(data stored in SCRATCH zone)

EMBL: CP000864

ID   CP000864; SV 1; circular; genomic DNA; STD; PRO; 28279 BP.
XX
AC   CP000864;
XX
PR   Project:PRJNA17827;
XX
DT   20-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acinetobacter baumannii ACICU plasmid pACICU1, complete sequence.
XX
KW   .
XX
OS   Acinetobacter baumannii ACICU
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
OG   Plasmid pACICU1
XX
RN   [1]
RP   1-28279
RX   DOI; 10.1128/AAC.01643-07.
RX   PUBMED; 18411315.
RA   Iacono M., Villa L., Fortini D., Bordoni R., Imperi F., Bonnal R.J.,
RA   Sicheritz-Ponten T., De Bellis G., Visca P., Cassone A., Carattoli A.;
RT   "Whole-genome pyrosequencing of an epidemic multidrug-resistant
RT   Acinetobacter baumannii strain belonging to the European clone II group";
RL   Antimicrob. Agents Chemother. 52(7):2616-2625(2008).
XX
RN   [2]
RP   1-28279
RA   Carattoli A., Villa L., Fortini D., Cassone A.;
RT   ;
RL   Submitted (18-SEP-2007) to the INSDC.
RL   Department of Infectious, Parasitic and Immune-Mediated Diseases, Istituto
RL   Superiore di Sanita', Viale regina Elena 299, Roma 00161, Italy
XX
RN   [3]
RP   1-28279
RA   Iacono M., Bordoni R., Bonnal R.J., De Bellis G.;
RT   ;
RL   Submitted (18-SEP-2007) to the INSDC.
RL   Istitute for Biomedical Technologies, National Research Council, via
RL   Fratelli Cervi 93, Segrate, Milano 20090, Italy
XX
DR   MD5; ed57774dc336f0b72fcd45c5975cdaa0.
DR   BioSample; SAMN02603140.
DR   EuropePMC; PMC2443898; 18411315.
DR   EuropePMC; PMC4776018; 26824943.
DR   RFAM; RF01497; ALIL.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..28279
FT                   /organism="Acinetobacter baumannii ACICU"
FT                   /plasmid="pACICU1"
FT                   /strain="ACICU"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:405416"
FT   repeat_region   213..321
FT                   /rpt_type=DIRECT
FT                   /rpt_unit_range=213..234
FT                   /note="iteron, control of plasmid replication"
FT   gene            375..1325
FT                   /gene="repAc1"
FT                   /locus_tag="ACICU_p0001"
FT   CDS_pept        375..1325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repAc1"
FT                   /locus_tag="ACICU_p0001"
FT                   /product="replicase"
FT                   /note="plasmid replication protein; COG:COG5527"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58980"
FT                   /protein_id="ACC58980.1"
FT                   /translation="MRDLVVKDNALINASYNLDLVEQRLILLAIVEARESGKGINANDP
FT                   LEVHADSYINQFGVHRNTAYQALKDACKDLFARQFSYQEKKANGNIRNVMSRWVSQIAY
FT                   NDNEATVDLIFAPAVVPFITRLEEQFTKYELQQVSSLSSAYAIRLYELLIQWRSTGKTP
FT                   TIELQEFRKKLGVLDNEYLRMAHLKERVLELSIKQINEHTDITVKYEQHKRGRSISGFS
FT                   FTFKQKKKDSPSIERDPNTLELFSKMTDAQRHMFANKLSELPEMGRYSQGTESYQQFAV
FT                   RIAEMLQDPAQFKELYPYLKKVGYMPSNKKDTVNG"
FT   gene            1318..1893
FT                   /locus_tag="ACICU_p0002"
FT   CDS_pept        1318..1893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0002"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58981"
FT                   /protein_id="ACC58981.1"
FT                   /translation="MAKLSLSEVSKKFHVDRSTIYRAVRNGRLSRSSDGQFDLAEVIRC
FT                   FGEPEQTSQKIESSKQEGDESTKKLIAHLENEVKKYQEREERLMQQIDRMQTLIELKSV
FT                   APATAAPHQDATACDTKMPQHATTQQDTDNKKNNELNIAENVAVPQQETTAYHTQTLQH
FT                   ATLQSVAVPQHKKRGLFGRVLNAVFDND"
FT   mobile_element  2607..3426
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   2607..2620
FT                   /rpt_type=INVERTED
FT   gene            2658..3374
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0003"
FT   CDS_pept        2658..3374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0003"
FT                   /product="transposase of IS26"
FT                   /note="COG:COG3316"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58982"
FT                   /protein_id="ACC58982.1"
FT                   /translation="MELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVN
FT                   VDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGR
FT                   TVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSD
FT                   VEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
FT                   GDPLGEMRLVSRVFET"
FT   repeat_region   3413..3426
FT                   /rpt_type=INVERTED
FT   gene            3955..4263
FT                   /locus_tag="ACICU_p0004"
FT   CDS_pept        3955..4263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0004"
FT                   /product="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit-related helicase"
FT                   /note="COG:COG0610"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58983"
FT                   /protein_id="ACC58983.1"
FT                   /translation="MAEELNLTEYEYAFYSAVADNESARELMQKEILRELAVVLTDSIR
FT                   KNVTLDWTIKEAARAKLRVIVKRLLKKYGYPPDMALLATEPVLEQAEQLAEELASAT"
FT   gene            complement(4468..5415)
FT                   /gene="repAcix"
FT                   /locus_tag="ACICU_p0005"
FT   CDS_pept        complement(4468..5415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repAcix"
FT                   /locus_tag="ACICU_p0005"
FT                   /product="replicase"
FT                   /note="plasmid replication protein; COG:COG5527"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58984"
FT                   /protein_id="ACC58984.1"
FT                   /translation="MKTELVVKDNALINASYNLELAEQRLILLSIVKARETGRGITSDS
FT                   RLEVHASDYMKQFNVEKSAAYEVLKSASESLFNRYFSYKEQRHDGTEFVVKSRWVSRVA
FT                   YAPNVAILEVTFAPDVVPLITRLEQHFTSYQLKQVSQLTSKYAIRLYEMLIAWRNVGKC
FT                   SFELINLRDSLGIASDEYKQMGHFKSRVLDASIAQINEYTDIKVTYEQQKNGRTISGFT
FT                   FKLKPKQVQQEITILDTKASLIPSDLTPNQRVTFASKLSKLQELGGKAEPGEEVEAFAK
FT                   RIELWLEDEKKLKMLTPFLYQVGFKKAKPKKVSQ"
FT   repeat_region   5500..5583
FT                   /rpt_type=DIRECT
FT                   /rpt_unit_range=5500..5522
FT                   /note="iteron; control of plasmid replication"
FT   gene            5840..6469
FT                   /gene="par"
FT                   /locus_tag="ACICU_p0006"
FT   CDS_pept        5840..6469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="par"
FT                   /locus_tag="ACICU_p0006"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /note="COG:COG1192"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58985"
FT                   /protein_id="ACC58985.1"
FT                   /translation="MIILIGSQKGGCGKSTIAINIAAYLAKHNKDIVLVDADPQQSSAN
FT                   WVKDRDDTDLPKVHCIQRYGDIKNTLKDLDSRYDYVVVDVAGHDSKELRTAMLAAHYLV
FT                   VPFRPSQFDLDTLPHLSEVIDQAQSFNEDLKPFGLLTLAPTNPSVSEVQQANEYLADFP
FT                   LFTALSSVIHDRKVYRDVTAEGKGVVESNNPKAIDEFDAFMKELLA"
FT   gene            6466..6702
FT                   /locus_tag="ACICU_p0007"
FT   CDS_pept        6466..6702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58986"
FT                   /protein_id="ACC58986.1"
FT                   /translation="MIKKRELAKPSPDMEAFINGANEETNQKLDPKAPRKFKTHTIPMN
FT                   EYEYQLLAELAEKYGQTHNGIIRFALKKLSEEN"
FT   gene            6969..7394
FT                   /locus_tag="ACICU_p0008"
FT   CDS_pept        6969..7394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58987"
FT                   /protein_id="ACC58987.1"
FT                   /translation="MNSDAVWTMTEKSRLKREDEVRMQELRHLFDLMDEREEEWQVTKT
FT                   TTLEKALKILSWCDLDVAPGLAELEMQQPIDIIEQHRKWLKAFRSAMPYLAKMLLVTDS
FT                   TLLIKLRCTLERYAEISYPNLLVVIQPKLQTLNFIKA"
FT   gene            7397..7645
FT                   /locus_tag="ACICU_p0009"
FT   CDS_pept        7397..7645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0009"
FT                   /product="Antitoxin of toxin-antitoxin stability system"
FT                   /note="COG:COG2161"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58988"
FT                   /protein_id="ACC58988.1"
FT                   /translation="MTQLIHARMTASITELKKSPMDTVLAGKGEPVAILNRNTPAFYCV
FT                   PADLYETMMEQLEDLELNKIADARANQKRIRVNIDDL"
FT   gene            7635..7922
FT                   /locus_tag="ACICU_p0010"
FT   CDS_pept        7635..7922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0010"
FT                   /product="Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /note="COG:COG2026"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58989"
FT                   /protein_id="ACC58989.1"
FT                   /translation="MTYKLDFLEEALAEWNKLNPSIKQPLKKKLIKVLENPHIPKNKLS
FT                   GHPNRYKIKLRSVGYRLVYEVIDDEVVVIVIAVGRRENNAVYDEANSRHS"
FT   mobile_element  8145..9480
FT                   /mobile_element_type="insertion sequence:ISAba2-like"
FT   repeat_region   8145..8168
FT                   /rpt_type=INVERTED
FT   gene            8194..8307
FT                   /pseudo
FT                   /locus_tag="ACICU_p0011"
FT                   /note="InsA transposase"
FT   gene            8277..8525
FT                   /pseudo
FT                   /locus_tag="ACICU_p0012"
FT                   /note="InsA transposase"
FT   gene            8525..9442
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0013"
FT   CDS_pept        8525..9442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0013"
FT                   /product="transposase"
FT                   /note="COG:COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58990"
FT                   /protein_id="ACC58990.1"
FT                   /translation="MVDFIHNNKELYGVEAICRILPIAPSTYYQTLDLCDEKHCFAREH
FT                   RAKRDLHDLHHAEEIKRIWKESSGRYGVRKVWQQLKREGYIIARCTVARLMKKLGIQGV
FT                   WRGKNKQTTRSRDDQKRADDLVKRNFTADHPDQLWVSDFTYIQTNSGWVYTAFIIDVFS
FT                   RAIVGWKVSTRMNTDMVLDALEQALHDRGMPKNVIHHSDRGVQYLSIRYTNRLEAANLR
FT                   ASVGTTGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKKRVHSA
FT                   LGYVSPFEFEAMYYDKINPLGQVA"
FT   repeat_region   9457..9480
FT                   /rpt_type=INVERTED
FT   gene            10064..10645
FT                   /gene="cinH"
FT                   /locus_tag="ACICU_p0014"
FT   CDS_pept        10064..10645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinH"
FT                   /locus_tag="ACICU_p0014"
FT                   /product="Site-specific recombinase"
FT                   /note="DNA invertase Pin homologs; COG:COG1961"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58991"
FT                   /protein_id="ACC58991.1"
FT                   /translation="MGREKVKGQKVGYVRVSSVEQNTGRQLEGIEVDRIFVDRASGKNT
FT                   DRPKFQEMLNYVREGDRVIVHSMDRFARSLKDLVTEVDKLVKRGIAIQFVKENITFTAE
FT                   STPMDNLMLQMMGAFAQFEREIILERQKEGIKLASAQGKYKGRVHKLKPDQAEALRQAW
FT                   KEGKYPSKMALGKAFGISRQAVYRYLQVSE"
FT   gene            complement(10854..11396)
FT                   /locus_tag="ACICU_p0015"
FT   CDS_pept        complement(10854..11396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0015"
FT                   /product="TPR repeat, SEL1 subfamily protein"
FT                   /note="COG:COG0790"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58992"
FT                   /protein_id="ACC58992.1"
FT                   /translation="MALGVCLSMETFAEPVFSNDLLAKAENGDTSAQLELAEIYLYGHG
FT                   VDSDENQAEVWALKSAENGNVAAMFWLADGYVTYARLMEDDDKNDSLEHFQKAFKWFQK
FT                   ASENGHSESMVELADLYTRADSGIEVNINKAFELREKAAKLGNKKAMRSLSVMYRDGIG
FT                   IPKNTDLAQSWWDKSEN"
FT   mobile_element  complement(11545..13366)
FT                   /mobile_element_type="insertion sequence:ISAba3"
FT                   /note="contains ISAba2 insertion"
FT   gene            complement(join(11545..11926,13233..13303))
FT                   /pseudo
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0097"
FT                   /note="tranposase; disrupted due to IsAba2 insertion"
FT   mobile_element  11927..13232
FT                   /mobile_element_type="insertion sequence:ISAba2"
FT   repeat_region   11927..11951
FT                   /rpt_type=INVERTED
FT   gene            11976..12293
FT                   /gene="insA"
FT                   /locus_tag="ACICU_p0017"
FT   CDS_pept        11976..12293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="ACICU_p0017"
FT                   /product="transposase"
FT                   /note="COG:COG2963"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58993"
FT                   /protein_id="ACC58993.1"
FT                   /translation="MXKPKYTPEIRDRAVQLLIESEKDYPSNWAAITAIAPKIGCTPET
FT                   LRVWYLKHLDQQNPIKVQQASDQEKMKQMEREIKELKRANEILRKAAAFFAQAELDRPH
FT                   K"
FT   gene            12293..13195
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0018"
FT   CDS_pept        12293..13195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0018"
FT                   /product="transposase"
FT                   /note="COG:COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58994"
FT                   /protein_id="ACC58994.1"
FT                   /translation="MVDFIHNNKDLYGVDAICRILPIAASTYYRTLDLADNPEHRAKRD
FT                   LHDLHHAEQIKRIWKESSGRYGVRKVWQKLKREGYIIARCTVARLMQKLGIQGVWRGKN
FT                   KQTTHSRDDQKRADDLVKRNFSADHPDQLWVADFTYIQTNSGWVYTAFIIDVFSRAIVG
FT                   WKVSTRMNTDMVLDALEQALHDRGMPKNVIHHSDRGVQYLSIRYTNRLEAANLRASVGT
FT                   TGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKERVHSALGYVS
FT                   PFDFEAMYYDKINPLGQVA"
FT   repeat_region   13208..13232
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(13343..13366)
FT                   /rpt_type=INVERTED
FT   gene            13384..14226
FT                   /locus_tag="ACICU_p0019"
FT                   /note="bla-oxa58"
FT   CDS_pept        13384..14226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0019"
FT                   /product="carbapenem-hydrolyzing oxacillinase"
FT                   /note="Beta-lactamase class D; COG:COG2602"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58995"
FT                   /protein_id="ACC58995.1"
FT                   /translation="MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQ
FT                   ALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEI
FT                   FKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGT
FT                   EVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSG
FT                   WGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL"
FT   mobile_element  14253..15054
FT                   /mobile_element_type="insertion sequence:ISAba3"
FT   repeat_region   14253..14280
FT                   /rpt_type=INVERTED
FT   gene            14317..14754
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0020"
FT   CDS_pept        14317..14754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0020"
FT                   /product="transposase"
FT                   /note="COG:COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58996"
FT                   /protein_id="ACC58996.1"
FT                   /translation="MQITLAIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHAL
FT                   SYLGCKSGITRKILQLMVRGSGIRDIAEVERISIGKVLRTLTESTYEIQPQQSHYESLE
FT                   VDEFWNFVGNKKNKQWLIYAYHRETGEIVAYVWGKRDLATV"
FT   repeat_region   15027..15054
FT                   /rpt_type=INVERTED
FT   gene            15197..15589
FT                   /gene="araC1"
FT                   /locus_tag="ACICU_p0021"
FT   CDS_pept        15197..15589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC1"
FT                   /locus_tag="ACICU_p0021"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /note="COG:COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58997"
FT                   /protein_id="ACC58997.1"
FT                   /translation="MSNWVNVTQDKSTGIELIHAHFKGFAYDPHLHSSYLIGVTELGHQ
FT                   QFNCRKKIIDSYQGQTFMLEPEEVHDGNAPDPLGFTYKMMHLDPAWLKKKWHCCKVSDE
FT                   AAFCLIQRPYVSKTLLTRRISPRGSP"
FT   mobile_element  complement(15483..16302)
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   complement(15483..15496)
FT                   /rpt_type=INVERTED
FT   gene            complement(15535..16251)
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0022"
FT   CDS_pept        complement(15535..16251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0022"
FT                   /product="transposase"
FT                   /note="COG:COG3316"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58998"
FT                   /protein_id="ACC58998.1"
FT                   /translation="MELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVN
FT                   VDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGR
FT                   TVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSD
FT                   VEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
FT                   GDPLGEMRLVSRVFET"
FT   repeat_region   complement(16289..16302)
FT                   /rpt_type=INVERTED
FT   mobile_element  16307..17246
FT                   /mobile_element_type="insertion sequence:ISAba2"
FT                   /note="truncated due to IS26 insertion"
FT   gene            16307..17209
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0023"
FT   CDS_pept        16307..17209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ACICU_p0023"
FT                   /product="transposase of ISAba2"
FT                   /note="transposase interrupted by the insertion of IS26;
FT                   COG:COG2801"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACC58999"
FT                   /protein_id="ACC58999.1"
FT                   /translation="MVDFIHNNKDLYGVDAICRILPIAASTYYRTLDLADNPEHRAKRD
FT                   LHDLHHAEQIKRIWKESSGRYGVRKVWQKLKREGYIIARCTVARLMQKLGIQGVWRGKN
FT                   KQTTHSRDDQKRADDLVKRNFSADHPDQLWVADFTYIQTNSGWVYTAFIIDVFSRAIVG
FT                   WKVSTRMNTDMVLDALEQALHDRGMPKNVIHHSDRGVQYLSIRYTNRLEAANLRASVGT
FT                   TGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKERVHSALGYVS
FT                   PFDFEAMYYDKINPLGQVA"
FT   repeat_region   17222..17246
FT                   /rpt_type=INVERTED
FT   mobile_element  complement(17247..17380)
FT                   /mobile_element_type="insertion sequence:ISAba3"
FT                   /note="truncated due to ISAba2 insertion"
FT   gene            complement(17247..17317)
FT                   /pseudo
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0096"
FT                   /note="transposase; truncated due to IsAba2 insertion"
FT   repeat_region   complement(17357..17380)
FT                   /rpt_type=INVERTED
FT   gene            17398..18240
FT                   /locus_tag="ACICU_p0024"
FT                   /note="bla-oxa58"
FT   CDS_pept        17398..18240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0024"
FT                   /product="carbapenem-hydrolyzing oxacillinase"
FT                   /note="Beta-lactamase class D; COG:COG2602"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59000"
FT                   /protein_id="ACC59000.1"
FT                   /translation="MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQ
FT                   ALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEI
FT                   FKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGT
FT                   EVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSG
FT                   WGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL"
FT   mobile_element  18267..19068
FT                   /mobile_element_type="insertion sequence:ISAba3"
FT   repeat_region   18267..18294
FT                   /rpt_type=INVERTED
FT   gene            18331..18768
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0025"
FT   CDS_pept        18331..18768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0025"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59001"
FT                   /protein_id="ACC59001.1"
FT                   /translation="MQITLAIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHAL
FT                   SYLGCKSGITRKILQLMVRGSGIRDIAEVERISIGKVLRTLTESTYEIQPQQSHYESLE
FT                   VDEFWNFVGNKKNKQWLIYAYHRETGEIVAYVWGKRDLATV"
FT   repeat_region   19041..19068
FT                   /rpt_type=INVERTED
FT   gene            19211..19603
FT                   /gene="araC1"
FT                   /locus_tag="ACICU_p0026"
FT   CDS_pept        19211..19603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC1"
FT                   /locus_tag="ACICU_p0026"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /note="COG:COG2207"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59002"
FT                   /protein_id="ACC59002.1"
FT                   /translation="MSNWVNVTQDKSTGIELIHAHFKGFAYDPHLHSSYLIGVTELGHQ
FT                   QFNCRKKIIDSYQGQTFMLEPEEVHDGNAPDPLGFTYKMMHLDPAWLKKKGHCCKVSDE
FT                   AAFCLIQRPYVSKTLLTRRISPRGSP"
FT   mobile_element  complement(19497..20316)
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   complement(19497..19510)
FT                   /rpt_type=INVERTED
FT   gene            complement(19549..20265)
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0027"
FT   CDS_pept        complement(19549..20265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="ACICU_p0027"
FT                   /product="transposase of IS26"
FT                   /note="COG:COG3316"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59003"
FT                   /protein_id="ACC59003.1"
FT                   /translation="MELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVN
FT                   VDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGR
FT                   TVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSD
FT                   VEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
FT                   GDPLGEMRLVSRVFET"
FT   repeat_region   complement(20303..20316)
FT                   /rpt_type=INVERTED
FT   gene            20573..24127
FT                   /locus_tag="ACICU_p0028"
FT   CDS_pept        20573..24127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0028"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59004"
FT                   /protein_id="ACC59004.1"
FT                   /translation="MFKTNIHDFLLNLGYTTNNLPFQFVPEKQYRFPSMGKSAKNRAAS
FT                   IVLKANGTYLIYDHSCGASYVFNAERTSDKSKQDPAELEKLHIELEKQRKAEKQKKIIQ
FT                   FQIKASEAQQIWNKAKPCSAHPYMALAGIKPINARTLSIVKTSDGQTFINPLIIPLFDV
FT                   RTHELINLQFITADGTKRPLSGAQSKNYYFVIEGTEPTIFVEGYKDACNVFHATGRRVI
FT                   ACISAGKFKEVYPVLGKLCDVIIADNDNILKADPDDKTRKVVLSEQVVKGRGTGHRVAY
FT                   ELKAKFYLAPKLGSDAGSMTHEEIRNLLQQKLTSDIPAYDVWTQLKDEPCAIETKLLTD
FT                   ALSTEDNSHKCAVLAYQYIMRNLVHVPYKKNLIELRNEIEPFCVHRVHPVTLDNIILYA
FT                   HNRIEFMQTLGLDAVTIRDRKNHNLIKLDSLDHFSPNYKGVYLVKAPTGSGKTQKVGRP
FT                   FRDWCGQNGHPFLTIAHLRSLIREMASRLDTAHYEDEKKSIIEARKIGLDAALSQSIGS
FT                   LAVCLPSLANQLFKPFIKDCQHIFIDEISQLIETFNSDKLFNKTDIEYVYNLLKVIIKN
FT                   AECIIVADANINSKTLDFIESCRPNEQFTIVEVEPKDESKTVYLYNSFAELQSFMLQRV
FT                   MVENQNLWITCDSKSHVQALHAILRDLDVKSIAIVGNENIKKETAEFLSDPETESLKYQ
FT                   VVISTSAIASGVSIQHEQFIHDNGKGYFDCVVGFFTGSSIQPTDAYQMIGRVRYATDFH
FT                   IFADQSKRYTMNVLDILQGKQQASILEGKKAKITEFSLFKTELENIRETRRSNFANNLI
FT                   WILESKLFNIKRVQKFDASEHTEFFKHTKKAVKEAKRELIKTAYKINDETASRLQRKEF
FT                   LSEAEANALQAYKMRSKLGLDYVTELTDEHFDIDIGQLIRFSAFMGRYKPSNDKSKDLA
FT                   IRRYHEAMGKAYKLAFDGVELQPNAVFTETSAKALLQQIAKYKLVLASIGAIPTRFGVQ
FT                   SWKPSEYAVRDLNEVLKHIGVKSKYVRNPFKPRLKRKLSVEMPNNLYIRIEPSQQIMDE
FT                   YAYKIDPDNYLLMQQLCESVLKSATKQVEHENVQQLAEAVKRPDFVSSDDVKIDIQSVT
FT                   LVTHATEQQLAIQPSNDVVFIDVMKELMRSDLTLADFYRLKDYAEYLPKLHVSADSAQQ
FT                   VSELDLINSMISSRASIL"
FT   gene            25654..25947
FT                   /locus_tag="ACICU_p0029"
FT   CDS_pept        25654..25947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0029"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG:COG1396"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59005"
FT                   /protein_id="ACC59005.1"
FT                   /translation="MLNDALLTMRKYHRISQTELSQSLGISNSYLSEIESGKKKPTLEL
FT                   LDKYSEYFDIPVSSLMFFSENMDKRDTLSGKFRYFAGSKVIKLMNWLSENGK"
FT   gene            25937..26815
FT                   /locus_tag="ACICU_p0030"
FT   CDS_pept        25937..26815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0030"
FT                   /product="Retron-type reverse transcriptase"
FT                   /note="COG:COG3344"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59006"
FT                   /protein_id="ACC59006.1"
FT                   /translation="MENSQPSDYAKYVYELELLNSPLFHITSKKRLAILLCSSIKELNH
FT                   IVRSKNQMYQYFNENKTDDSGNIIKVRPIQNPHDRLKQIHSRIGKFLGNLKAPDYLHSK
FT                   RSKSAISNAKAHVGLKGHTLNIDITDFYPSTSKAKVQSFFGYTLQYPTDIAKYISEVCT
FT                   VNNCLPTGSPLSSALAFWANKSMFDEIYRMAKSRSITMTVYVDDISFTGKAVNQNFLNK
FT                   IIQIIEKYQHNIKQEKIKFFPENSIKFVTGVAIVNGSLQPAHRHFRDIRQLKKIDNNIQ
FT                   AALRLIGKIII"
FT   gene            complement(27052..27423)
FT                   /locus_tag="ACICU_p0031"
FT   CDS_pept        complement(27052..27423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACICU_p0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACICU_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACC59007"
FT                   /protein_id="ACC59007.1"
FT                   /translation="MGEKVKTYAVRLDPQVAEFYDQLANSEGIRTSKLFSKILTNDFQS
FT                   IAVKQQADRIEDLVNRLEKRIDDFEEDNNFSEKYYEDFSGLYFMMLWLLMKNGASKDEV
FT                   RMIQAKGYSYADDNYKRVK"
XX
SQ   Sequence 28279 BP; 9179 A; 5150 C; 5551 G; 8398 T; 1 other;
     gaattccaag tttcttttgc ttttttttaa agtcacgcca gtattaacca aaaaattgcc        60
     ccaacgaact gagcgaaagc gaagttcaat agagtttgag cgaagcgaaa accaagggca       120
     atttttcatt ccctgggctt ttaattattt taaagttttt aaatactttt aaatggcttg       180
     aaagccttat gaataaaggg ttttagctct tatatgtcca cgtttacctt gcaatatgtc       240
     cacgtttacc ttgcaatatg tccacgttta ccttgcaata tgtccacgtt taccttgcaa       300
     tatgtccacg tttaccttgc attagtacac aaataatatt aacgtgtact tatacacaat       360
     aaaaaatagt ggctatgaga gatttagttg taaaggacaa tgccttaatc aacgcaagct       420
     ataacttaga cttagtagaa caacgtttaa ttttattggc tattgttgaa gcaagggaaa       480
     gtgggaaagg gattaatgca aatgatccat tagaagttca tgcagatagt tatatcaatc       540
     aatttggtgt acaccgtaat acagcttatc aagccttaaa agatgcttgt aaggatttat       600
     tcgcgcgtca atttagctat caagagaaaa aagctaatgg gaatatccga aatgttatga       660
     gtcgttgggt atctcaaatt gcttataacg acaatgaagc aactgtagac ttaatatttg       720
     cacctgctgt tgttcccttc ataacccgac tggaagaaca atttactaaa tatgaattac       780
     agcaagttag tagtcttagt agcgcttatg ccattcgctt atatgagctt ctaattcagt       840
     ggcgaagcac tggtaaaacc ccaaccatag aactacaaga atttagaaag aagttaggcg       900
     ttcttgataa tgaatattta cggatggctc atttaaaaga gcgtgtttta gagctttcaa       960
     ttaaacaaat aaatgagcat acggatataa ctgtaaaata tgaacagcat aaaagaggac      1020
     gttctatttc aggattttct tttaccttta aacagaagaa gaaggatagc ccatcaatag      1080
     aaagagatcc gaacactttg gagctttttt caaagatgac cgatgctcaa cggcatatgt      1140
     ttgcaaataa actttcagaa ctccctgaaa tgggtcgcta ttcacaagga acagaaagct      1200
     accaacagtt tgctgtacgt attgctgaga tgctacaaga tcccgctcaa ttcaaagagc      1260
     tatacccata cctaaaaaaa gtgggataca tgccatcaaa taaaaaggac accgtaaatg      1320
     gctaagttat cactaagtga agtatctaaa aaatttcatg tggatagatc aaccatttac      1380
     agagctgtac gtaatggacg tttatcacgc tccagtgatg gacaattcga tctagcagag      1440
     gtcatacgat gctttggaga acctgagcaa acatctcaaa aaattgaatc atctaagcaa      1500
     gaaggtgatg aatctacaaa aaaacttatt gcccatttag aaaatgaagt caaaaaatac      1560
     caagaacgtg aagaacggtt aatgcaacaa attgaccgta tgcaaacact cattgagctg      1620
     aaaagtgttg cacctgccac agcagcacca caccaagatg ctacggcatg cgacaccaag      1680
     atgccacagc atgcgacaac acaacaagac actgataaca aaaagaataa tgaattaaat      1740
     attgcagaaa atgtagcagt gccacagcaa gaaactacgg cataccacac ccaaacgcta      1800
     cagcatgcca cgttgcaaag tgtggcagtg ccacaacaca aaaaacgtgg tttatttggc      1860
     cgtgtgctga atgccgtctt tgataatgac tgagcaataa gggtgaaaga tcatgccgaa      1920
     actgaaagac attgccctgg gaattattgt agctccgctg ctgatcccga tcatgctgat      1980
     tgcatcgtac caggataaaa aggcgctgaa gaaagagctg gatgaatgcc aaaaagaaaa      2040
     agaccaggca tcctgattat tcaattgagc taatcaaaag tgtggaacat tgatgaaata      2100
     atagcgtgga acgtgaaaag tcataaaaaa agcccgaaca gggatgctcg ggctataaac      2160
     tagaaactac agcgttgaat tataaggata attatacagc atttcgtata aggtgtatta      2220
     tgttaatttt aggagatcta tacaattctg tactttttca caatcataga aaaagcaaat      2280
     aaaatactta cccaaaataa ataatcaata aaaaaattga gaaaaacaaa ttgatccatg      2340
     ccgatgaaaa taaataaagg attgatactt atacttccga ctggagaggt ttcaccatct      2400
     ataaggaact gtagaggaaa tcccccagct atgacttcaa ctttttcaag cttatctaca      2460
     actatgcgag caactaatat atttttttga taaagcaaag atacataagt caaaataatc      2520
     gctaagaaat taaaatataa tattttttca taactattct ttatctttta aattaattaa      2580
     aaacagccaa taacataagc caggaaggca ctgttgcaaa tagtcggtgg tgataaactt      2640
     atcatcccct tttgctgatg gagctgcaca tgaacccatt caaaggccgg cattttcagc      2700
     gtgacatcat tctgtgggcc gtacgctggt actgcaaata cggcatcagt taccgtgagc      2760
     tgcaggagat gctggctgaa cgcggagtga atgtcgatca ctccacgatt taccgctggg      2820
     ttcagcgtta tgcgcctgaa atggaaaaac ggctgcgctg gtactggcgt aacccttccg      2880
     atctttgccc gtggcacatg gatgaaacct acgtgaaggt caatggccgc tgggcgtatc      2940
     tgtaccgggc cgtcgacagc cggggccgca ctgtcgattt ttatctctcc tcccgtcgta      3000
     acagcaaagc tgcataccgg tttctgggta aaatcctcaa caacgtgaag aagtggcaga      3060
     tcccgcgatt catcaacacg gataaagcgc ccgcctatgg tcgcgcgctt gctctgctca      3120
     aacgcgaagg ccggtgcccg tctgacgttg aacaccgaca gattaagtac cggaacaacg      3180
     tgattgaatg cgatcatggc aaactgaaac ggataatcgg cgccacgctg ggatttaaat      3240
     ccatgaagac ggcttacgcc accatcaaag gtattgaggt gatgcgtgca ctacgcaaag      3300
     gccaggcctc agcattttat tatggtgatc ccctgggcga aatgcgcctg gtaagcagag      3360
     tttttgaaac gtaaggcctt tgaataagac aaaaggctgc ctcatcgcta actttgcaac      3420
     agtgccaata aaaatacgtc agtgattttt ttaactcagt aaaaattgat ataccaacct      3480
     gaatccactt cttgctgctt tggcatggat taattttaga attatttcaa tgtcaggttt      3540
     tgccatttaa atcaaggaca tgactgtcga gagcttaggt tttcgctttg ctcaatccga      3600
     ggggaagtag ggatttagct ttgttacata aatagtttaa aatatgattt tataaagctt      3660
     aacttaaatt agaactaaaa caaaactaaa gtaaaaccaa attagtttta cttaacaact      3720
     aattttattt cactattaaa cttctaatcc caaatctttt agaacaccag catactttct      3780
     aacattttga acatcctcta attcaattag aagccttttt tctagatcag catagctttc      3840
     ccctactgca gctttttggc ttgcaaatgg gtcatggtga gctagcttgt tggcaaaaaa      3900
     ttgaatctgc ttatccgtta gcttctggct aaggcaatcc aagaatcaga caaaatggca      3960
     gaggaactca acctgactga atatgaatat gccttctact ctgctgtcgc ggataacgag      4020
     agtgctcggg agttaatgca gaaggagatc ctacgcgaac tcgctgttgt tctgactgat      4080
     tccattcgta agaatgtgac cttggattgg acgatcaaag aagcagccag ggcgaaactg      4140
     agagttattg tgaagcgtct actcaagaag tatggctacc cacctgatat ggctttactg      4200
     gctactgagc ctgtactcga acaggcagaa cagttagctg aggaattagc atctgctaca      4260
     taaggtttta cgctccattt gataaaacac ccactcaatt tgagtgggtg tctcgagcca      4320
     taaacaactt ttagcagtag ctttggacat catcgagcat tattatcata acctacctac      4380
     atgattgctt tataggctaa aaaccacata attgacaact aaagaacaac taaattagtt      4440
     tcaaataaga actagaattg agaagttcta ctgagatact ttctttggtt tagctttttt      4500
     aaatcctact tgatagagaa atggagtaag catcttcaat tttttttcat cctctagcca      4560
     taactcaatt cgttttgcaa atgcctctac ttcctcacca ggttctgctt ttcctcctaa      4620
     ttcttggagt tttgataatt tactagcaaa agtaacacgt tggtttggag tcagatcaga      4680
     aggaattaac gatgcttttg tatctaggat ggtaatttct tgttgtactt gtttaggctt      4740
     taacttgaag gtgaatccac taatagttcg accattcttc tgttgttcat aagtcacttt      4800
     gatgtctgtg tactcattaa tttgagcaat tgatgcgtct agaacacgac ttttgaaatg      4860
     ccccatttgc ttatactcat cagatgcaat ccctaagcta tctctcaaat tgatgagctc      4920
     aaaagaacat tttcctacat tacgccatgc aatcagcatc tcatataatc taatagcgta      4980
     tttacttgta agttgagaaa cttgctttag ttggtagcta gtgaaatgct gctctaatcg      5040
     agtaattaat ggcacaacat ctggtgcaaa agttacttcc aatatagcta cattgggagc      5100
     atatgctaca cgactgaccc aacgtgattt aaccacaaat tccgttccat catgtctttg      5160
     ttccttatag gaaaagtaac gattaaagag actttctgat gcgctcttta atacttcata      5220
     agctgcactt ttctccacgt taaactgctt catatagtca ctagcatgaa cctctaaacg      5280
     actgtcagaa gtaatccctc gccctgtttc ccgagctttt acaatggaaa gtaaaattag      5340
     tctttgttct gcaagctcta aattataaga agcattaata agagcattat ctttaactac      5400
     tagttcagtt ttcatttttc aatttactag cacaagtaaa atcacactat atatcacagc      5460
     ttatttaatc acaacaaaca ttaatgtgat taaataaacg gaatctgtga ttgaatggaa      5520
     tggaatctgt gattgaatgg aatggaatct gtgattgaat ggaatggaat ctgtgattga      5580
     atgacctctg tatgccttgc tgtcactgca ttacagccag cttaaaagca ttaaaagcat      5640
     taaaagttaa taaaagcctt ttttcatttt ctaaaactta aaaagtaaga atgtattcct      5700
     atcaatttga taatggaata tgagctaata gttgatacat tttggaattt gtgaaaagta      5760
     aaaattgtca ttcattgtct ttacatatat ctaatttgat tacatactag ttgcaaatta      5820
     gttataagtt acaagtaaaa tgattatatt gattggaagc caaaaaggtg gatgtggtaa      5880
     atcaacaata gccatcaaca ttgcagcata tcttgctaaa cataacaaag acatcgtatt      5940
     agttgatgct gatcctcagc aaagttcagc taactgggtt aaagacaggg atgacactga      6000
     cttacctaag gttcattgta ttcaacgcta tggcgatatc aagaacacct tgaaagactt      6060
     ggacagtcgt tatgactatg ttgttgttga tgttgcaggt cacgatagta aagagctgag      6120
     aacagcaatg cttgcagctc attaccttgt agtaccgttt agaccatctc aattcgatct      6180
     agatacccta cctcatctct ctgaagtcat agatcaagcc cagtcattca atgaagactt      6240
     gaaacctttt ggcttactaa cattggcacc tacaaatcca tcagtatctg aagtacagca      6300
     agcaaacgag tatctcgctg acttcccatt gttcacagcc ttgtcatcag taatccatga      6360
     tcgcaaagtt taccgggatg ttactgctga aggtaaaggt gttgttgaat ccaataatcc      6420
     aaaagcaata gacgagtttg acgcttttat gaaggagctt ttagcatgat taagaaaaga      6480
     gaattggcaa aaccttctcc tgacatggaa gccttcatca atggtgctaa tgaggagact      6540
     aatcaaaaac tagatccgaa agcacctaga aaatttaaga cgcatacgat tccaatgaac      6600
     gaatatgagt atcagctatt ggctgagtta gctgaaaaat atggtcaaac ccataatgga      6660
     attatcagat ttgctctgaa gaaacttagt gaagaaaatt aactaatttg aaactaatat      6720
     aaaactaatt tagtttttaa ttggttgtga tttgagtgta gaaaagccct taatgattaa      6780
     gggctttttt gtatctgtta gacctatatc atgtcggaac atgaccaagg atgaaatagc      6840
     taaagcagtt ggttgtggag tttctaccgt ttatcgagta gcgaaaagta ctcattatgg      6900
     tttttttaat agcatcttta aatgtgcttc taggaatgct atagtcatag cgttgaatag      6960
     gagaatctat gaattctgat gctgtttgga ctatgactga aaaatctcgt ttgaaacgag      7020
     aggatgaagt tcgtatgcag gaactcagac atctattcga tttgatggat gaaagagagg      7080
     aagagtggca ggtaactaaa actactacat tagaaaaagc tctaaagata ctttcatggt      7140
     gtgatcttga cgtagctcct gggttagctg agctagagat gcaacaacct atagatatta      7200
     ttgagcaaca tcgtaagtgg ttaaaggcat ttcgttcagc gatgccttat cttgcaaaga      7260
     tgctcctcgt cactgattca accctactta tcaaattaag atgcacatta gagaggtatg      7320
     ctgagattag ctacccgaac ctacttgtag tgattcaacc caaactgcaa acacttaact      7380
     ttataaaggc ctaactatga ctcaattaat ccatgcacga atgactgcaa gtattactga      7440
     actcaaaaag agtccgatgg atacagtgtt agcaggtaaa ggtgaacctg tagcgatcct      7500
     taatcgtaat acaccagcgt tttactgtgt tccggctgat ttgtatgaaa ccatgatgga      7560
     acaactggaa gacctggaac tcaacaaaat tgcagatgct cgtgcgaatc aaaaacgcat      7620
     tcgagtaaat attgatgacc tataagttag actttttaga agaagcatta gcagaatgga      7680
     ataagcttaa tccaagtatt aagcaaccat tgaagaagaa actgatcaag gtactagaga      7740
     atcctcacat tcccaagaat aagctctcag gacatcctaa ccgctacaag atcaaacttc      7800
     gcagtgttgg ttatcgtttg gtttatgaag tgattgatga tgaggttgtt gtcatcgtca      7860
     ttgccgtagg cagacgtgaa aacaatgctg tgtatgatga agccaactct cgacattcat      7920
     aagtaattga ttgcattaag caggaattct ttcattaggg aattcctgct taatgcacat      7980
     atggaatata tcttacagat tttagttatt ttttttaata tttaattgaa actaaattaa      8040
     aactaattag aaactataat tgtgcattta ataggggatc atctctattt cacaacccag      8100
     agttgatccc acttaaagta gttatgcgtc aacttatctc tggtgaaccg taccgggttt      8160
     gtcggagagt caatattctg agagactatc ccgatgacaa aattaaaata tacccctgaa      8220
     atcagagaaa gagcggttca attattgatt gaatctgaaa aagattatcc atcgaattgg      8280
     gctgcgatca ccgctattgc tccctgagca gtatactgcg caagggttgt actactgaaa      8340
     cactacgtgt ttggtatcaa aaatatttag ataaacaaaa tccagttaaa gtacagcagc      8400
     tttcagacca agaacgtatc aaacaactcg aacgcgaaaa taaagaactg caacgcgcca      8460
     atgagattct acgtaaagca gccgcttttt tcgcccaggc ggagctcgac cgcccacaca      8520
     aataatggtg gattttatcc ataacaataa agagctgtac ggagtcgagg caatttgtag      8580
     aattttaccg atcgcacctt caacctatta ccagactcta gatctctgcg atgagaagca      8640
     ttgcttcgca agggaacatc gagcgaaacg agatttacat gacttgcatc atgctgagga      8700
     gattaaacga atttggaaag aaagttcagg tcgatacggt gtgcgtaagg tctggcaaca      8760
     actgaaacgt gaaggctata ttattgcacg ctgtactgtt gctcgattaa tgaaaaagct      8820
     aggtatacaa ggtgtttggc gaggtaagaa caaacaaacc acccgtagcc gagatgacca      8880
     aaaacgagca gatgatttag tgaaacgtaa ttttactgct gatcatcctg accaactgtg      8940
     ggtcagtgac tttacgtata ttcaaacaaa ttcaggctgg gtctataccg cctttattat      9000
     tgatgtgttt tcacgagcaa ttgttggctg gaaagtatct acacggatga atacagatat      9060
     ggtgctcgat gcattggagc aagcattgca tgatcgcggc atgccaaaga atgtgattca      9120
     tcattccgac agaggtgtgc aatatctttc cattcgctat accaatcgtt tagaagcagc      9180
     aaatttacga gcatcagtcg gtacgactgg tgattcatac gataatgctt tggctgaaac      9240
     ggtgaatggc ttatacaaaa cagaggtgat tgaatatcta aaagcagatt ggcaaggttt      9300
     agcagatgta caacttgcga cactaaactg ggtagattgg ttcaataaaa agcgtgtaca      9360
     cagtgcactg ggttatgtat cgccttttga gtttgaagca atgtactatg ataagattaa      9420
     cccgttaggt caggtggcct aacttaaata aaaaagtctc cgacaaaccc ggtacggttc      9480
     atggtcatct ttcatgtcct attgggtagc atacttgctc caagtgccag ttttgtcttg      9540
     ctaaacttat attgaatctt ttctagtgtt tccattaaaa ctgaaggtat ttgcaaaatt      9600
     agccatgtaa tttaattatt gatgggctat tggaagaagg aatgagtgat agactatgaa      9660
     caagaatgcg tagtcatttt attcagtatt ttgtaattta actaaatgaa atttattgaa      9720
     ttttaattat taattaaaaa aattaaaacg cccaatttga aaaactgggc gcttcactaa      9780
     tggtaataat cattaccatc aaccactaga gaacacaaac catggttcag ttttgtgttt      9840
     tataaacata ctttgtgtat gtgagtttgt aaatgatttt ttgctcagag atttaaaaat      9900
     caaagtatct tcttattgat atttgtaata ttagactata ccctaaagtt acaatctgaa      9960
     agttcatgaa attatgtatc atttaaatga tttttaatca taagtaacat gtaactttag     10020
     tgttaaagat ttataattta caaaattgtt catttttatc caattggggc gtgaaaaagt     10080
     gaaaggccaa aaagtagggt atgtccgtgt aagttctgtc gagcaaaaca ctggacgtca     10140
     acttgaagga attgaggtcg accggatttt tgttgaccgt gcttcaggta aaaatactga     10200
     ccgacctaaa tttcaggaaa tgttgaacta tgtgcgggaa ggggacaggg tgattgtaca     10260
     ttcaatggat cgttttgcgc gaagcctaaa agatttggtc actgaagtag ataaactggt     10320
     caaacgaggg atcgccatcc aatttgtaaa agaaaatatt acttttacag ccgaatccac     10380
     cccgatggat aatttgatgc ttcaaatgat gggtgctttt gcacagttcg aacgtgagat     10440
     cattttagag cggcaaaagg aaggaataaa actcgcctct gctcagggga agtacaaagg     10500
     tcgggtgcat aaactaaagc ctgaccaagc tgaagcttta cgacaagcat ggaaggaggg     10560
     gaagtatcca tcgaaaatgg cattagggaa agcttttggg attagtcgtc aggcggtata     10620
     ccgatattta caagttagtg aatagcttat taggattagc aactaaattt agtttaactt     10680
     ataaaaatca tgaaacactg ttcgaatttt aagcgtggaa catgaataat caataaaaag     10740
     ccgctctggt gccctatatt ccagaacggc ttgctttaag ataatgatat ttaaagagaa     10800
     atatcaagca ttacgtataa ggtgtattat gttaatttta ggaaatatta aaactaattt     10860
     tcagacttat cccaccaact ttgagctaaa tcagtatttt taggaatacc tataccatca     10920
     cgatacataa cggaaagact tcgcattgct ttcttattac ctaactttgc agccttttca     10980
     cgaagttcaa aagctttatt aatattaact tctattccgc tatctgcacg agtatataga     11040
     tcagctaact caaccattga ttcagaatgg ccattttctg aggctttctg aaaccactta     11100
     aaagcttttt ggaaatgttc taaagaatcg tttttgtcat catcttccat taatctagca     11160
     taagtaacat atccatcagc taaccaaaac attgctgcta catttccatt ttctgctgat     11220
     ttaagagccc aaacttcagc ttgattttca tctgaatcaa caccatgacc atatagataa     11280
     atctcggcta attctaactg agcagaagta tctccatttt ctgctttcgc taataaatca     11340
     ttagaaaaaa caggttctgc aaatgtttcc attgaaaggc aaactcctaa agccataaaa     11400
     atatttgtta atttattcaa tttttaacct ttaaactaaa ctgttaggct tgtatatttt     11460
     tatatcatac ctaaaagaaa actctaaaat tagagtatgt cttatctcta tttaacataa     11520
     tggctgttat acgaaacgag agtgttagaa cccatttaaa gtgtctatat tctcaccaat     11580
     aaaaatgtcc ggtttctccg aggtaaaata tgacttttga acaaaaaata agccattgtt     11640
     tattcttttt atttccaaca aaattccaga actcatctac ttcgagagat tcataatgac     11700
     tttgctgagg ctgaatttca taggttgatt cagttaaagt acgtaaaact ttaccgatac     11760
     tgatgcgctc aacttcagca atatctcgta taccgctgcc tctgaccatc aactgtaata     11820
     ttttacgagt aatacctgac ttacatccta gatagctcag tgcatgatca ccaataaact     11880
     gacgtttaca gtctttgcac tgatagtttt gtttcccatc tactttgaac cgtaccgggt     11940
     ttgtcggaga ccaactttct tgagagaatg tcccgatgay aaaaccaaaa tatacccctg     12000
     aaatccgaga tagagcggtt caattattga ttgaatccga aaaagattat ccatcgaatt     12060
     gggctgcaat cactgctatt gctcccaaga taggttgtac tcctgaaaca ctgcgtgttt     12120
     ggtatttaaa acatctcgat caacaaaatc ctatcaaagt acaacaggca tcagatcaag     12180
     aaaaaatgaa gcagatggaa cgtgaaatca aagaattaaa gcgtgccaat gaaattctac     12240
     gtaaagcagc tgcttttttc gcccaggcgg agctcgaccg cccacacaaa taatggtgga     12300
     tttcatccat aacaataaag acttatatgg tgttgatgcg atttgtagga ttttaccgat     12360
     cgcagcttca acctattacc gaactttaga tctcgcggac aatccagaac atcgagcgaa     12420
     gcgagattta catgacttgc atcatgctga acaaattaaa cgaatttgga aggaaagttc     12480
     aggtcgatat ggtgtacgta aagtttggca aaaactgaaa cgtgaaggct atattattgc     12540
     acgctgtaca gttgctcgat tgatgcaaaa gctaggtata caaggtgttt ggcgaggtaa     12600
     gaataaacaa actacccata gccgagatga tcaaaaacga gcagatgact tggtgaaacg     12660
     caattttagt gctgatcacc ctgaccagct gtgggtcgct gactttacgt atattcaaac     12720
     aaattcaggc tgggtctata ccgcctttat tattgatgtg ttctcgcgag caattgttgg     12780
     atggaaagta tcaacacgga tgaatacaga catggtgctc gatgcactgg agcaagcatt     12840
     gcatgatcga ggcatgccaa agaacgtgat tcatcatagt gacagaggtg tgcaatatct     12900
     ttccattcgt tataccaatc gtttagaagc agcaaattta cgagcatcag tcggtacgac     12960
     cggtgattca tacgataatg ctttggctga aacggtgaat ggcttataca aaacagaggt     13020
     gattgaatat ttaaaagcgg attggcaagg tttagcggat gtacaacttg cgacattaaa     13080
     ttgggtagat tggttcaata aagagcgtgt acatagtgca ctaggttatg tgtcaccttt     13140
     tgattttgaa gcaatgtact atgataaaat taacccgtta ggtcaggtgg cctaacttaa     13200
     ataaaaagtc tccgacaaac ccggtacggt tcactttgat accatttttc tttatactat     13260
     cactgaggca ggttggacat ttgattgcta gagttatttg catttctcta ttttatcaaa     13320
     atccaatcgg ctttttcttc agcatacttt ttgaaacact accaaatttt aaagttgtat     13380
     atcatgaaat tattaaaaat attgagttta gtttgcttaa gcataagtat tggggcttgt     13440
     gctgagcata gtatgagtcg agcaaaaaca agtacaattc cacaagtgaa taactcaatc     13500
     atcgatcaga atgttcaagc gctttttaat gaaatctcag ctgatgctgt gtttgtcaca     13560
     tatgatggtc aaaatattaa aaaatatggc acgcatttag accgagcaaa aacagcttat     13620
     attcctgcat ctacatttaa aattgccaat gcactaattg gtttagaaaa tcataaagca     13680
     acatctacag aaatatttaa gtgggatgga aagccacgtt tttttaaagc atgggacaaa     13740
     gattttactt tgggcgaagc catgcaagca tctacagtgc ctgtatatca agaattggca     13800
     cgtcgtattg gtccaagctt aatgcaaagt gaattgcaac gtattggtta tggcaatatg     13860
     caaataggca cggaagttga tcaattttgg ttgaaagggc ctttgacaat tacacctata     13920
     caagaagtaa agtttgtgta tgatttagcc caagggcaat tgccttttaa acctgaagtt     13980
     cagcaacaag tgaaagagat gttgtatgta gagcgcagag gggagaatcg tctatatgct     14040
     aaaagtggct ggggaatggc tgtagacccg caagtgggtt ggtatgtggg ttttgttgaa     14100
     aaggcagatg ggcaagtggt ggcatttgct ttaaatatgc aaatgaaagc tggtgatgat     14160
     attgctctac gtaaacaatt gtctttagat gtgctagata agttgggtgt ttttcattat     14220
     ttataagaat tagaagtttg aggttaatct atttttggta gtgtttcaaa aagtatgctg     14280
     aagaaaaagc cgattggatt ttgataaaat agagaaatgc aaataactct agcaatcaaa     14340
     tgtccaacct gcctcagtga tagtataaag aaaaatggta tcaaagtaga tgggaaacaa     14400
     aactatcagt gcaaagactg taaacgtcag tttattggtg atcatgcact gagctatcta     14460
     ggatgtaagt caggtattac tcgtaaaata ttacagttga tggtcagagg cagcggtata     14520
     cgagatattg ctgaagttga gcgcatcagt atcggtaaag ttttacgtac tttaactgaa     14580
     tcaacctatg aaattcagcc tcagcaaagt cattatgaat ctctcgaagt agatgagttc     14640
     tggaattttg ttggaaataa aaagaataaa caatggctta tttacgccta tcatcgagaa     14700
     acaggtgaaa ttgttgctta tgtttggggt aaacgagatt tagctacagt ctaacaattg     14760
     aagacaaagc ttaaacaatt agatattcac tacacccgaa ttgcaagtga tcattgggac     14820
     agtttcatca ctgcttttaa aaatggtaag caaagtattg gtaaattttt tactgtaggt     14880
     attgaaggca ataattgcaa aataaggcat agaattaggc gtagcttcag aagaagctgt     14940
     aatttttcaa aaaagcttga aaaccatttt aaagcttttg atttagcctt cttttctttt     15000
     acatcaataa tggcttcatt taaaggcagc atactttttg aagcaccacc aaaattttat     15060
     gttaagtaga gactaaaaat gcccttgatt aagggcttac aagggcattt tgtataaggt     15120
     gtattatgtt aattttagaa tttcttcatt agataatttt tgataagcta aatccattag     15180
     gactaattaa gtaaatatga gcaattgggt caatgtcaca caggataagt ctacaggtat     15240
     agaactaatt catgcccact tcaaaggctt tgcatacgat cctcatctac actcaagtta     15300
     tcttataggg gtaacagagt taggacatca acaattcaat tgtagaaaaa aaattattga     15360
     tagctatcaa ggtcaaactt tcatgcttga acctgaagaa gttcatgatg gtaatgcacc     15420
     agatcctctc ggcttcactt ataaaatgat gcatttagat ccagcatggt taaaaaaaaa     15480
     atggcactgt tgcaaagtta gcgatgaggc agccttttgt cttattcaaa ggccttacgt     15540
     ttcaaaaact ctgcttacca ggcgcatttc gcccagggga tcaccataat aaaatgctga     15600
     ggcctggcct ttgcgtagtg cacgcatcac ctcaatacct ttgatggtgg cgtaagccgt     15660
     cttcatggat ttaaatccca gcgtggcgcc gattatccgt ttcagtttgc catgatcgca     15720
     ttcaatcacg ttgttccggt acttaatctg tcggtgttca acgtcagacg ggcaccggcc     15780
     ttcgcgtttg agcagagcaa gcgcgcgacc ataggcgggc gctttatccg tgttgatgaa     15840
     tcgcgggatc tgccacttct tcacgttgtt gaggatttta cccagaaacc ggtatgcagc     15900
     tttgctgtta cgacgggagg agagataaaa atcgacagtg cggccccggc tgtcgacggc     15960
     ccggtacaga tacgcccagc ggccattgac cttcacgtag gtttcatcca tgtgccacgg     16020
     gcaaagatcg gaagggttac gccagtacca gcgcagccgt ttttccattt caggcgcata     16080
     acgctgaacc cagcggtaaa tcgtggagtg atcgacattc actccgcgtt cagccagcat     16140
     ctcctgcagc tcacggtaac tgatgccgta tttgcagtac cagcgtacgg cccacagaat     16200
     gatgtcacgc tgaaaatgcc ggcctttgaa tgggttcatg tgcagctcca tcagcaaaag     16260
     gggatgataa gtttatcacc accgactatt tgcaacagtg ccaataatgg tggatttcat     16320
     ccataacaat aaagacttat atggtgttga tgcgatttgt aggattttac cgatcgcagc     16380
     ttcaacctat taccgaactt tagatctcgc ggacaatcca gaacatcgag cgaagcgaga     16440
     tttacatgac ttgcatcatg ctgaacaaat taaacgaatt tggaaggaaa gttcaggtcg     16500
     atatggtgta cgtaaagttt ggcaaaaact gaaacgtgaa ggctatatta ttgcacgctg     16560
     tacagttgct cgattgatgc aaaagctagg tatacaaggt gtttggcgag gtaagaataa     16620
     acaaactacc catagccgag atgatcaaaa acgagcagat gacttggtga aacgcaattt     16680
     tagtgctgat caccctgacc agctgtgggt cgctgacttt acgtatattc aaacaaattc     16740
     aggctgggtc tataccgcct ttattattga tgtgttctcg cgagcaattg ttggatggaa     16800
     agtatcaaca cggatgaata cagacatggt gctcgatgca ctggagcaag cattgcatga     16860
     tcgaggcatg ccaaagaacg tgattcatca tagtgacaga ggtgtgcaat atctttccat     16920
     tcgttatacc aatcgtttag aagcagcaaa tttacgagca tcagtcggta cgaccggtga     16980
     ttcatacgat aatgctttgg ctgaaacggt gaatggctta tacaaaacag aggtgattga     17040
     atatttaaaa gcggattggc aaggtttagc ggatgtacaa cttgcgacat taaattgggt     17100
     agattggttc aataaagagc gtgtacatag tgcactaggt tatgtgtcac cttttgattt     17160
     tgaagcaatg tactatgata aaattaaccc gttaggtcag gtggcctaac ttaaataaaa     17220
     agtctccgac aaacccggta cggttcactt tgataccatt tttctttata ctatcactga     17280
     ggcaggttgg acatttgatt gctagagtta tttgcatttc tctattttat caaaatccaa     17340
     tcggcttttt cttcagcata ctttttgaaa cactaccaaa ttttaaagtt gtatatcatg     17400
     aaattattaa aaatattgag tttagtttgc ttaagcataa gtattggggc ttgtgctgag     17460
     catagtatga gtcgagcaaa aacaagtaca attccacaag tgaataactc aatcatcgat     17520
     cagaatgttc aagcgctttt taatgaaatc tcagctgatg ctgtgtttgt cacatatgat     17580
     ggtcaaaata ttaaaaaata tggcacgcat ttagaccgag caaaaacagc ttatattcct     17640
     gcatctacat ttaaaattgc caatgcacta attggtttag aaaatcataa agcaacatct     17700
     acagaaatat ttaagtggga tggaaagcca cgttttttta aagcatggga caaagatttt     17760
     actttgggcg aagccatgca agcatctaca gtgcctgtat atcaagaatt ggcacgtcgt     17820
     attggtccaa gcttaatgca aagtgaattg caacgtattg gttatggcaa tatgcaaata     17880
     ggcacggaag ttgatcaatt ttggttgaaa gggcctttga caattacacc tatacaagaa     17940
     gtaaagtttg tgtatgattt agcccaaggg caattgcctt ttaaacctga agttcagcaa     18000
     caagtgaaag agatgttgta tgtagagcgc agaggggaga atcgtctata tgctaaaagt     18060
     ggctggggaa tggctgtaga cccgcaagtg ggttggtatg tgggttttgt tgaaaaggca     18120
     gatgggcaag tggtggcatt tgctttaaat atgcaaatga aagctggtga tgatattgct     18180
     ctacgtaaac aattgtcttt agatgtgcta gataagttgg gtgtttttca ttatttataa     18240
     gaattagaag tttgaggtta atctattttt ggtagtgttt caaaaagtat gctgaagaaa     18300
     aagccgattg gattttgata aaatagagaa atgcaaataa ctctagcaat caaatgtcca     18360
     acctgcctca gtgatagtat aaagaaaaat ggtatcaaag tagatgggaa acaaaactat     18420
     cagtgcaaag actgtaaacg tcagtttatt ggtgatcatg cactgagcta tctaggatgt     18480
     aagtcaggta ttactcgtaa aatattacag ttgatggtca gaggcagcgg tatacgagat     18540
     attgctgaag ttgagcgcat cagtatcggt aaagttttac gtactttaac tgaatcaacc     18600
     tatgaaattc agcctcagca aagtcattat gaatctctcg aagtagatga gttctggaat     18660
     tttgttggaa ataaaaagaa taaacaatgg cttatttacg cctatcatcg agaaacaggt     18720
     gaaattgttg cttatgtttg gggtaaacga gatttagcta cagtctaaca attgaagaca     18780
     aagcttaaac aattagatat tcactacacc cgaattgcaa gtgatcattg ggacagtttc     18840
     atcactgctt ttaaaaatgg taagcaaagt attggtaaat tttttactgt aggtattgaa     18900
     ggcaataatt gcaaaataag gcatagaatt aggcgtagct tcagaagaag ctgtaatttt     18960
     tcaaaaaagc ttgaaaacca ttttaaagct tttgatttag ccttcttttc ttttacatca     19020
     ataatggctt catttaaagg cagcatactt tttgaagcac caccaaaatt ttatgttaag     19080
     tagagactaa aaatgccctt gattaagggc ttacaagggc attttgtata aggtgtatta     19140
     tgttaatttt agaatttctt cattagataa tttttgataa gctaaatcca ttaggactaa     19200
     ttaagtaaat atgagcaatt gggtcaatgt cacacaggat aagtctacag gtatagaact     19260
     aattcatgcc cacttcaaag gctttgcata cgatcctcat ctacactcaa gttatcttat     19320
     aggggtaaca gagttaggac atcaacaatt caattgtaga aaaaaaatta ttgatagcta     19380
     tcaaggtcaa actttcatgc ttgaacctga agaagttcat gatggtaatg caccagatcc     19440
     tctcggcttc acttataaaa tgatgcattt agatccagca tggttaaaaa aaaaagggca     19500
     ctgttgcaaa gttagcgatg aggcagcctt ttgtcttatt caaaggcctt acgtttcaaa     19560
     aactctgctt accaggcgca tttcgcccag gggatcacca taataaaatg ctgaggcctg     19620
     gcctttgcgt agtgcacgca tcacctcaat acctttgatg gtggcgtaag ccgtcttcat     19680
     ggatttaaat cccagcgtgg cgccgattat ccgtttcagt ttgccatgat cgcattcaat     19740
     cacgttgttc cggtacttaa tctgtcggtg ttcaacgtca gacgggcacc ggccttcgcg     19800
     tttgagcaga gcaagcgcgc gaccataggc gggcgcttta tccgtgttga tgaatcgcgg     19860
     gatctgccac ttcttcacgt tgttgaggat tttacccaga aaccggtatg cagctttgct     19920
     gttacgacgg gaggagagat aaaaatcgac agtgcggccc cggctgtcga cggcccggta     19980
     cagatacgcc cagcggccat tgaccttcac gtaggtttca tccatgtgcc acgggcaaag     20040
     atcggaaggg ttacgccagt accagcgcag ccgtttttcc atttcaggcg cataacgctg     20100
     aacccagcgg taaatcgtgg agtgatcgac attcactccg cgttcagcca gcatctcctg     20160
     cagctcacgg taactgatgc cgtatttgca gtaccagcgt acggcccaca gaatgatgtc     20220
     acgctgaaaa tgccggcctt tgaatgggtt catgtgcagc tccatcagca aaaggggatg     20280
     ataagtttat caccaccgac tatttgcaac agtgcctttt atgtcagtga tcaaactttt     20340
     ttttcaaaat ctcaactttt ggaaaatcat tttttttatt tgttaatgtc cgttactgag     20400
     tacacgtcga ggacatatag ctgattactt aatgaatagt gagtgagcta tagacctgac     20460
     tgtattccaa aatattgctt cagaagttga agtctcataa ataaaaaacc ccaatagcta     20520
     aatctcgtgg cgggactagc tattagggtt agaattacag gtacattgta caatgttcaa     20580
     aacaaatata cacgattttt tgttaaatct aggctacaca actaacaatt taccgtttca     20640
     gtttgtacca gagaagcaat atcgctttcc tagtatgggg aaaagtgcca aaaaccgtgc     20700
     agcgtcaatt gttttgaaag ccaatggcac gtatttaatt tatgaccatt catgcggtgc     20760
     gagctatgtc ttcaatgctg aacggacttc agacaaaagc aagcaagatc cagccgagct     20820
     tgaaaagcta catattgaat tagaaaagca gcgtaaagct gaaaaacaaa agaaaataat     20880
     tcaattccaa atcaaagcaa gtgaagctca acagatatgg aataaagcca aaccgtgctc     20940
     ggcgcatccc tatatggcat tggctggtat caagccgata aatgcaagga ctctatcaat     21000
     cgttaagacg tcagatggtc agacgttcat taatccgctc attattccgt tatttgatgt     21060
     tcgtacgcat gaacttataa accttcaatt catcacagcc gatggaacaa aacgcccgct     21120
     atctggtgct cagagcaaaa actattattt tgtgattgaa ggtacagagc caaccatatt     21180
     tgttgaaggc tacaaagatg cttgcaatgt gttccacgca actggtagac gagttatagc     21240
     atgtatttcg gctgggaaat tcaaagaagt ttatcccgta cttggaaagc tttgcgatgt     21300
     aatcattgct gataatgaca atattctgaa agcagatccg gacgataaaa cccgcaaagt     21360
     cgtattgtct gagcaagttg taaagggtcg tggtactggt cacagagtag cgtatgaact     21420
     gaaagcgaag ttctatcttg cacctaaatt gggttctgat gctggcagta tgacgcatga     21480
     agaaattaga aatttactgc aacaaaaact gacttcagac attccagctt atgatgtttg     21540
     gacgcagtta aaagacgagc cttgcgctat tgaaacaaaa cttttgaccg atgctttgag     21600
     caccgaagat aatagccata aatgcgctgt attagcttat cagtacatca tgcgcaactt     21660
     ggtgcatgtt ccatataaga aaaatttaat cgaacttcga aacgaaatag aaccgttctg     21720
     tgtgcatcgt gttcatcctg tcactttaga caatattatt ctctatgctc acaacagaat     21780
     tgagttcatg cagacgcttg gtttggatgc tgtcactatt cgggaccgaa aaaatcacaa     21840
     cttgattaaa ttggattctt tggaccattt cagcccgaac tataaaggtg tgtatttggt     21900
     gaaagcgcca acaggatcag gaaaaacgca aaaagtagga cgtccgttcc gcgattggtg     21960
     cggtcagaat gggcatccat ttttaaccat tgcacatttg cgaagcctaa tccgtgaaat     22020
     ggcgtcacgc ttggacacgg cacattatga ggatgagaaa aaaagcatca ttgaagcgcg     22080
     caaaattggt ttggatgctg ctttaagtca atccatcgga tctctggctg tatgcctgcc     22140
     aagtctagcc aatcagctat ttaagccttt cataaaggac tgtcagcaca tttttattga     22200
     tgagatcagc caattaattg aaaccttcaa cagcgacaag ttattcaata aaaccgacat     22260
     tgaatacgtt tataacttgc tgaaggtcat cattaaaaat gcagagtgca tcattgttgc     22320
     agatgccaac attaactcaa aaacattgga ttttatcgag tcgtgccgac caaacgagca     22380
     attcactatc gttgaagtag aacccaaaga cgaaagtaag acagtgtacc tgtataacag     22440
     ttttgctgaa ttacagagtt ttatgctgca acgtgtcatg gtcgaaaatc aaaatttatg     22500
     gattacgtgc gattccaaaa gtcatgtgca ggcacttcac gccattctca gagatttgga     22560
     tgttaaaagc attgcgattg tcggaaatga aaacattaaa aaagaaacag cggaatttct     22620
     tagcgatcct gaaaccgagt cactaaaata tcaggttgta atctctacaa gtgcgatcgc     22680
     ttctggtgta tccattcagc atgagcaatt cattcacgac aatggaaaag ggtattttga     22740
     ctgcgttgtt ggatttttta ctgggtcgag tattcaaccg actgacgcat atcaaatgat     22800
     cggccgtgtg cgttacgcta ctgacttcca catttttgcc gatcaaagca aacgctatac     22860
     tatgaatgtg ttggacattc tacaagggaa acagcaagcg agtattctgg aagggaaaaa     22920
     agcaaaaatc acggagtttt cactatttaa aactgaactt gaaaatatcc gtgaaacccg     22980
     tcgttctaat ttcgcaaata acttgatatg gatacttgaa agcaagctat tcaacattaa     23040
     gcgagtgcaa aaattcgatg cttcagaaca tactgaattt tttaaacata ctaaaaaagc     23100
     agtcaaagaa gccaagcgag agctgatcaa aactgcatac aagatcaatg atgaaactgc     23160
     atccagactt cagcgcaaag agtttttatc tgaagctgaa gccaacgcgc tgcaagcata     23220
     caaaatgcgg tctaagctcg gtcttgatta cgttacagaa ttaactgatg aacactttga     23280
     tattgatata ggtcaattga tacgattcag tgcttttatg ggtcgatata agccaagtaa     23340
     cgataagagt aaggatttag cgattagacg ctaccatgag gcgatgggga aagcatacaa     23400
     gctggcattt gatggcgtgg agctacaacc caatgcggtg tttactgaaa caagtgcgaa     23460
     ggcactgctt caacagattg caaaatacaa acttgtactt gcgtcgattg gtgcaattcc     23520
     gactcgtttt ggtgtgcagt cgtggaaacc ttccgaatat gcagtgcgag atttgaacga     23580
     agttttgaag catataggag ttaaatccaa atatgttaga aatccattca agccgcgttt     23640
     gaaaagaaaa ttaagtgttg agatgcccaa taatctatat ataagaatag agccatctca     23700
     acagataatg gatgaatacg cttataaaat tgatcctgat aattatttgc tgatgcagca     23760
     actctgcgag tctgtcttga agtcagcgac caaacaggtt gagcatgaaa acgtgcagca     23820
     acttgctgaa gctgttaaac gtcctgattt cgtttcatcg gatgatgtaa agattgatat     23880
     tcagtcagta acactggtta ctcatgcaac tgagcagcag cttgcgatcc agccaagcaa     23940
     tgatgtcgta ttcattgatg tgatgaaaga actgatgcgc tcggacttaa ctcttgctga     24000
     tttttatcgc ttgaaagatt acgcagagta tttaccgaaa ctgcacgttt ctgctgacag     24060
     tgctcaacag gtatcagagt tggatttaat caattcaatg atcagtagta gggcgtcgat     24120
     tttatagcct aagcactaat tcttaggcta ttttggcgat caaggctaga aagacattat     24180
     tgatataata gagctctttc ataaatcaaa agtgatcaca ttttggttaa tctttacacc     24240
     ataaattgtt gagcattcgt gcataattta aggatgaaat acatcgattc aaagcagctt     24300
     tctgaaactg cttaataaat ggcttgagca acaagacgaa ttaatttacc gtctcgggga     24360
     ttaccttagt ttatcgttat tattctctaa ttcttttaat ttcttgaatc taaaatcttt     24420
     tgcacattga ataaatttct cagtcttttt ttcatataaa gaatgagcag attcaccaaa     24480
     aaactctata agataataat aatgatcatt tttatactta aagtaagaat aaactaaata     24540
     actgtcactg gtacagtgcc actgagcata gccatatcct tcttcatctt cccaaatact     24600
     atcttcttgt ctcaaatgta catgctgaat ttcttctttt tgagcatttt ttgaaaactt     24660
     atcaaatcta tctcttccaa aatattcaga tgcaggttga tctctttctt gaacatttct     24720
     agatggagca ggatgttctc tgtttcggct agcttgcttg tatataagaa attgatcagc     24780
     aataaaattt aattcattgc tgattcccat ttcttcagca tcattttcta attcttcaga     24840
     aatctctaca taaatcattt ttatgcttga gtttcatgag tagaatttaa taatttctca     24900
     ttacctctag ctgttagcat acctaccgct ctaaagaaac tagcttgctt ctcactattt     24960
     aaaggtttgg caacaacttt tcgtggtttt ccacgacgga taactactgc tttagttacc     25020
     atattgaatc tcctttagat ccataaaagt tatttcatat ggaatatata ctagcataaa     25080
     tcattaccag ttcactctta ttattttttc gctattagcg aaataatatt tgctaatagc     25140
     taaaaaaaat gtatgatgaa taagttactt cttgttggat aatcacccat ttttgttatt     25200
     tgagtattta aatactcgga ggtttaacca cctcaaattt cggggggata tggctcttga     25260
     tgacatgtag agatctcaat gatcgatatg cggtaagact ataattccat cgatatgagt     25320
     gccacacgca atggagcgtg tggcactttt tgaagagtca agtgctgaac accagagtat     25380
     ttttcttcct agcgtaaatg gggccaattt tggtcgttaa ggaagattca aatgaaatat     25440
     ttaagtaacg ttcagcagcc atctaaagtt gagaataagg ctaataaacc caagcctcca     25500
     aaaggttgga agtggattaa acttattcta gtagtgttgc ggtttattct aaaacacatc     25560
     cttcaagagg acgatttagg aaactaaatt ctcccttgga gaacacttct ttaggtggtt     25620
     ctcttttaaa aaagcttatt agaggtcttt taaatgctta atgatgcact acttaccatg     25680
     aggaagtatc atcgcatatc tcaaacagaa ttatctcaat ctctaggcat ttctaactct     25740
     tacttatctg aaattgaaag tggtaagaag aaaccaactc tagagttact agataaatat     25800
     tctgaatatt ttgatatccc tgtttcttcc ttaatgttct tttcggaaaa tatggataaa     25860
     cgtgacactt tatcaggaaa atttcgttat tttgctggta gtaaagtaat caaacttatg     25920
     aactggttaa gtgaaaatgg aaaatagtca accttctgat tatgcaaaat atgtatacga     25980
     attagagtta ctgaactcac cgttatttca tattacaagc aagaagcgac tagctatttt     26040
     attatgttca tctattaaag aactgaacca tattgttcgt tcaaaaaatc agatgtatca     26100
     atattttaat gaaaataaga ctgatgatag tggaaacatt attaaagtcc gccctattca     26160
     aaatcctcat gatagattga agcagatcca ttccagaatt gggaaatttt tgggtaactt     26220
     gaaagctcct gattatttac attcaaaacg ttctaaatct gcaatttcga atgcaaaagc     26280
     gcatgtcggt cttaaggggc atacgctaaa tattgatatt actgattttt atccttctac     26340
     ttctaaggct aaagtgcaat ctttttttgg atatactctt caatacccaa ctgatattgc     26400
     taaatatata tctgaagtct gcactgtaaa taattgcctt cctacaggta gcccattaag     26460
     ttcagcatta gctttctggg ctaataaatc catgtttgat gaaatttata gaatggctaa     26520
     aagtcgctct ataactatga ctgtttatgt tgacgatatt tcgtttacag gaaaggccgt     26580
     caatcaaaac tttctaaata aaattattca aataatagag aaatatcagc ataatattaa     26640
     acaagaaaaa attaaatttt ttcctgaaaa tagcattaaa ttcgtcactg gggtggcaat     26700
     agtaaatggt agtttacaac ctgctcatag gcatttccga gatattagac agcttaaaaa     26760
     aattgataat aatatccaag cagctctacg attaatagga aaaataatta tataaaacaa     26820
     atcattaacc atgtctaaaa attctattta acataaaatc tcttatacga agcccaggtt     26880
     aattctgggc tttttgttca atctcatcat tggccgagaa catacttgga ttcgtaagcc     26940
     tgatattttc ctgacaactt ccacacagca tcaatcctgc aaaaagttgt acattttgtc     27000
     tattttcaca aagcgtacat ggctttgaaa gctgaataat attatctgac actactttac     27060
     cctcttatag ttatcatctg catatgaata acctttagct tgtatcattc taacctcatc     27120
     tttagaagcg ccatttttca ttaagagcca caacatcatg aaatatagtc cagaaaagtc     27180
     ttcatagtat ttttcagaaa aattgttatc ttcctcaaaa tcatctattc gcttttctaa     27240
     tcgattcacc agatcctcaa tacgatcggc ttgctgttta acagcaatag attgaaaatc     27300
     attggtcaaa attttactga ataatttact ggttctgatt ccttctgaat tagccaattg     27360
     atcgtagaat tctgctactt gtggatctaa cctgactgca taagttttga ctttttcgcc     27420
     cataaattac acctcttatt aaaattagat tttgtacaaa attaaatata tataattcaa     27480
     ctaattaaat aaaaaataat aattagatta cgtacaaact tatttgtaca gaattaattt     27540
     attctaaaac aaaaacttat ttaaatataa tgcttttttt atgtacaatc atgagtacat     27600
     attttttctt aaatttatca atatcttatc taaaaaaagt gttgttttga tgtacaacca     27660
     tgagcacagc ataaaaaata gataattcaa tcacttattc taaaaaagac catttttctg     27720
     tacacgtttc tgagacccta aaaaatcgct gaaatcctta tcctgtaagg ctttgagggg     27780
     tgtcatcgtt agatgcgtgg tgtgtgacaa aaaaatcccg gcatgtgccg gatcttggat     27840
     tggaaaattg gctaaagtga cgtagggccg gtgcttggtt ttgcatggaa aaaagtattt     27900
     atttccttgt ttagaaaaac gtaaaaaatc aattttttgt ccattcatcc aggttaaaaa     27960
     tttcaaccca aaactttaat tatgaaaagc ttcatagaac gcgttcaaat gcgatttaag     28020
     agcctttacc tagaaaacat agatctcata gtgaaaaaca caaaacagct caaaaaacgc     28080
     aaatgagagc gaaataaaga ggtattttga ctttagatag atgcatagag cgagtgtcta     28140
     cgagcgaact atcaaaattt gcgcctagac cctctgaaaa acattttttt gtcctcttta     28200
     gcctaagaaa gcgtaagttt cgtgcagaaa tttgctcctg gatcgagcgt agcgagtaaa     28260
     aaagttttat gagcgaagc                                                  28279
//

If you have problems or comments...

PBIL Back to PBIL home page