ
FT                   QGSGYYGNLSADEIAKLEQQRAEFFRATENTRQQLYEKNLALQSELAKENPDTAKASKL
FT                   QGEISKLQSDLDQKRLEYDIQARKSAPNYNRGYRGGYGSMMGYGPRGGGYCGW"
FT   gene            495853..496218
FT                   /locus_tag="Dole_0430"
FT   CDS_pept        495853..496218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA1327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66240"
FT                   /db_xref="GOA:A8ZTH6"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH6"
FT                   /protein_id="ABW66240.1"
FT                   /translation="MIIKYVYNKVLMGLLAIWSLNNFMLSPAFAQSGGYRNWHMGRWMM
FT                   GDWGMGWFGMIFMLLFWVLVIVGIVFLIRWLVQNTGSRGSSGVGTGSQAMDILKERYAK
FT                   GEITHDEFESMKKEILR"
FT   gene            496237..497820
FT                   /locus_tag="Dole_0431"
FT   CDS_pept        496237..497820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0431"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; KEGG: gfo:GFO_1338 CotA-like multicopper
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66241"
FT                   /db_xref="GOA:A8ZTH7"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH7"
FT                   /protein_id="ABW66241.1"
FT                   /translation="MRNRNTDLGFDSRHSRRHFLKLAGYGTLGLMAAGLWPGFDGFAAG
FT                   QTPDTEFIPDLDITLSARPGEVPVLPGDPTLIWRYHATVHKGDRTRIAEIPRSYLGPII
FT                   KVHQGEKIRIRFRNAIPEESIVHWHGLHVPAIMDGHPRYVVPQGQSYLYEFEVKNRAGT
FT                   YWYHPHPHGRTGPQVYRGLAGLFLVSDEEEQAVGLPDGEYDVPLVIQDRTFDSGNQLVY
FT                   MSGHRMERMTGFLGDMIMVNGLPDFTLPVSTAAYRLRLLNGSNSRIYKLAWEDGRPLTI
FT                   IGTDGGLLERPVFRRYVFLSPGERLEIWADFSDNPVGYTTSLLSLPFDVGGMGGGRMGR
FT                   GMMMGGRTGQNLNLPNGVAFSVFKVKVAQPVKTDYRLPDTLSEIGPVRPDDAANFFRPR
FT                   QFYLTMRHMQWTINGRVFQMEEVADDEIVQLGSTEIWEFNNTGGGMMNMMNMPHPIHLH
FT                   GKQFRVIERSGVAHEGYVDEGWKDTVLLMPGERIKILVDFDDYPGMFLYHCHNLEHEDM
FT                   GMMRNYFVRE"
FT   gene            complement(498097..499956)
FT                   /locus_tag="Dole_0432"
FT   CDS_pept        complement(498097..499956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0432"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; SMART: DEAD-like helicases; KEGG:
FT                   pap:PSPA7_3695 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66242"
FT                   /db_xref="GOA:A8ZTH8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH8"
FT                   /protein_id="ABW66242.1"
FT                   /translation="MTNEEIARFFNDTQAYIQGNADLRDPQVEGWFRTRQHFRNSSEHA
FT                   ILQIPVGCGKTGLMALLPFGIAQGRVLVIAPNLEIRRGISTAFDIAGRDCFWTYTRVLT
FT                   DVNHGPYTAVLDGQDANIHDCENSHIVVTNIQQLASRADRWLPAFPDDFFDLIMVDEGH
FT                   HNVARSWERVFERFPNAKVVSLTATPFRGDGREIAGEVVYAYPFRTAMVRGYIKQITAV
FT                   NVAPQEISFTYRGDSRHHTLDEVLQLRDEEWFSRGVALAPECNRSIVDASIQWLQHLRE
FT                   SGTFHQLIAVACSVDHSRQVRSLYAERGLNAREIHSNMPADQIEEVLQDLRRSRIDCIV
FT                   QVRMLGEGFDHPNLSVAAIFQPFRSLSPYVQFIGRVMRVIHQNNPQHPDNRGIAVSHVG
FT                   LNIDRHWDDFRRIDREDQELIQGWLESGDERPPADEPGRRRRLTPDMVVQDEIISHFIE
FT                   QAYLDPMDDAVIDDLVEEFRRRGLDPEALGLSRDNLRQRLIQARTRESMEPREIPVTPQ
FT                   RRRQEARRRLNERSRALASRIVSAIGASINGRNIALTYPELRSVNNYAAVVQIVNRAVN
FT                   ERLEADVGTRGEIPLERLEEVLEQIDQIGDEVQADIQERLSRR"
FT   gene            complement(499953..500756)
FT                   /locus_tag="Dole_0433"
FT   CDS_pept        complement(499953..500756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_0818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH9"
FT                   /protein_id="ABW66243.1"
FT                   /translation="MNGRKAQIGFSQRIRLEWFEQTANLTLAGNDKATINDSLQDLLQD
FT                   KVSVGGKSVRGNREKVITILLKTWLTVPRELEKLRDEGLEILQELPRKDRIAVHWGMTL
FT                   AAYPFWGAVAAHTGRLLRLQGTAAAAHVQRRVKEDYGERETASRSTRRVLRSFIDWGVL
FT                   KETGDKGVYGQGNQYPVEDPRLIAWMVEASLRARMNGSAAIKDLLDSPSIFPFRLAHIS
FT                   AEHVASLSPRLNILRHGLDDDLVMLREDHRKEPKRRKLGDSGSSL"
FT   gene            complement(500753..502417)
FT                   /locus_tag="Dole_0434"
FT   CDS_pept        complement(500753..502417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0434"
FT                   /product="PglZ domain protein"
FT                   /note="PFAM: PglZ domain protein; KEGG: ace:Acel_0817
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66244"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI0"
FT                   /protein_id="ABW66244.1"
FT                   /translation="MTALDRGDLDALYEAQKRHAPGVLGDNATKEFVLRHVFEIAPELI
FT                   RKPSDLLRALLRRHYREQRIPALLDERFVQVLRQQGDFEEWPLETIIPDREAFFAFLQE
FT                   RWPVFLNQSAIQDATGVREDEKPYGFEYPGPSDLPFDHDDIRVYIDNLFVEGLLEAVPH
FT                   DWAESLSKTWLAIGIRTDQQADRARRVEGLLDNLSADIPNEDTRHDDWFHFAKTWAELV
FT                   ALALDSNAVLPEPARQKMEALQAQIDAVLVPWLTKRYAGLVNLPPAPPVMLHHIPRFLS
FT                   RHINDAKQHKAAFVLVDGLAMDQWIVIRKEIARQRANYRFRENAVFAWIPTITSVSRQA
FT                   AFAGKPPIYFPNSIHTTDKEPALWTQFWVDQGLTKQEVAYAKGLGNGTLENVEEIVARP
FT                   KMRVVGLVVDKVDKIMHGMELGAAGMHNQVRQWAAGPFLAQLFDLLLENGFRVYLSSDH
FT                   GNIEASGCGRPVEGAVADLRGERARIYPDSLLRGQVKERFPNALEWPPIGLPEEYLPLL
FT                   APARSAFVRKAESLVGHGGASLEELIVPLVQIERRDT"
FT   gene            502435..503460
FT                   /locus_tag="Dole_0435"
FT   CDS_pept        502435..503460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66245"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI1"
FT                   /protein_id="ABW66245.1"
FT                   /translation="MGIAPLVEWQQHLDGWPGFSVFRKRHLQLTKSQATAVECRTDCGL
FT                   GCPRNVVTHAPNDIVAVCPEQEEKPYPLKQQDTLIYSVKRASLHKDICSALGITHRESK
FT                   VDGCRRTWRLGDFVPTAGLVFPVFLTQQENQDELLEIVKNLCLLHADPFVLLTPTRRRL
FT                   SPPVEQMLAQRKAVFLALEEEMPFDEQSDLQVRRTPDELFAAFHEDVPEPGSGGMVHFP
FT                   TPDGIRWSDIKIQFRNGHTVTIWAGGQSGRYTYYQMGMYSKKNGDRTVQWKLLEAFAAS
FT                   RGEIDWSNQAANNKLKKQKQELSKCLREFFRLQEDPIEWVKGEKCYRCRFRILPEGDEN
FT                   Y"
FT   gene            complement(503830..504177)
FT                   /locus_tag="Dole_R0006"
FT   tmRNA           complement(503830..504177)
FT                   /locus_tag="Dole_R0006"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 196.18"
FT   gene            complement(504223..505173)
FT                   /locus_tag="Dole_0436"
FT   CDS_pept        complement(504223..505173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0436"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   dde:Dde_1619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66246"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI2"
FT                   /protein_id="ABW66246.1"
FT                   /translation="MARFILQNDLVVSDTATGLAWTKDAALSEFPLTWQEALDFVADLN
FT                   RAAYGGHTDWKLPNRRELFSLASHDTINPSLPVGHFFENVFHGYYWTATTCHRLPDQAW
FT                   YVHMGGARVFKGMKHGSYMVWPVRLPPETPGRLLATGQQRCYTRSGKVTDCDGTGQDGA
FT                   FGSGRTALPRFTDQGDTFYDTLTRLSWLKPSLCPAALSDWPSTFDAVEQMNRDHAFGRS
FT                   DWRVPHIIEMESLVHMDRHSPAVATDDQRERVQPFYWSATTSAYNPDYAWVLYFNDGAV
FT                   GVGFKPLAEFFLWPVAGTPQAPPVPGLAGPGPDIH"
FT   gene            complement(505177..505959)
FT                   /locus_tag="Dole_0437"
FT   CDS_pept        complement(505177..505959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0437"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   cte:CT0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66247"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI3"
FT                   /protein_id="ABW66247.1"
FT                   /translation="MKPVAPDRIDALPGKRLSESDTFNFACHDGLACFNQCCRNLNLFL
FT                   YPYDVLRLKKALNITAGDFIERYVDVVMRPDNFFPDVLLSMADNAEKTCPFLTDTGCAV
FT                   YEDRSYSCRLFPMEQGVIMPDGEAKPEILYLFRPPEFCLGRHEDRPLSPAQWIADQQAE
FT                   TYVRMTRLWAEVKALFSADPWGAAGPYGPAAKMAFMAAYNMDAFRDFVFNSGFLKRYKV
FT                   KSATLQKLRASDTELMLFGFDWIKLFVWGIKSDRIRLK"
FT   gene            complement(505956..506567)
FT                   /locus_tag="Dole_0438"
FT   CDS_pept        complement(505956..506567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI4"
FT                   /protein_id="ABW66248.1"
FT                   /translation="MSESDKLQPFFDRLADLYARMDAAYNATAGRYGFDCADCADNCCY
FT                   TVFYNHTSIEYFYLMEGLARLSEEKRRAVVAKALDARNQVDAAKAAGQKPRVLCPLNEN
FT                   GLCAMHGHRLMICRLHGIPYEIHYPGRTPFKGSGCEVFETRCTGTAYLPFDRTPFYSEL
FT                   AQLEQAVRQATGRNEKVKMTIAQMLSTDLPADLSHAGGAR"
FT   gene            complement(506560..507633)
FT                   /locus_tag="Dole_0439"
FT   CDS_pept        complement(506560..507633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0439"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="KEGG: dps:DP1797 related to
FT                   deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   putative deoxyguanosinetriphosphate triphosphohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66249"
FT                   /db_xref="GOA:A8ZTI5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI5"
FT                   /protein_id="ABW66249.1"
FT                   /translation="MSIRSDFEEREKTFISPYGCLSSNLRGRDHEEPEGAIRTEFQLDR
FT                   ERIVYSNAFRRLKHKTQVFLSPLGDQYRTRLTHTLEVAQISRTLARAMRLNEDLAEAVA
FT                   LGHDLGHTPFGHSGETVLRKISPAGFAHNEQSLRVVEKLENNGKGLNLTFEVRDGILKH
FT                   SKGYGNILDDDPSEMAITVEGRIVRVADIMAYLNHDLDDALRCNVIERSHIPEKCVKVL
FT                   GKNHSERATTMIRDVVYSSSSEDGLLRLRISDPVFEAMTELRHFLYDHVYRSPKVHAEF
FT                   EKANRILTELYEFFYKHTDMLEAELKKMEMGNCMDTDDTDRVVCDFIASITDEYALALY
FT                   SKLFFPTPIIYPGPMHV"
FT   gene            508158..510020
FT                   /locus_tag="Dole_0440"
FT   CDS_pept        508158..510020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0440"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: sfu:Sfum_4075 thiamine pyrophosphate
FT                   enzyme domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66250"
FT                   /db_xref="GOA:A8ZTI6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI6"
FT                   /protein_id="ABW66250.1"
FT                   /translation="MHKLLAKEPGKEMLLLGNEALARGALEAGVGFASTYPGTPSSELS
FT                   LNFFQISRETDLYFEYSTNEKVALEVAAAAANCGVRSMCVMKHVGVNVAADALMTLAYV
FT                   GVKAGMVLLSADDPHMFSSQNEQDNRYYGKLSGLPVVEPSSVAEAKEMAVYAFEVSEAL
FT                   GEPVILRTTTRVNHSSAKVALGSLPEKVKTEGQFEKDPFNYVTVPAVSRKLHVRLLERL
FT                   KKAADLSNTSPYNIRTGKGRYGIICNGVSYFYVTDALKALGRESDFSVLRVGFSNPMPD
FT                   ALVKAFLADCDRVLVAEEGEPFMEEAVKAMAAEEKRCIDIAGKREDLFSRLSEFDPQLV
FT                   ARCIARYFDIPYTPPTPADMSGVPEIPQRPPNLCAGCSHRATFYAVKKAAEGYDTIFPT
FT                   DIGCYTLGFLPPLSMGDFLICMGSSVGTACGFSRASNQKVVAFIGDSTFFHSGIPALIN
FT                   GVFNNHDFTLVILDNGTTAMTGHQPHPGVDMDELNFSGFQRVSIEALVKGAGVQHVSVI
FT                   RPYNLKKSIEAIREAIEFKGVSVVIAREECVLKAKSLKRGSARVFYVSDRCKNHRDCIN
FT                   TLACPAFYVADGRVQINPNLCAGCAVCVQVCPEKAIVPVKQDQK"
FT   gene            510070..510675
FT                   /locus_tag="Dole_0441"
FT   CDS_pept        510070..510675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0441"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: sfu:Sfum_4076 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66251"
FT                   /db_xref="GOA:A8ZTI7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI7"
FT                   /protein_id="ABW66251.1"
FT                   /translation="MNMQDSKRLILVAVGGQGNLLASKVLTEACLLSGVPVRMSEVHGM
FT                   AQRGGVVESALVFGDAESTIISDGCADVLVGFEPSEALRALGRCNANTVAIINTAPMPP
FT                   FTVAIGKGVYPEVDTIKSLLAAKTSRLVALDANALAAEAGSSLAVNMVLLGALIQAGIL
FT                   PLSAETVKQAIAATVKKAFVEINCKAFDMGYEAASMAA"
FT   gene            511044..511238
FT                   /locus_tag="Dole_0442"
FT   CDS_pept        511044..511238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66252"
FT                   /db_xref="GOA:A8ZTI8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI8"
FT                   /protein_id="ABW66252.1"
FT                   /translation="MPRKIRQLIKDLENAGFVNRGGKGSHRNFLHEKGIAVTISGQPGD
FT                   DVKPYQEKIVKQKIEEAKS"
FT   gene            511235..511591
FT                   /locus_tag="Dole_0443"
FT   CDS_pept        511235..511591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0443"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; KEGG: pac:PPA1449
FT                   conserved HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66253"
FT                   /db_xref="GOA:A8ZTI9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI9"
FT                   /protein_id="ABW66253.1"
FT                   /translation="MKDRDRYLKIVEWSDEDKCYVGSVPGWIGKCCHGDNEEKVYRQLC
FT                   RIVDEWIDIYKKDGQPLPPSISDKQYSGKFQLRTGCELHKALAIKALQTGNSLNNYCIN
FT                   VLRKEVAPSEKTMD"
FT   gene            511883..512101
FT                   /locus_tag="Dole_0444"
FT   CDS_pept        511883..512101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_A0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66254"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ0"
FT                   /protein_id="ABW66254.1"
FT                   /translation="MRITLSIPDEVAHRFQAAIPARQRSGLVTRLLEQELKKRDNSLAA
FT                   ACRAANRDKALEQEIDEWQAFDGGIEE"
FT   gene            513192..513581
FT                   /locus_tag="Dole_0445"
FT   CDS_pept        513192..513581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66255"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ1"
FT                   /protein_id="ABW66255.1"
FT                   /translation="MGQWKKESLEYTDQFIELLAKEKYDELRTLYNISGDKLEDFKIKF
FT                   GKISDYKYGFTNSSKSGVSGQFTGYFMHYIIQFHSEESYQGTFSISIDNNGNKPIPGEI
FT                   NCFTVRGRDQSREKIFHIYMKENRS"
FT   gene            513719..514300
FT                   /locus_tag="Dole_0446"
FT   CDS_pept        513719..514300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0446"
FT                   /product="Cro-like protein"
FT                   /note="KEGG: acb:A1S_3464 Cro-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66256"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ2"
FT                   /protein_id="ABW66256.1"
FT                   /translation="MNKYLTSSAIIDWDNPKVMTKAKDLAQGVDSSLEIAKKCFIYVRD
FT                   EIQHSNDYQLNPVTCKASDVLEHKTGFCYAKSHLLAALLRANGIPAGLCYQRLAVENDK
FT                   PPFCLHGLNAVYLPDFGWYRIDARGNKEGVFTEFIPPVEKLAFQIVNEGEADFQEIWSD
FT                   PLPEIKKVLESSNSFQEVADNLPDIEIIKS"
FT   gene            514385..514981
FT                   /locus_tag="Dole_0447"
FT   CDS_pept        514385..514981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66257"
FT                   /db_xref="GOA:A8ZTJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ3"
FT                   /protein_id="ABW66257.1"
FT                   /translation="MEALAAIGFGRSGGAGRRRNVRDERIRRYLKMKLSQALIIILLVA
FT                   NLIATIWFGINKEPGGEVSQIAKAAHHELPPVVSSEVRNEIFETFFQYFNAADYDSLYN
FT                   MFGPVAKAEVLKEASVKEFKRMVDYFHSIESGVYIYSELLGSRGNTNIYTMYYSVNLSE
FT                   KSEFGTKGTLKVTIAVQGNEYQIYGIRLNAESAAQ"
FT   gene            complement(515117..517117)
FT                   /locus_tag="Dole_0448"
FT   CDS_pept        complement(515117..517117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0448"
FT                   /product="Exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="PFAM: ribonuclease II; KEGG: sfu:Sfum_0728
FT                   exoribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66258"
FT                   /db_xref="GOA:A8ZTJ4"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ4"
FT                   /protein_id="ABW66258.1"
FT                   /translation="MEKGTIIDFIDSQKMICAVATETSGTGTSHLRLLTENGREVKLPL
FT                   RRASYAGGRLNPSVGRQALVDQLKATAHKRSELAERVDIKEVWDLLKDEDQWIDLASMT
FT                   GLCFSGPVTPDHEAAVVRAIFDDRLYFKFDHNRFYPHTEEQIHAICVRRDKEARQRAMI
FT                   HEGAEWLKKAGAGTPPPMDETARAVVDVLADYYVFEKEAKEPALAREILGGAGNLSPDT
FT                   LFSLLVRLGVWDEHENIDLLRHRVPVSWPDDVTKASEKLVATAGIPSAGPDRVDLTGLS
FT                   LFTIDGSQTLDFDDALSLEPMENGACRLGIHISDVGHYIKKEDPLDAEALKRGSSIYTA
FT                   DKKIPMLPAEISEGLCSLVAGKPRPAISMLITLSSSAEVMECRVVASVIRVENHLTYSQ
FT                   VNLSLDKDERLGRLSRIAVRLREKRVRDGALLIEIPELYVQFDDNRAVVLAKGDRESPS
FT                   RILIEEMMILANTVMARFLKEHGLPAIFRSQPEPKTRLFKKGTTGETLFQNWVQRKMVA
FT                   RVVVDTKPERHCGLGVDLYTSATSPIRKYADLITQRQVRAALGLETPYTEDQLQHLMQM
FT                   LQQPLSYVGKIQQARHRYWVFKHLETKTGQRVNAIVLDRFKNEYSILLPDYLTECRLPM
FT                   PPSALLKPKDTIQVTIQHVNARNGVISVFCN"
FT   gene            517312..517833
FT                   /locus_tag="Dole_0449"
FT   CDS_pept        517312..517833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66259"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ5"
FT                   /protein_id="ABW66259.1"
FT                   /translation="MTGLDKRIAGKKKEILGAWFERVSETYQDQTRSFLNKGGDRFANP
FT                   VAGIVSESLEKTLEGLLSGAGIEVLSQCMDPLIRVRAVQGLSPSASLAFVFSLKSILRD
FT                   LLHIQGPEADQMALMDKRIDGLALICFDKFMECREKIYELKACEVRNRTFKAFERAGLI
FT                   VDPEAAEPRA"
FT   gene            517894..518922
FT                   /locus_tag="Dole_0450"
FT   CDS_pept        517894..518922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0450"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   sfu:Sfum_1146 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66260"
FT                   /db_xref="GOA:A8ZTJ6"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ6"
FT                   /protein_id="ABW66260.1"
FT                   /translation="MNVSYLFAFVAVVVLILLAWAGVGAWGMTGVFGILVPYAAMLLFV
FT                   VGFARKILDWSNSYVPFRIPTTCGQQKSLPWIRQNKIDNPNTTGGVIVRMLLEILLFRS
FT                   LFRNTRAKFKDNNRLSYRWEIVLWVAALAFHYAFAVTLLRHMRFFFEPVPMVIQLLESA
FT                   DAFFRVEFFSPYFVIGLPGVYASGLVLLGALLLLLGRRIFLSQVRYVSLAADFFPLFLI
FT                   IGIAASGILMRYFAKVDISAIKTFAMGLATFKPVPPDGVSALFYVHLFLVSVLAAYFPF
FT                   SKLMHAGGVFLSPTRNMANNNRAVRHVNPWNYSVHTHTYDEYEDEFREKMIEAGLPVEK
FT                   EQ"
FT   gene            518923..520572
FT                   /locus_tag="Dole_0451"
FT   CDS_pept        518923..520572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0451"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: mta:Moth_1606 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66261"
FT                   /db_xref="GOA:A8ZTJ7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ7"
FT                   /protein_id="ABW66261.1"
FT                   /translation="MGNDIKPEELLERTDFGVPVTGWMDTPVEIREGMYCYASNPKSVE
FT                   YVELPNPRKWDPLEEDWHLPDNWQQILHEGIKQRLERFRTFKVFMDICVRCGACADKCH
FT                   FYLGTGDPKNMPVLRAELLRSVYRNDFTSAGKIIKKVFGRNISGARDLTLDVLKEWWYY
FT                   FFQCTECRRCSVFCPYGIDTAEITIMGRELLNLLGLNIDWIATPVANCYRTGNHLGIQP
FT                   HAFKDMIDFFVDDIEEFTGIALDPPPMNKKGADILFITPSGDVFADPGTYTAMGYLMLF
FT                   DYLKKVYGLDVTWSTYASEGGNFGFFTSHETMKRLNAKMYAEARRLGVKWILGGECGHM
FT                   WRVIHQYMGTMNGPADFLEEPVNPITGTVFENARSTKMVHIAEFTADLIKHGKLNLDKS
FT                   RNDHLKVTYHDSCNPARGMGLLDEPRYVIQNVCNHFHEMPANTIREQTFCCGSGAGLNA
FT                   GENMELRMSGGLPRANAVKYVHETFGVNMLSCICAIDRAVFPALMEYWVPEVGVTGLHE
FT                   LVANALVFPGEPRRTMDLRGEPLLGMEDADEE"
FT   gene            520562..520951
FT                   /locus_tag="Dole_0452"
FT   CDS_pept        520562..520951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0452"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: dde:Dde_2273 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66262"
FT                   /db_xref="GOA:A8ZTJ8"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ8"
FT                   /protein_id="ABW66262.1"
FT                   /translation="MKNKGLIITGLIVFFVIATIPFWYNVFSGTKAKTPELVYTDKAKE
FT                   AKVCVESTDYMKTEHMQLLDLWRDAVVRKAERAYVNSSGKTFDMSLTNTCLDCHANKAE
FT                   FCDRCHNYSSVRPYCWDCHNTKENN"
FT   gene            520951..521784
FT                   /locus_tag="Dole_0453"
FT   CDS_pept        520951..521784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0453"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_1778 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66263"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ9"
FT                   /protein_id="ABW66263.1"
FT                   /translation="MESNRRAFLKIAGITAAGITVAPVLTRFTASAEDTAQKGGAPSGK
FT                   TMSGTEALTARHWGMVIDTRQFTSAADLDPLIEACHKVHNVPTFETDLETPFFSADKNR
FT                   HEIKWLWEDEFKHVFPDAENKYLAQRLAELPFLALCNHCENPPCVRACPTKATFQREDG
FT                   IVMMDFHRCIGCRFCMAACPYGSRSFNFRDPREGLKETNIAFPTRMKGVVEKCNFCAER
FT                   LAKGQLPACVEASNGAILFGDLDDPASEVRRALEENFTIRRKPSLGTEPSVYYIV"
FT   gene            521806..522975
FT                   /locus_tag="Dole_0454"
FT   CDS_pept        521806..522975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0454"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   sfu:Sfum_1150 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66264"
FT                   /db_xref="GOA:A8ZTK0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK0"
FT                   /protein_id="ABW66264.1"
FT                   /translation="MLDTALKGNRQYWALIGVLAGITGVGFLVYLLQFKYGLGITGMSR
FT                   DVSWGFYIAQFTFLVGVAAGGVMLVLPYYLHNYKVFGKITILGEFLAISAVSMCLMFII
FT                   ADLGQPMRAFNVLLYPTPNSMLFWDMIVLNGYLFLNVVVGWSVLEADRNGVAPPKWVKP
FT                   LIYLSVPWAFGIHTVTAYLYCGLPGRHFWLTAILAPRFLASAFAAGPALIILLAMVMRK
FT                   FTRFDAGKEAIQGIARIVTYALIANVFFFACEVFVAFYSNIPGHMDHIKYLFVGLHGHG
FT                   VLVPWMWTSLGLMLLAIVLLVIPKTRANETFLAFSCIILFIGIWIDKGLGMISGGFVPS
FT                   PMHHVTEYIPTVPEIIITIGIYGAGALILVVLYKIALTVKAETGDAAHH"
FT   gene            complement(523090..523884)
FT                   /locus_tag="Dole_0455"
FT   CDS_pept        complement(523090..523884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0455"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ava:Ava_4070 putative MerR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66265"
FT                   /db_xref="GOA:A8ZTK1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK1"
FT                   /protein_id="ABW66265.1"
FT                   /translation="MKKVSAYDTIGTKYNAYRNADTRITAALKDLLGLQKGSSIVDVGA
FT                   GTGNYTNALASLGYKMKAVEPSPVMREQSIPHPHVEWVTGSAESIPLADGSVDGLVSTL
FT                   AIHHFPDIDAASLEMWRVCGNGPMVLFTIDPRRGASFWFKDYFPGIYNRIFDVFPPVEE
FT                   LISIFTGDHGATASIHDFPLPFDLADLNMHAGWNKPEIYFDPEVRRGMSGFAVSDESEI
FT                   KEGLNLLKRELENGDWEKHNGHLRKKSCYDLGFVFVKLQTGI"
FT   gene            complement(523994..525079)
FT                   /locus_tag="Dole_0456"
FT   CDS_pept        complement(523994..525079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0456"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0095 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66266"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK2"
FT                   /protein_id="ABW66266.1"
FT                   /translation="MSDQTYRTAASAVIAAGAIPFPVNDTLLEILKNIMTPEQAGFVQL
FT                   LDRPLNREEIKKKSGMADADLDQMLNSLMKSGVISGTASRGSGLMVYRAMPPIPGIFET
FT                   TMMRGETGEKQKTLARLFENLFEELAGMVQANYDAIVPAFKAMPPMTRIVPVEKHIDRA
FT                   FDTVMPCEDVKKLVDRFDTIGVATCYCRHQKDLLDRPCKVTDERKNCLFFGKTAEFFIT
FT                   YGFAEPITQDQAKQILEKAEADGLVHKAFHEKYDTGRNEMAICNCCKCCCETFQSYYRG
FT                   SSPTITYAAYVARVDADTCTGCEACADICPMEAIEMKDDIAHVSDSRCIGCGVCAYHCP
FT                   ADALALERTGQREVFVPPPKH"
FT   gene            complement(525097..525717)
FT                   /locus_tag="Dole_0457"
FT   CDS_pept        complement(525097..525717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0457"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hch:HCH_05785
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66267"
FT                   /db_xref="GOA:A8ZTK3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK3"
FT                   /protein_id="ABW66267.1"
FT                   /translation="MKKPNTIHAASCGRQRQIIEAALACFTEKGFPATSIADICKKAGA
FT                   STGSVYHHFKSKGRLAAAIYLEGVRDYQAGMIDALSKETTAKGGIFAIVQYHLTWVKTH
FT                   PEWARFLFQKRHAEYMDDTEDRMKQLNAEFVKQMSAWFAKHMESGAIRPLPRDVFSALL
FT                   LGPCQEFARMHVTGYAKTDVTEAARHLAAAAWASLGNFTINPS"
FT   gene            complement(525875..526840)
FT                   /locus_tag="Dole_0458"
FT   CDS_pept        complement(525875..526840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0458"
FT                   /product="methylenetetrahydrofolate reductase"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   sfu:Sfum_3130 methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66268"
FT                   /db_xref="GOA:A8ZTK4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK4"
FT                   /protein_id="ABW66268.1"
FT                   /translation="MKAGSHLEKILRAGHFAFTGEIGPPRGTDVEEVKEKARFLKGNVD
FT                   MANITDNQTAVVRMSSWATSLVVMEEGVEPNYQMVCRDRNRLAMQADILGAYALGIRNI
FT                   LALSGDHQQFGDHPFAKGVYDLDSIQLVNMIKNMRDEGKFQGGADISHPPKMFIGAAAN
FT                   PFAEPYEWRVHRLAKKIDAGADFVQTQCIFNMERFREWIRQANDMGLTEKIYILGGITP
FT                   MKSIGMARYMQKKVPGMDVPEAIIKRLQGVDKKEVANEGIKIACEQIQELKETKGVAGV
FT                   HLMAIEWEHKVPEIAEKAGMLPRPVVEDDPAPEAKKGDAE"
FT   gene            complement(526887..527270)
FT                   /locus_tag="Dole_0459"
FT   CDS_pept        complement(526887..527270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0459"
FT                   /product="hmc operon protein 6"
FT                   /note="KEGG: dde:Dde_0648 hmc operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66269"
FT                   /db_xref="GOA:A8ZTK5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK5"
FT                   /protein_id="ABW66269.1"
FT                   /translation="MKANTKGVNPKAIQDIIEKDKAKIAFSLKACAHCSMCAESCFLFQ
FT                   ARNQDPKYMPSYKFLSTLGVIYKKKGKVDRQTLEEMRETVWKRCVLCTRCYCPMGIDIP
FT                   YMIRLTRRICRSQGVYHTYDTEA"
FT   gene            complement(527316..527984)
FT                   /locus_tag="Dole_0460"
FT   CDS_pept        complement(527316..527984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66270"
FT                   /db_xref="GOA:A8ZTK6"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK6"
FT                   /protein_id="ABW66270.1"
FT                   /translation="MDPLNLVYDLARGPLVWVAVVVFLVGAVVQVYRMWSLTSAARPVE
FT                   NLPRSLKPVERKKLPLGVRLRLSVAGTSPVTVVVTTVFHLCLVITPLFVLGHNILVDNA
FT                   WGASLFSFPEGFSDFLTLVVVACAGYFLVRRIFYERVRLISTPWDYLFLALAAGPFITG
FT                   ALAYHQIFDYKLMITAHMLLGELMLIAIPFTKFAHMLFFPVFRFAVASEYSLGNGRRTW
FT                   "
FT   gene            complement(528005..528685)
FT                   /locus_tag="Dole_0461"
FT   CDS_pept        complement(528005..528685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_1232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66271"
FT                   /db_xref="InterPro:IPR022026"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK7"
FT                   /protein_id="ABW66271.1"
FT                   /translation="MVKAKRKPLEEIADCVKGYTKILNIGCGGCVSVCMAGGQREVNTT
FT                   NAELTLLFQEKEITSRIDGYTVERQCNAALLEELDDLVVRYDCLVSMACGAGVQMLAER
FT                   YPSKPVFPAQNTIAIGVDREMGIYEERCRACGFCVLAYTGGICPVTRCSKGLFNGPCGG
FT                   TNNGKCEISNDVSCAWNDIYNRLKQQNRLNDILRIQAAMEWQNTTPRTFVQTGYEHRYA
FT                   KEEA"
FT   gene            complement(528716..529123)
FT                   /locus_tag="Dole_0462"
FT   CDS_pept        complement(528716..529123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0462"
FT                   /product="cytochrome c class III"
FT                   /note="PFAM: cytochrome c class III; KEGG: dde:Dde_3710
FT                   acidic cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66272"
FT                   /db_xref="GOA:A8ZTK8"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK8"
FT                   /protein_id="ABW66272.1"
FT                   /translation="MRQRVGRKKATVLVSAFFSLFFVLSGNCVLAQDLELKMTDDVTRP
FT                   PVIFPHDLHMGGFDCFDCHHDYDEDGNNILDDYALEEGNPDILCGACHTGKTTIEPREA
FT                   FHLQCMGCHEQFTFKKRPTGPVLCGECHVKE"
FT   gene            529533..529850
FT                   /locus_tag="Dole_0463"
FT   CDS_pept        529533..529850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0463"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: sfu:Sfum_4045 DsrC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66273"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK9"
FT                   /protein_id="ABW66273.1"
FT                   /translation="MATIEFQGKSFNVDEDGFIESYSEFSEEWVQWVKKEEGIDELTDE
FT                   HRQVIKVLQDYYEKNGIAPMVRILSKLTGFKLKHIYELFPSGPGKGACKMAGLPKPTGC
FT                   V"
FT   gene            529984..530436
FT                   /locus_tag="Dole_0464"
FT   CDS_pept        529984..530436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0464"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: regulatory protein AsnC/Lrp family; KEGG:
FT                   mta:Moth_2198 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66274"
FT                   /db_xref="GOA:A8ZTL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL0"
FT                   /protein_id="ABW66274.1"
FT                   /translation="MHLDDTDRAILNAVQSDFPLAPRPFSAIGEQLGLDEDEVVRRMAR
FT                   LKREGIIRRIGGNFVPEKLGYVSTLCAASVPEDRIETFALAVNEYPGVTHNYIRDNTYN
FT                   VWFTFIAPSRDAIEESLAEIAKKTGVTRIINLPATRVFKIRAAFNL"
FT   gene            530470..531288
FT                   /locus_tag="Dole_0465"
FT   CDS_pept        530470..531288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0465"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: drm:Dred_2191 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66275"
FT                   /db_xref="GOA:A8ZTL1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL1"
FT                   /protein_id="ABW66275.1"
FT                   /translation="MQEIRIAAVTCACPAGQVDRNLETTARWVGKAAARGAGIVCFPEL
FT                   NVSGYCLDAALYREAAGRYNDVVGALSRMATAFDIVILAGTVAEAAGGRVTACHLVISP
FT                   NGSAGGYTKLHIAPPEKQLFVPGRKVPLFEAKGAVFGVQLCYDAHFPELSTAMALKGAD
FT                   ILFVPHASPRNTPEEKLASWMRHLPARAYDNGVFVAACNQAGENGAGQGFPGVAVALDP
FT                   SGKVMAQTTSPDSMIVADCSPSTLNTVRNHPMRYFLPGRRPELYGSGDGS"
FT   gene            complement(531264..532022)
FT                   /locus_tag="Dole_0466"
FT   CDS_pept        complement(531264..532022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0466"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: sfu:Sfum_1666 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66276"
FT                   /db_xref="GOA:A8ZTL2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL2"
FT                   /protein_id="ABW66276.1"
FT                   /translation="MKKNFRLIIEYDGACFHGWQIQKDLRTVQGEITGALASITGQAVS
FT                   VIGSGRTDAGVHAMAQVASFICDTRLEPGTLQKALNGILAKDIVIHDCREVSLNFHARY
FT                   SAKSKTYRYRILNRNLPAALYRGYAWHIKKPLDLGAMTAALPHILGRHDFSSFEGTGSP
FT                   KASSVRHVTAATFNMAEDGYLAFEITADGFLKHMVRNIVGTLVEVGLGKKTPEAVADIL
FT                   AAKDRSRAGATAPGHGLFLVRVNYEPSPDP"
FT   gene            complement(532094..532169)
FT                   /locus_tag="Dole_R0007"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(532094..532169)
FT                   /locus_tag="Dole_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(532231..533535)
FT                   /locus_tag="Dole_0467"
FT   CDS_pept        complement(532231..533535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0467"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: sfu:Sfum_1671 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66277"
FT                   /db_xref="GOA:A8ZTL3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL3"
FT                   /protein_id="ABW66277.1"
FT                   /translation="MARQSEYQRLIHEMYNLRRFGIKLELTTMQRMLDALGRPHTRYET
FT                   IHIAGTNGKGSIATTLATILHAAGYRTGLYTSPHLVTFNERIQINNRPVSNAAVVRACK
FT                   AVRGLSGDGREPTFFEYTTAMAFYLFAELGVDIAVIETGMGGRFDATNIITPCLSVISN
FT                   ISVEHRMYLGNTLGEIAGEKAGIIKPGVPVVTGARQKPVLDVIKKVAKKQAAPLYRLGG
FT                   EFRVRRHGDGTFSYHGISHRWDRLRTVLAGGFQMDNAALALAGCELLMASGKPLSEATV
FT                   RKGLASTRWPARLEIVSDSPTILIDGAHNLQAAKNLAAFLSEQMAGRKITLVAGILDDK
FT                   PYRAMLRALVPLCDRVILTRAQIGRAIAPEILEREARNLGATRTHVVDRVDKALAFALA
FT                   HTPKKSGAVCVAGSLYVAGEARHAIKKQGEMQPAI"
FT   gene            complement(533608..533814)
FT                   /locus_tag="Dole_0468"
FT   CDS_pept        complement(533608..533814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0468"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; KEGG: pca:Pcar_2255
FT                   30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66278"
FT                   /db_xref="GOA:A8ZTL4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL4"
FT                   /protein_id="ABW66278.1"
FT                   /translation="MKEIEVRVIDNDLEKAMRILKKKIQNDGLFKRLRLRKTYEKPSEF
FT                   KRRKEREAQRRLRIAEIKRRRFR"
FT   gene            complement(534043..534717)
FT                   /locus_tag="Dole_0469"
FT   CDS_pept        complement(534043..534717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0469"
FT                   /product="adenylate kinase"
FT                   /note="PFAM: adenylate kinase; KEGG: dde:Dde_2028 adenylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66279"
FT                   /db_xref="GOA:A8ZTL5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTL5"
FT                   /protein_id="ABW66279.1"
FT                   /translation="MNILFFGPNGSGKGTQGAILKEKYSLPHIESGAIFRENISKGTEL
FT                   GAKAKEYIDRGDLVPDDITIPMILDRLQQDDCKKGWLLDGFPRNKVQAETLDATLKKAN
FT                   MALDIVVEIELDREIAKNRIMGRRLCVNDNNHPNNIFIDAIKPDGDKCRVCGGELKTRS
FT                   DDQDEAAIDKRHNIYYDTETGTLAAAYYFRDLAAKGGSLKYITLDGAPGVKEVAAELVS
FT                   KL"
FT   gene            535141..536385
FT                   /locus_tag="Dole_0470"
FT   CDS_pept        535141..536385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0470"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: sfu:Sfum_1711 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66280"
FT                   /db_xref="GOA:A8ZTL6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL6"
FT                   /protein_id="ABW66280.1"
FT                   /translation="MDISELKKKKMDELKEIAAGYEVDSAGMKKQELIFSILQAEAENN
FT                   GYIFGESTLEVLSDGFGFLRSPDSSYLPGLDDIYVSPSQIRRFNLRTGDIVSGQIRQPK
FT                   ENERYFALLKVEAINHEDPEIARHKTPFDNLTPLFPNEKIKLERESDNYSMRIMDLLTP
FT                   IGFGQRGLIVSPPRAGKTMLLQNIANSIIASHKKVVPFVLLIDERPEEVTDMKRSVNAE
FT                   VISSTFDEPADRHVQVAEMVIEKARRLVEHKKDVVILLDSITRLARAYNSVVPSSGKVL
FT                   SGGVDSNALHRPKRFFGAARNIEEGGSLTIMATALIDTGSRMDDVIFEEFKGTGNMELH
FT                   LDRKLADRRVYPAIDINRSGTRKEELLVEKDVLNRVWVLRKLLATLNSVDGMEFLLDKM
FT                   SSTKSNKDFMDAMNS"
FT   gene            536619..536840
FT                   /locus_tag="Dole_0471"
FT   CDS_pept        536619..536840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0471"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: sfu:Sfum_1712
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66281"
FT                   /db_xref="GOA:A8ZTL7"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTL7"
FT                   /protein_id="ABW66281.1"
FT                   /translation="MKQEIHPEYHQATARCACGNEFTVGSTKESIKVEICSQCHPFFTG
FT                   KQKLVDTAGRIERFRRKYAKFEQQKSGK"
FT   gene            536892..537962
FT                   /locus_tag="Dole_0472"
FT   CDS_pept        536892..537962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0472"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   pca:Pcar_2692 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66282"
FT                   /db_xref="GOA:A8ZTL8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTL8"
FT                   /protein_id="ABW66282.1"
FT                   /translation="MFDRLQDVERRFGELEGLMADPSIVNDREAYQKHSREHAELADIV
FT                   DAYRRYKAVSDEIEKSRDLLEDRDPEIRELAKEEISRLKDERERLDGELQNLLTPKDPN
FT                   DNKNVLVEIRAGTGGEEASLFAHDLFRMYWRYAETMGWKTEIMSSSVTGSGGFKEVIFM
FT                   VYGKGAYSHLKFESGIHRVQRVPETEAQGRIHTSAVTVAVLAEAEEVELHIDPSEIKTD
FT                   VFRSSGPGGQSVNTTDSAVRLTHLPTGVVVICQDEKSQLKNKNKAMKVLRARLLDRMIQ
FT                   DQNEKIAQNRKDQVGSGDRSGRIRTYNFPQGRVTDHRAGITLYKLESVLQGDLSELVNG
FT                   LATYFQAERLKQADAS"
FT   gene            537952..538845
FT                   /locus_tag="Dole_0473"
FT   CDS_pept        537952..538845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0473"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: sfu:Sfum_1714 modification
FT                   methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66283"
FT                   /db_xref="GOA:A8ZTL9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL9"
FT                   /protein_id="ABW66283.1"
FT                   /translation="MPPDTRVWTILDVLSWTATFFSDHRVEAPRVSAELLLAHVLGIKR
FT                   LDLYLRYDQPLTPDELAAFRSLISRRKAGEPVAYILGEKAFWSMDLVVTPDVLIPRPDT
FT                   ECLVETALSFLAGPGSDTPAERWVLEPATGSGAVVLALAKSHPGCRFFAFDRSTAALAV
FT                   ARKNAVRYDPAHRVVFFASDWFSALGNSASGRFDMIVANPPYVASGDIDHLAPEIGFEP
FT                   RMALDGGADGLDPVRHILQAAGRFLKPGGRLLIEIGWDQKERVAQVTEQAGLYTAVGFA
FT                   KDLAGHHRVVHMQRAG"
FT   gene            539062..539976
FT                   /locus_tag="Dole_0474"
FT   CDS_pept        539062..539976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0474"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: pca:Pcar_1921 30S
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66284"
FT                   /db_xref="GOA:A8ZTM0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM0"
FT                   /protein_id="ABW66284.1"
FT                   /translation="MSYITMKELLESGVHFGHQTRRWNPKMKPYIFGARNGIYIIDLQK
FT                   TVRMFKDAYDFIGHVAEKGGSVLFVGTKKQARESIYEEANRAEMFYVHNRWLGGMLTNF
FT                   QTIKKSIDQLHYLNELVNDGSIERYPKKEQAGLMRQREKLDSVLGGIQSMTRLPAALFV
FT                   IDVRKEAIAVGEARRLGIPVVAVVDTNCDPDNIDYVIPGNDDAIRAIRLMSSRVADACI
FT                   DGRKRFEEKKQAFEDKAEAETEEKPRPAPAAAAAAEDQKPVEREVISDGTDGPIVERIR
FT                   KTFTSAADYQEPEEDADEENSEA"
FT   gene            540012..540608
FT                   /locus_tag="Dole_0475"
FT   CDS_pept        540012..540608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0475"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   sfu:Sfum_1779 translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66285"
FT                   /db_xref="GOA:A8ZTM1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTM1"
FT                   /protein_id="ABW66285.1"
FT                   /translation="MGTISASLVKELREKTGAGMMDCKEALTACDGDIEKAVDFLRQKG
FT                   LAKAAKRSGRETSEGIVESYIHMGGKIGVMVEVNCESDFVAKTDDFKEFARNVAMQIAA
FT                   TNPAGIAPEDVPADLLERERQVYRAQVLEMGKPENMVDKIVDGKIKKFFKESCLIEQQY
FT                   VKNPDITIGDYLNETVAKIGESIRIKRFARFALGE"
FT   gene            540612..541349
FT                   /locus_tag="Dole_0476"
FT   CDS_pept        540612..541349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0476"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66286"
FT                   /db_xref="GOA:A8ZTM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM2"
FT                   /protein_id="ABW66286.1"
FT                   /translation="MTPRYKRVLLKLSGEALMGDQTMGISPDVLQYVAEEIESICRMGV
FT                   QLAVVVGGGNIFRGVAASSYGMDRTSADHMGMLATVINSIALQDAIEKRGIATRVQSAI
FT                   EVHAVAEPYILRKALRHLEKGRVVIFAAGTGNPYFTTDTAAVLRAEEIHAELLLKATKV
FT                   NGLYDSDPVKNSGARFIKQITYMDVIKRQLAVMDATAITLAMDNHLPLVVFSMRDKGNA
FT                   RRIICGEDLGTYIGDEASADQSI"
FT   gene            541391..541948
FT                   /locus_tag="Dole_0477"
FT   CDS_pept        541391..541948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0477"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: sat:SYN_00919
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66287"
FT                   /db_xref="GOA:A8ZTM3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTM3"
FT                   /protein_id="ABW66287.1"
FT                   /translation="MLELVYEEIEEKMGKTLEVFKNDLKKVRTGRASLALLDGIVVDYY
FT                   GTPTPLNQLASLSVPESRLIVIQPWDATAIKDVEKAILQANIDLTPSNDGKVIRLSIPP
FT                   LTEDRRKEIAKRVNQMAEEHKVAMRNIRRDANETLKQMKKDGDISEDESFAGKDKVQKV
FT                   TDGYIERIDEVFKAKEKEILEL"
FT   gene            541938..542681
FT                   /locus_tag="Dole_0478"
FT   CDS_pept        541938..542681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0478"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: gur:Gura_3729 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66288"
FT                   /db_xref="GOA:A8ZTM4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM4"
FT                   /protein_id="ABW66288.1"
FT                   /translation="MNSDAPLPDLAVLDPARLPRHIAIIMDGNGRWAKQRSLERLEGHR
FT                   RGVQVIEAIVTACTEIGVSCLTLYAFSTENWQRPAPEVEGIMALLEMFLAAKQQELKDN
FT                   GVRLNVVGEVDMLPASVRAALDRAIEHTKSGNTLVLTLALSYGGRSEITAATRRIAADV
FT                   VAGRIDVKDVDEALVSRYLYTHDMPDPDLMIRTSGEMRISNFLLWQLAYAELYVTPTLW
FT                   PDFDKAELIRIIADFQSRDRRFGKV"
FT   gene            542702..543541
FT                   /locus_tag="Dole_0479"
FT   CDS_pept        542702..543541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0479"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   sat:SYN_00917 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66289"
FT                   /db_xref="GOA:A8ZTM5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM5"
FT                   /protein_id="ABW66289.1"
FT                   /translation="MHLKRWLTAAVAMPILIAVVFGAPAWFFALFICVAAVLALFEYYQ
FT                   IVFSGNTDSPLSITRLSGYGSAAIISGAALSGRFDVICLAASGLLIFSGACSLVEYRAG
FT                   NPVFERVLRQVLGLIYIPLALSFLVVIRQGAHGPLWIMFLVFLVFLGDTGAFYGGRFFG
FT                   KHKLLPAVSPGKTIEGAVGGMLATVGVGATINIFFPVLPWGLAMARLPWTTALIFFVVV
FT                   SIVGQAGDLFESTMKRDAGIKDSGALFPGHGGILDRIDALIFAIPVAYLFKAYVFFL"
FT   gene            543538..544689
FT                   /locus_tag="Dole_0480"
FT   CDS_pept        543538..544689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0480"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: sfu:Sfum_1784 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66290"
FT                   /db_xref="GOA:A8ZTM6"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTM6"
FT                   /protein_id="ABW66290.1"
FT                   /translation="MKRLTLLGSTGSIGVNTLKVVSRFCDRFSVEALCARGSVDTLAEQ
FT                   VQRFSPSLAVVIDAPTAQALKERLPAGSRTEVLFGEAGYCHAVSLPGVDMVVSAMVGAA
FT                   GLGPTIAAIKAGKAVALANKEVLVMAGETVMALAAQKGVPLLPIDSEHSAIFQCLQGND
FT                   KTFLSKIHLTASGGPFLNKTRQEIETATPEQALAHPTWTMGKKISIDSATLMNKGLEVI
FT                   EARFLFDVPADCIEVVVHPQSIIHSMVSYIDGSMMAQLSVPDMKGAIAYALSYPERLDL
FT                   NQPAPDLAALEQLTFFSPDLDRFPCLGLAFEACRRKKTFPAVLNAANEVAVDAFLREAI
FT                   PFGRIPRVIEQVLAEHTGVTDPSLSDIKDADAWARQRAGALLP"
FT   gene            544794..545861
FT                   /locus_tag="Dole_0481"
FT   CDS_pept        544794..545861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0481"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="KEGG: gme:Gmet_1257 peptidase M50, putative
FT                   membrane-associated zinc metallopeptidase; TIGRFAM:
FT                   putative membrane-associated zinc metalloprotease; PFAM:
FT                   peptidase M50; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66291"
FT                   /db_xref="GOA:A8ZTM7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM7"
FT                   /protein_id="ABW66291.1"
FT                   /translation="MTTLFALIIVLGVLIFFHELGHFLVARLFGVGVEKFSLGFGPRLF
FT                   GFKSGITDYQVSAIPLGGYVKMVGEDPDDEADLSEAEQAISFTHKPVGKRFLIVAAGPV
FT                   FNMLLAVLIFYGLFQVYGKAYLLPVIGEVMPESPAAAAGMLAGDRVVAVDDTGVTTWDE
FT                   MALMIQNSGGRALRLTVQREGGLLRVDVQPDPTDGETIFGEPRTDYKIGVAAAGEVVRE
FT                   RLNPVEAMGRSVDQTWEVIRLTAIGVGKMVSGTVSAKNLGGPILIAQMAGEQARQGSAS
FT                   LLAFIAFISINLAILNILPIPVLDGGHLLFFAIEAVRGRPVSARTRETAQQFGMFLILM
FT                   LMVLVMYNDISRFFE"
FT   gene            545871..548867
FT                   /locus_tag="Dole_0482"
FT   CDS_pept        545871..548867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0482"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: sfu:Sfum_0432
FT                   phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66292"
FT                   /db_xref="GOA:A8ZTM8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM8"
FT                   /protein_id="ABW66292.1"
FT                   /translation="MAHRLEIALKPGLTDAQGQKVKKRAADYLSISLSDVRVVHVITLD
FT                   AALSEPQQWAVQEIFTNPVTQVSSFGPLAVAFDWIIWVGLRPGVKDNAGDTAKEAISDS
FT                   LGRTFTDDEGVYTSRRYCLTGDGLSREQVETIARELLANDTIEQWRLFSKEEWDDTSGI
FT                   GLIIPRVRLAHSPTVTLIPVESDAALMKVSDERNLALNPNDVPVIREYFVRKEVRERRR
FT                   AVGLSDPTDIEVEYISQARSDHCNHNTFGGRFYYKDLITGETLKIDSLFATCIRQPTLD
FT                   LQKEKPWVVSVLWDNAGMARFDEDHCYVITGETHNSPSNMEAYGGAMTGIVGVYRDPMG
FT                   TGKGARLVMGGYGFCTGRRDYDGDLKPRLSPRRLLDGVIEGVKDGGNKSGIPTTFGQLY
FT                   FDDGYMGKCLVFVTAIGILPAYINGEPSDKKTTRPDDLIVMCGGRVGKDGIHGVTASSE
FT                   VYSEHTPAGHVQIGDPYTQKKMHDFLLCARDAGLIQFITDNGGGGLSSSVGESALYSGG
FT                   CEVWLEKVPLKYAGLDQWEIWVSESQERMTVAVAPENIDRFLALSADHAVESTVIGKYT
FT                   DSGMLHILYDGATCAYIDLDFMASDFPQWEFEAHWTPPEARGLCEPVLGGSPDFNTLLS
FT                   DMLARPNICSREWVARQYDHEVQGGSAVKPLVGADRDIASDAAVTRPVLASEKGIAFAQ
FT                   ALLPAYSKIDAYHMTTAVIDEAVRRLVAVGADPAGIGGVDNFCWPNIAYNPASNPDGRF
FT                   KAAQLVRSCLALRDACNAFGIPLLSGKDSMYVDGHLAGRYGETRKVSALPTMQFSATAV
FT                   VDDVTACTTLEAKAEGDLVYVAGITRNELGASEYYELLGFTGLTIPRVRFDESSAVCRA
FT                   VATAIGRGLCASVHGVYRGGLGVHLAFVAMGGNLGMTVDLSKIVQEPGLSDHALLFSES
FT                   PARFVITVAPENRAAFEALWQDAPCACIGTVTGKNGRLTLSGQNGKPLVDREGATLKQT
FT                   WKQPFGNLI"
FT   gene            548864..549694
FT                   /locus_tag="Dole_0483"
FT   CDS_pept        548864..549694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0483"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sfu:Sfum_0433
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66293"
FT                   /db_xref="GOA:A8ZTM9"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM9"
FT                   /protein_id="ABW66293.1"
FT                   /translation="MKHSVNALILSGYGLNCDNETAFAFEQAGARAERVHINALISGQK
FT                   TLEDFHILAFVGGFSWGDDHGAGVIQAHRMKTRLGKDMVAFVERGGLVIGICNGFQTLV
FT                   NLGLLPGIDGDYATRSVALIANDCGNFRDDWVTLAVNTASPCVFTKGIASLDLPIRHGE
FT                   GKFFCEPDILAALAANSQVVMRYADESGAPAKGRFPQNPNGSVDDIAGICDTTGRVFGL
FT                   MPHPEAYNHPTNHPHWPLQKEKAVRSGQSPVFAFPTDGIRLFLNGVDFVKTEVS"
FT   gene            549746..550966
FT                   /locus_tag="Dole_0484"
FT   CDS_pept        549746..550966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lmo:lmo1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66294"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN0"
FT                   /protein_id="ABW66294.1"
FT                   /translation="MELRRKIFWPVILLFLLCCVAACNRPDATEKDGHEPVRQAVTMAA
FT                   NHLADQVTKNGQFVYQNNLNPKVRVAPGYNILRHAGTIYAMAMYDAAWPDKRVRAAMVK
FT                   AGRYLQKEAVSPVPGKKNMSAVWSLPEVNKTGAPVQAKLGGTGLGLVALLSIEAVSPGF
FT                   TPMARLGDLGRFILYMQKPEGNFYSKYIPGSGGPDDSWTSLYYPGEAAFGLVMLYEKDP
FT                   DPAWLDGAVRALTFLADSRRGAVSVPEDHWALIATERLLALSEPAAVPEGTKDLLTSHA
FT                   IQICTRMVDRYENSRKPGRKFASALSTTQVACTLEGLQAALALLPPDHLLRPRMRTVIE
FT                   EGITFLIDAQVADGPHRGAIPRMAGGSGAPLTGAGGPKATEIRIDYTQHALSALVRYAQ
FT                   REVAGTQ"
FT   gene            complement(551100..551726)
FT                   /locus_tag="Dole_0485"
FT   CDS_pept        complement(551100..551726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3606 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66295"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN1"
FT                   /protein_id="ABW66295.1"
FT                   /translation="MKYRIWTTMFFIAVWCLAPGTASADIYKYVDESGRVHYTNNPDSI
FT                   PKAAHETVVVDQEVESRSPDPAQPQEMAPEEGAPQETDTPLTRISQQRNHLHTERKNAL
FT                   VKRQQALNEERQALQAENTRLETLRRTANTRAEIERYNAEVEQYNQRTAAYQAQKNAYQ
FT                   QEKELFQKEVEAYQAELKKTLEATLEKMEKSPSQPAASPPPEETP"
FT   gene            552061..552564
FT                   /locus_tag="Dole_0486"
FT   CDS_pept        552061..552564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0486"
FT                   /product="pilin assembly protein"
FT                   /note="KEGG: sat:SYN_01761 pilin assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66296"
FT                   /db_xref="GOA:A8ZTN2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN2"
FT                   /protein_id="ABW66296.1"
FT                   /translation="MNREMKKGFTLMELMVVVAITAVIMAIAIPNVVSWRNNQQLSRAA
FT                   RQVFVDIQATRMSAVKYNQFAFIQFDTGNGTYVAWRDSPDGAASGVLDPGDDNVILRGN
FT                   MPPGVEMSAAAFSAPNGDTAGFSPMGLCRWPSGAFRSGSVTVTNGVRDSRIILNESGRI
FT                   RTES"
FT   gene            552575..553354
FT                   /locus_tag="Dole_0487"
FT   CDS_pept        552575..553354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0487"
FT                   /product="Tfp pilus assembly protein PilW-like protein"
FT                   /note="KEGG: dps:DP1458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66297"
FT                   /db_xref="GOA:A8ZTN3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN3"
FT                   /protein_id="ABW66297.1"
FT                   /translation="MHSQKHLLRSAYGFTLAELLVAMAAASLIMALVVATYFGQTTTNS
FT                   SQGQVVAMQQNLRVALQVMEREIMMAGYKPRPGTSVPAAFGIITADADELVISMVEPVT
FT                   DLDRIDNDSDGTVDESGEKDGRDNDDGGAGEVDEAGEIITIRYQLYDSLGDGDQDLGRE
FT                   ELNSNVSVSAIAENIEALEFVYTLADGTQPTPPVSAADLPDIRAIGISILARTEEPSVS
FT                   GYVDRIIYKTLSGTDWGAYNDAYRRQLSVVTVNRRNF"
FT   gene            553377..553862
FT                   /locus_tag="Dole_0488"
FT   CDS_pept        553377..553862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66298"
FT                   /db_xref="GOA:A8ZTN4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN4"
FT                   /protein_id="ABW66298.1"
FT                   /translation="MNAKNSLAKRRANRSCSIGRNGFTLIEVLMAVAIFSIGVLGAASM
FT                   QTSAVSTTTRLRKATMGVACASDVMERLFSLDFSHPYLSAGTHAPGDGEDEDGDGEDDM
FT                   PVIPEYNSVFESITWRVDNQDLDVSTAGIDAKVITVTVLWGGGSRNITLTSARTFKA"
FT   gene            553859..554380
FT                   /locus_tag="Dole_0489"
FT   CDS_pept        553859..554380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2273 type IV pilus assembly protein
FT                   PilX"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66299"
FT                   /db_xref="GOA:A8ZTN5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN5"
FT                   /protein_id="ABW66299.1"
FT                   /translation="MIIRKEAVVKTAFDNLKNQNGSVLALVLMVMVTILIIGITAIHDT
FT                   AIEGKISRNSTIRSISFYRAEAAAREAIQLLENSNTPLTDLIPGSGSAFAWIQDVGFDV
FT                   QADAGASAINSGLVSNAQYLVVYDGFAEEGEMGMEEDTHLYEYIIYGRGFYDVRDQSDC
FT                   TLQMAYRRRF"
FT   gene            554441..559078
FT                   /locus_tag="Dole_0490"
FT   CDS_pept        554441..559078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0490"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: neu:NE1747
FT                   putative type 4 fimbrial biogenesis protein PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66300"
FT                   /db_xref="GOA:A8ZTN6"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR021655"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN6"
FT                   /protein_id="ABW66300.1"
FT                   /translation="MNRNIIKCDGKTGPGRAVRTVVCLFVLLLVMSFSAVGAWAGDFGR
FT                   NQDAGDTADRARRYSLDFSGSGQNDEWDWDYDWIKFSLDQTAEVTFTLTNDSRYSYLRV
FT                   TNGATDLLGDWVAANTTQVLTLSPGLYYVCVAAYPNGIFTRTRYTLSISAVYGTACYLD
FT                   ADGDGYGDPTDVIYNASCPAGRVANDDDCDDTDPAKWSGALDICDGIDNDCDGDVDEDC
FT                   ATYYRDTDGDGYGDPGHTASAPAAGFVTLSGDCDDTNSAINPGATEVCDGIDNNCDGAV
FT                   DDINLWYYLDEDGDGYGDPAGELKPCSLTGYEGYVDNGLDCDDFDAAIHPGATEICNNL
FT                   DDNCDGAIDEGLPVVTYYYDQDGDGWGIPTNSQSGCTPPSGNYVEADDADGDGTDDFDC
FT                   NDENPRIHPGAFDPCNTTIDENCANGMDDCEESPAGCANLADYPLETRAISANPMVEFL
FT                   FDDSGSMAWEVMHKGTYNGKFYYQYYYRGVRSASVSDVFNTTSSTDRSFYQTQCADENS
FT                   LYYNPEYSYVPWPGHTPADPDRPKKSPDSSDTITMNDNFSSIGISNAHYFVKDGGNVYL
FT                   VDLDSSGVRYYTVSYETGSYYYGRVNSVSLIGSAPTGVNIGSLAEARQNFANWFQFYRT
FT                   RQNTAKASILQVVNSLSGVKIGVHTINGNNSITIPNTGMLSVDDNKATILGYIEDVGAY
FT                   SGTPLRLGLKAVGNFFAGDYSGVDSPYSTVAAGGECQAAFAIVMTDGYYNGSNPGIGNA
FT                   DADDANNDFDGPPFADSYSDTLADVAMYFYKNDLRDDLADAVPTNEYDQATHQHLVTYG
FT                   VCFGLVGTEDPADYPNCPAGGTGACPDPWPSPGTDEGPGRIDNLYHAAINGRGKFISAS
FT                   NPLQLVEAIRAIMDDVVARRGSGASVAVSTQSLKEDTLLFQGSYDSAGWKGDLRAYSIS
FT                   MMTGLINPNHVWSAAAGLDALTDTEAKARNIFTYDGSTGVAFSYDNLSEDQQSSLGETE
FT                   TDQRLVVDFIKGDRSKEQNNENGLFRIRRSRMGDIVHSAPVHVGDTIYVGGNDGMLYAF
FT                   NALTGAERFAYIPEHLYPYSKLYKLADPNYIHKFYVDNTTFVRNDLLVCGLGRGAKGYF
FT                   ALDVSNPSGFTASDVLWEYPAVTYDGTESDPDMGYTFSRPAVVPCGAYGDVLIFGNGYS
FT                   STNQEAVLYVIDIDDTDGSFEESDVKKIYTGVGSTGTGVCNGLSTPTLIDTDQDGDLDI
FT                   VYAGDLQGNLWKFDLSGTKDTWAVACKDSSGNPKPLFQAKDESGNVQPITTKPAVTKHC
FT                   AGLGYMVAFGTGQFMAEGDFADMSTQALYGIWDWENAWAAADDELSADQLDRMHYGYLR
FT                   APSSGVRLFSEIEASGMFASPNPEVSLTLVKQSQVSLSSSERVTSENDVNWFSPDKWVA
FT                   QREAGETPYSGGQHVGWYLEFPSGGGERVISDPQIRSSKTGNLLIFMSLVPSIEVCRAG
FT                   GYSIFNVLDACTGKWEKGVVLDDIYYKPPIIDPPEPPPPLDDDDDNDDGYIGDPDSSLV
FT                   PYDPGNPPETIEGEKKGMVFWRFIM"
FT   gene            559149..559484
FT                   /locus_tag="Dole_0491"
FT   CDS_pept        559149..559484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66301"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN7"
FT                   /protein_id="ABW66301.1"
FT                   /translation="MKTNWRVFGIALACLVVLVLVSGLPGSAGQNDLAAEDVQEIVAQE
FT                   TGNQGRILSVGDGSVNIDDVEYFFSGNTRFYSATGKTLSPSSFRTGSLVRFLLDTPSTI
FT                   GVMIKLK"
FT   gene            complement(559555..560400)
FT                   /locus_tag="Dole_0492"
FT   CDS_pept        complement(559555..560400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0492"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rba:RB12347 similar to hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66302"
FT                   /db_xref="GOA:A8ZTN8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN8"
FT                   /protein_id="ABW66302.1"
FT                   /translation="MNRFYKICADRLLAPMVPVPTPMAPRGGPAHPVLAVLFDIYGTLF
FT                   ISAAGDTGQQTQHPRTGPLLQEVLKDANLHFPAAVSLALAREIQNAHAQKKADGIDFPE
FT                   IEIDRLWQKVLNTDDLQAARNAAFAHEMTTNPVWPMPGLEKLTEKIEQKKLAAGIVSNA
FT                   QFYTPLLFEYFSGCAPEASWALPDLVFYSYRHGVAKPSPHLFDLAARALEKRGILPHQT
FT                   LFVGNDMKKDMAPARAVGFQTVLFAGDARSLRLHASDPCCKNFYPDMVITDLAQLADAL
FT                   "
FT   gene            complement(560397..561797)
FT                   /locus_tag="Dole_0493"
FT   CDS_pept        complement(560397..561797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB5546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66303"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN9"
FT                   /protein_id="ABW66303.1"
FT                   /translation="MKIAVLHYHLKPGGVTTVIDRQVAALKNDLDFLVISGQAPDRPLA
FT                   VKTEVVADIGYDRPDTPACTDPAAGADRILAAIRRHWPNGCDLIHVHNPLLAKNRHFLR
FT                   ILAALEERGARLLLHVHDFAEDGRPGAWFADDPYPKKSHFCVINSRDKSILIQAGADAA
FT                   GVHLTPNMVTPLPAAPAPAFVENMALYPVRALRRKNIGEALLLSLFFPGRETVAITLGP
FT                   NSPSDIAPYNQWKTFARDNGLKVRFEASVGQDFAGLVAGSAFIITTSITEGFGFSFLEP
FT                   WTAGKTLWGRKLPDICADFEGAGLDLGHLYAAVNIPVEWIGKAVLAEKIKQAVKKSCLA
FT                   FGLAPATRLDHFTTLADAAFIDFGRLDEAMQQQVLARLMASNAAKETVSAVNPWLNSMG
FT                   TRVDESHIEQNRNAVQAGFNSAVCAGRLLSAYRAAMSVEVAHNIDKAALVDRFFCPETF
FT                   SLLKWGAP"
FT   gene            complement(562038..562634)
FT                   /locus_tag="Dole_0494"
FT   CDS_pept        complement(562038..562634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0837 metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66304"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP0"
FT                   /protein_id="ABW66304.1"
FT                   /translation="MFFKQIILDGSGALSYFIGCPKARKACVVNPKKDIEEYMDTAAQF
FT                   GMQITDIIETAGFEARKSGAVELAGVTGASVWFLEAQEKTSGKVAKTGALFRFGDAEVK
FT                   VVRESRYTPFAKSLLVIDQAKPDKPWLVLTRRSLCADSRLNEAFAGKNMADELVDTIDF
FT                   YNTDTRDGITDNIASLARSLFHTSRADIARMSLPA"
FT   gene            562967..564208
FT                   /locus_tag="Dole_0495"
FT   CDS_pept        562967..564208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0495"
FT                   /product="Ste24 endopeptidase"
FT                   /EC_number="3.4.24.84"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: cph:Cpha266_1902
FT                   STE24 endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66305"
FT                   /db_xref="GOA:A8ZTP1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP1"
FT                   /protein_id="ABW66305.1"
FT                   /translation="MTGIGWIILVLLCVHYGVERLADLLNLRALSRKVPPSFAGWYDPD
FT                   RHAKSRAYLKNTTGLAMVEASVDLAILLAFWSARGFSFLDRWVSGLGFSPIVSGLVFIG
FT                   VLVSARAVFSLPFSIYSTFVIEERFGFNRTTWPLFLSDRIKSLFLALLLGAPLLTGLLW
FT                   FFENLGKTAWLWCWIGFCLVVLVLQVVVPAWILPLFNRFTPLEPGDLKNAVLACARAAG
FT                   FPVQTVFVMDGSKRSAKSNAFFAGLGRHRRLVLFDTLIDNHPVFEVVAVVAHEIGHYKK
FT                   RHLQWQTLAAMGQAGVMFFLLSVAVSWPDLFTAFYVSNVSVYGGLVFFSILYGPVAWAL
FT                   GLPVQALSRHHEYQADAFAVNLTGNGPALADALKRLSADNMANLTPHPFYVLLHYSHPP
FT                   VIDRVQAIEKHEGH"
FT   gene            complement(564444..565130)
FT                   /locus_tag="Dole_0496"
FT   CDS_pept        complement(564444..565130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0496"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: gme:Gmet_3075 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66306"
FT                   /db_xref="GOA:A8ZTP2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP2"
FT                   /protein_id="ABW66306.1"
FT                   /translation="MTADSRRAVVLSSGGIDSTTAMAMAVSQGFSVFSLTFDYGQRHRH
FT                   ELSAARAVARHLNAEKHLVLETDFRKIGGSALTADIPVPGTGPVENTIPVTYVPARNTI
FT                   FLAYALAWAETLDAADIFIGVNAVDYSGYPDCRPEYIEAFARVANLGSKAGVEGRITFA
FT                   VHTPLIHMTKAEIIRTGAALGVDYSITSSCYDPSPEGLACGLCDSCRIRKKGFVDAGLP
FT                   DPTRYV"
FT   gene            complement(565127..565765)
FT                   /locus_tag="Dole_0497"
FT   CDS_pept        complement(565127..565765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0497"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sat:SYN_01560 queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66307"
FT                   /db_xref="GOA:A8ZTP3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP3"
FT                   /protein_id="ABW66307.1"
FT                   /translation="MSLHVSELFFSIQGESLDAGLACAFVRLAGCNLCCAYCDTAYARQ
FT                   GGTPMEIPEILDRVARFGCSLVEITGGEPLLQKETPLLIQRLLSVGYRVLLETNGTQNI
FT                   GLVDKSCIRIVDVKCPSSGESEKNDARNLDRLAAHDQVKFVISDRTDYLFAKKTAGRIT
FT                   AVAPGHILFSTVHGVLDPAQLAHWMLADGLPVRLHLQLHKILWGEARGK"
FT   gene            complement(566635..566720)
FT                   /locus_tag="Dole_R0008"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(566635..566720)
FT                   /locus_tag="Dole_R0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(566726..567061)
FT                   /locus_tag="Dole_0498"
FT   CDS_pept        complement(566726..567061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0498"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: gme:Gmet_1949
FT                   preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66308"
FT                   /db_xref="GOA:A8ZTP4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP4"
FT                   /protein_id="ABW66308.1"
FT                   /translation="MTILITIIHVIVCFALILIVLLQTGKGAGMGATFGGGGSQTLFGS
FT                   TGGSTFLSKATTGAAVVFMVTCLSLAYVSTHRQPASIMEGEKIPATQPAPEQTLPPDAP
FT                   AGEPAAD"
FT   gene            complement(567084..567839)
FT                   /locus_tag="Dole_0499"
FT   CDS_pept        complement(567084..567839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0499"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: gsu:GSU1628
FT                   phosphoglycerate kinase/triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66309"
FT                   /db_xref="GOA:A8ZTP5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP5"
FT                   /protein_id="ABW66309.1"
FT                   /translation="MTARTPLIAGNWKMHKTGDEAGDTAADLARRIAGVTGREVMIAPP
FT                   FTALAAVKIAIAGSIIGLGGQNLHWESSGAFTGEISGPMLTAAGCTHVIIGHSERRQFF
FT                   GETDETVNKKIQAARAANLVPVMCIGETEAQREAEQTFSVLDKQIRNGLQGFALQDISD
FT                   LVLAYEPVWAIGTGKTASREQAQEAHAFIRSVVEKLFGGPAAAAMRILYGGSVKPSNIA
FT                   DLMAMDDIDGALVGGASLEAATFADIVTY"
FT   gene            complement(568105..569109)
FT                   /locus_tag="Dole_0500"
FT   CDS_pept        complement(568105..569109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0500"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: gka:GK3058 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66310"
FT                   /db_xref="GOA:A8ZTP6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP6"
FT                   /protein_id="ABW66310.1"
FT                   /translation="MTIRLGINGFGRIGRMVFRAAMNHPQVKVVAINDLSDAETIAHLL
FT                   AFDSVHGRFGHTVKAGENSIIVDGETIPVFAVKDPAKLGWRDVNAGIVAECTGIFRDRD
FT                   GASKHLEAGARKVIISAPAKEPDITIVMGVNSTSYDPRKHHIISNASCTTNCLAPVAKV
FT                   IHEKFGIQAGLMTTIHSYTGDQRLLDFPHKDLRRARAAALSMIPTTTGAAKAVALVLPE
FT                   LAGKMTGLAIRVPTPNVSIVDFVATVNASGVTASDVNAALKAASENELAGILGYSDLPL
FT                   VSSDFNGSALSSIVDALTTDVMGNMVKVLSWYDNETGYSTRMVDLAAMIGESL"
FT   gene            complement(569111..569581)
FT                   /locus_tag="Dole_0501"
FT   CDS_pept        complement(569111..569581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0501"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: sat:SYN_02847 acetyltransferase GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66311"
FT                   /db_xref="GOA:A8ZTP7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP7"
FT                   /protein_id="ABW66311.1"
FT                   /translation="MANDLPLFYTSGITPADIPAITAIETDCFKDPWSMAAVALELSAS
FT                   HAGGMTARCAATHHIAAYIFFRRVLDEMHILKVATARPWQRRHGAWLLMDEAIRRARKM
FT                   GLRQVFLEVRASNIAAIKLYEKTGFTVAGRRPGYYYDDNDDAIMMIHNLKEA"
FT   gene            complement(569571..569987)
FT                   /locus_tag="Dole_0502"
FT   CDS_pept        complement(569571..569987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0502"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: sat:SYN_02844 pts system fructose IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66312"
FT                   /db_xref="GOA:A8ZTP8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP8"
FT                   /protein_id="ABW66312.1"
FT                   /translation="MIGILIVTHEKLGDALIEAAQFILGSKPEKLAAVSIDLNENADKL
FT                   RKKIADGIKTVKGENGVLILTDMFGGSPSNLSYSFLEEGQVEVLSGVNLPILIKAIRIR
FT                   QDMPLADLILTVEAFGKKSISIASSILKGNKRGE"
FT   gene            complement(569984..570865)
FT                   /locus_tag="Dole_0503"
FT   CDS_pept        complement(569984..570865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00941 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66313"
FT                   /db_xref="GOA:A8ZTP9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTP9"
FT                   /protein_id="ABW66313.1"
FT                   /translation="MRNFIIHILTGLSGSGKSTALDVFEDAGFYCVDNMPVALLPKFLE
FT                   IPVNTASGISGLAFVMDLREPDFLATYPSVFNDLKAQGYRLTVLFFEAGENVLIQRYSQ
FT                   TRRHHPLAGDKGLVSGIRRERELLEELRASSDTVIDTSTLTIHELKIRLLARIRKSADH
FT                   MPMRIHVMSFGYKYGIPHDADIIMDVRFLPNPYFVDPLKHKNGTDADVAAHVLNHSTGS
FT                   AFLEKFLNLIDFLLPLYKNEPKAYLTVAVGCTGGCHRSVAVATAVFNHMKKREERHVEI
FT                   SHRDLKEAGQTT"
FT   gene            complement(570872..571330)
FT                   /locus_tag="Dole_0504"
FT   CDS_pept        complement(570872..571330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0504"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: pca:Pcar_1936 PTS
FT                   system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66314"
FT                   /db_xref="GOA:A8ZTQ0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ0"
FT                   /protein_id="ABW66314.1"
FT                   /translation="MKLLDVLRKEAVLVNLEARDKKGVLEELTVPAAKISGIEHSKLVR
FT                   MLMERERLGTTGIGGGIGIPHGKLKELGTVILCAGLSRKGVDFDAMDGRPVHIFFLLFT
FT                   PEGSTELHLMLLSRISKLLKNDIFRQRLADAQDADTVLEIIEEYDEEP"
FT   gene            complement(571510..571845)
FT                   /locus_tag="Dole_0505"
FT   CDS_pept        complement(571510..571845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0505"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   gsu:GSU1886 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66315"
FT                   /db_xref="GOA:A8ZTQ1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ1"
FT                   /protein_id="ABW66315.1"
FT                   /translation="MQVTVTFKNLEASEHLKQFVSEKLNKFDRLFDSPAKAEVLLSVEK
FT                   FRNIAEINLTGDKLNIIGKEETEDMYAAIDLVMDKIEKQIKKNKQKIKQHRPATRKAAK
FT                   REDTDLP"
FT   gene            complement(571857..573299)
FT                   /locus_tag="Dole_0506"
FT   CDS_pept        complement(571857..573299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0506"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ade:Adeh_4167
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66316"
FT                   /db_xref="GOA:A8ZTQ2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ2"
FT                   /protein_id="ABW66316.1"
FT                   /translation="MALDLRQHLKLSQQLVMTPQLQMAIRLLQLNRLEMVDMIQQELSE
FT                   NPALEEAPETAPEDELSTDDREAEALPERVEAEKEVSIEEKISDQVEWENYLNEYNSYG
FT                   GVQFESEAREQPQYESFVASHKSLKDHLLWQFLMTLPTGQEEAIASLIVGNVDDDGYLK
FT                   ADVAEIAATANAPIEQVETILAMLQNFDPPGVCARTLAECLLIQARQLGIDTPVIAGIL
FT                   NNHMKHLESKNYKVIARALKTDTEEIVAAVNLIRTLEPRPGRSFKQEDAGYIIPDIYVH
FT                   KFENDFVIVLNDDDLPRLHISPYYRQAMRGRAAGSKEAKEYLQEKIRSATWLIKSIQQR
FT                   QKTIYAVMNSILKFQRDFFEKGVAHLRPMILRDVAEDIGMHESTISRVTTNKYAHTPQG
FT                   IFELKYFFNSAINRTGADSMASVSVQDKIRQIIKNENPKKPFSDDKIADILKAANINIA
FT                   RRTVTKYREAMGILSSTKRKQF"
FT   gene            complement(573301..574023)
FT                   /locus_tag="Dole_0507"
FT   CDS_pept        complement(573301..574023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0507"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gur:Gura_2973 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66317"
FT                   /db_xref="GOA:A8ZTQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ3"
FT                   /protein_id="ABW66317.1"
FT                   /translation="MAVLYLRELVKHYSGRPVVNAVSLELESGQVAGLLGPNGAGKTTT
FT                   FYMTVGMIRPDSGAIAVDSDDITGDPMHIRARKGIGYLPQESSVFKKLTVEQNIRAVLE
FT                   YLGLPVAQQVERTHTLLEELGIERLSGQRAGLLSGGERRRLEICRVLATNPAFVLLDEP
FT                   FAGIDPLAVADIQSIIQHLTDRGLGVLVSDHNVRETLGVCDKAYILNNGQIIEAGTPQV
FT                   IAESKTAKSIYLGEGFRL"
FT   gene            complement(574038..574634)
FT                   /locus_tag="Dole_0508"
FT   CDS_pept        complement(574038..574634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0508"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: ppd:Ppro_0972 OstA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66318"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU06"
FT                   /protein_id="ABW66318.1"
FT                   /translation="MPAIETGIWNTMKIQTGLLTICFLVFPALFASADTPPPPQDDAKA
FT                   IHISADRLVSESRADYAEFTGNVRAVGEKFDIQADTLQVFYSPAPDTQAPGTANRLDTG
FT                   TGKTVREIIATGNVTILFDDKVAKTDQAVYSRESGRVVLMGPGSTVTGKSGRISGDTIT
FT                   LHTETESVTVISGGETRVQAVIHPDGSKNDDQTEK"
FT   gene            complement(574634..575206)
FT                   /locus_tag="Dole_0509"
FT   CDS_pept        complement(574634..575206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0509"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   afw:Anae109_4315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66319"
FT                   /db_xref="GOA:A8ZU07"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU07"
FT                   /protein_id="ABW66319.1"
FT                   /translation="MRYTRPISLFLMITVFAALGAVIYLLVQSRPLSVPPAATEQADTG
FT                   VDISMTGVSQTFVQEGRISHTLTADTASLLARDKKAVFENVTLTFLAEDGTPSVVTAKQ
FT                   GELSTETGDATLSGGVVVENRARKIYAQTLHYNDNRHILYSVEPVVVTGDSFRFTGNSM
FT                   TFDMTSGKAVLSGNVTGRITDDALALQ"
FT   gene            complement(575231..575755)
FT                   /locus_tag="Dole_0510"
FT   CDS_pept        complement(575231..575755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0510"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: sgl:SG0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66320"
FT                   /db_xref="GOA:A8ZU08"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU08"
FT                   /protein_id="ABW66320.1"
FT                   /translation="MHDIDLSLFEPICLLLLDVDGVLTDGTLFYTETDTETKAFSVKDG
FT                   LGLRMLVRSGIDVGIVTGRSSDALNRRCKELGITTVYDNVKDKAACLEAILARCRVQAG
FT                   QTAFMGDDLPDIPLMKRAGLAIAVADAHPAVKSTAAFVTRAPGGRGAVREVCEHILHAR
FT                   GLWKTAAGKFL"
FT   gene            complement(575748..576587)
FT                   /locus_tag="Dole_0511"
FT   CDS_pept        complement(575748..576587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0511"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: ppd:Ppro_1615
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66321"
FT                   /db_xref="GOA:A8ZU09"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU09"
FT                   /protein_id="ABW66321.1"
FT                   /translation="MTDTIVLNDISIGGGAPLVVIAGPCVIEDYDTTLQAAEFLKTVTD
FT                   RLGIPFIFKASYDKANRSSVHSFRGPGPDLGLDILRRVKERLHVPVLSDVHTESQIGPA
FT                   AQVLDIIQTPAFLCRQTDFITAVAATGKIINIKKGQFLAPWDITQVVEKARTAGNENIL
FT                   ITERGAMFGYNNLVVDFRAIPIMQQQTGKPVIFDATHSVQLPGGQGTCSGGQREFVPCL
FT                   ARAAVAAGADGIFLEVHRNPDKALCDGPNSLPLEQVEPLLTALVAIRQAATEQAGHA"
FT   gene            576902..578263
FT                   /locus_tag="Dole_0512"
FT   CDS_pept        576902..578263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0512"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: dvl:Dvul_1311 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66322"
FT                   /db_xref="GOA:A8ZU10"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU10"
FT                   /protein_id="ABW66322.1"
FT                   /translation="MRSKSDGKSRAWPIILMLMLAAGAVALLILFFPRLEGKAPVVAFS
FT                   DFNPAIGTSSSFTVSVSDDKSGLRHVWMALLVDGREVVLADESYTAPVSEKDFNLTIEP
FT                   GAMDLPDGPALLRISVTDNAARNWLKGNLTYLEQAVTIDTRKPDVSVISRQHYVNQGGA
FT                   GLVVYRVAEPGTTHGVLVGDNFFPGHQGVFSDKTLCLALFAVDHRQGKDTPLLVSATDA
FT                   AGNTAKTGFYYLIKPKTFPKDVLTISDTFLNLKMPEFDLPEEPASLLDKFVTINSAERK
FT                   RNVEKIVSLCRTSDSALHWKGDFIRLPNAAPRAGFADQREYVYNGKTVSHSVHMGIDLA
FT                   SLANAEVPAANAGRVVFADWIGIFGKTVVIDHGCGLFSMYSHLSTMDVTPGKMVERGTP
FT                   IGRTGMTGMAAGDHLHFGMMVHGTFVNPLEWWDAAWITNNITSKIEAVADLPRL"
FT   gene            578308..578958
FT                   /locus_tag="Dole_0513"
FT   CDS_pept        578308..578958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0513"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: dps:DP0107 related to signal peptidase I;
FT                   TIGRFAM: signal peptidase I; PFAM: peptidase S24 and S26
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66323"
FT                   /db_xref="GOA:A8ZU11"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU11"
FT                   /protein_id="ABW66323.1"
FT                   /translation="MTGEETRASTEEKRSDGRSSLRENVEAVLVAVLLALFIRTFAVQA
FT                   FKIPSGSMIPTLQIGDHILVNKFVYGLEVPLLRMPLFDGKDPARGDVIVFKYPEDPQKD
FT                   FIKRVVAVGGDVVDIQNKKVYVNGELLPDAYAIHTDARMVPVRDNLGPIHVPEGKLFVL
FT                   GDNRDNSHDSRFWKFVDMEAVRGKAFIIYWSWNDRPSGVTDRVRWGRIGRMLR"
FT   gene            578968..579903
FT                   /locus_tag="Dole_0514"
FT   CDS_pept        578968..579903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0514"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: sfu:Sfum_2090 aspartate carbamoyltransferase;
FT                   TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66324"
FT                   /db_xref="GOA:A8ZU12"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU12"
FT                   /protein_id="ABW66324.1"
FT                   /translation="MGLSTRDILDMGSLSRKDISLVLDTARSMKEISLRPVKKVPTLRG
FT                   KTVVSFFYEPSTRTKVSFDVAAKRLSADSISLSVATSSMTKGETLLDTVKNLERMSPDV
FT                   VVIRHSSAGVPHMLARHVSVPVINAGDGMHAHPSQALLDMMTVQEKKGRIEGLRLAIIG
FT                   DIARSRVARSNVEGFLKMGASVVLAAPPTMIPVGVETFGADVTHNVDEAIAGADVIMML
FT                   RIQKERAAAFLFSTVREYARTYGLTANRLKNAKKDVLIMHPGPVNRGVEIAPEVADGPY
FT                   SVILDQVENGVAVRMALFYLVMGGQRDAGD"
FT   gene            579890..581179
FT                   /locus_tag="Dole_0515"
FT   CDS_pept        579890..581179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0515"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: sat:SYN_01533 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, multifunctional complex type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66325"
FT                   /db_xref="GOA:A8ZU13"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU13"
FT                   /protein_id="ABW66325.1"
FT                   /translation="MLVIKGGRVIDPGVRDGIYDIVIADGKIRGIVESATGAVPAEGVS
FT                   RWIDASGKIVAPGLIDMHVHFREPGYEYKETIATGCAAAARGGFAAVCPMPNTDPVNDH
FT                   AQVCEFVRGRAKACGVGVKVWPVGAVSVGQAGKELAEFGELKAAGAVALSDDGHPVSDG
FT                   QLMRRALEYARGFGLPVISHCEELSLVGPGVMNEGAFAARLGLAGIPNAAESVMVCRDV
FT                   ALCELTGAALHIAHVSTAESVRIVREAKKRGVPVTAETAPHFFMLTDEAVGLYDTSAKV
FT                   NPPLRSMADREAIREGLADGTIDVIACDHAPHSVLEKEVEFDAAANGISGIETSLGLCL
FT                   SLVNDNVLSMAGLIDKMSMAPARILGKPWGLKEGSPAHITIIAPDSPWVVNAKTFFSLG
FT                   KNTPFDGWELSGRAVMTIADGRVIFDGLTA"
FT   gene            581241..582647
FT                   /locus_tag="Dole_0516"
FT   CDS_pept        581241..582647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0516"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: sfu:Sfum_2092
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66326"
FT                   /db_xref="GOA:A8ZU14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU14"
FT                   /protein_id="ABW66326.1"
FT                   /translation="MAGAKANILVVDDELSMRELLDVMLSREGYKVACAEDGTQALSML
FT                   GEMKFDLVLCDVRLGDMSGIDVLKAAKKANHDTVVIMISAYATTEVAVAAMNEGAYDFV
FT                   PKPLDSAELKQTIIRSLSLRTVEQERQALDNSLEDHLYFERIVGSHPKMKHIYNMVRQV
FT                   AQTRTRILITGESGTGKELIARAIHEQSDRANHPFVVVNCGGIPENLMESELFGHRKGS
FT                   FTGAVMDKKGLFTIAHKGTIFLDEIGELSMPLQVKLLRVVQDGAFKQVGGTEEISVDAR
FT                   ILSATNKNLSQEVIDGNFREDLFYRLNVIELNVPPLRERKSDIRVLAQFFVEKFSKDLG
FT                   KEVIKLSSYALDMLEKYSFPGNVRELENLIERSVALSTTNIILPESLSLAVHKRRWIEG
FT                   VPGRRFDLEEVTKGVALDEILADIERAYLKKALESSGGNKNRAAELLGISFRSFRYRLD
FT                   KLNVPWDEEE"
FT   gene            583148..583603
FT                   /locus_tag="Dole_0517"
FT   CDS_pept        583148..583603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0517"
FT                   /product="tfp pilus assembly protein, major pilin"
FT                   /note="KEGG: sat:SYN_00814 tfp pilus assembly protein,
FT                   major pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66327"
FT                   /db_xref="GOA:A8ZU15"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU15"
FT                   /protein_id="ABW66327.1"
FT                   /translation="MLRKMRAKVTLGTQGFTLIELMIVIAIIGILAAIAIPNFIAYRNK
FT                   TFCSATESDANSIASAIADYFSIPANVSVTDGSLESDANGKTYVGTELSNGNTWDVDAT
FT                   NMDNIVIEVTDVSGRCPDDYQTAMDATVSPRGYWDGNSLYVKSMTME"
FT   gene            583988..585619
FT                   /locus_tag="Dole_0518"
FT   CDS_pept        583988..585619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0518"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase protein"
FT                   /note="KEGG: sat:SYN_00815
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66328"
FT                   /db_xref="GOA:A8ZU16"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU16"
FT                   /protein_id="ABW66328.1"
FT                   /translation="MLATGCIVILASVPPVSRDALIHHLAVPKMYLRHGGLYEIASMHF
FT                   SYFPMNMDLLYLVPLYFKIDIAAKYVHFLFALFCAGLIYRYLRQTLNRNYGLLGALFFL
FT                   TLPVIVKLSVTVYVDLGLIFFSWASLYLIIQWHDAGFPPRRLILAGIACGLALGTKYNG
FT                   LLLLPILGTLIPILYASEKNRAVFHENFRLRYKNAFAGLGWSAIFIVIALILFSPWMIR
FT                   NMVWKGNPVYPLYNSVFNPPAQPVFSETVEKEETPAKNAFWMRRHVYKESFWQTLSIPV
FT                   RAFFQGQDDNPRYFDGRLNPFLLLLSLAAFIRARQPCFPAFTTHRTVLALFALLFILFV
FT                   LFQTDFRIRYMGPAIPPLVVLSVFGIRNLSDLASRQTGAIKKAGQAAVTAVVLLALFLN
FT                   GHYVYSQFSHIRPQDYLSGAVDRGAYISRFRREYPVIAHANKVLPADARVLCLSIGDRT
FT                   YYLDRDLHLAEDFYDKTGGRYSEADVINKLTRYNTTHVIIDRGVLFDWLRTLPTEDRAV
FT                   FLNVFKNNTRVLYEENNVLLLELALQ"
FT   gene            585640..586812
FT                   /locus_tag="Dole_0519"
FT   CDS_pept        585640..586812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0519"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: DSBA oxidoreductase; Vitamin K epoxide
FT                   reductase; KEGG: afw:Anae109_3126 vitamin K epoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66329"
FT                   /db_xref="GOA:A8ZU17"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU17"
FT                   /protein_id="ABW66329.1"
FT                   /translation="MRARNFFKQGPPLAYGWYFIPVFVIALIGFGDSIYLAVSHYRNYV
FT                   DMGYQSFCAISRSLNCDTVSQSPYSIFLNVPVPVWGIFGYGFFLFLLGVAWHPTAGRKR
FT                   VWTLLFVISLAFSVYSVVLALISSYLIRSYCIMCILSYAVNLALLFYAWMIRKRFGCEP
FT                   FASALVLDIRHLLNFKKTTIPVAAVFGVVGLAMMLAFPDYWHLSPPPLSAQTRTGVTAE
FT                   GHPWIGAQHPKLEIVEFTDYMCFQCKKMHFFLRRLVDAHPDTLRLVHRHFPMDHEYNPF
FT                   VKEPFHVGAGKLSLIALYAQTQEKFWEANDLLFTLGKADIKLKDVLNPLGLEVTGLADA
FT                   LENRGLERVLRQDIHDGLRIGITATPCYVIGDYAYVGTIPANIINEAIRR"
FT   gene            586890..587945
FT                   /locus_tag="Dole_0520"
FT   CDS_pept        586890..587945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0520"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: lbj:LBJ_0629 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66330"
FT                   /db_xref="GOA:A8ZU18"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU18"
FT                   /protein_id="ABW66330.1"
FT                   /translation="MNVLVTGGCGFLGSHVCEYYARRGDQVVSYDNMTKHELERAGFAT
FT                   GKARNHNRDFLAGLGVDLVTADIRDAEQLIDSAAGCDYIVHTAAQPAMTISVEDPALDL
FT                   SSNVMGTFNVLETARRLKVPVASCATIHVYGNRINDTLTEGQARYARQPEAIDEDHPVL
FT                   EGTLTPLHASKAGAELYVRTYIETYGVTAASFRLTGIYGPRQFGGEDHGWVANFAIRSV
FT                   LKRPLTIYGTGKQVRDIVFAGDVCRAFDAFYQKRVPGIYNIGGGPNTAISLLECIALLE
FT                   KLNGEKPDIRFGPDRHGDLRYFVCDVSKARSLLGWRPEVKPEPGIRALLEWIRQNRKCF
FT                   GFTTESKGSLS"
FT   gene            587942..588670
FT                   /locus_tag="Dole_0521"
FT   CDS_pept        587942..588670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0521"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: hwa:HQ3507A
FT                   sugar nucleotidyltransferase II (probable
FT                   glucose-1-phosphate thymidylyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66331"
FT                   /db_xref="GOA:A8ZU19"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU19"
FT                   /protein_id="ABW66331.1"
FT                   /translation="MKALILAGGRGNRINEFSENRNKCMALLKGRPLLEHVLLRMAPED
FT                   LSELVVVVGYKATEIINHFGIRYQDKRIRYVLQKEQKGLVHAMGCAKAALEGEDFFLAL
FT                   GDEVLTSDRCSDMIRMFKGDPNPFGVCGIVKVENCDQIRKTYAVVKDEQNRIFRLIEKP
FT                   IRPINDFQGTGHCIFNNRILDYIDITPFHHERREKELPDLVQCSIDDGKTVRAFPVCDR
FT                   YVNINSVEDLDVAESLLKDE"
FT   gene            588680..589816
FT                   /locus_tag="Dole_0522"
FT   CDS_pept        588680..589816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0522"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sfu:Sfum_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66332"
FT                   /db_xref="GOA:A8ZU20"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU20"
FT                   /protein_id="ABW66332.1"
FT                   /translation="MRQSKENITTVLLTATSYPRDTQDWRGRFLADMVEALSGRPAVSL
FT                   RTWLPPGILPAGVTTAALPEEARFLEALSEAGGIAHILRSEKLKGIPWALKLLRHLRAV
FT                   YQRESHVSVMHVNWLQNAIPLWGSHTPALITVLGTDYKLLTLPGMVSLLRTVIRQRKTI
FT                   IAPNAHWMQAPLEEKFGDIAQIRPIPFGVQRRWFDIQRQFSGQGINRWLVVSRLTANKI
FT                   GPLFEWGRDVFDAENELCLLGPNQENLPVPEWVTYGGATYPEDLERKWFPSAAGLVTLS
FT                   RHDEGRPQVILEAMATGLPVIASDMAAHRDVVIHKKTGWIVTTPDDLRQAINFMSVPEN
FT                   NRRMGEAAKIWVKEHIGTWEDCAMRYEAAYADLTGKVS"
FT   gene            589813..590730
FT                   /locus_tag="Dole_0523"
FT   CDS_pept        589813..590730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0523"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: sfu:Sfum_0803 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66333"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU21"
FT                   /protein_id="ABW66333.1"
FT                   /translation="MKHPTVLLLGGGGFIGRALAGHLCRTGGPVHVVGRNPVKNFEGGA
FT                   VFHQGSMADRSLLESILPQCDVVIHLASATTPGSSAGRPLAEADTNILPTLKLLDMFRD
FT                   CGNRWMIFVSSGGTLYGNPETVPVNESQPLCPLSYHGAGKIAIEAFLHAFAHDSGKHVT
FT                   ILRPANVYGPGQPLSQGFGFIRTVLEHARMDTEVKIWGDGSTVRDFLYIEDMIKGIESV
FT                   MNADPHTDTYNIGSGEGHSLNNVIKTVEKVCGRPLKVQYSTARQVDVRKIVLDCSKIME
FT                   KTGWKPETSLEEGVRLTWQWMLHQ"
FT   gene            590753..591793
FT                   /locus_tag="Dole_0524"
FT   CDS_pept        590753..591793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0524"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sfu:Sfum_0130 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66334"
FT                   /db_xref="GOA:A8ZU22"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU22"
FT                   /protein_id="ABW66334.1"
FT                   /translation="MSGPMDEVFHQDIVCSVCIANYNGANVLAACLDSVFQQAFPYPFE
FT                   VIVHDDASTDGSAGIVAEKYPTVRLLQSRTNVGFCVSNNRMAAVARGRFILLLNNDAEL
FT                   HRDAFATLYDVAVRQNVYGILGLPQYSMATGELIDRGSLLDIFCNPVPNLNPSRRDVGM
FT                   VIGACLWLPRHLWQELGGFPEWFESLAEDMYLCCYARVKGYPVIALAASGFNHWVGESF
FT                   GGGKVVGRTLQTTYRRRTRSERNKTYVMLLCYPAPLAQVLVPLHLLLLAVEGLLLSAFK
FT                   KDARIWKEIYWPCLLALWRRRHMLMRLRCEIQATRRASLKAFYSTHTFWPHKLTMLIKY
FT                   GLPILK"
FT   gene            591827..592684
FT                   /locus_tag="Dole_0525"
FT   CDS_pept        591827..592684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0525"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_3219 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66335"
FT                   /db_xref="GOA:A8ZU23"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU23"
FT                   /protein_id="ABW66335.1"
FT                   /translation="MEKADDIAGRGATPQQPLVSIITVVLNGADTLERAIKSVVSQTFR
FT                   DFEYIIIDGGSTDGTLDIIRRYESHLTCWISEPDKGLYDAMNKGVALSKGEWVYFLGAD
FT                   DYLLDGFTSAAARLKDGTTVYYGNVYRPVADRIYDGRFSFYKLACRNICHQSIFYPRCV
FT                   WKKFSYNLKYPVFADYDLNLRCFVDDGIQFKYIPDTIAVFTDEGGLSPRQADKAFEKDK
FT                   LDLIKATFPSRTHMLMLARTGLLKILAVLGLQKTATAIYHFFLKVRLVPAKGRSGTVKK
FT                   DEKG"
FT   gene            complement(592707..593600)
FT                   /locus_tag="Dole_0526"
FT   CDS_pept        complement(592707..593600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0526"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_3806 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66336"
FT                   /db_xref="GOA:A8ZU24"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU24"
FT                   /protein_id="ABW66336.1"
FT                   /translation="MQWPKISIVTPSFNQGRYLEATIDSVLSQGYPNLEYIIIDGGSTD
FT                   NSLEIIKKYAAYLHFWSSKPDEGHYFAVNKGFTKAGGDVFAWLNSDDMYCRDALKTVGT
FT                   IFADFPDVAWLTTLRQTVFNSRGQRISTKQMPGFSRQAFLDGLYVTKPFSGLGFIQQES
FT                   TFWRHELWEKVGGVRTAFSLAGDFDLWARFFSHADLYGVDHPLAGFRVHENNRSRGTDT
FT                   YIREAGQSLEEMRHRFNWPRGNGIASFWQGLKQAPPIRRLSNAFHIPWKNKYSAAVISK
FT                   AETNMEGRWQIKTVYF"
FT   gene            complement(593651..594388)
FT                   /locus_tag="Dole_0527"
FT   CDS_pept        complement(593651..594388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0527"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   syn:slr0907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66337"
FT                   /db_xref="GOA:A8ZU25"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU25"
FT                   /protein_id="ABW66337.1"
FT                   /translation="MNSIILRTVNMVNRILKPVGAKIISRQADDFNINSAIERIHDHGI
FT                   RIDSVVDIGGSNGTWSLKAMKVFPAASFVAIEPLVERKEELLRLVRRFPKFSFELCAAG
FT                   ETDGDTATLTIAQDLDGSTINGHGGETRRVPVRTIDAIVAKHNLSGSFLLKFDTHGYEL
FT                   PILKGAKQTLEKTSVIIMEVYNFQISQNALRFHKMCAHMENLGFRCYDMADPMLRDHDK
FT                   ALWQMDLFFCRKDEKIFDHPHYK"
FT   gene            complement(594428..595534)
FT                   /locus_tag="Dole_0528"
FT   CDS_pept        complement(594428..595534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0528"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mma:MM_0654 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66338"
FT                   /db_xref="GOA:A8ZU26"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU26"
FT                   /protein_id="ABW66338.1"
FT                   /translation="MNILYDYHIFHAQRHGGISRYFYELAKHLSAREDCSIEIFAPLHI
FT                   NEYLDLTSDIRLRGIKIKNYPFSGYIRRSINNALTRILITRRSDLDIFHETFYSGTDHR
FT                   PHSAKGLITVHDMIHEKFAEYFPGRDITTKIKAAAVNRADHVICVSENTRRDLIELLRV
FT                   PEEKTSVVYHGYSLSGATPAVYPITGRKPFILYVGHRDGYKNYQLLLRAYASSKSLRNE
FT                   VPIICFGGGEITAHEKDLMALLNLPPDCVQYMEGNDSVLAGLYASASVFVYPSLYEGFG
FT                   IPPLEAMALGCPVVCSNTGSIPEVVGNSARLFDPESESDLRSAMEEVVFSPEHAERLKA
FT                   KGFDRIKMFSWEKCAQDTLAVYKKVSGN"
FT   gene            complement(595556..596308)
FT                   /locus_tag="Dole_0529"
FT   CDS_pept        complement(595556..596308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66339"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU27"
FT                   /protein_id="ABW66339.1"
FT                   /translation="MSNPAVITLAELQGGLAGLDRLQIEDNIGEAIHLHIGPVRLDFTI
FT                   TDFLDLAEGMKKALDATGRFSPYTAEQFDPMFLLTCGSLLAHLEGIDIEERYIDDLRCI
FT                   VYRSRRLGIYTVKPVKQTPAYRFLATGDEKFLCYEQKSYLGMNNKERLVQVVANIENFG
FT                   YPREGRHIILFKGQSIVRDGQHRLAALRHRYGNMKIPVMVFRFSPKATTHLKPWQPYIG
FT                   IVFRLGRICGSRMNNRLKKINKFFKSPP"
FT   gene            complement(596310..596960)
FT                   /locus_tag="Dole_0530"
FT   CDS_pept        complement(596310..596960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU28"
FT                   /protein_id="ABW66340.1"
FT                   /translation="MNLIPASHILTFCSAMVDSGPPFRLLRNIDNELPDRLSSGKDIDI
FT                   LVRWQDSEKLEKWMPQAGFHRTPHPFQNEKFLYGVHPFRFYRNNNAPFIIDCHFELACR
FT                   SLNKGEWIPLDQTIQSQAWTSCGYHLVDGLHIPGLNPVCEWIHLLTRCVFDKRRFEKGY
FT                   IRRIDHLMARLNETEMLEISRLVFFKFSMSLLALLQTGRYTEIIREHLHFTDY"
FT   gene            complement(597174..598061)
FT                   /locus_tag="Dole_0531"
FT   CDS_pept        complement(597174..598061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0531"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66341"
FT                   /db_xref="GOA:A8ZU29"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU29"
FT                   /protein_id="ABW66341.1"
FT                   /translation="MPRRARQHLVSLYKNFFLSRKQWNVILDKEIRSIEKVHSPLYENT
FT                   CLHTAVVFDCSTASYRQWLTRAKSSFLNVRYPHKKALEFFFSAMLLNIQKDDIVLDAAG
FT                   GRSEYLSNIRNVVGCRNLYVNDQIYSTGNVKRGGVNFVGGDVTAIGLPDGAVTKIACHH
FT                   AVEHFRGDKDARFVLEISRLLKTGGRACILPLFIADRYAEVWNIKPESCYDQRAMCIED
FT                   PSSSLPGGKDDGHFARIYDSRALSERVLATADSASLRATIMECTLDGQAVPDMSLNFGS
FT                   RINRPLRALVLEKV"
FT   gene            complement(598178..599527)
FT                   /locus_tag="Dole_0532"
FT   CDS_pept        complement(598178..599527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0532"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; KEGG: lic:LIC12135
FT                   polysaccharide biosynthesis export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66342"
FT                   /db_xref="GOA:A8ZU30"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU30"
FT                   /protein_id="ABW66342.1"
FT                   /translation="MKIQSPLSYLPYGLRGRIEQSPDLMRILNNISWLFFDKFLRMGVG
FT                   LIVSIWVARYLGPEQFGLMSYAVAFVALFSVIAGLGFNGIAVRDLVQNPSETNTTMGTA
FT                   FALQALGGLFAFGLTMLTIGFVKPDDGMAKLAVSILAFLMVFNATDVVRYWFESQVQSK
FT                   YVVWTESGVFLFVSAVKIGLILAKAPLIAFIWVLFAQGLVIATGLIVIYSWRGGDIKAW
FT                   RPRLYRAKTLLSDSWPLILAGIAYLIYMRIDQIMLGQMVGNEAVGLYTAAVQISEVWYF
FT                   IPMTITASVFPFIIQAKKKSEDLYTQSLQKLFDLMVALACIVALPITLFADWIVTSLFG
FT                   LAYHLAGTALSIHIWAGIFFFLQAAGGKWFLIEGLQKHSFYRTLSGAVLNVGLNMVLIP
FT                   TMGIVGAAWATIASLACASVFFNALHKRTRPLFRMQCQSFFFINRLLKQK"
FT   gene            complement(599535..600086)
FT                   /locus_tag="Dole_0533"
FT   CDS_pept        complement(599535..600086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_0701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66343"
FT                   /db_xref="GOA:A8ZU31"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU31"
FT                   /protein_id="ABW66343.1"
FT                   /translation="MDTLFSGLISSKTRIRLLVRFFFNPEARSYLRELAKELDVSTNAV
FT                   REELNQLRKTGLLTSEKNGRSVIYAANTKHPLFPELKSMVGKFLGLDQLIESILTRLGD
FT                   LEKAYIIDDYAEGKDTGIIDLILVGNIDPYHLNDLSRKTERYIKRKIRTLVLTIEEFKS
FT                   FEPTLVTRPNLLVWTRQKQR"
FT   gene            complement(600321..601037)
FT                   /locus_tag="Dole_0534"
FT   CDS_pept        complement(600321..601037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0534"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   syx:SynWH7803_0193 glycosyltransferase of family GT2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66344"
FT                   /db_xref="GOA:A8ZU32"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU32"
FT                   /protein_id="ABW66344.1"
FT                   /translation="MTSGRTCSPDLLLSIIIPVYNEEETVQEVVERVLDVPYRKEVIIV
FT                   DDGSTDRTRQILSGLDAPEIKRVFHEKNCGKGRAIGTGLAHATGDILLIQDADLEYNPA
FT                   EYPVLLQPIFEGRADVVYGSRFAGSGTHRVLYFWHYMGNRFLTLLSNMFTDLNLTDMET
FT                   CYKVFTKKALEGITIEEPRFGFEPEITAKIAKKHLRIYEVPVSYYGRTYQEGKKIGWRD
FT                   GVRAIWVIVKYNLFRF"
FT   gene            complement(601040..602005)
FT                   /locus_tag="Dole_0535"
FT   CDS_pept        complement(601040..602005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0535"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sde:Sde_0868 ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66345"
FT                   /db_xref="GOA:A8ZU33"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU33"
FT                   /protein_id="ABW66345.1"
FT                   /translation="MYQNKSVCVVIPAHNETTQILRVLSTLPEWVDHIVVVDDASTDAT
FT                   ADVVTGQAKKDGRVVLLRHDVNQGCGGALVSGYRWAIEHHIDIAVRMDGDGQMDPADLP
FT                   ALVEPVASGAVDYTKGNRFFSGNAYRHMPKIRYFGTAFLSLLTKIVSGYWHISDFQSGY
FT                   TAISNKALNTIDWDRMYKQYGQPNDLMILLNVDNFRVADVPVEPVYNVGEKSGIRIKKV
FT                   VFTISWLLFKRFFWRMKEKYIIKDFHPLVFFYLLGMGFGALTAGLFARLFYIWYISGYI
FT                   PPINALAAMFSFMSASQFILFAMWFDMEANKDLKSESIKR"
FT   gene            602144..603961
FT                   /locus_tag="Dole_0536"
FT   CDS_pept        602144..603961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0536"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: ppd:Ppro_1060 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66346"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU34"
FT                   /protein_id="ABW66346.1"
FT                   /translation="MIDDFEKLFAPRKVCQILVARKMISKETAEDLLKRYGGVKSKLEK
FT                   AQSARLAAAPPGIRINNPITIVDVMVSMGLSRADTEVGELDEDAVFQALAEEWDVPFKK
FT                   IDPLKLDLELVTNTIPRSFAMNYLSLPIAVENGELIVATPNPFNTTVMDDIARVVHRRV
FT                   VPVVSTKSDIIRTINEFFGFKKSIAAAETQFAAPTVDLGNLEQYVRLAGEGELPLNDSH
FT                   IVNAVNHLFSYALDQHASDIHIEPKRDITMVRMRIDGVLHTIYKIPKKVHYALVSRIKN
FT                   LARMDMAEKRRPQDGRIKTDKGGSEAEVRVSTIPVAFGEKVVMRIMDPDILFQPLEGLG
FT                   FSAEEMNIYQQMANRPNGIILVCGPTGSGKSTTLYSTLRYLSTPDVNITTVEDPIEMVH
FT                   EDFNQISVQPTVGITFGSILRNILRQDPDIIMIGEMRDLETAQNAIQASLTGHLVLSTL
FT                   HTNDAPSSIIRLLDIGVPNFLVQATLVGVVSQRLVRRICPYCREPIEIDAAEFETMGIQ
FT                   TGKRGKLKLYKGKGCTKCRGTGYKGRTGIFELLPYTEAIRALTLPQTDMAKIQAKSREE
FT                   GMMTLREAAVKKMLRGETTYQEVLRVTWE"
FT   gene            complement(604052..605236)
FT                   /locus_tag="Dole_0537"
FT   CDS_pept        complement(604052..605236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0537"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   ade:Adeh_2701 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66347"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU35"
FT                   /protein_id="ABW66347.1"
FT                   /translation="MAENEPAAPSAGDAAAVAPGEPTVQGTGTDPLPPAEDTSVFQETT
FT                   TGTQLAVEDEQADQPEGGDFAPGFYYTVRPGDTLWDLSRKFYDSEWVWPAMWGQNKDLT
FT                   NPHLIYPGQKIRLYQKTDVPDYRDKMVPPPPPEEEVAVAQFMPEEQAAPEPPVEKQVYF
FT                   EFAPIDSVGFIQRLEKTVLSRNPLDPYKLGKIFKVEGYDRKLLSQGDTIYIQQTGDTSF
FT                   ISGNTYRIYKPITPVDDPTTGKYVGHQYNIAGIAEITAVTPDFAVANIHRSFQEITVGD
FT                   LIMPFEQRAPKIPLTESPEGLTGTIVGVNSPAKIFGEHAVVFINRGKKDGIYTGQRYEV
FT                   YYQENEQVGGKKVAMPPIVYGRLLVLLTLDTTATVVVTNSDDMIEAGATFRSPL"
FT   gene            complement(605473..606258)
FT                   /locus_tag="Dole_0538"
FT   CDS_pept        complement(605473..606258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0538"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: ade:Adeh_0664 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66348"
FT                   /db_xref="GOA:A8ZU36"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU36"
FT                   /protein_id="ABW66348.1"
FT                   /translation="MIGIFDSGLGGLTVARAVMDELAGYDILYFGDTARTPYGAKSPET
FT                   VIKYALENTELLLSHGAKMVIMACNTASSVATEAVTARFDIPVFEVITPAVALAARLSK
FT                   TGAIGVIGTRATINSGIYEKKILEQRPGARVHSQACPLLVPLVEEGWLKKPETAMIVKK
FT                   YLHPLKTRQVDTLILGCTHYPILKKTIGHKIGRRVAIIDSSTAVARSVKAFIDGHPPME
FT                   ASLSKTGTARFLVSDITAQFKTTAQLILSREVALEHVSL"
FT   gene            complement(606242..606712)
FT                   /locus_tag="Dole_0539"
FT   CDS_pept        complement(606242..606712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0539"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dde:Dde_1303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66349"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU37"
FT                   /protein_id="ABW66349.1"
FT                   /translation="MPSDHTQPEEIFECKQCGDCCRGYGGTFVTPEDIAAISAYVHTDP
FT                   KEFVEKWCAFSGSRPVLAQKADGYCVFWDRVCTIHPVKPRMCRAWPYIESVMIDPGNWE
FT                   IMSSMCPGIKTGVGPETIRACVRRHLADLPPAGSRHLEQPVSEGRSTNDRHL"
FT   gene            complement(606702..607301)
FT                   /locus_tag="Dole_0540"
FT   CDS_pept        complement(606702..607301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0540"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: tte:TTE0041 recombinational DNA repair
FT                   protein; TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66350"
FT                   /db_xref="GOA:A8ZU38"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU38"
FT                   /protein_id="ABW66350.1"
FT                   /translation="MLPYPPSIRNAISHLSRLPGIGQKTAERLAMHLLHVPDRAVHELA
FT                   RSLVDLKKNTRMCSVCFTLSDTPVCAICGDPDRNASLLCVVEGPTEVMAIEKTAAFKGV
FT                   YHVLHGVLSPMDGIGPDDIRIRELVDRVKKGIVKEIVLATDTRVEGEATAAYLVEVLKP
FT                   FPVTVTRIASGMPAGGEVRYSDPVTLKNAMEKRYAL"
FT   gene            complement(607301..607612)
FT                   /locus_tag="Dole_0541"
FT   CDS_pept        complement(607301..607612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66351"
FT                   /db_xref="GOA:A8ZU39"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU39"
FT                   /protein_id="ABW66351.1"
FT                   /translation="MKNMGGMLKQAQKLQAQMVKLQEELAEKTVEATAGGGMVKATANG
FT                   RQQITALVIEKEVVDPADVEMLQDLVLAAINDALTKSQEMMNSEMGKLTGGLNIPGLM"
FT   gene            complement(607665..609377)
FT                   /locus_tag="Dole_0542"
FT   CDS_pept        complement(607665..609377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0542"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sfu:Sfum_2789 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66352"
FT                   /db_xref="GOA:A8ZU40"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU40"
FT                   /protein_id="ABW66352.1"
FT                   /translation="MSYLVLARKYRPQTFEEVVEQQQVTRTLTNAIASGRVAHAILFTG
FT                   PRGTGKTTIARILAKAMNCEKGPTPTPCCACRSCLEIASGNATDVFEIDGASNNSVDQV
FT                   RELRGNVKFMPAHSPYKIYIIDEVHMLSGPAFNALLKTLEEPPAHVMFFFATTEPHKIP
FT                   VTILSRCQRHDLSFVGIDPLVAHLETLCEKENIPIEKKSLELIAHEAGGSVRDSLSLLD
FT                   QVMSSAQGPVSHEMVLEALGIIDREVIFGLSGAVLAGDMTGALDILDTVYRGGHDIKRF
FT                   YAEMLGHFRDLLMVKLGVRAERLASLPGWAVEKMQAQTRDVTELFLSQAMALMLAEEDR
FT                   VRFSSQPKIAVEMVFVKLLHTKPVLPIDTLIQKVDALRKSFAQLAGNGNAPATASKDAA
FT                   PERNADGAAGVSASRPAQARPAPTENQPRPSSPPPASPLPEETGPVATGTTDPVPLDNA
FT                   GTWEAILARIDEQYPLLGANLRNSTLAAMEGGRLEIKVYGSQTNKAILAREQSMENLKQ
FT                   VCCDFFKTDINLAVTYTCDTQPAQPDKQKPRTAGPDPLVAEALNIFGGTIVNT"
FT   gene            complement(609447..609537)
FT                   /locus_tag="Dole_R0009"
FT                   /note="tRNA-Ser2"
FT   tRNA            complement(609447..609537)
FT                   /locus_tag="Dole_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(609609..609700)
FT                   /locus_tag="Dole_R0010"
FT                   /note="tRNA-Ser1"
FT   tRNA            complement(609609..609700)
FT                   /locus_tag="Dole_R0010"
FT                   /product="tRNA-Ser"
FT   gene            complement(609896..610621)
FT                   /locus_tag="Dole_0543"
FT   CDS_pept        complement(609896..610621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0543"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: putative RNA methylase; methyltransferase
FT                   small; KEGG: sat:SYN_01006 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66353"
FT                   /db_xref="GOA:A8ZU41"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU41"
FT                   /protein_id="ABW66353.1"
FT                   /translation="MTRPITQDSFFNGHVCVRQTADGYRFSIDAVILAWHITPAPGARI
FT                   VDLGTGCGIIPLILACRHPSVSITGIEIQPQLAQIATENAAANQMTDRVSIVCADIRNA
FT                   NDHLPAGKADIVVCNPPFRKVAAGRINPDEERAIARHELAVTLKDILAAAKRALRTAGE
FT                   FVVIYPAFRAPDMICAMREAGIEPKLVRTIHSRQHEEARLVLIKGTRNGRPGAVIPSPL
FT                   VIYDADDRYTPEVERMFLP"
FT   gene            complement(610618..610878)
FT                   /locus_tag="Dole_0544"
FT   CDS_pept        complement(610618..610878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66354"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU42"
FT                   /protein_id="ABW66354.1"
FT                   /translation="MRGMQNGLHADLMLISKIWPTVVDGPTAQNAQPAAIKQKTLTVHV
FT                   TSPAWIQHLRFHQNDMIRQINQAAGRDLVTDMRFKIGGLHS"
FT   gene            611105..612205
FT                   /locus_tag="Dole_0545"
FT   CDS_pept        611105..612205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0545"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   ade:Adeh_3522 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66355"
FT                   /db_xref="GOA:A8ZU43"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU43"
FT                   /protein_id="ABW66355.1"
FT                   /translation="MDTGKTMNWDWEKLQQQQKSRRPSGPGPSGGGGGGTPPQMDELIN
FT                   KFKNMKFSMGPVLIIVAILVILLGSTMVYTVEQREVGVVQRFGKYVRTTYPGLHFKLPM
FT                   GIETLHIVNVDETRSAGFGLSTAQAEKTLFSSRPAAPSNVYDESLMLTGDLNVGIVPWV
FT                   VQYNIKDPIRFLFRVHEAEILLKDLSEATMRLVVGDRSINEVLLIREEIASECRTRLQQ
FT                   ELDDAETGIQVTALELGKTNVPPKVQPSFNAVNKAEQEKETMIFTARKEYNQAIPAAMG
FT                   EAKKTILAAEGYALDRVNRAEGDAAKFMALYKEYSKAKDVTRRRLYLETMKDVLPKLGK
FT                   KYLIDEDQKNVLPLLNLETGNRGVTK"
FT   gene            612202..613191
FT                   /locus_tag="Dole_0546"
FT   CDS_pept        612202..613191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0546"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   ade:Adeh_3523 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66356"
FT                   /db_xref="GOA:A8ZU44"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU44"
FT                   /protein_id="ABW66356.1"
FT                   /translation="MKSRGITTIAVVLVVGIVAFFLSAFIVDETELAIVTRFGKVTREP
FT                   VMEAGLNFRVPFLDKVYLFPKNLREWDGEKGELPTLNKTYIWVDTFARWRIEDPVVFYQ
FT                   RAVNMDKAQRLMGNILDSEVKNAIANQELIETVRNSNRQMASLEELFSSSSEPTDGEAT
FT                   TGTRRGTVKSSEIKVGREQVENIILERAKPKIAELGIDLVDVKIKRINYREDVQESVYD
FT                   RMIAERSQIVEQFRSEGRGEAQRILGEKEKKLKEIQSEAYKTAQTIMGKADARVTEISA
FT                   DAYSRDPEFYSFVKTLSLYAESLDESSSVVLSTDTDFFKYLKGYSDKR"
FT   gene            613585..614145
FT                   /locus_tag="Dole_0547"
FT   CDS_pept        613585..614145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66357"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU45"
FT                   /protein_id="ABW66357.1"
FT                   /translation="MKQKTRQARQATPCFSLDQLAVLNDSVAVAEEMVCDYYKMSASQW
FT                   LRHRYDVKTRAGLSGTEIVEGPFAQIVRYAARGSDASLGSSVYDFYKICVQDPAILSVV
FT                   SATPGLSLFPFLVYVIVHELVHIIRFARFDQHFDAPPEEKEREEGRVHRATRAILVRHE
FT                   IAGMAPVLKFYEKWETCQAPVDL"
FT   gene            614305..614571
FT                   /locus_tag="Dole_0548"
FT   CDS_pept        614305..614571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0548"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   PFAM: Putative regulatory protein FmdB; KEGG: sfu:Sfum_1038
FT                   putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66358"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU46"
FT                   /protein_id="ABW66358.1"
FT                   /translation="MPIYEYECTKCGKIHEAWQKINDKPLQRCDACSGKLHKLISHSAF
FT                   HLKGSGWYVTDYSGGAKPGASTCQACESTPAASKEKSGSSKDK"
FT   gene            614684..614971
FT                   /locus_tag="Dole_0549"
FT   CDS_pept        614684..614971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0549"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sat:SYN_00062
FT                   co-chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66359"
FT                   /db_xref="GOA:A8ZU47"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU47"
FT                   /protein_id="ABW66359.1"
FT                   /translation="MKFRPLHDRILVKRVEEETKTKGGIIIPDTAKEKPIEGKVMAVGN
FT                   GRLGEDGKLIPLEVKKGDRVLFGKYGGTEVKMDGQEYLIMREDDILGILE"
FT   gene            615009..616661
FT                   /locus_tag="Dole_0550"
FT   CDS_pept        615009..616661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0550"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ade:Adeh_3594 chaperonin Cpn60, GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66360"
FT                   /db_xref="GOA:A8ZU48"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU48"
FT                   /protein_id="ABW66360.1"
FT                   /translation="MAGKEIKYSTKAREAMLAGVRTLADAVAVTLGPRGRNVVIEKSWG
FT                   SPTVTKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDTAGDGTTTATVLARAIYEEGQ
FT                   KLVAAGNNPMAIKRGIDKACEVAVKELAGMSKPTKNQREIAQVGTISANSDETIGNIIA
FT                   EAMEKVGKEGVITVEEAKSMDTTLDVVEGMQFDRGYLSPYFVTDAEKMVVSLENAYILI
FT                   NEKKLSNMKELLPILEQTAKAGRPLLIIAEDIEGEALATLVVNKLRGTLNVAAVKAPGF
FT                   GDRRKAMLEDIATLTGGQVVSEDVGINLEGITLGDLGHAKRITIDKDNTTIVDGAGKKA
FT                   DIEGRVKQIRAQIEDTTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDA
FT                   LNATRAAVEEGVLPGGGVALVRCLDALSKIKIKSEEKLGVKVVMRAIEEPLRRIANNAG
FT                   VEGSVVIEKVKNETGSFGYNAATGDYGDLIAAGVIDPTKVVRFALQNACSVASVMLTTE
FT                   AMIAEKPSKEEPAAMPGGGMGGMGGMGGMGGMM"
FT   gene            complement(616751..618085)
FT                   /locus_tag="Dole_0551"
FT   CDS_pept        complement(616751..618085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0551"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: pca:Pcar_1022 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66361"
FT                   /db_xref="GOA:A8ZU49"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU49"
FT                   /protein_id="ABW66361.1"
FT                   /translation="MKRILYMTPLLGLAMSVSAWAGEAAITPAANAAAIELVQSHADYL
FT                   WTLVAACLVFFMQAGFALVETGFTRAKNAVNILMKNLMDFSIGSLVFWAVGFGLMFGAS
FT                   ASGWFGTSGFFLSDFSPEGDPWVLAFWMFQVVFCATAATIVSGAMAERTKFIGYIAYSI
FT                   VLSALIYPVFGSWAWGSLFNGGGWLEGFGFIDFAGSTVVHSVGGWAALAGAIVLGPRMG
FT                   KYAKDGTARAIPGHNIPLAALGVFILWLGWFGFNPGSTTVADKSIAMIFVNTNLAAATG
FT                   AVFAMIVSWLKFGKPEISMSLNGALAGLVGITAGCANVSPTSSIIIGAIAGVLVVFSVL
FT                   FFDKIKVDDPVGAVSVHGVCGAWGTLAAGIFNMGGTSASIIGVQLLGMGTCFAWTFSMA
FT                   FVMFKLIDKTIGLRVSPEEEAEGLDFSEHGGNAYPDFSVSAYAQK"
FT   gene            complement(618107..618445)
FT                   /locus_tag="Dole_0552"
FT   CDS_pept        complement(618107..618445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0552"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   nme:NMB1995 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66362"
FT                   /db_xref="GOA:A8ZU50"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU50"
FT                   /protein_id="ABW66362.1"
FT                   /translation="MKKIEAIIKPFRLDDVKTALNEAGVTGMTITEVKGFGRQRGHTEI
FT                   YRGAEYQVDFIPKIKLEVITDDEMSEKVVSIILEKASSGKIGDGKIFVLPVEGVVRIRT
FT                   GEKGSAAV"
FT   gene            619063..619743
FT                   /locus_tag="Dole_0553"
FT   CDS_pept        619063..619743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0553"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mxa:MXAN_1525 FHA domain/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66363"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU51"
FT                   /protein_id="ABW66363.1"
FT                   /translation="MTRREIDDTLNLDKEALDFVEQEKFQVEEKVIYSGRKKGACIVFI
FT                   TGPSRGNVVAAHKGTMTIGRDQASDIVINKQYVSKKHAQIISSEDGAKIVDCKSTNGTF
FT                   LNDTLIEQAELKDRDEIKIGSVIMQYFRIDLNDADQERIPAVLEDQKPSAFYNKVFAEV
FT                   QPFFGQMTGRFLDRQIRSHLGKSPGTLEFSDRESLARWLRISAGLLMNEKIADTLAEKI
FT                   LALE"
FT   gene            619843..620739
FT                   /locus_tag="Dole_0554"
FT   CDS_pept        619843..620739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0554"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rrs:RoseRS_3625 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66364"
FT                   /db_xref="GOA:A8ZU52"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU52"
FT                   /protein_id="ABW66364.1"
FT                   /translation="MAKLTEVDLSHLLGREVGTSTLLKELDRGAMAVVFVAFQRTLKRQ
FT                   IAVKILPKSILTPETAALFVQEAEMAAILSHPNIIQVYEVGETDEFLYFTMQLIQGNSL
FT                   AYHIGRVRDHVIPSKRFLPVSASLDLVRAMLDALDYAHGQDIVHRDVKPSNVLIEPHTQ
FT                   RPILMDFGISKSVREPGAAENTILGTPVNMAPEQILGKEMDNRVDVYGAGVLLFQSLVS
FT                   NLPLAPHESTRELLKLKLADRMFIRPPSAVNPAVHSDMDEIVVKATAFHPRDRYGSCRE
FT                   FADALKHYAANHLQADR"
FT   gene            620751..622967
FT                   /locus_tag="Dole_0555"
FT   CDS_pept        620751..622967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66365"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU53"
FT                   /protein_id="ABW66365.1"
FT                   /translation="MAEPKAGSAEYVKLSRMVCMLLNRAMMYKADHPQIREAAANLYRE
FT                   LALLLPQVASISLILHQDQLYLDEEPVDPRINVGRIVALFKKAGIQSISFFKGMAAEEL
FT                   DVLIDIVTSPAQYADSPAMIEELRFRGVDQLKINHVFYKKITREEEVITRRDQEEKPVP
FT                   PPVSDAAKKQLMKTLLESVLAEETDKTLSMQRLMSDPAGMSKQMLSVEEKGMAAVASGN
FT                   LAPGDSGAAGDTAAITPGATLLYQIQTLGDDIRQHLETEGPSDMMNVAEAVFEMKRQLT
FT                   LGIEARKAVNQAYENESAIVDQVNALSDDVLVQLIKNEYQQGKITTVRLAQILRRMVPE
FT                   PGELRRLLPKIKKALLSEGMPVAEYLSLVQHLGKELESEGLSRVLQEAAGSVGVDGADL
FT                   VDEIQKNPEQVAGLIAIAAEIRKGDGDQQAFMDTLVNYVEELGSGLRKETAGGDAADAR
FT                   SMMADLGSNLTAHLRGMNIDPDALAEMETRINDRIQAVFDRLDTGPAALGGGGCPARKE
FT                   RTLLEMMEQSLEGNQDLKQILQAVRADAQADALDENSIEQIYAAIVKHQEARREKESKR
FT                   QMPAGVLKPAEFRFHLEKELSRAGRHKLYLSTLAFTIINVRPKTKVPADVKIKKADLFA
FT                   AAYERLVEVARTSDIVGELDPNTMTIILPMAEKAGARLALQRITKLLHDQPFEIQGIPL
FT                   NVIIAGSVTSFMPDERPNTESFIRTMAYELDHVAKRVRNVHNLT"
FT   gene            complement(622974..624011)
FT                   /locus_tag="Dole_0556"
FT   CDS_pept        complement(622974..624011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0556"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mac:MA1774 nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66366"
FT                   /db_xref="GOA:A8ZU54"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU54"
FT                   /protein_id="ABW66366.1"
FT                   /translation="MIKKFFQSTNNPEAAFARFVLDEEKCNGCGACVAACPMQILMVAD
FT                   GKAAPNQRYDHFRCITCQNCVATCPNKAIVIEGDYRVGAGFWKNTHLFENGKTLPAPIR
FT                   SRAGEPFEQIEGQLTETERVIYKRRSIRLYKKKPVERDLVERVIEAGRFAPSAGNNQPW
FT                   KFIAITNKQVIDEINDKCKRSLRKGTFIMMPHAYLDKKTPGDPNAKLNWWQNMVMALLC
FT                   RIKTGDVEPRARGGINTVTSDPDYHIFFNAPVLIILLADKRGIGSIQLDTGICGQNMVL
FT                   AAHALGLGTCWVSLVRGLGFYPAFRRQLGIDDQFEIISSLTLGWPKMQIDNVVAREQAR
FT                   IQWVE"
FT   gene            624421..625314
FT                   /locus_tag="Dole_0557"
FT   CDS_pept        624421..625314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0557"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein MerR; regulatory protein
FT                   TetR; KEGG: ttj:TTHA0167 transcriptional regulator
FT                   (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66367"
FT                   /db_xref="GOA:A8ZU55"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU55"
FT                   /protein_id="ABW66367.1"
FT                   /translation="MENTQHLFRIGELERLSGVARRNIHFYMQQGLLHAPHRTGRTMAY
FT                   YDASHLNKLAYIIEQKALGQPLFSIRENIERLEAESPGCFSARRSTPARKAGTTDRRMP
FT                   RRGKSMKTREAILDLGSALFRQKGYRATRVSDITTRLNIGKGTFYFYFSDKKELLLACV
FT                   PRIFGELFANGWDVIRQEADPLKRLELRARAVLPVLDEFCAILAICEEAHEDPDPKLKQ
FT                   MGEQTLVTIRKPMESDIRKGMAQGLIRTVDPAIAAALMIGAMRSMRVLRSMDPDISDDA
FT                   VLREVIGVVLSGIRRH"
FT   gene            625652..626875
FT                   /locus_tag="Dole_0558"
FT   CDS_pept        625652..626875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0558"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: bbr:BB1086 putative thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66368"
FT                   /db_xref="GOA:A8ZU56"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU56"
FT                   /protein_id="ABW66368.1"
FT                   /translation="MRDVAIIGAGMTRFGKFPEKSIKDLVKESSQAAIKDAGIQPSDIQ
FT                   AAYVGSAVAGLMTGQEMIKAQVTLSAMGIEAIPMYNVENACASSSSALNLAWTAVGAGI
FT                   FDCVLVTGFEKLYDEDKKKSFAALGTAVDIELFKLFLAEFQKNQGKGESIIKEGSGQKR
FT                   SVFMDMYAHYTKIYMDRYGLTQEHFARIAVKSHKNGALNPHSQYQEEVTLEQVLNSGDV
FT                   SWPLTRMMCSPIGDGAAAVIVCSKEAAARFGARPVWIASSVVGSGKLSGDLEDTLTKRL
FT                   APKAFEAAGIGPDDIDVIEVHDATSPSEIITLIELGLCPGADAPKWIDEGYMEIDGSRP
FT                   SNTSGGLAAKGHPIGATGLGQVYEIVNQLRGTAGKRQVKNPKVGMTHNGGGILGVDAAA
FT                   MALHVFKN"
FT   gene            626913..628280
FT                   /locus_tag="Dole_0559"
FT   CDS_pept        626913..628280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0559"
FT                   /product="phenylacetate--CoA ligase"
FT                   /note="KEGG: rxy:Rxyl_1851 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66369"
FT                   /db_xref="GOA:A8ZU57"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU57"
FT                   /protein_id="ABW66369.1"
FT                   /translation="MDNNQPYWNMEIEPRLNTEEMRELQWKKLVPALQWQYENTPMHRS
FT                   RFEKAGITPADIRSFDDFAQALPPMGQAEIRDLIGEIGLDMDKLMGHLFGEKRMNDLYL
FT                   LTTTSGTTGIPTPYPNFGASLDDAAEIMARAAWRIGIRPGDRVGICFGLSMHAAGTPQV
FT                   LWFRKFPGITLVPIGAEAGTEKILQFMQLFKVNVFLGTPSLALHLIERAPEVLMGQTVK
FT                   SLGIKVLMLGAEAGAGIPEVRAKLEEAYGAKVFDLGGGYGCSCDHPVYQGMHWIADDYA
FT                   YYELIDPETRQPVPMENGATGIMVGTSLNPPAAVWFDLRFTMMDIHQVFTDPCPCGRSG
FT                   FRYKIVGRADDMLKVKGVPVYPAAIEGVIHSFPDKLTGSFRIVLDEPPPRVVPPLKLKI
FT                   EYAEGVRKEDLPGIEADLTSRMHSLLKIRPAIQWLAPNTLERATKKTQLLEKAYEE"
FT   gene            628425..630194
FT                   /locus_tag="Dole_0560"
FT   CDS_pept        628425..630194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0560"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: fra:Francci3_0479 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66370"
FT                   /db_xref="GOA:A8ZU58"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU58"
FT                   /protein_id="ABW66370.1"
FT                   /translation="MGTTVAITGVNSYFASTILPLLETDPDVDKVIGIDVSPWKGGYGK
FT                   VEFHRADIRDPQIADILAGADVVYHLAFIVGQIQDTQKALDININGSRNVFESCVKNNV
FT                   SKVIYTSSSTVYGAHADNPIGFREDAPLRVNEDSYYNESKVKVETFARDFFRNHPDITF
FT                   TVIRSALLFGPHIDNMFSKLYDLPVSSLPMGRTTHNQYIHEEDLGSALHMAMACDLPGI
FT                   YNVGADDGMATRHAFAMAGVRIIPVPTSLLKLVAAVGFKLRLFSAGRGWVSLGEYTIFM
FT                   NCDKFKQATGWKPRYTSRQTFESFLAARERDAKDNPIQATLSWIFKSGPRTRPTMAVLN
FT                   VFRLGKVPGLRRAIPWMNPKKNSMSYLPVNRSLGQVVDQVLPAQVVHDFIDAADTYVIM
FT                   DKCGCRLARKCQHHTPDIGCLFMGETALKMPHGVSRRVTREQAHAHVDRAISVGLIPMT
FT                   GKVRVDNFIFLTPDRSKLLSVCFCCHCCCMMTSLKHIPGDYLDGIMPRIEGLEISVTDA
FT                   CVGCGTCVEFCGFGAITIENGKAVHNDQCRGCGRCETRCPNHAVRITINNPNVTEDVKK
FT                   RIEQYVDFKGTAA"
FT   gene            630197..631093
FT                   /locus_tag="Dole_0561"
FT   CDS_pept        630197..631093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dde:Dde_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66371"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU59"
FT                   /protein_id="ABW66371.1"
FT                   /translation="MKESTKRIIRYHGLRPDRAFHNWLYFAHYRIYVKTMLAAARFLQK
FT                   HFGGMWLLSRPFKSVFERYHSKVMTEADVRKILTLNRELDLGPHKQVIPYAYANKIIFD
FT                   EPDFIVVMDCPCRLHREHHCEPVTVCMAVGRYYGQLWLEHSQKFHPRKITQEEALELVR
FT                   SQREKGCITTAWVKVGTGGRTGIICNCCTCCCGGLEGMRMVKAIKGGENVSNVAPSGYK
FT                   VDHDPALCTACGTCISGCMFDAITADENGAPVYNRDACMGCGLCVEHCPRQARSLNKEF
FT                   AEGLFPLDLDMLQEKKQ"
FT   gene            631443..631751
FT                   /locus_tag="Dole_0562"
FT   CDS_pept        631443..631751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66372"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU60"
FT                   /protein_id="ABW66372.1"
FT                   /translation="MAEQPKNSDWVFVAAEVAGDWAGRFVAYRDEVSDISYVPAFYKKE
FT                   EAQACFINLPREKGKKYEIQAVMFEDLAKDATANGCLIFMLDADGRILLKIDPATVD"
FT   gene            complement(631985..632518)
FT                   /locus_tag="Dole_0563"
FT   CDS_pept        complement(631985..632518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0563"
FT                   /product="membrane protein of unknown function (DUF1430)"
FT                   /note="KEGG: pub:SAR11_1266 membrane protein of unknown
FT                   function (DUF1430)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66373"
FT                   /db_xref="GOA:A8ZU61"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU61"
FT                   /protein_id="ABW66373.1"
FT                   /translation="MSQFTDRMIRAAKLDVNVYEEVEADGEAMGQAMGVVILSSLAAGV
FT                   GTIGTGGIMGLVLGTAGALAGWFIWAWLTYLIGTKLLPEPQTQSSPAELLRTIGFSSSP
FT                   GLLRILAIIPGLGAIVFMITGIWMLATMIIAVRQALDYTSTLRAVGVCLIGFIVQAVVI
FT                   GLLVSLFGAPQGAM"
FT   gene            complement(632711..633049)
FT                   /locus_tag="Dole_0564"
FT   CDS_pept        complement(632711..633049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0564"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   gsu:GSU1836 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66374"
FT                   /db_xref="GOA:A8ZU62"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU62"
FT                   /protein_id="ABW66374.1"
FT                   /translation="MKKIEAIIKPFKLDDVKNVLNELGIQGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYIVDFVPKIKLEVVVAASMADKVVDAIAKAALTGKVGDGKIFVMPVEQAVRVRT
FT                   GEKGKDAI"
FT   gene            complement(633089..634375)
FT                   /locus_tag="Dole_0565"
FT   CDS_pept        complement(633089..634375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0565"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: wsu:WS0410 ammonium
FT                   transporter, AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66375"
FT                   /db_xref="GOA:A8ZU63"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU63"
FT                   /protein_id="ABW66375.1"
FT                   /translation="MKKILLVPVALLLSVLPAFAEEAVLDTGDTAWIIVATALVMMMTP
FT                   AGLALFYGGMSRSKNLLNTYAMTFAAYCLASLVWVCWGYTLAFGPDKGGIIGGLDHLFL
FT                   NGIGIDTLSGTIPASVFVLFQLTFAGITVALVLGSVVDRMKFSAWIVFCLLWLTFVYSP
FT                   VAHWVWGGGWMAEMGALDFAGGNVVHINAGIAGLVLALMLGKREGYGKVAMFPSSVSLT
FT                   ALGAALLWFGWFGFNAGSALGANGLAGSAFLVTNTSAAMAGMAWMFAEWIVSKRPTLLG
FT                   LASGVVAGLVAITPAAGFVNLPASLVIGLVAGVLGFYSVAVLKHKIGYDDSLDAFGVHG
FT                   VCGIWGALATGLFANPAISGASGLFYGNPAQLGIQAISIVATIAFTAVATLIIVYVTRL
FT                   ITGGLRVSREDEMMGLDNAIHGERAFELD"
FT   gene            complement(634397..635680)
FT                   /locus_tag="Dole_0566"
FT   CDS_pept        complement(634397..635680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0566"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: plt:Plut_0089 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66376"
FT                   /db_xref="GOA:A8ZU64"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU64"
FT                   /protein_id="ABW66376.1"
FT                   /translation="MPALAAAPETVIDTGTTSWMLTSTALVLLMVPGLAMFYGGLVRTK
FT                   NVLGTMMHSFVAMAVIGVLWVVVGYALTFGKSVMGGVVGWNSDYFLLKGIDSSITNGVP
FT                   EYVLAMFQGKFAIITPALISGALAERVYFRGYILFIALWFLVIYCPLCHWVWAADGWLF
FT                   NLGAAGVIDLAGGTVIHVSAGVSALVIALMLGARRGYPQTPMLPNNMVMTMMGAGLLWV
FT                   GWFGFNAGSTVQSGLDTARALTMTQISAASGALTWLVIEALIYRKATSLGFVSGILAGL
FT                   VVITPAAGVVLPGGALVLGALSSMACYFALKAKNRLGYDDSLDCFGIHGVGSGLGVLLL
FT                   SFFIRDSWMKDAAEAAGGAWSAWNQLAVQLAGVGATVALAVVGTLAIYFVVEKSVGFRI
FT                   EEQGEVEGLDQFLHGENGYGLVRSDFIT"
FT   gene            complement(635768..638431)
FT                   /locus_tag="Dole_0567"
FT   CDS_pept        complement(635768..638431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0567"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: gsu:GSU1820 protein-P-II uridylyltransferase,
FT                   putative; TIGRFAM: protein-P-II uridylyltransferase; PFAM:
FT                   amino acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66377"
FT                   /db_xref="GOA:A8ZU65"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU65"
FT                   /protein_id="ABW66377.1"
FT                   /translation="MNAGTTTGIDTPATRMRTARERLIADFSAQGKAFDFLSRHTALLD
FT                   DYFISCFEGSRVGPKMNFHKHPFAVIALGGYGRQEMCIHSDIDLLFLFKKQVPPAAEAL
FT                   IREMVYPLWDLGFEVGHATRSVKECVTLAGQDLDVLTSLLDARFLCGMLPLHTQLRERL
FT                   APGLSGRRARNVIAALIQGNQERHRKFGDSSYLLEPNLKEGVGGLRDYHSMLWIARIIS
FT                   PIISPRDLEYYGYLSHDEYADLNRALAFIWTVRNHLHGLAGRKFDQLYLDHQEVIATAM
FT                   GFKTAGGQMAVERFLGRLHSEMEYIRHTNRAFLAEAGYARGYRFARKTRVRQPVAPGIE
FT                   VDRNLLTFASPEAILSRPHLLLDIFEQSARLHLPLGLEARRILREFAFLVDKPFRSDPA
FT                   VTKAFERILAAWAPDAGVLNEMLHTGVLERLIPKMKTIIDRIQFDGYHLFPIARHSIQT
FT                   VERLKALGAKESDAPLCARLYRELGRRKTILLWAGLLHDIGKGEAGGGHSERGAKIAET
FT                   ILSGMGYGPEFTGAVAFLVKEHLLLAKTATRRDINSEETALACARRIGDEKTLSMLYLL
FT                   TVADSMATGPKAWNDWTASVLRDLFLKVLKILEKGELASRKALATVETKTRELLDIAAS
FT                   AEEKTALAAHMEILPPRYCLYVPALNIRAHMDLYRRLGHGDFVWTVASTANGTARTVTI
FT                   CAKDRPGLFSKIAGVFTLNSLDILEAEIYTWKNGIALDVFTVSPPADRIYEHQQWEKAA
FT                   SHLQAALSGDLDLAGAIAARPAPLRTEKTFATRPHRVKIDNEESSFFTIVEVFAYDFPG
FT                   LLFSITDILFQCGIDIWVAKIATKVDQVIDIFYVRTLEGEKVDTPEAVDRLQTMIETML
FT                   ERHEAGNPAPSQTATV"
FT   gene            complement(638772..639551)
FT                   /locus_tag="Dole_0568"
FT   CDS_pept        complement(638772..639551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0568"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase; KEGG:
FT                   fjo:Fjoh_1792 NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66378"
FT                   /db_xref="GOA:A8ZU66"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU66"
FT                   /protein_id="ABW66378.1"
FT                   /translation="MKTEKVVDHIVSWLVNYCDNAKMKGFVVGVSGGIDSALTSTLCAK
FT                   TGRPVWALNLPILQDPAQVSLSAKHIAWLTGRFDNVRTETVDLSNVLASLQDALPDAVG
FT                   DTRTLANTRSRLRMVTLYVFASHYSLLVAGTGNKVEDFGVGFYTKYGDGGVDLSPIADL
FT                   VKTEVYEAARHLGVIQEILDVPPTDGLWPDNRTDESQIGATYPELEWAMAFDATGEDPS
FT                   LLSARRQEVLAIYRRFHRANRHKMDPIPVCQIPNDLR"
FT   gene            complement(640569..640871)
FT                   /locus_tag="Dole_0569"
FT   CDS_pept        complement(640569..640871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66379"
FT                   /db_xref="GOA:A8ZU67"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU67"
FT                   /protein_id="ABW66379.1"
FT                   /translation="MEYEKILNPDFWKAFKIPGYALAVLLLLLLMRDINNGLEYIYIQK
FT                   VANFAIGASIISYGHSMLHSTWVNRRKEMDLPFWPQLLALTIHAVWFGFFLYQVV"
FT   gene            complement(640970..641386)
FT                   /locus_tag="Dole_0570"
FT   CDS_pept        complement(640970..641386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0570"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   dde:Dde_3072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66380"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU68"
FT                   /protein_id="ABW66380.1"
FT                   /translation="MKTFRKELVFNVPTRRAFINITPEVEQCLSESGIQEGLVLVNAMH
FT                   ITASVFINDDESGLHYDYDQWLEKLAPHAPVSQYRHNVGEDNADAHMKRQIMGREVVVA
FT                   VTGGRLDFGTWEQIFYGEFDGRRPKRVLIKIIGE"
FT   gene            641490..642101
FT                   /locus_tag="Dole_0571"
FT   CDS_pept        641490..642101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0571"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sde:Sde_2037 putative haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66381"
FT                   /db_xref="GOA:A8ZU69"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU69"
FT                   /protein_id="ABW66381.1"
FT                   /translation="MKTDKVTTILFDLGGVLFELSGIQKISHWTGGRLAPADLLERWLA
FT                   SPSVRAFECGRIDFFAFRHALKQELELAVSDDEFEKTFRAWIRQVFPGTKELLADLAPR
FT                   YRLACFSNTNDVHWQIIRSDFDVLSCFEKTFASCEIGLVKPDAEAFDHVLAGLGCGPGQ
FT                   VLFFDDSPTNVAAAEACGMNARRVYGAQNVRQVLIDMGLL"
FT   gene            642120..643499
FT                   /locus_tag="Dole_0572"
FT   CDS_pept        642120..643499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0572"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: ppd:Ppro_1976 sigma54 specific transcriptional
FT                   regulator, fis family; TIGRFAM: PAS sensor protein; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; ATPase associated with various
FT                   cellular activities AAA_5; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66382"
FT                   /db_xref="GOA:A8ZU70"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU70"
FT                   /protein_id="ABW66382.1"
FT                   /translation="MAKKKTDNTLPQDVTGIILESISDGVFTVDNNWRITSFNRAAEKI
FT                   TGIPRKEALGRHCWEVFRSNMCEAECALKKTRKEGKPFVSTDSYIINSEKKRIPVTVST
FT                   ALLKDDDGEVVGCVETFRDHSQLEELRKELSDTWRMGDIVSRSPAMRRILKMLPQVAES
FT                   DSVVLIEGETGTGKELTAKALHSLSFRKDKPFVTVNCGAFPDTLLESELFGYKAGAFTH
FT                   AVKDKQGLFAAANGGTLFLDEIGETSPAFQVRLLRVLEDRAFTPLGTVKKEKTDVRILA
FT                   ATNAGLAKMVEAGTFRQDLFYRINVIRLALPPLRQRMEDVPLLVDHFIDRLNRLRGKTI
FT                   SGIDQEALEVLMTHRFPGNIRELENIVEYAFVLCSDDRIGVRHLPADLVRQEAEPSAGD
FT                   HGFDDPVRSAEVQAITDALARNDYNRNAAARDLGIHKSTLFRKMHRLGIPLPDRDGRTK
FT                   A"
FT   gene            643826..644344
FT                   /locus_tag="Dole_0573"
FT   CDS_pept        643826..644344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66383"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU71"
FT                   /protein_id="ABW66383.1"
FT                   /translation="MLAEIKDGEVVSRRYESIDPVWISHLADRLRELGVDVLICGAISQ
FT                   TPSTIIEANGIRLIPFIGGAIEEVLNAFARSGRIASDFLMPGCGRGQRRQGRGACPRSY
FT                   KEVNAMPRSDRTGPQGLGPGTGRGRGPCQGGRTGTGTGQGTGQGQGQGRGQGRGQGAGN
FT                   GAGQGKRNR"
FT   gene            644529..644849
FT                   /locus_tag="Dole_0574"
FT   CDS_pept        644529..644849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0574"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01170 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66384"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU72"
FT                   /protein_id="ABW66384.1"
FT                   /translation="MPGYNGTGPMGAGPMTGGARGYCSPAAAGQRGTGFGFGRGMAYRR
FT                   GGGFGPGRGAGGGYGRRFAGPQAPYGVSPTDEAAALKQQAQAMQNSLDAISARLAELEK
FT                   EE"
FT   gene            645231..645629
FT                   /locus_tag="Dole_0575"
FT   CDS_pept        645231..645629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0575"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_01178 response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66385"
FT                   /db_xref="GOA:A8ZU73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU73"
FT                   /protein_id="ABW66385.1"
FT                   /translation="MQALLVGSNRPAFTAMSAALEAAGFAVKWADTCESALAVSEAGPL
FT                   DLVIVDERVEGADGLECIKTMVTRNPFLNCAAVSTRSPEDFHEASEGLGVLMQLPPVPG
FT                   EAHARKLIDHLSAILNLGKKAGKKERAK"
FT   gene            645626..646480
FT                   /locus_tag="Dole_0576"
FT   CDS_pept        645626..646480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0576"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dps:DP0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66386"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU74"
FT                   /protein_id="ABW66386.1"
FT                   /translation="MIISVASGKGGTGKTTVATNLAVALGPDVQVLDCDVEEPNAHLFL
FT                   KPAFTDMEAVMVMVPAVDEEKCTYCRKCAEICRFRAIAVLGETILTFPELCHSCGGCIE
FT                   VCPEDAVYETSRKVGVVERGTGVGDTAFVHGRLRVSEAMAPPLIKRVRAYTRPSGLTII
FT                   DAPPGTSCPVIASVKDADFVVMVTEPTPFGLHDLKLGVEAVRMLGLPCGLVINRSDIGN
FT                   DEVWRYAEAENLPILMEMPFDRGIAEAYSRGEMVVERFPEWREKFVDMYGRITQLVEKG
FT                   GRK"
FT   gene            646477..647352
FT                   /locus_tag="Dole_0577"
FT   CDS_pept        646477..647352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0577"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dps:DP0340 similar to iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66387"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU75"
FT                   /protein_id="ABW66387.1"
FT                   /translation="MKELVILSGKGGTGKTSLTAAFAAITNNRVLCDADVDAADLHLLM
FT                   APAVKQETDFTGGGIAEIDPDRCTSCGRCLELCRFEAIRDDFVVDPIACEGCGVCVDLC
FT                   PEQAIDFPIQTCGQWYISGTRFGPMVHARLGIAEENSGKLVALVRQEARKLAEAQNLDL
FT                   ILTDGPPGVGCPVIASLGGATALLIVAEPTVSGIHDMGRAAELAAHFKVPAMVCVNKYD
FT                   LNPDQSDAIEALCRDRGLAFVGRIPFDPVFTKAMVYGKTVFEYDAKAEVTEAVRRLWET
FT                   IAASPEMNPA"
FT   gene            647434..647817
FT                   /locus_tag="Dole_0578"
FT   CDS_pept        647434..647817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0578"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: sat:SYN_01180 dinitrogenase
FT                   iron-molybdenum cofactor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66388"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU76"
FT                   /protein_id="ABW66388.1"
FT                   /translation="MKDGRIAVPSNGAGGLDGTRSGHFGHCDVFTLVDVKDGQIAQVST
FT                   ISNQEHVQGGCMVPVNLLAEHRVNALVVGGIGMRPLAGFRQVGIDVYHDDQRPEIRPVV
FT                   EDLIAGKLLQIRDDQVCGGGGGH"
FT   gene            648076..648825
FT                   /locus_tag="Dole_0579"
FT   CDS_pept        648076..648825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0579"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dvl:Dvul_0948 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66389"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU77"
FT                   /protein_id="ABW66389.1"
FT                   /translation="MTTYTIHPIVMGTKVFDKSMMTYQFGAGTPYTIPIYCWYIKGGDK
FT                   TILVDTGERNPICSAEREAAIGGKIYTFEEGLARWGIKPEAIDVVIHTHLHNDHCENDD
FT                   KCPNAVFYVHERELAHLHAPHPLDIRYVEDYLETVEENGQVVTVEGNTDIVDGIRVIHT
FT                   PVHTEGGLTVLIQTPAGTAAITGFCVIDENFNPPKEARAMEMEVIPPGTVVNSYKAYDI
FT                   MQAVRSMADILLPLHEPRFAAMGTIPE"
FT   gene            648853..649197
FT                   /locus_tag="Dole_0580"
FT   CDS_pept        648853..649197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0580"
FT                   /product="Protein of unknown function CGGC region"
FT                   /note="PFAM: Protein of unknown function CGGC region; KEGG:
FT                   afu:AF1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66390"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU78"
FT                   /protein_id="ABW66390.1"
FT                   /translation="MEKVAVVGCGAYMDNGYGCPGEWRCLKAAALGEGKFEAPATVVAF
FT                   IKCECPGRCLVPNVGMAMKLSEIKPDRIYLSSCLANAKPGCPYSNAEEMAKMIEGKFGI
FT                   PVVTGTHDYH"
FT   gene            649212..649682
FT                   /locus_tag="Dole_0581"
FT   CDS_pept        649212..649682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0581"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: mbu:Mbur_0621 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66391"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU79"
FT                   /protein_id="ABW66391.1"
FT                   /translation="MKVAVSSTGTDLSSQIDPRFGRCAYFVVVNTEDMGFTAFPNEGVG
FT                   LSGGAGVQAASFIASQGVSAVLTGNCGPKALQGLSAADIKIYAGLSGSVADAVEKFKSG
FT                   TLQEVTEATVAEKAGVAGGGGRGVSGGGRGMGGGGGRGMGGGGGGGRGRGMM"
FT   gene            649872..651311
FT                   /locus_tag="Dole_0582"
FT   CDS_pept        649872..651311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66392"
FT                   /db_xref="GOA:A8ZU80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU80"
FT                   /protein_id="ABW66392.1"
FT                   /translation="MRVNQAVEPAPTSLEAEKAQQSLWRLLPRFRGTPWFDQLLANEFL
FT                   PPDVQERRQLAMLQRTVARAFETVPYYGDRFQAAFGRPDIGRLSDLARLPVLTRLDIQA
FT                   HFDRMQSTALKPGQPMLPTQTSGSTGQPVTVLHTVESRRMFGLLKQRELRWFRWNPEKT
FT                   LAAVRSANEIPFSDDNRTAFENTFFCQTPHWPVIGSCFHTGPFCGMSCTAPLETQVRWL
FT                   DHVQPHYLMVIASKLEHLAFGYQQRPVPETLEAALSISQELTPRMRAFVEAVFRVPVHQ
FT                   NYGINEVGIIASRCPEGGRYHVNTELCVVEIVDADGQPCKPGQKGRLLVTALANDAMPL
FT                   IRYDTGDLAEAMEGPCPCGRTLPSFGMVHGRYNSIVSLPDGYWNYWIAFVGNFSSMPSH
FT                   LMQYIRQFQMHLFRDNIFELRLALTPGRPEALIEYVKSAWRPDTDNPPAMRIVEVDGFP
FT                   EPANGKFQMFTSDYITQPPIK"
FT   gene            651346..651765
FT                   /locus_tag="Dole_0583"
FT   CDS_pept        651346..651765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66393"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU81"
FT                   /protein_id="ABW66393.1"
FT                   /translation="MRDNLPVGKVYPLSVAPFEEMAHHEMAQWFERFVPVGFPVEMAVH
FT                   NVSVPKGIVPEMYVTPHAHEDHDEINIVLGAGGLSYSIILDGREQKVAAPAAVWVPAGC
FT                   SHSANAVSGEGFFICVKIKKEPVPPGISESDRLLR"
FT   gene            651871..652713
FT                   /locus_tag="Dole_0584"
FT   CDS_pept        651871..652713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66394"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU82"
FT                   /protein_id="ABW66394.1"
FT                   /translation="MTPSRPEHWSLHARQWRHIGPPLRPCTQDIRIFEQRIAAWHAETR
FT                   PADDSVALLLGVTPEIAAMSWPARTRLLAVDHNLDMVRYVWPGEAGCADSMAVCGRWQQ
FT                   MPVRKAAVSMVIGDGCFILMDFPEGYRRVADVLHQVLLPGGCLISRFFTRPAKAPTVSQ
FT                   LMAGLENGTIRSFDAFRIQLAMALQGDDVEKGVCLNDVWQAWQNADIDKEQIARNLGWT
FT                   PEAMALMDNYRGQPTRYFLPTQKEVGQIFGERFDLVEFFTGDYEMADLCPIMRFVPQR"
FT   gene            652724..653485
FT                   /locus_tag="Dole_0585"
FT   CDS_pept        652724..653485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0585"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: syn:slr1117
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66395"
FT                   /db_xref="GOA:A8ZU83"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU83"
FT                   /protein_id="ABW66395.1"
FT                   /translation="MDDYQLLIDLHKSADRQGPGGDAETEQAIFLAMPDRSKPLKIADI
FT                   GCGTGASALLLARLPKAQITAVDFLEDFLEVLEDRAASMGLSEKITTLCGSMDNLPFQD
FT                   EAYDVIWSEGAIYNIGFEKGVKAWRRYLPVGGLLVVSEITWLTASRPPELQKYWEAEYP
FT                   EIDTAASKIAVLEKHGYSPVGYFVLPAHCWLENYYRPMQNRFKEFLDRHKNSKAAQAVV
FT                   EAEIREIKMYEQYKPYYSYGVYVAKKVDQQP"
FT   gene            complement(653589..655706)
FT                   /locus_tag="Dole_0586"
FT   CDS_pept        complement(653589..655706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0586"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   sat:SYN_01949 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66396"
FT                   /db_xref="GOA:A8ZU84"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU84"
FT                   /protein_id="ABW66396.1"
FT                   /translation="MAKTQLDFTASADLLEAYGIPILGKMVTDPQQAVQVARDLGYPVV
FT                   LKAISEKIIHKTDAQVVFLNLKTEEAVKNALDRLMENVKQAGAGLPDGILVQKMADPGF
FT                   ELLVGAKQDPGFGPVTMVGHGGRFVELWADVQPGIGILTETDVEEMLSQTMAGTVLNGF
FT                   RGPALDKPAVIRLAINVSRFMADHPEINELDLNPVIVYEQGYAIVDCRLIADDPITVPS
FT                   GTDLSEEKMKSLKAVFSPRSVAIVGASRPGTMGGIILKNCLGIPTVYPINPKLKTVQGL
FT                   TCYPDFDALPEAPDLGVFAVNAEATVESFERFCKAGGRGAIIFSDGFAEIGRKDLEERL
FT                   LELSIQYDVAYIGPNCMGVIDNFSKVNTLFIPEHRTSVIRGSSGIGIISQSGGVGLELM
FT                   EMMEADNLDLGMWVSCGNASSVGVAEILAHMGNDPRIKVIAIYMEGFDNGLKLMQVGKT
FT                   VSAKKPVLVIKGGTGGGAAATLSHTASLAGSHEAFKACCRQAGFYLVEELTEDPKVLVN
FT                   ILSMLSSQPAAGGNRVAVVSVGGGAGILLADRVTEECMELAEFAPETRKALQDLMADNI
FT                   KTARPEDKATIVAGIGSNPLDLFGNCDDDRLLAALRIIADDPNTDIILTAIYLQVPYLS
FT                   EYLPERLIDLQRDLKKPLIVSPRGFSKHVARSRAYLYSKKFHTYTVPMIKPMSIAIKVW
FT                   CDYGRSFIPEE"
FT   gene            complement(655802..657517)
FT                   /locus_tag="Dole_0587"
FT   CDS_pept        complement(655802..657517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0587"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   sat:SYN_00833 transglutaminase-like superfamily member"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66397"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU85"
FT                   /protein_id="ABW66397.1"
FT                   /translation="MKRFAVGLLACVTFFTGPAFAENYLLNGGQDSAIAYQMVQSITPA
FT                   PDTRKLFLSYVKPVSFTSPTYNQAVESVNITFSVAPDSQTSKTDENGNTIMEAAWNNPA
FT                   QPVSATLAFNVKNSVRLDTLKTSAPFPVAGLPDAVKPYLAATDQVPASDPAITQKAREL
FT                   TASAETQFDAVRRVLTWVIDHMRYVQPPESYDAMYAFTSGKGNCQNYSHLSAALMRAAG
FT                   IPVRIVNGVTLKNPYEIKQGDTVLIMKNAEGRHSWIEVYFPDLKWVPFDPQCTELFVSN
FT                   RFIRVEVGLDNNDTENDGLIRWTRVKGSTGKPSFREDIRADFLSDNVTLAGTKTDYGPK
FT                   NKMFGPPVTAAFQKVTKVYKEPEPEPVKPERLKTLVFSEPFVFGNLEFPKHLDFQTARA
FT                   RTEEAPDGSMKMVKTFLVETAEYVTTQGKKYAQSFVLDRPVKLSAIGLALHNFSSDGQL
FT                   WVELFTDKNGIPDQQMAVSDMVFLADRVYKPGYDWVNFAFAGQEIVLQPGRYWAALGFT
FT                   GGPIVNWFFSYGKPTGPQDGTRYRTLFDEQWSHSHAFEFNYRVTGLAPKDFKAE"
FT   gene            complement(657664..658968)
FT                   /locus_tag="Dole_0588"
FT   CDS_pept        complement(657664..658968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0588"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gme:Gmet_2078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66398"
FT                   /db_xref="GOA:A8ZU86"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU86"
FT                   /protein_id="ABW66398.1"
FT                   /translation="MNPIAKELNDILQAKSPHIFDMLSDVGKSLFFPKGILSQSAEAKE
FT                   KAHAINATIGIAKEEGGIMCLPSVMDQVAPLVPEESLTYAPSFGIPGLRKAWQKGLYEK
FT                   NPSLAGQAVSLPVVTCGITHAISVFADVWTNPGDTVLLPHMFWGNYNMILNVRGGVNLS
FT                   HFPLFNEAGGFNVKGFEKAARAAAEKDGKLITLLNFPQNPTGYTLTHAEGEAMTAVLTD
FT                   IAAGGTNVMVVCDDSYFGLFYEENVMKESLFARLCGAHERLLAIKLDGATKENYVWGLR
FT                   IGFITYGCKAGASADVYDALEKKTAGCVRGSISNASHLGQSIVLKSLENANYQKERQAK
FT                   GEVLKARANKVKQVLADSRFDDAWEVYPFNSGYFMCLKLKKVKAETLRVHLLDKYGVGL
FT                   IALGEHDLRVAFSCIEEADVQRLFDIIYKGAKELQ"
FT   gene            659151..660308
FT                   /locus_tag="Dole_0589"
FT   CDS_pept        659151..660308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0589"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF362; KEGG:
FT                   mba:Mbar_A0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66399"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU87"
FT                   /protein_id="ABW66399.1"
FT                   /translation="MVGLPMDGTKGARVKTQDRVLIMDAAYEAEVMADVVDRVFDTFPL
FT                   DLAGKNVLVKPNILSGYAPEKAVTTHPVLVSAVVEKLRGAGARVMVGDNPGLHGYGRSE
FT                   KAARIAGILQAAGDSFINLGGRPVRHTVSSRVIDHVMIASEVLSADLVINLPKLKTHGL
FT                   TYFTGAVKNTFGYVVGGDKMRVHADAPTPVKFAEALVDIFSIRPPDLTIMDAVLAMEGN
FT                   GPSSGAPRFVGKVLAGTNAVSLDAAAVTLVGKKPARIPHLRIAAQKGLGPIDMADIEIN
FT                   TPIVPVAGFKMPVTFLPGIMGVVLNRILSRRMNCTPEVVEAVCKQCGICVSHCPVNAMT
FT                   MAEGEFPRADAAACIHCYCCQEMCPEHAIELTGRVMSFFRRRNIH"
FT   gene            660321..661238
FT                   /locus_tag="Dole_0590"
FT   CDS_pept        660321..661238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0590"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   sth:STH2808 putative muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66400"
FT                   /db_xref="GOA:A8ZU88"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU88"
FT                   /protein_id="ABW66400.1"
FT                   /translation="MDLAPMSKIKPRALAFGDTIGIAAPAGAFDADRLEKGLSVLQAMG
FT                   FLVRLPDGTHASQRYLAGTDEHRAAMFNNLFADPEIKAVACARGGFGALRMAPLLDMDA
FT                   ITRHPKIFLGFSDISVLLSILGRKAGLITFHGPVVTSLADADDATIASLADALTTTEPL
FT                   RIDLAEGMSLVPGTAQGPVAGGNLASLCQMIGTPWQPAFDGCILFLEETSEPAYRVDRM
FT                   LTQMRLAGCLAGVAGVALGRFDRCGHMDVIFEIVREHLPEGVPVLAGFPVGHNGTNRTL
FT                   PLGVWASLDAENRFLEYHEPALAR"
FT   gene            661863..662945
FT                   /locus_tag="Dole_0591"
FT   CDS_pept        661863..662945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0591"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sfu:Sfum_0547
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66401"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU89"
FT                   /protein_id="ABW66401.1"
FT                   /translation="MRQAEELMKEGVAIGVFPGGVLCVWVKGAVRFCKAYGVTDLESRH
FT                   PVTTDTVFDLASLTKPLATAPAILKLADQGFLSVEDPAGKYLDGFDAGDKKEITIAHLL
FT                   CHTSGLPAHREYFYDLSTTAFEDRQPALKKLLENEPLEYRPGEKVVYSDLGYMVLGFIV
FT                   KAVSGLALDRFATDRLYRPLAIFDLFFIPINPETAVNNPLGLSNVAATENCPRRKMVVR
FT                   GVVHDDNAYEMGGVAGQAGLFGTAGAVTAFAAEILDVYSGAKPGPVFSSAMAAHMMAPQ
FT                   CGTNRTFGFDTVDPENSSAGRLFSARGAGHLGFTGTSCWIDPDREAVVVLLTNRVHPDR
FT                   ASDAIRAFRPRLHDAVMVHV"
FT   gene            663102..664145
FT                   /locus_tag="Dole_0592"
FT   CDS_pept        663102..664145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0592"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: sfu:Sfum_2592 cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66402"
FT                   /db_xref="GOA:A8ZU90"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU90"
FT                   /protein_id="ABW66402.1"
FT                   /translation="MNIIANAILGLFSNDLAIDLGTANTLVFVKGKGVVLSEPSVVAVY
FT                   TDTRHKNRVRAVGAEAKQMLGRTPGNITAIRPMQDGVIADFAVAEAMIRYFIQKVHNRR
FT                   KFIRPRIIIAVPSGITEVEKRAVKDSAERAGAREVLLLEEPMAAAIGAGLPISEPTCNM
FT                   VVDIGGGTTEVAVISLGGIVYSRSLRVAGDKMDAAIAQYIKRKYNLLVGERTAEMIKMT
FT                   IGNAYPDEDNVETIEVKGRDLVSGIPKILAIDSEEIRLAISEQIDAIVETVKIALEQTP
FT                   PELAADIVDRGIVLTGGGALLKNLDKLLREESGLPITVAENPLTTVAVGSGMALDNIDI
FT                   LKQVMIT"
FT   gene            664193..665026
FT                   /locus_tag="Dole_0593"
FT   CDS_pept        664193..665026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0593"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: gur:Gura_2860 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66403"
FT                   /db_xref="GOA:A8ZU91"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU91"
FT                   /protein_id="ABW66403.1"
FT                   /translation="MFSRRMLVIVGIAGMLIVSLVFFAVTGRRATYPVSGGGVGMLVVA
FT                   PIQEMVTGSARFVRNTWRRYFALVSVAHENERLTDALAREIAENNRYREMELSSRRLRE
FT                   LLNFYETVDVKSFAAEVVARDPSGWFNTVIIDKGSTHGVRRSMPVVVDEGIVGQVVDTS
FT                   RYYAKVLLIIDPNSSVDGLCQRTRARGVVKGTIHERCDFMYVLRKDDVRVGDSVISSGL
FT                   DGIYPKGLPIGRVSAVVKRNAGIFQTVEVDPYVDFGKLEEVLVILNAPRHEFQDM"
FT   gene            665039..665542
FT                   /locus_tag="Dole_0594"
FT   CDS_pept        665039..665542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66404"
FT                   /db_xref="GOA:A8ZU92"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU92"
FT                   /protein_id="ABW66404.1"
FT                   /translation="MRYLVCLMVCVLLIVAQSAAPPAYSPLYGLYDWLIPLLIYLAVFR
FT                   SPVEAGVTALGAGLMMDAVSGGAFGLYLLTYLWIVAGVRISLRFFHGEGVPFLFFAVLA
FT                   GVLIETLVFWGAGRVAGHAYAFGGSAAGGLARQLVLAGITGPFVVLGFNAVLGQLLIRL
FT                   DRPV"
FT   gene            665691..667595
FT                   /locus_tag="Dole_0595"
FT   CDS_pept        665691..667595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0595"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   sfu:Sfum_2589 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66405"
FT                   /db_xref="GOA:A8ZU93"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU93"
FT                   /protein_id="ABW66405.1"
FT                   /translation="MTRGAAQRRYWAFYKAIRIFRVEDYFATLDADWFKHRLVALSLCV
FT                   AGVFVVLFARLFFLQVVEGEEYRRLSENNCIRLQRIEPPRGQIFDRNGVNIVDNRPSFD
FT                   LSIIPKDAGNPGKIIERLVALTGIPAARLHGNFVKHKTVNPYKPVLLAQDVGRDVLAVV
FT                   EGHRFDLPGVVMDVTPRRQYLYNGFAAHLIGYLGEISRNELGSDRFAGYEPGSYVGKYG
FT                   AERLYEPFLRGRYGGRQVEVNAGGNVVRVLKTVEAESGHHVYLTLDFNLQQKAEALMAG
FT                   VSGAVIALDPDTGAVLAMVSSPSFPQSRFVDGMSAEEWQALVTDPRRPMENKAIQAEYP
FT                   PASVYKIVTSFAGLEEAVVEPDTTFYCPGYYRYGDRVYRCWAEQGHGRVSVVDALARSC
FT                   DVYYYQVGQRVGVERLSWYAKACGLGRPTGIDLYPEKGGLVPSGQWKRRRLGTAWQGGE
FT                   TLSVAIGQSYNLVTPLQMAVLTAAVANGGVLKRPVILDRVETVEKERLKEGEPRDMGML
FT                   PVSDATLEIVRQGMWKAVNDRHGTAWWSARSRKVEISGKTGTAQVVASPRNGDEEIYAV
FT                   DTHKPHAWFVAYAPSENPVIAVAVIVEHGEHGSSAAGPVAKAMIETYLSDKGGSTDGR"
FT   gene            667592..668698
FT                   /locus_tag="Dole_0596"
FT   CDS_pept        667592..668698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0596"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: gme:Gmet_0929 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66406"
FT                   /db_xref="GOA:A8ZU94"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU94"
FT                   /protein_id="ABW66406.1"
FT                   /translation="MRESWESRQFDWGLLLPVVALGMIGVIVLYSASASAPAHLQKMLC
FT                   IKQAVWFVLGLVLAGGSLLFHYKRLDNWAIVIYIFSMALLVSVLLWGKAAGGSTRWLPM
FT                   GPVAIQPSELAKIAMIIILARYYAKQATADGLGIKKLLVPILLVGIPFVLIGMQPDLGT
FT                   AMLLALIATVVTLFIKVQKRTLYLMGGVMGVLLALGWFFLLKEYQKQRVLTFLNPDRDP
FT                   LGAGYHIIQSKIAIGSGMVFGKGFMQGTQNALAFLPEQHTDFILSVMAEEWGLVGVSVA
FT                   LFLYLLIIIWGISIGYQCKDNFGIILAVGVTAMIFWHVVVNVGMVMGLLPVVGVPLPLI
FT                   SYGGSSVVTFMLGIGLLLNISMRRSGVE"
FT   gene            668796..669161
FT                   /locus_tag="Dole_0597"
FT   CDS_pept        668796..669161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0597"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   afw:Anae109_4500 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66407"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU95"
FT                   /protein_id="ABW66407.1"
FT                   /translation="MGKTEKGPDAITTFLGADASVEGTVSFEGTIRVDGRVTGKVTSAS
FT                   GTVIIGEKAVIDGDVSVDVAIIKGRVNGTVDAASRIEVYPPAAIEGDIHAPVISIDAGV
FT                   KFNGNCSMASRKHTEIK"
FT   gene            669338..669856
FT                   /locus_tag="Dole_0598"
FT   CDS_pept        669338..669856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0598"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: sat:SYN_00549 ATP synthase B chain, sodium ion
FT                   specific"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66408"
FT                   /db_xref="GOA:A8ZU96"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU96"
FT                   /protein_id="ABW66408.1"
FT                   /translation="MRLDKKISAGAAMACGILLSARAASAEGGITVIPDGSVIWQMANF
FT                   IVLVVVLNFVLYKPIRTVVARRKEKMEGLDNNIEAYTQDAADKERAFAEGIKKARTRGM
FT                   DEKNALIEAAADEEKKIMEGIYQQSQMTLAQTREEITRDAARAAEALQREIDEFAAAIG
FT                   SKILGRDVA"
FT   gene            669853..670455
FT                   /locus_tag="Dole_0599"
FT   CDS_pept        669853..670455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0599"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: dvl:Dvul_2191 H+-transporting two-sector ATPase, B/B'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66409"
FT                   /db_xref="GOA:A8ZU97"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU97"
FT                   /protein_id="ABW66409.1"
FT                   /translation="MRLFGMCESVKKKAAVIVVVSLMAFCCAGFAVAAEHGAEAAPKGW
FT                   VATDTFRVMNFAVLAIALFLLLRKPVAGALNNRIAGIREELARLEAQKEEARKALEAYN
FT                   ERLKMLDKEAEKIIEDYKKQGEAAKARIMESAQASAAKLEEQARRNIDNEFESARQKLR
FT                   LDIFEQAVARAEALVTEKITPDDQHRLVEEYLDKAVL"
FT   gene            670455..671006
FT                   /locus_tag="Dole_0600"
FT   CDS_pept        670455..671006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0600"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: sfu:Sfum_2585 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66410"
FT                   /db_xref="GOA:A8ZU98"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU98"
FT                   /protein_id="ABW66410.1"
FT                   /translation="MKNYVIQRRYAKALLLIGKEDNNAEQYKEELNGFVSVLDMEKAFE
FT                   SAITNPLYPVEARRKVLDMVIEKLGVSVMMRSFLALLFEKRRIQHVRGINEVYQNLVDE
FT                   LKGIVRADVVSAGELSDDVVEKIRASLSKMTGKQVIVDIAQDPTLIGGIVTKVGDMVLD
FT                   GSIKTQLSNMKESLKKGERV"
FT   gene            671006..672523
FT                   /locus_tag="Dole_0601"
FT   CDS_pept        671006..672523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0601"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: dps:DP0832 probable ATP synthase, alpha chain
FT                   (AtpA); TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66411"
FT                   /db_xref="GOA:A8ZU99"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU99"
FT                   /protein_id="ABW66411.1"
FT                   /translation="MEIRAEEISQIIKEQIRGFDKKVELSETGVVLSVGDGIARVYGLE
FT                   KVMTMELVEFPGGILGLVLNLEEDNVGVAIMGEDTNIKEGDIVKRTGRIAQVPVGEAVL
FT                   GRVVDTTGAPIDGKGPINASETRRIEVVAPGVIARKSVHEPCYTGLKAVDAMTPVGRGQ
FT                   RELIIGDRQIGKTAVAIDAILAQKDTDVYCIYVACGQKKSSVAQVAAILEKHGAMEYTT
FT                   IVAACASDPASLQYLAPYAGCSMGEYFRDNGKHALIIYDDLSKQAAAYRQVSLLLRRPP
FT                   GREAYPGDIFYNHSRLLERAAKLNDELGAGSLTALPIIETQAGDVSAFIPTNVISITDG
FT                   QIYLEPNLFFAGIRPAINVGLSVSRVGGAAQVKAMKQVAGTLRLDMAQFRELEAFAAFG
FT                   SDLDAATQRQLTRGARLVEILKQPQYKPLSMEKQVTILFAGTNGHLDELPLDAIAAYEA
FT                   GLYTFIETKYPQVFADLKEKQAFTDEIKQTLTKALGEYGQEFKDTIK"
FT   gene            672566..673462
FT                   /locus_tag="Dole_0602"
FT   CDS_pept        672566..673462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0602"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: dde:Dde_0986 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66412"
FT                   /db_xref="GOA:A8ZUA0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA0"
FT                   /protein_id="ABW66412.1"
FT                   /translation="MPSLKEVQLKIKGVKQTKKITKAMNMVATSKLRGAQTNMEAFRPY
FT                   AEKFAEVLGSLAAKAGEETSPLLVPKESVKRVNVVLCTSDRGLCGGFNTNLVRMANAYL
FT                   KRCQEKEIEVSFTHFGKKGRDWCRKMTDCERKSEYLGVVGARFGFNVAVTAGRELINGF
FT                   LNGDYDEVHVIYSEFQGMAKQLPVIRQLLPIPPIETADSPASDGGEDYLAEHICEPSPD
FT                   EILDAMLPKNVFIQIYSALLETSTSEHAARMAAMDNASKACNDMINELTLLYNKARQAA
FT                   ITAELMDIVGGAEALKG"
FT   gene            673501..674904
FT                   /locus_tag="Dole_0603"
FT   CDS_pept        673501..674904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0603"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: sfu:Sfum_2582 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66413"
FT                   /db_xref="GOA:A8ZUA1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA1"
FT                   /protein_id="ABW66413.1"
FT                   /translation="MSDNIGKVVQVMGPVVDVEFEPGKLPAILTALLITNTVINDEADN
FT                   LVVEVAQHLGDNVVRTIAMDVTDGLVRGMPVKDTGAPITMPVGAASLGRVLNVVGKPVD
FT                   GLGPVSREKTMPIHRPAPLFTEQDTSVNVLETGIKVIDLLVPFPRGGKMGLFGGAGVGK
FT                   TVIMMEMVNNIAMQHGGISVFAGVGERTREGNDLYHEMKDSGVLPKAALIYGQMTEPPG
FT                   ARARVALSALTCAEYFRDVEGQDVLIFIDNIFRFTQAGAEVSALLGRIPSAVGYQPTLA
FT                   VDLGGLQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIAELGIY
FT                   PSVDPLDSTSRILDAAYIGEEHYRVAREVQQTLQKYKELQDIIAILGMDELSDEDKVTV
FT                   ERARKLQRFLSQPFHVAEVFTGKPGSYVKIEDTVRSFKEICDGKHDDLPESAFYMVGSI
FT                   EEAVAKAKG"
FT   gene            674928..675329
FT                   /locus_tag="Dole_0604"
FT   CDS_pept        674928..675329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0604"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: dvl:Dvul_2196 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66414"
FT                   /db_xref="GOA:A8ZUA2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA2"
FT                   /protein_id="ABW66414.1"
FT                   /translation="MAENLRLEVVTPEKTVVSDDAQIVMAPGVLGEFGVLVNHTPFLTS
FT                   LMPGALHYKDTGEKEHLLFVSDGFAEVLPDRITVLVESAERKEDIDLQRAEAARERAEK
FT                   RLESGEDVDFVRAKAALTRAIQRIRVAGA"
FT   gene            675400..676245
FT                   /locus_tag="Dole_0605"
FT   CDS_pept        675400..676245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0605"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; Nucleotidyl transferase; KEGG: sat:SYN_02437
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66415"
FT                   /db_xref="GOA:A8ZUA3"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA3"
FT                   /protein_id="ABW66415.1"
FT                   /translation="MFLPGFVPVCRRHGPGLKNKYLEYGYKMSNSPVSIVILAAGLGTR
FT                   MKSDKAKVLHEIAGKSMLSYVLDAALTVTACEHVVVVVGCQAEAVRAEAAKKGGVRFAF
FT                   QERQLGTGHAVQCALDALSEETGDVVILCGDVPFIAGDTICRLVAAHRQEARAVTLLSV
FT                   ALENPTGYGRVIRDPEGNVSRIIEEADASEQEREINVVNAGIYCVKKDFLAWALSRIEP
FT                   HNAQNEIYLTDIIGVAYTNKRRIGTLVCPDADEVIGVNSRADLARAEERMAAGLRGKTS
FT                   "
FT   gene            676293..676568
FT                   /locus_tag="Dole_0606"
FT   CDS_pept        676293..676568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66416"
FT                   /db_xref="GOA:A8ZUA4"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA4"
FT                   /protein_id="ABW66416.1"
FT                   /translation="MNEQETRQLHDQFDEIEKRVEQLFKTIESLETANIQLKDRINQLE
FT                   QEVKEKAEAQERFVEEKALVRSKIDALIEKINHFKSLEGNATVGQQ"
FT   gene            676602..676892
FT                   /locus_tag="Dole_0607"
FT   CDS_pept        676602..676892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66417"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA5"
FT                   /protein_id="ABW66417.1"
FT                   /translation="MGEHITIHLFGKSYTFEADADVPNAHAVADLLEQEVTVVAKKAGG
FT                   TAISRNPFAMLTQAALNIANECVGLRSDRHRMVQAVTTRSQALIQAMDARL"
FT   gene            677324..678886
FT                   /locus_tag="Dole_0608"
FT   CDS_pept        677324..678886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0608"
FT                   /product="RNA binding metal dependent phosphohydrolase"
FT                   /note="KEGG: sfu:Sfum_2578 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: KH type 1 domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66418"
FT                   /db_xref="GOA:A8ZUA6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA6"
FT                   /protein_id="ABW66418.1"
FT                   /translation="MNIYTGVAGVAGVVIGYVLAVVIQNWLARKKVNEAREESRRIVED
FT                   ARLRAENLVKEAKLEAKDRLFKMKSDFDAETADARKELKKLEQRLISKEENLDKKYDQM
FT                   ERREQEVVKKEKRAQKIEEEVEQKQAEYDHLLAEQKRQLEVVSGLTAEQAKEILVRSME
FT                   DEARHDAAKLIKKITTEAEEEAVKKAQKIISTAIHRYAGDYVAEKTVSVVELPGDEMKG
FT                   RIIGREGRNIRALEAATGIDLIIDDTPEAVILSGFNPVRREVARISIQRLIADGRIHPA
FT                   RIEDVVKKVEVEVAATIKEAGEQAAFDLGVHGINPELVRILGSLKFRTSYTQNVLQHSI
FT                   EVGFLCGIMAAELGLDQKLARRMGLLHDIGKAIDHEVEGPHALIGSNVALKYGESAEVA
FT                   HAIGAHHEDVEPQSVYDVLVQASDALSGARPGARKELLENYIKRLEDLEKIANAFKGVA
FT                   TAYAIQAGRELRVMVEGEALSDEESVVLSRNIAKQIEENLTFPGQIKVTVIRETRAVEY
FT                   ANK"
FT   gene            679115..680416
FT                   /locus_tag="Dole_0609"
FT   CDS_pept        679115..680416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0609"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: sfu:Sfum_2577 tyrosyl-tRNA synthetase;
FT                   TIGRFAM: tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66419"
FT                   /db_xref="GOA:A8ZUK6"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUK6"
FT                   /protein_id="ABW66419.1"
FT                   /translation="MSVVDILSERGFVEAFTHEQELRDLAAESAVTCYIGFDPTASSLH
FT                   VGSLVPIMALAHMQRNGHRPIALVGGGTGLVGDPSGKTEMRQLITPETVEANIEGIQRQ
FT                   LSRFIDFDGGKALLVNNADWLTGLEYIPFLRDIGRHFSVNRMIKAESYRMRLESEEGLS
FT                   FIEFNYMLLQAYDFLKLCGDRDCVLQMGGSDQWGNIVAGIDLVRRVLNRQVYGLTFPLI
FT                   TTSSGAKMGKTAAGAVWLDAERTSPYDYYQYWINTDDQDVARFLSLFTFLPMPEIQEVK
FT                   RISGADLNSAKAVLAFEATRIAHGTDAAVQAHSDAAVNFGRRDIPQDLLPSSTIPRDAE
FT                   GTGAAVSGTAPQTEMTMAELSEGIPAFVLFHTVGLADSKGQARRLIQQGGGYVNDRRIE
FT                   SDEYRVSAEDLDDAKIVLRAGKKRYHTIVVRKGA"
FT   gene            680920..682475
FT                   /locus_tag="Dole_R0011"
FT   rRNA            680920..682475
FT                   /locus_tag="Dole_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            682656..682733
FT                   /locus_tag="Dole_R0012"
FT                   /note="tRNA-Ile1"
FT   tRNA            682656..682733
FT                   /locus_tag="Dole_R0012"
FT                   /product="tRNA-Ile"
FT   gene            682852..682927
FT                   /locus_tag="Dole_R0013"
FT                   /note="tRNA-Ala1"
FT   tRNA            682852..682927
FT                   /locus_tag="Dole_R0013"
FT                   /product="tRNA-Ala"
FT   gene            683476..686073
FT                   /locus_tag="Dole_R0014"
FT   rRNA            683476..686073
FT                   /locus_tag="Dole_R0014"
FT                   /product="23S ribosomal RNA"
FT   gene            686201..686317
FT                   /locus_tag="Dole_R0015"
FT   rRNA            686201..686317
FT                   /locus_tag="Dole_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            686449..688872
FT                   /locus_tag="Dole_0610"
FT   CDS_pept        686449..688872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0610"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: pgi:PG1180 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66420"
FT                   /db_xref="GOA:A8ZUK7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK7"
FT                   /protein_id="ABW66420.1"
FT                   /translation="MNNDAHGYAFKTGRVDLLNRWFERIGGGAYHYRWAVLLLCAVLLC
FT                   CGAWAASLVRFDNSFKSYFDQNDPAYKAFLEFREVFGSDEISYILYQAPDAAHGIWNME
FT                   VMQKIRDLTRRLKQEVPFVKEVTSLANAEFVEGVEGDLLVHDVLEDFPETQAALLAIRQ
FT                   KILNKPIYINGLVSRDGTYGAILVEMEKASVDALEEIRFDPGKGDALENLYPQVTYDRI
FT                   ETILAMPEYEGIRFYHTGDVPLNAAYNRISQQESTRLAIISFAVIGGVLLFFFRSVRGV
FT                   AGPLVVVLCAMLASVGFMAVFSWDMDLMFIMLPALLVAVGVADAVHVLSEFNIYYQKYG
FT                   DRKAAVKKALFLVGVPCLFTSLTTMAGFASMSISPIKAIKHFAIYSAVGVGAAFLLSVT
FT                   MLVVFLSFGRRRKEPGRQDRQNRVSHLAAAFLGGLARCNVRYKTTILAGFAVIFVLSLA
FT                   GMTRLQVDSNFISEFSKRAPIRQVTEHVDSVMGGSTSFSYVFDSGTPDGVTDPAFLKRI
FT                   EALQRAAEKKPVVMKAYSVVDMIKDINREFHNGDPSYYRIPDTQEEAAQLLLVYEMSGG
FT                   EELDDYLSGDFQKARLELRCQAVATSQYKSMVDELGTFLVSSGAEKEDLPVLAGMGTLW
FT                   LTLLDYITKSQIIGFLVAFSVIAGMMCVVLGSVRVGLLSMVPNLTPVVITLGLMGWAGI
FT                   PLDYVKLLIASIAIGIAVDDTVHMVIRYRHEFARHRNYQEALLAAMLGVGRALLVTSVV
FT                   LVAGFLVFTGSIMQTLSDFGILVACTIAVALLADFLLLPSLVLTLKPFGEENTV"
FT   gene            689453..690847
FT                   /locus_tag="Dole_0611"
FT   CDS_pept        689453..690847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0611"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   aeh:Mlg_2639 type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66421"
FT                   /db_xref="GOA:A8ZUK8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK8"
FT                   /protein_id="ABW66421.1"
FT                   /translation="MEKAVSARRCVRRKIVSGITTGALTVALLCLAGVPSVLYAADLMT
FT                   VFNQALENDPRFVGMRHERDAEQERLRQAWAGVLPSLSAEGVHKETAQDIVSSDNTVFG
FT                   SGSSDFPTTEYTLSLTQPLFNLSSFINIRRASALVRGADLELEAARQELAVRVAQAYFH
FT                   ALAARDRLTATAAEEAAVGGHYELVNERFNRGLSTRTEYYDAKARLADIMARRLTAESD
FT                   LDDAYQALAEITGSPVEDLSLLHEELPLVSPDPVDADAWIEAAVRQNPSLEAVRQSVAS
FT                   ARQEVRRQRAGHYPNVNLEASHNWRETDGTLFGGGSEVETSEILFRLNVPLYQGGMVNS
FT                   RTREAICRMNALLQEESRQTRALQRETRAAFYGVDNAIERVRSLRDAVEAQQLALEGKK
FT                   EGHRSGLFTVLAVLDAERDLSLARQNYAMARYDYIINSLVLKKTVGTLDDANIAGVNGW
FT                   LRNVSE"
FT   gene            690896..729121
FT                   /locus_tag="Dole_0612"
FT   CDS_pept        690896..729121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0612"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   gsu:GSU1154 surface repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66422"
FT                   /db_xref="GOA:A8ZUK9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK9"
FT                   /protein_id="ABW66422.1"
FT                   /translation="MPRIKVGSKAGEKDKKKKRRAARKERPFQFEALEPRLLLSAEMGI
FT                   PPADPENLTATPAPVVENVDRFNDVTTTPAADGIKDDGEVKTVADNGEKEGPAAPEKPD
FT                   PSHALTANDVVDAEPAPGTTLFSDTVDKITAERALRQVVVIDPAVVDTNHLLTAIDGSR
FT                   QDARIINLAGNADLPADTSAGSLLDIYLLDGSRDGVAQLTDILENYDTLDAVHIFSHGD
FT                   TGAVYLGTTPVTGENLADRQNDLTAWGAALAPDGDLLLYGCDVAAGDDGVAFVETLAAF
FT                   TGADVAASTDRTGPVDLDGNWDLEFQTGPVETPVLSNATTGYSHLLETFVSTGDNETFE
FT                   GTGANDIFSFDDNWGSDTIVNGGGSNTVNFSAVSADLIFTFHADGTVSATDGENVLNPA
FT                   EGISTIIAGSGDNRFVFERGAVFSGTINAAAGATNTLDFSGVAPVIDPVDEDAPDRTGL
FT                   DLVFTVHAGGAVSVSADGSAILGSTASMDAIIGGGGDNRFAFADGAAFAGSIDGGEGGS
FT                   TTLDYSAYTSAVAVDLTAGTATGVTGGISNFSNIVGGAGNDILTGDEYANEITGGSGSD
FT                   IIDGGIGDDTLTGGIGNDVFRFSDDWGFDAITDGDVGANTLDFSNATADLEVIFAADGT
FT                   LSVDDYTSLLETGGSVAAITTGTGDDNFVFENAAAFDGTITGGTGTNTLDFSAYQTPVR
FT                   IDLGAGTVDMGGFVNDAGVMEGMTADMPLAYLNSGDGVGVAGITDETLLADLNDSAGVG
FT                   LTVELTTATLLADLNNGAGVGIAPALIATTLLADLHDGAGIGVVDGDDIHITLTNGDTV
FT                   DIDLDGCATLEDVLTAISAADARLGATINADGNGINITDTAGGAGDLAVSTLNYSLAAS
FT                   DLGIEGAGTGNLLEGSMIINGLGIVLTDGTRVNADLSGAVTVADVLAAINAAGGGKLSA
FT                   EVNALGNGINITDTAGGEGDLRVAGLADSPVAANLGIDGYGLDGVLEGSALMHDLRVTL
FT                   TDGTAVDVSLAGVETVGDVLTALNSVDISLYAVINAAGNGFELYDDAGGAGDLAVSALN
FT                   GGTAAPGLGITGTGTGDTLTGTTLVYDISITLTDGTTVNVALGGTATVGEALAAISAAH
FT                   PALSAVINGTNNGINISDTAGGAGNLTIADLGTSTAAADLGIAGTGAGALVAGTVLVAP
FT                   VSTAHFTGISNAAGGAGADLLIGNSQDNVLDGGGGGDTYRFAAGWGSDKIVDYGTDGSD
FT                   VLDFSAVASNLAVTVHADGTVSVTDGASTLDNADIIEGIVGGSGSNTFAFEDQADFAGF
FT                   IDGGTGTGNTLDYSAYTTGVTVGLADVTATGTTGVDNIQNITGGSGDDTLTGDDQANTI
FT                   TGGDGNDTITGGGGADTLSGGAGDDTYVMTNDGATVTITEAAAAGTDTLDYSEWGAPVT
FT                   VNLSTGTAPGTSGVNNIEQAIGTRFADTLAGTTGDDTFVFHDGWGTDTVTDPTATDSDT
FT                   LDFSAVTAALTFTFTGTGAVSVSDGTSALNNVANIENLTGGKGDDHFVFADNWGNYTIT
FT                   SAGDVDNDTLDFSAVTANLTFTIHSDGTVSVTDGTNTLGASGGIDNIVGGSGTNTFVFE
FT                   DQGFLNAYIDGGTGTAILDYSACTTAIAVDVSNMDVTVTRTVDGAAVTTTLIGSASGLK
FT                   GINRIDAVIGGTSAGDTLTGFEEDTAWTLSGENAGSVAGGTTLRNITFSGFENLAGHAD
FT                   HDDTFTIQAAGSLDGALIGHPYGPATGTDTVRIANGAYTTVTLASAGEDAGWIDRDGDQ
FT                   IRYIGIDRVEDLSTATTRTVASAADRTAEVYLAGDPYEKDQEWILTVDGVDYVHTVASD
FT                   NEVLADVIADWVGLLQGAGYVAIARNSTLQVTGPAGTTPVVTATLPDGILFLVDDPETR
FT                   DADIRLERDSGTGRITVVSGSDSFVDFEFVEPTTNLNLETGAGNDRVTVGTGFSPTTAA
FT                   VTIDGQAGADHVAYEVTGIAGTAQTITHAANTLSNSGTAIFTYTADTEYAKDITVFGTA
FT                   GNDQMAMADGAGTTYVVSSTTATFGDITLDDPGAGGILTLNGGDGDDTITVNVTGLAAD
FT                   LVLQGGKGDNTVTAVNGTFATLNLGGDFTTMNAAGATVTDFVFDARPSIANRVTVSRVG
FT                   GQIQIVDETDIGTTTTTINDPTGSLTINTGYNAPETTEYIHLGALTLDADLILDAGSLN
FT                   RNSDGGDTVLIQGDLVLGGHSLEIKADTITVESGVTVNTGDASGTTAGNITLEGHDITL
FT                   ETGASLLAADDVNGDITILAVDNTALFVPLIDIDISHVSFTMKSGAAIEGGNVEIIASA
FT                   SNQQVFENNEEGFGGKALGLLESALGVVEDLNFFITVSYVESTAKIDIQDGSVITAEQF
FT                   TAYANTYADVRAKLIKSWGVGGAAGVAISEASVTLAGELNVTGNVTLRSLADITMDVVA
FT                   TPSPVKGVAVAVGISVIDSESTVHVTDTAELTIGGDLSMRAETIEHSRVLAQSTSGKDG
FT                   AVGLAFAITVEQGSTNAWMDGQAVIGGDVLVSAGMVQEMIEVKKLYFLPSTTIGTGAQA
FT                   GVGSNSSGDVLDDVKSSAQSAILAKVMSPVQGKIDKVTKWFKTKLGISDEPSKEPPFDV
FT                   AGAVSFVYDSNETSARIGDGDDATFDGALDAGGSVLVISSIASCPYVSANASASNNDST
FT                   QPSGGKADSKFSGSAAISIGIYKNDAEAVINDGAVVDAVDDINVCAAALNDYVFVWGRN
FT                   LYDVWVQEADYTTDDAGPVTVLEGQTVEVTSGYTGNGEEGTWYKYLGAADLSVDDWSTV
FT                   DFSDEALWEGINPLHKKGMDFVTNLTTYLSGDFGMSAWLGNSWTQATAEGDTLAIAGAV
FT                   TYLDMANNAEAAIRKDAQINQNDGGDGFGDVVVQAVNLNETVNLGGNINLPGISSEPEE
FT                   GKTLPKLSAQYKPKDLLGTKAEDGKGAVGATVMIYNYKDTTEAVIEDGVILSADSLLVD
FT                   AQTGTMGVNVGASGGQGGKVGFNGVVIVNVVDNETTARIDAGADIAVGSGLVVDGVAFD
FT                   PEDAISLIGDWIDLGGYYGLKAGDSLVYDNGGGTSIGGLTQGETYYVAAVSGTKIRLAD
FT                   ASGNAIGLDKDSATGADHNLTGINSLVVNARDDLFLVDVAGGVAVSSEVGIGASVNVNI
FT                   VNRDTQALIGDLHDTDAADQTAVGDRGTVTVAGNTAVSAVNDGFIGGFSVAGAVAKSSQ
FT                   KAPGSGGGTSSNRGTGGTQGSDGSVTSNDALSSWQSKWASVLGEGKDKGKLSGDVAGDT
FT                   SKSTDQTAQSKSGFAVSGAVVVDVVDDNARAYIFNAGAVTLTSDGSLSVSAGNDTDLGS
FT                   FAGAVAYAKGSGTGSGTAVGGAFGVNVLSGATEAFIEDAVSLTANDLSIVADREGLNVA
FT                   IVAGVGIGMGQKGVGVAGSVSVNIALFTVEAALRDITGPVQVNTLSVTADDDSTLIAIA
FT                   GSVAFGGKAGVGIAMGFSWTETDVSALVSNVSNLTHTGDFTVDATADGLIVAVTGSVGI
FT                   SAGQAKGYAGAGTVSINFLKNTLEAKIVDTIVTAASTGDISVDADDSTGIYSFAGALAA
FT                   GKTAGLGAAIAVNSLDNSVTALVDGSTLETSGDFSATAEETGTVVTVAVAGAGSTKLAI
FT                   AGSVAINIFDNDITARVVDSAISANAVAFTAEDRSTSVAAAGGIAISTGQAGVGAAVGV
FT                   NLIFNNVTARVENSAIDAASAIDVSAGAETLLVSVTLGGAGGEKFALGGSFSANVVMNT
FT                   VTADIISGSTLDAAGDIGIAASDTTTAVIVAGGFAGSGKAAVGLSFSQLYMENQTTAVI
FT                   DDATVTSTGGSIGLAAGIAPPASKAELSDVRMMTYGVDLPDTNSSSIFNLTVAGAGAGK
FT                   VAAGFALSVNNINNTITAEIRNGSVVDGSAGVALSAIDASVIDAIALGVAGAGDVAVGG
FT                   AVSVNTITNTIGTAISESTVRAGVNATGTVLTNADAAVTLDSASSSIIRALAIGVSGSG
FT                   KVAVSVTALGNAVANDVSAEIIGSTVMAGGDISLTASDIAPALIPGMELAAEDQDRLDD
FT                   SLADSPVDPQGNILSLMISVAGSGKVAVSAALAGNVINNTVTTLVDDATVLAGINAVTG
FT                   DVINAAADVTMAALSKAGIVAVTVGVAGAGNVAVQATGFGNVITNTVASSIQGNATVSS
FT                   GHDFSLTAYDQSTIRSLAIGVAASGSAAVSALIGANVVTNTVTAQIAGSEASSGGALTV
FT                   DAQNSSAIYSFAGGVAASGSVAVQVSLAANVVANRTEASINDRTFDEDGDLVEGVTVAS
FT                   VVNAGGSLSVTADDTSSIDAIGIGVAGSGSVAVGVALSANVIANSILASVEGSTVDAGG
FT                   SVGLAAESEAIIRAIAIGVSGSGTVAVQVTAMGNVITNTVSATITDATVTAADNVTLEA
FT                   SDIAPSAIPEWMVSAEDMDSINGSLEDSPIDMDASILAINISVAGSGAVAVNGAFTGNV
FT                   ITNTVVSSIENATVTATAGEVILASDSKARIIAATVGVGASGAVAVNVTGFGNVIVNQV
FT                   EASITDGAVVTTGADVLLSAVDDSSISSIGLSVAGSGAVAVSVIVGANVITNHVTAGIN
FT                   DATVDSGGAIGLIASQEAAIFSFAGGVAATGAVSVQVSLAANVITNTTEASIVESTVDA
FT                   DGDVFLAASDSSSIDSFAFGVSGSGAVAVGVALSANVIANTVTASIEDATVTAGGAVSL
FT                   TATSEAIIRAVALGVSGSGAVAVQVTAMGNVVTNHVLATITDSTVTAVNDVTIEASDIA
FT                   PSAIPAWMVPADKMDEINESLEDSPIDLDANIVALNISVAGSGAVAVNGALTGNVIANT
FT                   VCADIDASTVRAGVDINDVVINTAAAVGLLASSRSRIISISVGVGGSGVVAVNATCFGN
FT                   VITNTVETSVKGGSVIKAGGNVDLDATDSSSISSIGLSVAGSGVVAVSVIAAANVITNT
FT                   TVAQIAGSTVEAGGNVTLDAIQNAVIYGFAGGVAASGVVSVQLSLAANVITNTTEASIT
FT                   DRVFNEDGSINEGASAPSTVTADGDVALLAKDSSSIDSVAFGVSGTGGVAVGAVLSANV
FT                   ITNDIATAVTGSTVAAGGAVSLDSESSAVIRSLNLGVSGSGAVAVTVNAMGNTVVNSVT
FT                   ADITDATVTAGTDVSLAASDMAPDTVSALNVPADREDEVTAAFDDTESPFGADSFTDAN
FT                   ILAMNISVSGSGLVAVDVNLTGNVIINTVLTTIDNSTVTATGGNLSMTAESRAVITSLS
FT                   LGVGASGAVSVGAVAFGNVITNTVESVIQNGATVTAGGALALAAADRSAIGSIGLSISA
FT                   SGGVAVSAIVGYNEIDNTISAKIDDATVESGGAMSLTALSDADIFSFSGGVAASGVVSA
FT                   QVSVSINTIENEVTAAVSDADITAGGLSLFARDLSTMDSVAIGVSASGFGAAGAAVSKN
FT                   LIDNSVQATITASTITAGAGGVSLTAESPALIRSFAAGIAGSGLAAGQASVTLNEITNT
FT                   ITAKIDDSDIHSTGTVSLLASDEAPDAIPDFLGDMMIPTGIIDTATDNLDGESVDQAAN
FT                   IVSFAATIALSGGVAGSAAVAENTITNTVVARVIDSDVTSTAGGITSEALSGSRISTLS
FT                   AGIGVAGGLALNASVSVNTIENTIQSSITGTGEISAHGTVGLTAVDDSRIDALTFSVAG
FT                   ALAAALGGAVVTNTVDNDVSAFIQGTSGTDKIQVFSAGQVSLLADARQIIGGRSIGATV
FT                   GAVAAGASVSVGTVSGSTKAYIGNYVEVGMAAGNTVGGITITAEADARVNSDTTAISAG
FT                   IGAGSGNDGRAIITSPVEAYISGTGTGVVVTDDIIVSATVRPKAVADTWGVNAGALAVG
FT                   VSLSEATVTSTVNAYVGGSITAGSLTVSAAQDLPPSGDSAKAEATGSGGALVGVDATVA
FT                   TATSDATVKGYVLANTTLNIAGATVISADTETRQRAEADSNVGGVVAVGVSSATASSDT
FT                   ETKAWLGSGVQLTGGSLSITATGHDDNLADTTAGAFGGIPVSSATAVTDNTSTTTAEIK
FT                   DGVVGRNIDLTSGGTGEFQIVADHTATFDSMVSAIAGGLFGGTGAEIDNTVTSTVDARV
FT                   GDSVNVTATDILMDAVNRARKNEDGTANIDGEAGGAIAGGGADSDTTIDFKTRVTIGNG
FT                   TSLAVTGDMASPGDFALRALNDLVVKDKINFFAAGGLSGLGAYSSIETLNDLARVTVGD
FT                   ADLISVGAINISARGTGDVSSVVNAQAYGAGTLILGDAVANVCPTNEVIINSGAHIQAL
FT                   GDLNISTGTNTNFVRDDYAVEATLDTFAGSAIPIEDVDASAYLFQENTITVASGALLET
FT                   ARSVSLHAEKYGFGEMTGRAKTVNWVSSIADALNGEAAEEMVGGTVRTESHAVVTVDGT
FT                   IRTGIMRSWSLTLDGWDRETGEITASGTVNGTDQKIGFTVTQEVLTSDLVNELMNAQSQ
FT                   LALYQDKGNATLITYYESEIARLEDLLREEGLLEGEDGEYAAVQQYVMTVNLDPVWAEA
FT                   GIIDIRADQLKGDGSFDAPGDASVTVLNHTPAFLRINGITIPEKNGGLFFNGLEMADNS
FT                   TINTINDNNADLDNQINDHEGNRLPTGWSAVVGGGAAFAAIPDNALSEPSVYVENDFVA
FT                   GTVAPDEIYPWPDIIVDGAVSNINGSATFKTLQAGDGNIVFNASVRAKDMTVIAGGTVY
FT                   IDGVSSYSVGGEAYSLWNSYTDEGTESATSSDINTILGMEPGDKVNLFGDKIFINAEYL
FT                   NINGVMQSGKEAYVLELDQDTIDEINSLSASQKGLVVLKTASQDDFIVRFDTTTRQIIV
FT                   DEMSVSGGHIELTGHILNTGAGEIRVLGGYATVEITNETAYDLVINRLDASQRGGGTLF
FT                   INDTATDLVTLYRMSGSEVIRTIDDGTTVQVDALVRTFDGTAYAPVDTYTPDDGWRYGW
FT                   TMLQQEGILYTSHVQKSAWLGIDALASDPAVENNKHSEPLGQPTITGTGPYFYKDTDIT
FT                   DDYTYLHTQQTIATEDWKLTDKRVDSTWYGEKTYHTWWKKEETVEHTYTHTISADRPFD
FT                   ITFLGHDQGQVTIDSHGDVVFQGPILNPSGTTRIETDGVIQQAGDSAYVNGLRVELDAE
FT                   KGIGSNTALNTNLADGPVYQYTSVYTGYPDDYADESKRGMTTLTTNDRVKLAADYAGGG
FT                   EPGAVYRYTGDPADRDLRVQDYSDTSLWEKVDHRPSLSAVTTSGKIQINEIIGDLF