(data stored in ACNUC1104 zone)

EMBL: CP000868

ID   CP000868; SV 1; circular; genomic DNA; STD; PRO; 3448466 BP.
XX
AC   CP000868; AAVB01000000-AAVB01000037;
XX
PR   Project:PRJNA17407;
XX
DT   16-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 4)
XX
DE   Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3448466
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   "Complete sequence of chromosome1 of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
RN   [2]
RP   1-3448466
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   ;
RL   Submitted (26-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9e0e4b50d666bf045f6d565e1a8e81f5.
DR   BioSample; SAMN00623032.
DR   EnsemblGenomes-Gn; Bmul_R0001.
DR   EnsemblGenomes-Gn; Bmul_R0002.
DR   EnsemblGenomes-Gn; Bmul_R0003.
DR   EnsemblGenomes-Gn; Bmul_R0004.
DR   EnsemblGenomes-Gn; Bmul_R0005.
DR   EnsemblGenomes-Gn; Bmul_R0006.
DR   EnsemblGenomes-Gn; Bmul_R0007.
DR   EnsemblGenomes-Gn; Bmul_R0008.
DR   EnsemblGenomes-Gn; Bmul_R0009.
DR   EnsemblGenomes-Gn; Bmul_R0010.
DR   EnsemblGenomes-Gn; Bmul_R0011.
DR   EnsemblGenomes-Gn; Bmul_R0012.
DR   EnsemblGenomes-Gn; Bmul_R0013.
DR   EnsemblGenomes-Gn; Bmul_R0014.
DR   EnsemblGenomes-Gn; Bmul_R0015.
DR   EnsemblGenomes-Gn; Bmul_R0016.
DR   EnsemblGenomes-Gn; Bmul_R0017.
DR   EnsemblGenomes-Gn; Bmul_R0018.
DR   EnsemblGenomes-Gn; Bmul_R0019.
DR   EnsemblGenomes-Gn; Bmul_R0020.
DR   EnsemblGenomes-Gn; Bmul_R0021.
DR   EnsemblGenomes-Gn; Bmul_R0022.
DR   EnsemblGenomes-Gn; Bmul_R0023.
DR   EnsemblGenomes-Gn; Bmul_R0024.
DR   EnsemblGenomes-Gn; Bmul_R0025.
DR   EnsemblGenomes-Gn; Bmul_R0026.
DR   EnsemblGenomes-Gn; Bmul_R0027.
DR   EnsemblGenomes-Gn; Bmul_R0028.
DR   EnsemblGenomes-Gn; Bmul_R0029.
DR   EnsemblGenomes-Gn; Bmul_R0030.
DR   EnsemblGenomes-Gn; Bmul_R0031.
DR   EnsemblGenomes-Gn; Bmul_R0032.
DR   EnsemblGenomes-Gn; Bmul_R0033.
DR   EnsemblGenomes-Gn; Bmul_R0034.
DR   EnsemblGenomes-Gn; Bmul_R0035.
DR   EnsemblGenomes-Gn; Bmul_R0036.
DR   EnsemblGenomes-Gn; Bmul_R0037.
DR   EnsemblGenomes-Gn; Bmul_R0038.
DR   EnsemblGenomes-Gn; Bmul_R0039.
DR   EnsemblGenomes-Gn; Bmul_R0040.
DR   EnsemblGenomes-Gn; Bmul_R0041.
DR   EnsemblGenomes-Gn; Bmul_R0042.
DR   EnsemblGenomes-Gn; Bmul_R0043.
DR   EnsemblGenomes-Gn; Bmul_R0044.
DR   EnsemblGenomes-Gn; Bmul_R0045.
DR   EnsemblGenomes-Gn; Bmul_R0046.
DR   EnsemblGenomes-Gn; Bmul_R0047.
DR   EnsemblGenomes-Gn; Bmul_R0048.
DR   EnsemblGenomes-Gn; Bmul_R0049.
DR   EnsemblGenomes-Gn; Bmul_R0050.
DR   EnsemblGenomes-Gn; Bmul_R0051.
DR   EnsemblGenomes-Gn; Bmul_R0052.
DR   EnsemblGenomes-Gn; Bmul_R0053.
DR   EnsemblGenomes-Gn; Bmul_R0054.
DR   EnsemblGenomes-Gn; Bmul_R0055.
DR   EnsemblGenomes-Gn; Bmul_R0056.
DR   EnsemblGenomes-Gn; Bmul_R0057.
DR   EnsemblGenomes-Gn; Bmul_R0058.
DR   EnsemblGenomes-Gn; Bmul_R0059.
DR   EnsemblGenomes-Gn; Bmul_R0060.
DR   EnsemblGenomes-Gn; Bmul_R0061.
DR   EnsemblGenomes-Gn; Bmul_R0062.
DR   EnsemblGenomes-Gn; Bmul_R0063.
DR   EnsemblGenomes-Gn; Bmul_R0064.
DR   EnsemblGenomes-Gn; Bmul_R0065.
DR   EnsemblGenomes-Gn; Bmul_R0066.
DR   EnsemblGenomes-Gn; Bmul_R0067.
DR   EnsemblGenomes-Gn; Bmul_R0068.
DR   EnsemblGenomes-Gn; Bmul_R0069.
DR   EnsemblGenomes-Gn; Bmul_R0070.
DR   EnsemblGenomes-Gn; Bmul_R0071.
DR   EnsemblGenomes-Gn; EBG00001111113.
DR   EnsemblGenomes-Gn; EBG00001111114.
DR   EnsemblGenomes-Gn; EBG00001111115.
DR   EnsemblGenomes-Gn; EBG00001111116.
DR   EnsemblGenomes-Gn; EBG00001111117.
DR   EnsemblGenomes-Gn; EBG00001111118.
DR   EnsemblGenomes-Gn; EBG00001111119.
DR   EnsemblGenomes-Gn; EBG00001111120.
DR   EnsemblGenomes-Gn; EBG00001111121.
DR   EnsemblGenomes-Gn; EBG00001111122.
DR   EnsemblGenomes-Gn; EBG00001111123.
DR   EnsemblGenomes-Gn; EBG00001111124.
DR   EnsemblGenomes-Gn; EBG00001111125.
DR   EnsemblGenomes-Gn; EBG00001111126.
DR   EnsemblGenomes-Gn; EBG00001111127.
DR   EnsemblGenomes-Gn; EBG00001111128.
DR   EnsemblGenomes-Gn; EBG00001111129.
DR   EnsemblGenomes-Gn; EBG00001111130.
DR   EnsemblGenomes-Gn; EBG00001111131.
DR   EnsemblGenomes-Gn; EBG00001111132.
DR   EnsemblGenomes-Gn; EBG00001111133.
DR   EnsemblGenomes-Gn; EBG00001111134.
DR   EnsemblGenomes-Gn; EBG00001111135.
DR   EnsemblGenomes-Gn; EBG00001111136.
DR   EnsemblGenomes-Gn; EBG00001111137.
DR   EnsemblGenomes-Gn; EBG00001111138.
DR   EnsemblGenomes-Gn; EBG00001111139.
DR   EnsemblGenomes-Gn; EBG00001111140.
DR   EnsemblGenomes-Gn; EBG00001111141.
DR   EnsemblGenomes-Gn; EBG00001111142.
DR   EnsemblGenomes-Gn; EBG00001111143.
DR   EnsemblGenomes-Gn; EBG00001111144.
DR   EnsemblGenomes-Gn; EBG00001111145.
DR   EnsemblGenomes-Gn; EBG00001111146.
DR   EnsemblGenomes-Gn; EBG00001111147.
DR   EnsemblGenomes-Gn; EBG00001111148.
DR   EnsemblGenomes-Gn; EBG00001111149.
DR   EnsemblGenomes-Gn; EBG00001111150.
DR   EnsemblGenomes-Gn; EBG00001111151.
DR   EnsemblGenomes-Gn; EBG00001111152.
DR   EnsemblGenomes-Gn; EBG00001111153.
DR   EnsemblGenomes-Gn; EBG00001111154.
DR   EnsemblGenomes-Gn; EBG00001111155.
DR   EnsemblGenomes-Gn; EBG00001111156.
DR   EnsemblGenomes-Gn; EBG00001111157.
DR   EnsemblGenomes-Gn; EBG00001111158.
DR   EnsemblGenomes-Gn; EBG00001111159.
DR   EnsemblGenomes-Gn; EBG00001111160.
DR   EnsemblGenomes-Gn; EBG00001111161.
DR   EnsemblGenomes-Gn; EBG00001111162.
DR   EnsemblGenomes-Gn; EBG00001111163.
DR   EnsemblGenomes-Gn; EBG00001111164.
DR   EnsemblGenomes-Gn; EBG00001111165.
DR   EnsemblGenomes-Gn; EBG00001111166.
DR   EnsemblGenomes-Gn; EBG00001111167.
DR   EnsemblGenomes-Gn; EBG00001111168.
DR   EnsemblGenomes-Gn; EBG00001111169.
DR   EnsemblGenomes-Gn; EBG00001111170.
DR   EnsemblGenomes-Gn; EBG00001111171.
DR   EnsemblGenomes-Gn; EBG00001111172.
DR   EnsemblGenomes-Gn; EBG00001111173.
DR   EnsemblGenomes-Gn; EBG00001111174.
DR   EnsemblGenomes-Gn; EBG00001111175.
DR   EnsemblGenomes-Gn; EBG00001111176.
DR   EnsemblGenomes-Gn; EBG00001111177.
DR   EnsemblGenomes-Gn; EBG00001111178.
DR   EnsemblGenomes-Gn; EBG00001111179.
DR   EnsemblGenomes-Gn; EBG00001111180.
DR   EnsemblGenomes-Gn; EBG00001111181.
DR   EnsemblGenomes-Gn; EBG00001111182.
DR   EnsemblGenomes-Gn; EBG00001111183.
DR   EnsemblGenomes-Gn; EBG00001111184.
DR   EnsemblGenomes-Gn; EBG00001111185.
DR   EnsemblGenomes-Gn; EBG00001111186.
DR   EnsemblGenomes-Gn; EBG00001111187.
DR   EnsemblGenomes-Gn; EBG00001111188.
DR   EnsemblGenomes-Gn; EBG00001111189.
DR   EnsemblGenomes-Gn; EBG00001111190.
DR   EnsemblGenomes-Gn; EBG00001111191.
DR   EnsemblGenomes-Gn; EBG00001111192.
DR   EnsemblGenomes-Gn; EBG00001111193.
DR   EnsemblGenomes-Gn; EBG00001111194.
DR   EnsemblGenomes-Gn; EBG00001111195.
DR   EnsemblGenomes-Gn; EBG00001111196.
DR   EnsemblGenomes-Gn; EBG00001111197.
DR   EnsemblGenomes-Gn; EBG00001111198.
DR   EnsemblGenomes-Gn; EBG00001111199.
DR   EnsemblGenomes-Gn; EBG00001111200.
DR   EnsemblGenomes-Gn; EBG00001111201.
DR   EnsemblGenomes-Gn; EBG00001111202.
DR   EnsemblGenomes-Tr; Bmul_R0001-1.
DR   EnsemblGenomes-Tr; Bmul_R0002-1.
DR   EnsemblGenomes-Tr; Bmul_R0003-1.
DR   EnsemblGenomes-Tr; Bmul_R0004-1.
DR   EnsemblGenomes-Tr; Bmul_R0005-1.
DR   EnsemblGenomes-Tr; Bmul_R0006-1.
DR   EnsemblGenomes-Tr; Bmul_R0007-1.
DR   EnsemblGenomes-Tr; Bmul_R0008-1.
DR   EnsemblGenomes-Tr; Bmul_R0009-1.
DR   EnsemblGenomes-Tr; Bmul_R0010-1.
DR   EnsemblGenomes-Tr; Bmul_R0011-1.
DR   EnsemblGenomes-Tr; Bmul_R0012-1.
DR   EnsemblGenomes-Tr; Bmul_R0013-1.
DR   EnsemblGenomes-Tr; Bmul_R0014-1.
DR   EnsemblGenomes-Tr; Bmul_R0015-1.
DR   EnsemblGenomes-Tr; Bmul_R0016-1.
DR   EnsemblGenomes-Tr; Bmul_R0017-1.
DR   EnsemblGenomes-Tr; Bmul_R0018-1.
DR   EnsemblGenomes-Tr; Bmul_R0019-1.
DR   EnsemblGenomes-Tr; Bmul_R0020-1.
DR   EnsemblGenomes-Tr; Bmul_R0021-1.
DR   EnsemblGenomes-Tr; Bmul_R0022-1.
DR   EnsemblGenomes-Tr; Bmul_R0023-1.
DR   EnsemblGenomes-Tr; Bmul_R0024-1.
DR   EnsemblGenomes-Tr; Bmul_R0025-1.
DR   EnsemblGenomes-Tr; Bmul_R0026-1.
DR   EnsemblGenomes-Tr; Bmul_R0027-1.
DR   EnsemblGenomes-Tr; Bmul_R0028-1.
DR   EnsemblGenomes-Tr; Bmul_R0029-1.
DR   EnsemblGenomes-Tr; Bmul_R0030-1.
DR   EnsemblGenomes-Tr; Bmul_R0031-1.
DR   EnsemblGenomes-Tr; Bmul_R0032-1.
DR   EnsemblGenomes-Tr; Bmul_R0033-1.
DR   EnsemblGenomes-Tr; Bmul_R0034-1.
DR   EnsemblGenomes-Tr; Bmul_R0035-1.
DR   EnsemblGenomes-Tr; Bmul_R0036-1.
DR   EnsemblGenomes-Tr; Bmul_R0037-1.
DR   EnsemblGenomes-Tr; Bmul_R0038-1.
DR   EnsemblGenomes-Tr; Bmul_R0039-1.
DR   EnsemblGenomes-Tr; Bmul_R0040-1.
DR   EnsemblGenomes-Tr; Bmul_R0041-1.
DR   EnsemblGenomes-Tr; Bmul_R0042-1.
DR   EnsemblGenomes-Tr; Bmul_R0043-1.
DR   EnsemblGenomes-Tr; Bmul_R0044-1.
DR   EnsemblGenomes-Tr; Bmul_R0045-1.
DR   EnsemblGenomes-Tr; Bmul_R0046-1.
DR   EnsemblGenomes-Tr; Bmul_R0047-1.
DR   EnsemblGenomes-Tr; Bmul_R0048-1.
DR   EnsemblGenomes-Tr; Bmul_R0049-1.
DR   EnsemblGenomes-Tr; Bmul_R0050-1.
DR   EnsemblGenomes-Tr; Bmul_R0051-1.
DR   EnsemblGenomes-Tr; Bmul_R0052-1.
DR   EnsemblGenomes-Tr; Bmul_R0053-1.
DR   EnsemblGenomes-Tr; Bmul_R0054-1.
DR   EnsemblGenomes-Tr; Bmul_R0055-1.
DR   EnsemblGenomes-Tr; Bmul_R0056-1.
DR   EnsemblGenomes-Tr; Bmul_R0057-1.
DR   EnsemblGenomes-Tr; Bmul_R0058-1.
DR   EnsemblGenomes-Tr; Bmul_R0059-1.
DR   EnsemblGenomes-Tr; Bmul_R0060-1.
DR   EnsemblGenomes-Tr; Bmul_R0061-1.
DR   EnsemblGenomes-Tr; Bmul_R0062-1.
DR   EnsemblGenomes-Tr; Bmul_R0063-1.
DR   EnsemblGenomes-Tr; Bmul_R0064-1.
DR   EnsemblGenomes-Tr; Bmul_R0065-1.
DR   EnsemblGenomes-Tr; Bmul_R0066-1.
DR   EnsemblGenomes-Tr; Bmul_R0067-1.
DR   EnsemblGenomes-Tr; Bmul_R0068-1.
DR   EnsemblGenomes-Tr; Bmul_R0069-1.
DR   EnsemblGenomes-Tr; Bmul_R0070-1.
DR   EnsemblGenomes-Tr; Bmul_R0071-1.
DR   EnsemblGenomes-Tr; EBT00001702452.
DR   EnsemblGenomes-Tr; EBT00001702456.
DR   EnsemblGenomes-Tr; EBT00001702460.
DR   EnsemblGenomes-Tr; EBT00001702462.
DR   EnsemblGenomes-Tr; EBT00001702465.
DR   EnsemblGenomes-Tr; EBT00001702468.
DR   EnsemblGenomes-Tr; EBT00001702472.
DR   EnsemblGenomes-Tr; EBT00001702476.
DR   EnsemblGenomes-Tr; EBT00001702480.
DR   EnsemblGenomes-Tr; EBT00001702485.
DR   EnsemblGenomes-Tr; EBT00001702489.
DR   EnsemblGenomes-Tr; EBT00001702493.
DR   EnsemblGenomes-Tr; EBT00001702496.
DR   EnsemblGenomes-Tr; EBT00001702500.
DR   EnsemblGenomes-Tr; EBT00001702503.
DR   EnsemblGenomes-Tr; EBT00001702506.
DR   EnsemblGenomes-Tr; EBT00001702510.
DR   EnsemblGenomes-Tr; EBT00001702513.
DR   EnsemblGenomes-Tr; EBT00001702518.
DR   EnsemblGenomes-Tr; EBT00001702521.
DR   EnsemblGenomes-Tr; EBT00001702525.
DR   EnsemblGenomes-Tr; EBT00001702528.
DR   EnsemblGenomes-Tr; EBT00001702531.
DR   EnsemblGenomes-Tr; EBT00001702534.
DR   EnsemblGenomes-Tr; EBT00001702538.
DR   EnsemblGenomes-Tr; EBT00001702542.
DR   EnsemblGenomes-Tr; EBT00001702544.
DR   EnsemblGenomes-Tr; EBT00001702549.
DR   EnsemblGenomes-Tr; EBT00001702550.
DR   EnsemblGenomes-Tr; EBT00001702552.
DR   EnsemblGenomes-Tr; EBT00001702556.
DR   EnsemblGenomes-Tr; EBT00001702561.
DR   EnsemblGenomes-Tr; EBT00001702566.
DR   EnsemblGenomes-Tr; EBT00001702571.
DR   EnsemblGenomes-Tr; EBT00001702576.
DR   EnsemblGenomes-Tr; EBT00001702581.
DR   EnsemblGenomes-Tr; EBT00001702584.
DR   EnsemblGenomes-Tr; EBT00001702589.
DR   EnsemblGenomes-Tr; EBT00001702593.
DR   EnsemblGenomes-Tr; EBT00001702599.
DR   EnsemblGenomes-Tr; EBT00001702605.
DR   EnsemblGenomes-Tr; EBT00001702610.
DR   EnsemblGenomes-Tr; EBT00001702617.
DR   EnsemblGenomes-Tr; EBT00001702622.
DR   EnsemblGenomes-Tr; EBT00001702626.
DR   EnsemblGenomes-Tr; EBT00001702630.
DR   EnsemblGenomes-Tr; EBT00001702635.
DR   EnsemblGenomes-Tr; EBT00001702639.
DR   EnsemblGenomes-Tr; EBT00001702642.
DR   EnsemblGenomes-Tr; EBT00001702644.
DR   EnsemblGenomes-Tr; EBT00001702646.
DR   EnsemblGenomes-Tr; EBT00001702649.
DR   EnsemblGenomes-Tr; EBT00001702654.
DR   EnsemblGenomes-Tr; EBT00001702659.
DR   EnsemblGenomes-Tr; EBT00001702661.
DR   EnsemblGenomes-Tr; EBT00001702662.
DR   EnsemblGenomes-Tr; EBT00001702663.
DR   EnsemblGenomes-Tr; EBT00001702664.
DR   EnsemblGenomes-Tr; EBT00001702665.
DR   EnsemblGenomes-Tr; EBT00001702666.
DR   EnsemblGenomes-Tr; EBT00001702667.
DR   EnsemblGenomes-Tr; EBT00001702668.
DR   EnsemblGenomes-Tr; EBT00001702669.
DR   EnsemblGenomes-Tr; EBT00001702670.
DR   EnsemblGenomes-Tr; EBT00001702672.
DR   EnsemblGenomes-Tr; EBT00001702673.
DR   EnsemblGenomes-Tr; EBT00001702674.
DR   EnsemblGenomes-Tr; EBT00001702675.
DR   EnsemblGenomes-Tr; EBT00001702676.
DR   EnsemblGenomes-Tr; EBT00001702677.
DR   EnsemblGenomes-Tr; EBT00001702679.
DR   EnsemblGenomes-Tr; EBT00001702680.
DR   EnsemblGenomes-Tr; EBT00001702681.
DR   EnsemblGenomes-Tr; EBT00001702682.
DR   EnsemblGenomes-Tr; EBT00001702683.
DR   EnsemblGenomes-Tr; EBT00001702684.
DR   EnsemblGenomes-Tr; EBT00001702685.
DR   EnsemblGenomes-Tr; EBT00001702686.
DR   EnsemblGenomes-Tr; EBT00001702687.
DR   EnsemblGenomes-Tr; EBT00001702688.
DR   EnsemblGenomes-Tr; EBT00001702689.
DR   EnsemblGenomes-Tr; EBT00001702690.
DR   EnsemblGenomes-Tr; EBT00001702691.
DR   EnsemblGenomes-Tr; EBT00001702692.
DR   EnsemblGenomes-Tr; EBT00001702693.
DR   EnsemblGenomes-Tr; EBT00001702694.
DR   EnsemblGenomes-Tr; EBT00001702695.
DR   EnsemblGenomes-Tr; EBT00001702696.
DR   EnsemblGenomes-Tr; EBT00001702697.
DR   EnsemblGenomes-Tr; EBT00001702698.
DR   EuropePMC; PMC2493190; 18515486.
DR   EuropePMC; PMC4029289; 24883196.
DR   EuropePMC; PMC4981952; 27514367.
DR   EuropePMC; PMC6315756; 30545132.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000868.
DR   SILVA-SSU; CP000868.
DR   StrainInfo; 39670; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002733
CC   Source DNA available from James Tiedje (tiedjej@msu.edu)
CC   Bacteria available from ATCC: ATCC 17616
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3448466
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="1"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   gene            74..1648
FT                   /locus_tag="Bmul_0001"
FT   CDS_pept        74..1648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bur:Bcep18194_A3182 chromosomal replication
FT                   initiator protein, DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13696"
FT                   /db_xref="GOA:A9AI97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI97"
FT                   /protein_id="ABX13696.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADLARDFWNAPIEVQFVLDPKAGMRSPAAGAAPAAPRAPLASG
FT                   PAATVAAIAANLTANQSATPAAPADVPMTPSAAAAHHLNNDDADIDLPSLPAHEAAAGR
FT                   RTWRPGPGAAPAAGGEADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISY
FT                   NPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKAFDDFKR
FT                   YYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLI
FT                   SRFDSGLTVAIEPPELEMRVAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALRK
FT                   ILAYSKFHGREISIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRPA
FT                   NIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHV
FT                   LEQTLKG"
FT   gene            1817..2923
FT                   /locus_tag="Bmul_0002"
FT   CDS_pept        1817..2923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bch:Bcen2424_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13697"
FT                   /protein_id="ABX13697.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGSDQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDFGASLTVPQKSFRQLLGMVHFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIDGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQ
FT                   TQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFQIGREELQRSLQRAAILTSDKFK
FT                   GVRCIVAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQV
FT                   SLGDASSSALITVPENDEFKYVVMPMRI"
FT   gene            3115..5589
FT                   /locus_tag="Bmul_0003"
FT   CDS_pept        3115..5589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bvi:Bcep1808_0003 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13698"
FT                   /protein_id="ABX13698.1"
FT                   /translation="MSEQHNSQPDNSSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
FT                   HHLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVVDNGRGIPTDVKMNDKHEPKRSAA
FT                   EIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLTVRRNGKKHFMEFHRGVA
FT                   QDRVIEVVDGEEVSPMQVIGDTENRGTEVHFMADPTIFGTVEYHYDILAKRMRELSFLN
FT                   NGVRIRLTDLRSGKEDDFAFAGGVKGFVEYINKTKSNLHPTIFHVIGEKDGVGVEVAMQ
FT                   WNDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKVETTGDDMR
FT                   EGLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICGKI
FT                   VEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQ
FT                   GRDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKDDYNLDKLRYHRI
FT                   IIMTDADVDGAHIRTLLLTFFYRQMPEMIERGYVYIAQPPLYKVKAGKDERYLKDDAEL
FT                   NAHMLRLALQGSELLPSENATPITGDALGELARSYLMSQSVIERLSRLYDPAALEAIMD
FT                   GVSIDLSSEASTEASAKALHAALHDDTLKNEVRVVPAYDPVRELRSLRVERAHHGNVRV
FT                   SVIDEEFQHTADYQQLVNTAKTFEGLIQAGAVIKRGERSMAVTDFKNAMKWLLADAERN
FT                   VSKQRYKGLGEMNPEQLWETTMDPNVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAFI
FT                   ESNALRAGNIDV"
FT   gene            complement(5706..6746)
FT                   /locus_tag="Bmul_0004"
FT   CDS_pept        complement(5706..6746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0004"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: maq:Maqu_3383
FT                   restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13699"
FT                   /protein_id="ABX13699.1"
FT                   /translation="MAIWLVRAGSHGEYEQKFIQESRIYVTWDDLDVDLAKLEQRNELT
FT                   AEMTQRYPEAKRKTVLNWVSQVWPFAHEMQKGDLVVLPLKTQAAVYIGEITGDYHAEKA
FT                   GPNPFFHWRPVKWIGEAIPRTHFGKDLLFSFGAFLTICRIQRNNAEQRIAVMRANGWKA
FT                   ETLAAPAKAATATTTDVEAADTDLDELARDQIAALVSARFKGHGLTRLVEGILKAQGYT
FT                   TYRSPEGADGGTDILAGSGPLGFSAPRLCVEVKSEDSPIGREPVDKLLGAMTKFNADQD
FT                   LFVAWGGFKGNVQKQLASQFFRLRLWTQKELLEQLFEQYERLDEDLKAELPLKRVWMVA
FT                   SQEDGF"
FT   gene            complement(7465..7998)
FT                   /locus_tag="Bmul_0005"
FT   CDS_pept        complement(7465..7998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0005"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bch:Bcen2424_0009
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13700"
FT                   /protein_id="ABX13700.1"
FT                   /translation="MMKASTTFSLPARVLHWVMAAMVLTMLFVGVGMVASVSERHDFLV
FT                   ALHKPLGVAVLVLVCVRIVVRLSSKPPALPDDLPWWQKVAAHGSHLVLYALMVAMPLIG
FT                   WAMLSAGGYPVTLGGGVQLPAIVAANPVTFAWLRVAHRVLAYLFFLTFLAHFGAALYHG
FT                   LIRRDGVLRAMVGR"
FT   sig_peptide     complement(7894..7998)
FT                   /locus_tag="Bmul_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.494 at
FT                   residue 35"
FT   gene            complement(7995..9086)
FT                   /locus_tag="Bmul_0006"
FT   CDS_pept        complement(7995..9086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0006"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: bam:Bamb_0007
FT                   catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13701"
FT                   /protein_id="ABX13701.1"
FT                   /translation="MERSSSSSPPPREPGRRGWRWAAIGGAVAGAALAFGYVGGWLAPA
FT                   RLTPHRLVDALQTAGGLHPGFRRNHAKGVCVTGYFEGNGTASQYSVAPFFKPVRTPVVG
FT                   RFALPGGNPYAPDSSVPIRSLALKLTAPDGEQWRTGMNAMPVFPVATPQAFYAQLLATR
FT                   PDPATGKPDPAKVKAFFAAHPETAAFREWVKGAKPSASYVTERYDALNAFYFIDAAGQR
FT                   HAVRWRVVPEQTAGAGDVATAADPNVLEQDLTRRIADGAQKWKLLVTLAEPGDPVDDAT
FT                   KVWPAQRTTIDAGTLVLDHVEPQDSGPCRDVNYDPTVLPRGIQVSGDPLLAARSAAYAD
FT                   SYLRRTSEEAGVADAARLSAEGR"
FT   gene            9242..9760
FT                   /locus_tag="Bmul_0007"
FT   CDS_pept        9242..9760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0007"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bam:Bamb_0008 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13702"
FT                   /protein_id="ABX13702.1"
FT                   /translation="MPSNALDDDALRELIPRLRRFALWLARDVHAADDLVQSTLERALS
FT                   RWTSRRDDASLRSWLFTILYRQFLDGKRSAKRYAWLLGRIRDDEEPHWPSAEREVAARA
FT                   TLEAFGRLSDEQRSLLLLVAVEGFTYQEVADLLDVPIGTVMSRLSRARQALRLLSDGEL
FT                   PAPSLRLMK"
FT   gene            9757..10518
FT                   /locus_tag="Bmul_0008"
FT   CDS_pept        9757..10518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0008"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: bam:Bamb_0009 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13703"
FT                   /protein_id="ABX13703.1"
FT                   /translation="MNPIRPDEHDLQAYVDGQLDDDARAAVERYLALHPESAEQVKQWQ
FT                   QDAQRLRAALESVRMPGENPALDPAAIRARRAERARMRFAMAASFVFCVGLGTFGGWQA
FT                   RGWNAQPAVAPMSDALNAYRMLVVNRTAKVDYRPTGANDLQRWLTTRVGTSAKLPDLSA
FT                   AGFRPVGGRLFTTDVGATSAMVLYEDDAGRTLSFYVRPAESSRRLLPAGQRVDGPLLAR
FT                   YGSVNGLNFAVVGPADSLEEKAVVRALDQQT"
FT   gene            complement(10913..11878)
FT                   /locus_tag="Bmul_0009"
FT   CDS_pept        complement(10913..11878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13704"
FT                   /protein_id="ABX13704.1"
FT                   /translation="MTNTIKLYDMTDDMTRRRVFWLLQRLTSFSLWKRKRDAFARFANE
FT                   YENAVKTWPEDDPEALPPQNLPIISEILAAYDRGLSALARGNRFVWQRGEPLQYAIDRY
FT                   NHLNAYFFPHPDYWDRGAQAFPYPPKVDALAQLLHASEAQLEYAPFEPGHRDFAQLQSV
FT                   GLLLTPNAYDHGFYTLPYPVFPDDLPPVPQAIGPVIKSGNKVPCDGIWEPVVVEREKLL
FT                   GIVPIGHRRLRNNGCFNYFIRDIRAPKLRDNDLGLPVKTHWRLLWEDKRYTDGVIPDES
FT                   EYFLEGPQQNRDIVAYVRTNGLMIRAATGRCVVQRQSLVA"
FT   gene            complement(11875..12774)
FT                   /locus_tag="Bmul_0010"
FT   CDS_pept        complement(11875..12774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13705"
FT                   /protein_id="ABX13705.1"
FT                   /translation="MKKHDMHDDVTRRKVFWLLQRLTSWTLWRTKHENFKIFAVAYENA
FT                   VKTWPLSHPKAIDPDHLEAIYEILSDYDEGITELASGRRFVWRAGGALERAVRKFDNLG
FT                   RYFYRDPDYWERGQTATYPPKVDALYQLMRASQFQMDYAPLEVQSDENVAHLEWPGALL
FT                   DLTQYDHGFYELGYPVFPAALPDIPDPAGLVIRSGQSVPCDGIWEPVAIEPSRISGTIP
FT                   VDAKRFRNNGCFNYFVADVIAPGFADVDVDTFDVTLRCTYWRLLWEDTRYTNGVVPDES
FT                   QYILKAGEGPRRLMSILR"
FT   gene            complement(13024..14142)
FT                   /locus_tag="Bmul_0011"
FT   CDS_pept        complement(13024..14142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13706"
FT                   /protein_id="ABX13706.1"
FT                   /translation="MVQTIIVPWGVSSESGPVAPVPTMTNTIKQYDMTDDTTRRKVFWL
FT                   LQRLTSFSLWKRKRDAFATFANEYETAVKTWPGDDPERVLADHLPTIFEILASYNRGLS
FT                   ELARGYRFVWQRGEPLEYAIDRYNYLNAYFFPHQNYWERGAQFAPYPPRIDALAQLLHA
FT                   SEYQMENAPLEPASLNNDLAQLRSVGRLLSPSAYEYTFYTLPYPVFPDDLPEVPEAVGP
FT                   VIKSGDKVPCDGIWEPVAIEQSKLLGVVPVGNRSLRNNGCFNYFVQDIHAPNVRDDDTG
FT                   AIVKTHWRLLWEDKRYADGIIPDESQYFLEPPSSPQPSRDTAAPVRTGDICPVSGVWRT
FT                   QEYGGKTVRVEAGAAMPDMLVRDNLVNSRCTG"
FT   gene            complement(14239..15312)
FT                   /locus_tag="Bmul_0012"
FT   CDS_pept        complement(14239..15312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13707"
FT                   /protein_id="ABX13707.1"
FT                   /translation="MTNTLKQYDMNDDTTRRQVFWLLQRLTSLSLWTRKREAFAKFASE
FT                   YESAVKAWPEDAPEHMPADNLPTIFEILAAYDRGLAELARGYRFIWQRGEPLQYAVDRY
FT                   QHLCRYFFPDPDCWDRGAQIAPYPPRVDALAKLLRASEYQMENAPFEPARSNNDLAQLR
FT                   APSLLLDPGRYNHGFYTLGYPVFPSYLPEVPNGAGPVISSGDKVPCDGIWEPVAIEQSK
FT                   LLGIVPVGDRSSRNNGCFNYFIRDIRAPNLRDATGAVTGTRWRLLWEDRRYADGTVPDE
FT                   SQYFLEPPSSPQPTRDTSAPVRTGDICPVSGEWRTDEYGGKTVRVEAGAAMPDMLVRDN
FT                   LGELKVHWVTWHLVTRS"
FT   gene            complement(15309..16889)
FT                   /locus_tag="Bmul_0013"
FT   CDS_pept        complement(15309..16889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_3742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13708"
FT                   /protein_id="ABX13708.1"
FT                   /translation="MSWTIEDFRATSLEVGQWCWGTLEGAFNEKQTISQIIVDAVIGMI
FT                   PLVGDATAVRDLLAVSIGMSQDPVKRNDTTQRVLLVVLIFALIPVVGGVIKGVGRLLLK
FT                   VTGDVAKDAELLKAVVQFLNRMGHGDAPKWLKALDLAKYQAQVVTRLKDFCATVRVAIQ
FT                   RSLAARVGRMLPDKWRAALERVSSGFHAIQDMADQIVPEAIKELNAKLKVLQNMVYRGE
FT                   VHEIATGGAPKLQREAEAYLEERRLARDIRRGRYSSTQCAADGQEIERWIRAKYQPKID
FT                   AGWPDILDKQGKMPMFGDDDVFLDVASFSGEIKALTARELAGKKVYRVFGNPSELARSE
FT                   KGSSAGGRSPAFWGVGEPPKTAEEWRRLAAVLDTWNGNGFIVIMQLPHDFGERMPTANA
FT                   WFGKIAEQYGSAVPVQYLEGGGDQLIVDFGKLADYVTEEGNLIKQKYRNFVGHANVHVQ
FT                   REFDGVKIDFYKTNWEDVEKVHGYSRYEDDIGYSTKTRRLASDEVQTKMTNSKVTAATR
FT                   SAANLEGHR"
FT   gene            complement(16892..17638)
FT                   /locus_tag="Bmul_0014"
FT   CDS_pept        complement(16892..17638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4023 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13709"
FT                   /protein_id="ABX13709.1"
FT                   /translation="MQLPKTAKNRNLETVRIRVLPPVLLAPLRRPSPAPLRRPATAGKS
FT                   LIASIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVKVVSATDRIEIAADQ
FT                   GILLTSGGAYIRIKDGNVEVHAPGKVDIKGSSHTFAGPASMQYPLPALPTSKHAAAMQY
FT                   LYHDDEPVQGAKYIATLPDGSTREGVLDSHGRMRLEDVPAGAIKVELGPDARAYARKDT
FT                   TANPDYKGERLSDADIDSIINKHGGA"
FT   gene            complement(17601..18044)
FT                   /locus_tag="Bmul_0015"
FT   CDS_pept        complement(17601..18044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0015"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   bvi:Bcep1808_4315 IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13710"
FT                   /protein_id="ABX13710.1"
FT                   /translation="MAQALGHCAARQGRDVLFISQTELLKRLNAARATGAYDRKFQQYA
FT                   RVPLLIVDDFALKPLRTPQDEDFHDLVAARYEHAATILTSNLDFGEWGAAFPDNRILGT
FT                   ATLDRLRHGAYRLVLEGDSYRTPKPMPDPPQNAVAKNGKKPQP"
FT   gene            complement(18095..19456)
FT                   /locus_tag="Bmul_0016"
FT   CDS_pept        complement(18095..19456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0016"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bvi:Bcep1808_7290
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13711"
FT                   /protein_id="ABX13711.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   gene            complement(19878..20246)
FT                   /locus_tag="Bmul_0017"
FT   CDS_pept        complement(19878..20246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0017"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: bvi:Bcep1808_4315 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13712"
FT                   /protein_id="ABX13712.1"
FT                   /translation="MNPSPELNSILKQLRLSGILDSLEQRNRQAIDGQLAYTEFLAMLL
FT                   HDEVARREHKKLGTRLLRAGFAMGKTLETFDFDRLPTLNRSHVHDLATGRYLDEKVAIL
FT                   IAGPTGTGKSQVSIAVRG"
FT   gene            complement(20251..21783)
FT                   /locus_tag="Bmul_0018"
FT   CDS_pept        complement(20251..21783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0018"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13713"
FT                   /protein_id="ABX13713.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   gene            complement(21939..24131)
FT                   /locus_tag="Bmul_0019"
FT   CDS_pept        complement(21939..24131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0019"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bam:Bamb_0367
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13714"
FT                   /protein_id="ABX13714.1"
FT                   /translation="MPDISAAIRGGLLQQDRLLKLDTPLGADLLAVQRAAGRSRIGRDY
FT                   SFTLDVVSGNDRLELKKLIAQPATLWIEQANKSYRPVNGYVYTVRRLGANGGLTTYQLE
FT                   LRAWMHLLRFRRDQKIWIDRNAEEIISDVLSVHPEARGRFRFALSQPLLNRSFTRQSET
FT                   DWNFVHRLMEDEGLYCTWQQADDGKSHTLVITDNLQAFAPLSPETVRFYRGGAASETDA
FT                   FTQWSGTRTLQSVTRTTRTFDYKNPSQPSNPKGTSLPTMGGQGELPDQLEVYEYTGAYT
FT                   YLDQSRGDHLTKIRMEEWESQAKRFHGAGGVRAIDAGRRFTLIDHPEHDRDPADQREFA
FT                   TIEVAWWIENNLPVSASDSNFPHSLASSLARVRARYGDMRELQVPHPDGSVGFYLVEVE
FT                   AQRTSVPYRSPFEHAKPKMHLETAIVVGPQGEEVYTDELNRIRVQFVWDRINPGNENAS
FT                   CWVRVVQSDTGGGYGGVHVPRIGEEVLIDYVGGDCDRPLAVGRVYNGANKPQWHSDGIL
FT                   SGYRSKEYAGGGYNQLVMDDATGQNRVQLMSSSANSLLHLGYIIDQNGNARGSYLGSGF
FT                   DLRSDAYGAVRASQGLYVTTHPKAANSQPLDVKEAQQQLVTGESLIEAMSGVSEQHQAE
FT                   SLKEAHDTMRAFADATQSSVSGNASGGRTAGGGTGSANAFKEPVMLFGSPSGIAMSTQQ
FT                   SVHMVANDHVNVASGQSVHVAAGVTGRRYGANAGSA"
FT   gene            24858..24934
FT                   /locus_tag="Bmul_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            24858..24934
FT                   /locus_tag="Bmul_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(25082..25951)
FT                   /locus_tag="Bmul_0020"
FT   CDS_pept        complement(25082..25951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0020"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bam:Bamb_0012 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13715"
FT                   /protein_id="ABX13715.1"
FT                   /translation="MTNVDPADTMADAAASFDPLRRMLIRVAYRMLGSVADAEDVVQDA
FT                   FIRWMDVDRTGIRVPEAFLRRMVMRLCLDHLKSARHRRETYVGPWLPEPVVDEDEQEDV
FT                   TLPLMLALERLSPLERAAFLLHDVFGLEFDEVAATIQREPAACRQLAARARTHVREARP
FT                   RFRVDKQRGIELAEAFFAASRSGDMRTLGAMLAEDVSLHSDGGGKRTAAAKPVFGFERV
FT                   MKVHTHLAELFATQASMLVRAGFINGLPGFVTREADGELQTTALEIEDGKIVAIYVVRN
FT                   PDKLKHLH"
FT   gene            complement(25951..26424)
FT                   /locus_tag="Bmul_0021"
FT   CDS_pept        complement(25951..26424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0021"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bam:Bamb_0013 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13716"
FT                   /protein_id="ABX13716.1"
FT                   /translation="MTAKLNPFAVAPALMKDWMAVSVAAAGSLEPTLIELVKIRASQIN
FT                   ACANCLNMHTVEARAQGETEQRINLLAAWREAPCYTDRERAALGWTDALTRLSEGHAHD
FT                   AAYAELNAHFTQEEQVKLTLMINVINGWNRLAVGFGLWVDPAEAKAAAAKMVA"
FT   gene            26732..27046
FT                   /locus_tag="Bmul_0022"
FT   CDS_pept        26732..27046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13717"
FT                   /protein_id="ABX13717.1"
FT                   /translation="MRIAIVRAGRRISDSGSPSLPHAHRRMLSNVFRFRFPRNPIRDLH
FT                   ISGPYCSARADGLTPLLRPGARAGCPMDAAPKVARQPRALEREAFLFPATQRSELRRGR
FT                   "
FT   gene            27051..28265
FT                   /locus_tag="Bmul_0023"
FT   CDS_pept        27051..28265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0023"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   bam:Bamb_0015 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13718"
FT                   /protein_id="ABX13718.1"
FT                   /translation="MSLLASQLQRRYQDVRAHSVALTATLSAEDQAVQSMPDASPTKWH
FT                   LAHTTWFFETVVLMRRVHGYTPFNDAFQFLFNSYYEALGPRHPRPQRGLLTRPSLDEVH
FT                   AYRQYVDEAMLNALASADPSLLDTIAPEIELGLHHEQQHQELIVTDMLHAFSCNPLKPA
FT                   YRPRSDADTQALAAGDAGPLRWLHRPGGLVDIGHGGETFSFDNERPRHTALVRPYEIAN
FT                   RLITNAEFAAFVADGGYARPEYWLSDGWATVQREGWQAPAYWIADDAAAHGWRTFGLHG
FT                   VEALAPDAPVCHVSFYEAAAYAEWAGARLPTEFEWEAAFGADGIRQMLGHVWQWTRSSY
FT                   EPYPGFRPLAGVAAEYNGKFMVGQQVLRGSSIATPPGHERPTYRNFFPPAARWQFTGVR
FT                   LARDV"
FT   gene            28249..29262
FT                   /locus_tag="Bmul_0024"
FT   CDS_pept        28249..29262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13719"
FT                   /protein_id="ABX13719.1"
FT                   /translation="MRETSDLTATTGGQPPAREVRPSAFERDLIDGLSRTPRSIPPKYF
FT                   YDATGSALFDRICELPEYYPTRTELGILRARAAEIVQRVGPHADIVEFGAGSLEKIRIL
FT                   LDAFAAHGANAPLRYVPIDISADYLHGAAARLRAEYPWLDVAPIAADYTKAEQLAELTA
FT                   TPRRRIGFFPGSTIGNFSPEEADAFLRDAAQLLRGGGLLVGADLVKDERVLHDAYNDAQ
FT                   GVTARFNLNLLARANAELGADFDLDAFSHCAFYDPQRQRVEMHLVSDVAQTVHVRGHVF
FT                   HFDAGERIHTENSYKFTIDGFRAIARRAGFVPDTVWTDADRLFSVHWLRSVDDIRA"
FT   gene            29507..29797
FT                   /locus_tag="Bmul_0025"
FT   CDS_pept        29507..29797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13720"
FT                   /protein_id="ABX13720.1"
FT                   /translation="MSKKLLLGAVIGVAALAASGVASAHVDLSVGIGVPGVYTAPAPVY
FT                   VAPPPVAYAPVGYRYDDWRAREWREREWRRHEWREHEWRERDRGWRGGRWD"
FT   sig_peptide     29507..29581
FT                   /locus_tag="Bmul_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 25"
FT   gene            29853..30107
FT                   /locus_tag="Bmul_0026"
FT   CDS_pept        29853..30107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13721"
FT                   /protein_id="ABX13721.1"
FT                   /translation="MMSIRSFRTCAAAAIVALATIDSAHAAGCMKGAVVGGVAGHYAGH
FT                   HAVAGAVGGCVVGHHMAKKHAQEQAEQRNERAQSAPPKQ"
FT   sig_peptide     29853..29933
FT                   /locus_tag="Bmul_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.633 at
FT                   residue 27"
FT   gene            30314..30679
FT                   /locus_tag="Bmul_0027"
FT   CDS_pept        30314..30679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13722"
FT                   /protein_id="ABX13722.1"
FT                   /translation="MKKQRYLSVLAAALLALGTVCAHAAAGGNGGGNGGGHGAGGSGGN
FT                   AGGMSGGHMSGEALSNSNGFHAGDRDKGLARAADRSDTIADRAGTQPGRGHTHGHVAHT
FT                   TSHGKHTKRNAFGKTTL"
FT   sig_peptide     30314..30388
FT                   /locus_tag="Bmul_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 25"
FT   gene            complement(30898..33924)
FT                   /locus_tag="Bmul_0028"
FT   CDS_pept        complement(30898..33924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0028"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: bam:Bamb_0019 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13723"
FT                   /protein_id="ABX13723.1"
FT                   /translation="MRLHFEADLDYQRDAIDAVCDLFRGQESYRGDFSVLASAAPGTTA
FT                   AAQGSLGFAMSERGVGNRLSLTDDALARNLADVQLRGGLPPSGSPGSRDFTVEMETGTG
FT                   KTYVYLRTIFELNRRYGFTKFVIVVPSIAIKEGVHKTLSITEDHFRALYAGVPYDYFLY
FT                   DSAKLGQVRHFAASATIQIMVMTVAAINKKEVNNLYKDSEKTGGEKPIDLIRATRPIVI
FT                   VDEPQSVDGGLEGRGREALAAMDPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIE
FT                   IASAIVEDAHNKPYVRLVGVSNRRGAISARLELDVATANGVKRQLVSATDGDDLERLTK
FT                   RALYAGLRIGEVHAVKGAEYVELRHPEGETFLSLGEAFGDIDTLAVQREMIRRTIREHL
FT                   DKELRLAERGVKVLSLFFVDSVERYRRYDENGMPVKGEYALIFEEEYARAARVPAYRAL
FT                   FDGVDIAREVERAHNGYFSIDRKGGWTDTSESSAVARENAERAYGLIMREKEALLSFDT
FT                   PLKFIFSHSALKEGWDNPNVFQICTLRDIQTERERRQTLGRGLRLAVDQDGERVRDPGV
FT                   NTLTVIATERYESFAENLQKEIEADTGIRFGIVEQHQFAALPVQEGDGPAHALGIELSR
FT                   VLWTHLHEQGYVDAQGKVLDRLKDALRQSALVLPDAFESLRAPIVATLRKLSGRFAVRN
FT                   ADERRAIALRRDASGKAVVFGDDFRALWDRIRHRTVYRVDFDNAKLVRDCAAALRDAPD
FT                   IARARLQWRKAEIDIGKSGVEAIEVGGAGTVLIDEGELPLPDLLTELQDRTQLTRRSLA
FT                   TILADSGRLDDFRVNPQQFIAIAADAINRCKRLALVAGIAYRKLGDRHVHALESFESEA
FT                   LTGYLRNLRLEARKSIHEAVVCETDAERAFADALEAHDGVKLYAKLPAWFRVATPLGSY
FT                   HPDWAVLAEQDDGERLYFVVDTPNADGDTPTEHERAKLACGEAHFRALADGDDAARFVR
FT                   VRHVDALFDAAAAPARTAR"
FT   gene            complement(33924..35990)
FT                   /locus_tag="Bmul_0029"
FT   CDS_pept        complement(33924..35990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0029"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bch:Bcen2424_0028 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13724"
FT                   /protein_id="ABX13724.1"
FT                   /translation="MPRPRPTLPARAAGPPMEKTMQKLDAANPLAMSTDFTADNVARLK
FT                   ALFPELVTEGPKGVSVNVDVLKTLVGDRTVSDADERYGFHWHGKRDARQAALTPSTGTL
FT                   RPCPDDSVAWDDTRHLMIEGDNLDVMKLLHKSYAGKVKLVYIDPPYNTGNDFVYADDFS
FT                   DSIRHYLAMTGQTEGGVKRSTNTEANGRFHTDWLNMMYPRLKLAHALLSEEGLIVVHID
FT                   EHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLERA
FT                   PLKRPKRNAQRMLDAAHDAMYRSGTPKDAAKAYRAWVKAQTNLSGGEAMYDRLSEDGRV
FT                   YRLVSMAWPNKKKAPDEYFTPLLHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPD
FT                   ETTQPQRIYYLDENMYENVPSVLPFGGSDDALLKALGIPFEQPKPVDFAAAVIGWCTRR
FT                   DDIVLDCFAGSGSTGHAVMQVNATDGGARRYILVQLPEPLDRRDKTQQAAADFCAKLKK
FT                   PATLAEVTKERLRRAAQQVARDYPESYGDLGFRVYRLDTTNVIEWDPRRDDFDHALFAS
FT                   VEHVKTGRTDDDLLAELTLKLGLDLCTPVEHHTIAGKTVHLIGREIVACFDARVSRDDA
FT                   EPLADGIVALLDASGATRDVTCLFRDSGFVDDVAKLNLAALLEQHGVKRVRSL"
FT   gene            36347..37036
FT                   /locus_tag="Bmul_0030"
FT   CDS_pept        36347..37036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0030"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: rme:Rmet_3986 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13725"
FT                   /protein_id="ABX13725.1"
FT                   /translation="MGTSSDAVKKIFREIMMAITVAIADDHPVVVSLLVQLFQADPSFH
FT                   VEHCCNEGSALIESLARVPTDIVIVDYSMSRGDRPVDGFALLRKLREVAPKAGRVLFTM
FT                   QRNPTVFAAAMRLGVAAIVSKEDEVAELLRACRYIQDGGACYLSPTVRTIVDQAGTVLR
FT                   DNAPPLTQKEIDVVRLFVSGHSLADIAKQLGRSVSTVSTQKYTAMRKLRADTNVHLIRY
FT                   AYENGLI"
FT   gene            complement(37084..38217)
FT                   /locus_tag="Bmul_0031"
FT   CDS_pept        complement(37084..38217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0031"
FT                   /product="outer membrane protein (porin)-like protein"
FT                   /note="KEGG: bam:Bamb_0021 outer membrane protein
FT                   (porin)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13726"
FT                   /protein_id="ABX13726.1"
FT                   /translation="MLKRKTLTLSVAAAGLCAATGAYAQSSVQLYGLMDLSFPTYRTHA
FT                   DANGKHVIGMGNDGEPWFSGSRWGLKGAEDIGGGTKIIFRLESEYVVANGQMEDEGQIF
FT                   DRDAWVGVEDERFGKLTAGFQNTIARDAAAIYGDAYGAAKLSTEEGGWTNSNNFKQMIF
FT                   YAAGPTGTRYNNGIAWKKLFSNGIFASAGYQFSNSTAFATGSAYQAALGYNGGPFNVSG
FT                   FYSHVNHGGFRNQTFSVGGNYTFSIVRVNAGYFRYNGDQGSLGQRHDNAWTVSLKVAPQ
FT                   GPLDYELGYQQMRIKNAAYNADGFTPNANLGAFSLTNGVGNGFKETLYASVFYHLSKRT
FT                   ELYLAGDYMKLHGGYKVASTFGSNNQLELTTGIRTRF"
FT   sig_peptide     complement(38143..38217)
FT                   /locus_tag="Bmul_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(38493..39170)
FT                   /locus_tag="Bmul_0032"
FT   CDS_pept        complement(38493..39170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0032"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bch:Bcen2424_0030 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13727"
FT                   /protein_id="ABX13727.1"
FT                   /translation="MKLLLVEDNAELAHWIVNLLRGEDFAVDCVGDGERADTVLKTERY
FT                   DAVLLDMRLPGISGKEVLARLRRRNDNVPVLMLTAHGSVDDKVDCFGAGADDYVVKPFE
FT                   SRELVARIRALIRRQAGVGSTQLVCGDLVYAFGTREFRCGDAPLVLRRREHAILETLML
FT                   QQNKTVSKARLMDSVFALDDEPSADAIDIYIHRLRKHLAASSAEIITLRGLGYILRAKA
FT                   GTA"
FT   gene            complement(39184..40551)
FT                   /locus_tag="Bmul_0033"
FT   CDS_pept        complement(39184..40551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0033"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase domain protein; KEGG: bch:Bcen2424_0031 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13728"
FT                   /protein_id="ABX13728.1"
FT                   /translation="MAHSLRGRLLWWLLLPLAVFVLIAAAMAYDAARRTADLVQDSTLV
FT                   ASARTIGEDIEWRNGLPVADVPPAALEIFESPSRDSVFYKVIDGDGRLLAGNPALDVVA
FT                   RHGAEPVSYDTTLDGMRLRAVAYDRQLYDEGQVDTVTVVVAKTTRSRNAMVATIWRPQL
FT                   VRLALMLVLAVALVYLGLTFELRPLMKLKDDVADRGPMELEPIRPERLQHELRPIVDAI
FT                   NQCIARLNTHTATQRRFIADAAHQLRTPIAVLDTQIQYAQQRGNDDRELASVLDSMQRS
FT                   SRKMADVTDKLLLLAHAEATPSTLLTQRVDLAALVSSVLEETIVLAQRRDIDLGAELGE
FT                   RLDVAGSGSLLSALVTNLVDNAVRYTQPGGCVTVAARRDGDTVVLDVIDDGPGIPAEAR
FT                   PHVFKRFYRVSSDTEGSGLGLAIVSEIAQAHGGSATLAPGPGNRGVVVTVRLPAYD"
FT   sig_peptide     complement(40465..40551)
FT                   /locus_tag="Bmul_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            complement(40637..41494)
FT                   /locus_tag="Bmul_0034"
FT   CDS_pept        complement(40637..41494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0034"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_A3216 ABC
FT                   nitrate/sulfonate/bicarbonate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13729"
FT                   /protein_id="ABX13729.1"
FT                   /translation="MTDMTLPPTALPATPLEDDERAAQRRLRRRRTLIVTLRIAVLVVV
FT                   LGGWELAARLKWIDPFFFSMPSLIFDQIRDWFVNGTSQGPLLTQVWVTLEETAIGFLIG
FT                   SVAGVICGIVLGRNKLMADVFGLYIQIANSIPRVVLGSVFVIALGLGMASKIALAVVMV
FT                   FFVVFGNAFQGVREADRYLIANAQILGASRRQITTAVVIPSALSWILASLHVSFGFALV
FT                   GAVVGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADYLLTWVEKRLLKWR
FT                   PAAF"
FT   gene            complement(41511..42308)
FT                   /locus_tag="Bmul_0035"
FT   CDS_pept        complement(41511..42308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0035"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0033 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13730"
FT                   /protein_id="ABX13730.1"
FT                   /translation="MNQAVSASTPAIEFRNVSCRFISPEGKATVALREFSMSVARGEFI
FT                   AIVGPTGCGKSTTLNLITGLLKPASGEVRVMGRPVDGIDPRIGFVFQADAVFPWRNVID
FT                   NVAAGPLFRGRSKDVAYAQAEEWIRKVGLDKFTKHYPHQLSGGMRKRVALAQTFINQPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWSANKGSVVFVTHDLEEAIALADRVFVLTARPA
FT                   TLKRVYSIDLPRPRVMSEVRYDARFIEISKDIWHDLREEVQIG"
FT   gene            complement(42416..43420)
FT                   /locus_tag="Bmul_0036"
FT   CDS_pept        complement(42416..43420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0036"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bvi:Bcep1808_0044 ABC nitrate/sulfonate/bicarbonate
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13731"
FT                   /protein_id="ABX13731.1"
FT                   /translation="MRPILRTLAVAASLSCALAAHPALADDGGKITIMVGGIAKLIYLP
FT                   ARLTQELGYFKAEGLDVELLSQPAGVDAENELLAGAVQAVVGFYDHTIDLQSKGKDVKA
FT                   IAVFGQVPGEVEMVSTKAAPTFKSMADAKGKTLGVTGLGSSTSFLTQYLALQHGVPSTQ
FT                   YTMLPVGADASFIAAIKQGRIDAGMTTEPTVSALEKMGDAKVLVDMRTVDGTRAALGGT
FT                   YPAASLYVQSAWADSHKAQATKLAHAFAKTMQFIHTHSAEEIAAKMPADYQKDKALYVA
FT                   ALKASLPMYTADGKMPADGPATVLKVLSAFNPSVKGKHIDLARTYTNEFVAAK"
FT   sig_peptide     complement(43343..43420)
FT                   /locus_tag="Bmul_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            43984..44469
FT                   /locus_tag="Bmul_0037"
FT   CDS_pept        43984..44469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0037"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   amt:Amet_1054 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13732"
FT                   /protein_id="ABX13732.1"
FT                   /translation="MAAIFPVAAVARLIAHGPLVASALLTWMLTYLVGILIWFAQYFFD
FT                   FSPEVFVGPRIIRDDLATRLLLGSLIAPIVETFLFQWLPIRTLRRVFKARTWLAVSVST
FT                   LAFAAAHGYSLLYVVVALWGGLVFAAVFVLRDYPGGHPFWAVAIAHAARNTLASSIL"
FT   gene            complement(44568..45350)
FT                   /locus_tag="Bmul_0038"
FT   CDS_pept        complement(44568..45350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0038"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   bam:Bamb_0027 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13733"
FT                   /protein_id="ABX13733.1"
FT                   /translation="MFSVTYAQLNGWLTAFLWPFVRMLALVATAPVVGHASVPARVKIG
FT                   VAAFMALIVAPTLGPMPAVTVFSAEGIWIVVTQFLIGTAMGFTMQIVFAAVEAAGDFIG
FT                   LSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAFLAVDGHLQVLAALTASFQSLPVSAD
FT                   LLHAPGWRTLATFGATVFGMGLLLALPVVAALLIANLALGILNRAAPQIGVFQVGFPVT
FT                   MLVGLLLVQLMVPNLVPFVSRLFDMGLDAIGRVVLGWR"
FT   gene            complement(45374..45646)
FT                   /locus_tag="Bmul_0039"
FT   CDS_pept        complement(45374..45646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0039"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: bch:Bcen2424_0036
FT                   flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13734"
FT                   /protein_id="ABX13734.1"
FT                   /translation="MTPEQVMTLAHQAMMVGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATLVIAGPWMLTTMLDYLRQTLLHVATLGAG"
FT   sig_peptide     complement(45554..45646)
FT                   /locus_tag="Bmul_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.573 at
FT                   residue 31"
FT   gene            complement(45663..46424)
FT                   /locus_tag="Bmul_0040"
FT   CDS_pept        complement(45663..46424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0040"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: bam:Bamb_0029 flagellar biosynthetic protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13735"
FT                   /protein_id="ABX13735.1"
FT                   /translation="MNHVFLRRAARIVPALLLGLAPALACAQAAGLPAFNASPGPNGGT
FT                   TYSLSVQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALF
FT                   LTFFVMSPVLDRAYTDGYKPFSDGTLPMEQAVQRGVAPFKGFMLKQTRETDLALFAKIS
FT                   KAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVS
FT                   PSTVSLPFKLMLFVLVDGWQLLIGSLAQSFT"
FT   sig_peptide     complement(46335..46424)
FT                   /locus_tag="Bmul_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.610 at
FT                   residue 30"
FT   gene            complement(46466..47041)
FT                   /locus_tag="Bmul_0041"
FT   CDS_pept        complement(46466..47041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0041"
FT                   /product="flagellar biosynthesis protein FliO"
FT                   /note="PFAM: flagellar biosynthesis protein FliO; KEGG:
FT                   bch:Bcen2424_0038 flagellar biosynthesis protein, FliO"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13736"
FT                   /protein_id="ABX13736.1"
FT                   /translation="MSVAPSGRRAAFAAAAACAASAVGMPACAADLNAVNHAGTIASSV
FT                   VVGSAAPSLGVGAVLQTLVGLAVVIGLVFGCAWLARRFGFQPARRGGPLKVVSSVAVGA
FT                   KESATIVEIGDTWLVLGVAPGNVRLLHTLPAGSAAVASTDAAAGVAPSGRAAPGTGGLS
FT                   VNGASFGARFRDALAGEAAKRLGRGKER"
FT   sig_peptide     complement(46952..47041)
FT                   /locus_tag="Bmul_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 30"
FT   gene            complement(47038..47517)
FT                   /locus_tag="Bmul_0042"
FT   CDS_pept        complement(47038..47517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0042"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   bur:Bcep18194_A3223 type III secretion system outer
FT                   membrane O protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13737"
FT                   /protein_id="ABX13737.1"
FT                   /translation="MTELNPTPELDPQALADAALADSAGAQQAADADPAMDDWAAALAE
FT                   QNHQPVQAGATGAGVFQPLSKAAASSTHNDIEMILDIPVKMTVELGRTKIAIRNLLQLA
FT                   QGSVVELDGLAGEPMDVLVNGCLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNR"
FT   gene            complement(47510..48508)
FT                   /locus_tag="Bmul_0043"
FT   CDS_pept        complement(47510..48508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0043"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; flagellar motor switch protein FliM; KEGG:
FT                   bvi:Bcep1808_0050 flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13738"
FT                   /protein_id="ABX13738.1"
FT                   /translation="MGHEEFMSQEEVDALLKGVTGESDTVDEERDTAGVRPYNIATQER
FT                   IVRGRMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFE
FT                   HYTVAWKSVRPLQFEFVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVELTADLAEIPTTFEKILNLRAGD
FT                   VLPLDIADTITAKVDGVPVMECGYGIFNGQYALRVQKMISASDTMKEGGYD"
FT   gene            complement(48531..49064)
FT                   /locus_tag="Bmul_0044"
FT   CDS_pept        complement(48531..49064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0044"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: bur:Bcep18194_A3225 flagellar basal body-associated
FT                   protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13739"
FT                   /protein_id="ABX13739.1"
FT                   /translation="MHATSHHARIHMASTTANPPADKPASSGKFKRIALIAVIALGAAA
FT                   AAAAGMYVFMGRQGATHASAAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKL
FT                   TDPKAQEQLTARMPEIRSRVLLALSNKHPEDIATPDGKQALAQQLRNLIEEPTQPGNQR
FT                   TKVDDVLFTEFVVQ"
FT   sig_peptide     complement(48918..49064)
FT                   /locus_tag="Bmul_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.779 at
FT                   residue 49"
FT   gene            complement(49143..49865)
FT                   /locus_tag="Bmul_0045"
FT   CDS_pept        complement(49143..49865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0045"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bur:Bcep18194_A3226
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13740"
FT                   /protein_id="ABX13740.1"
FT                   /translation="MFAALSNLPADRVNAAISFGCFVLTVALYFASKRLYAYKKTLLFS
FT                   PLVFVPGVLVLLVLLTGIPYSVYFRDTRWLMWLLGPATIAFAVPIYDYRDLIRRHWLSL
FT                   SVGVAVGIGAGVCGSLLLAKLLHLSPELQRSLMTRSVSTPFALAVSDKIHAPKDLTALF
FT                   VIATGICGMLLGEIVLALVPMRTRLARGALFGAAAHGVGTAKAREIGSEEGVVSSLTMM
FT                   IAGVAMVLIAPLLSRLPI"
FT   gene            complement(49891..50337)
FT                   /locus_tag="Bmul_0046"
FT   CDS_pept        complement(49891..50337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0046"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bch:Bcen2424_0043
FT                   LrgA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13741"
FT                   /protein_id="ABX13741.1"
FT                   /translation="MNRPTAVPARPAGAAHAGRIALQAAALGVLWLAVDWAVRAVGLPV
FT                   PSGVIGLAVLLVLLFSGRVAPTWVKDGANWLLSDMLLFFVPAAVAAVQYGGLFREDGWR
FT                   LALVVVAGTAFVMVAVAVAVDLAARLERRFVVQRVYAERRRARA"
FT   gene            50477..51403
FT                   /locus_tag="Bmul_0047"
FT   CDS_pept        50477..51403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0047"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_A3228
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13742"
FT                   /protein_id="ABX13742.1"
FT                   /translation="MELRALRYFIEVVRQQSFTAAADKLFVTQPTISKMVKALEDEIGS
FT                   PLLLRDGRQMVLTDAGRIVFQRGQDVLAAQAQLQSELNDLGTLGRGELTIGIPPLGGSL
FT                   FTPIIAAYKQRYPNIELKLFEQGARMIEAALMSGELELGGLLEPVDPATFERLPMVRAP
FT                   LWLVAPRESRWEDHAAVPLADLARESFVFYAESLALHDAVLDACRQAGFTPSIVSRSGH
FT                   WDFMAALVHAGVGIALLPEPYCRRLDAGQFTCRPIVEPEIMWAIALGWVKKGYLSHAAR
FT                   AWLEVARATLPIAPGDDLAFGGLRARE"
FT   gene            complement(51492..53054)
FT                   /locus_tag="Bmul_0048"
FT   CDS_pept        complement(51492..53054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0048"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_0055 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13743"
FT                   /protein_id="ABX13743.1"
FT                   /translation="MSATTASAASPAAEPAPLSGGALALLTVGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGLASNFETLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPLLGGWISDNYTWPWIFYINLPIGIFSATCAFFLLRGRETKTTKQRIDAVGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSSFIVALALIAVVSLAFMLVWEATEKEPVVDLTLFKDRNF
FT                   ALGALIISFGFMAFFGSVVVFPLWLQTVMGYTAGKAGLATAPVGLLALVLSPLIGRNMH
FT                   RLDLRMVASFAFIVFAIVSVWNSTFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   IPDERLASASGLSNFLRTLSGAIGTAVSSTFWENDAIYHHARLAESVSVYAQNTTDYQG
FT                   ALAQLGVVGQTANAQLNQIVTQQGFMMATNDFFHLSAIVFVALAALVWITKPKKGAGPA
FT                   MGH"
FT   gene            complement(53215..53703)
FT                   /locus_tag="Bmul_0049"
FT   CDS_pept        complement(53215..53703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0049"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bam:Bamb_0038
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13744"
FT                   /protein_id="ABX13744.1"
FT                   /translation="MAGGLYDPDSIELETSLGYYLTKARQVLFERMDRALEPFDLTAQQ
FT                   IGVILLLSRGYARTPFELSRKMAYDSGSMTRMLDRLERKGLIARSRSEQDRRMIELALT
FT                   ERGADAARALPSLIATALNAQLAGFSTDELATLTALLQRFIENGPGPAGCPKPDDGHD"
FT   gene            53877..54152
FT                   /locus_tag="Bmul_0050"
FT   CDS_pept        53877..54152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13745"
FT                   /protein_id="ABX13745.1"
FT                   /translation="MLFLKNAAGALRRTLTDTAHHVFSGPHRGWKIALYVAMLVLPGGS
FT                   LAALGFAWFDHRRQRNAKGASRRTPERAATEPPSWRLAAQPLPVRR"
FT   gene            54348..55931
FT                   /locus_tag="Bmul_0051"
FT   CDS_pept        54348..55931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0051"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bch:Bcen2424_0050 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13746"
FT                   /protein_id="ABX13746.1"
FT                   /translation="MPYAPLPRALRPLSAAVAVATAVLLAGCAVGPDYHRPDTSIPAAF
FT                   KEAPAGWKVAQPADRADRGPWWTVYDDPQLNALIDKLNASNQTIAQSAAAYRQARALVS
FT                   EARAAYFPTVGLSASGSRARTPRSSFSSGTSSSFGSSTSGSINNSYSVGLDASWEPDLW
FT                   GKVSRTVSAQRAGEAAAAADLANARLSQQALLAQTYFQLRTSDALQKLLDETVQSYRQS
FT                   LQLTQNQYAQGVAARADVIQAQTQLQSAQAAAIDNGVARAQYEHAIATLIGEPASTFSL
FT                   PPMPLTAEPPITPVDVPSTLLERRPDIAAAERRAAAANEQIGVAISAFFPTLTLSASGG
FT                   FESSVWSQLFTLPARFWTVGPQLAATLFDAGLRAAQTQAARATYDQDVAAYRLAVLSAF
FT                   QDVEDNLASQRILAQEIDVQRQAVESAEHALAIVTNQYKAGTVAYLNVLTAQTTAFTAR
FT                   QKLATITGQRMVSSVGLVKALGGGWNVSDIARETGDMAAPAAVPASGAAAASAVSAVSA
FT                   APAPGTLARQ"
FT   sig_peptide     54348..54437
FT                   /locus_tag="Bmul_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.418 at
FT                   residue 30"
FT   gene            complement(55977..56765)
FT                   /locus_tag="Bmul_0052"
FT   CDS_pept        complement(55977..56765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13747"
FT                   /protein_id="ABX13747.1"
FT                   /translation="MNRWTMRLVAALPWVAVGALATAITLIALAPAAWIAPQFARATGG
FT                   HVNLVDPAGSLWHGSATLMLAPGADQSASTLLPGRVEWTTRFWPLLTGRVQMRLRQTDA
FT                   MPQPVTLDATWRGAVLSAGAMAVPASLLAGLGTPFNTLDLQGDVRLGWTDWRLIGRNAF
FT                   GQLTVTIDGMSSRVSRVKPLGSYRAVLQAKGTGADLDLTTTQGPLFLDGHGTFGPGSGA
FT                   FRGTAHAAPEQQANLAGLLNLLGRPIGNGQVSLIYGGAMR"
FT   sig_peptide     complement(56664..56765)
FT                   /locus_tag="Bmul_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.352 at
FT                   residue 34"
FT   gene            complement(56797..57303)
FT                   /locus_tag="Bmul_0053"
FT   CDS_pept        complement(56797..57303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0053"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   bvi:Bcep1808_0060 general secretion pathway M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13748"
FT                   /protein_id="ABX13748.1"
FT                   /translation="MNTERLTQALTQFWGERTPREKTLLGWGGAVLAVAIAYSVLWSPA
FT                   QEGRARIERELPTMRRELAQMTAQANEAKSLTAAAQGVAPTGLALKDALAASLSDHGLP
FT                   GAQVQIVGNGVQIQMKNVSFPAWTQWLDDVRRQLKAQVGEAHVSALKEDGQVDLTAVMQ
FT                   PSMPK"
FT   gene            complement(57300..58706)
FT                   /locus_tag="Bmul_0054"
FT   CDS_pept        complement(57300..58706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0054"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: bur:Bcep18194_A3235
FT                   general secretion pathway L protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13749"
FT                   /protein_id="ABX13749.1"
FT                   /translation="MSTLIVSLPPREPAVPLQEWQWPELPFMLVDKAGHVQRAGRAALS
FT                   LLPRASATVLIVAARDVLLLAASVPPLKGPKLRQALPNIVEDQLIQDPLGCHIALDPVA
FT                   LPDGRRVLGVVDRAWFRAICDAFTAAGHRQLRAVPATRCLPAPLAAAPAPSAVPSDDDA
FT                   PDIAAAADGLPLGSSTGTPSAEPLVRPAAVAAVLGVATSVEPALVEAGAQPLAASAPRL
FT                   ELAIARGALGEGFAAPAARAPGTLAALAGGGAVELYELGEPGAEPRVASAGRAGGAPLL
FT                   PGAMPLSFDAFARRALAERFDLCQFEFESQPWRFDRATLKRLRLPIALAAATLGIAVIG
FT                   MNLHWWKLSRERDALSAQITETLLSAFPKTTTVLDPPAQMQRQLDQLRLAAGELSPNDF
FT                   LALSSGLARSMGALPLNGIASLDYHDRRLDVGFKPEVKVDPDFPQRLARNGLAGEVDSN
FT                   TGKWTIRSRS"
FT   gene            complement(58731..59855)
FT                   /locus_tag="Bmul_0055"
FT   CDS_pept        complement(58731..59855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0055"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   bam:Bamb_0044 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13750"
FT                   /protein_id="ABX13750.1"
FT                   /translation="MRTRPHLSMPERRACRRAHGLPRGERGAAIITALLVVALAAILVS
FT                   GMLWRQQVQVRRIENQRMLAQAQWVARGALDWTRMILRSEGDTAPGITYLGGIWAVPIA
FT                   KTKLSDFLGRIGAPNQGGDDTYISGSIEDAQAKFNLRNLIASPAPGVLQLNVAQLAAFQ
FT                   RLLTTLGYDGAFAKRIALQVRAGLMHSATRFQLPTLPGGGMAPTAPVTGGDTQAGGFTD
FT                   DPGLADSERGPAPLTMTSVDSLLDVDGVTPEMVARLRPFVTVLPTTTPVNMNTAPAEVI
FT                   AALVPGMSVSSAQALVSRRETVFFRNVGDVQLALRGAGAPGVQLDASLIDVNSSYFVVH
FT                   GRIQHDRAEVDRTSLVYRDPTTHSTRVVRIRDQL"
FT   gene            complement(59862..60557)
FT                   /locus_tag="Bmul_0056"
FT   CDS_pept        complement(59862..60557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0056"
FT                   /product="putative general secretion pathway protein J"
FT                   /note="KEGG: bvi:Bcep1808_0063 putative general secretion
FT                   pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13751"
FT                   /protein_id="ABX13751.1"
FT                   /translation="MKPAVRSDAPMPRPFARASRARGFTLIELMIAIAILAVVAVLAWR
FT                   GLDQIMRGRDKVASAMEDERVFAQMFDQMRIDARLAATDDEAGQPAIGVAGNTLQIIRA
FT                   LDVPGAAPRLQVVRYRIAGGRVVRYASPPLDDANRLHALLKDSSVDGWSAVALMGGVGA
FT                   IDAKLYVPRVGWTTSVQAANDALAQNNDALKVPQIGNAPPPRAVTGLQVSIGATSLRVP
FT                   ITRVFLVGE"
FT   gene            complement(60535..60972)
FT                   /locus_tag="Bmul_0057"
FT   CDS_pept        complement(60535..60972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0057"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG:
FT                   bvi:Bcep1808_0064 general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13752"
FT                   /protein_id="ABX13752.1"
FT                   /translation="MRGRMRRPARSPRIAGALRMRGAARGFTMIEVLVALAIIAVALAA
FT                   SIRAVGTMATGASELHRRLLAGWSADNALAQLRLAHAWPQIGEQNFDCSQGNVPLVCTQ
FT                   RVSATPNPVFRRVEVSVSMPGRSGVLAQMVTVVANETSRSL"
FT   sig_peptide     complement(60823..60972)
FT                   /locus_tag="Bmul_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.302 at
FT                   residue 50"
FT   gene            complement(60975..61607)
FT                   /locus_tag="Bmul_0058"
FT   CDS_pept        complement(60975..61607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0058"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   bur:Bcep18194_A3239 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13753"
FT                   /protein_id="ABX13753.1"
FT                   /translation="MLALRTTYRSGCHGGLRRAAASTVRACAAAEPGSRRRLAKSAGPC
FT                   AASPAFGGQRTQHRRRAARGFTLLEMLVVLVIAGLLVSLASLSLTRNPRTDLREEAQRL
FT                   ALLFETAGDEAQVRARPIAWQPTAHGFRFDVSSSDGWRTLHDDLLRPRDWDGGVTGADI
FT                   DYPGSDTRASRVVFGTESIDTPVRVTLHSAVGSATIVGTGNGRYEVQ"
FT   gene            complement(61647..62099)
FT                   /locus_tag="Bmul_0059"
FT   CDS_pept        complement(61647..62099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0059"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: bch:Bcen2424_0058
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13754"
FT                   /protein_id="ABX13754.1"
FT                   /translation="MQTWITRRNGAVRRQRGFTLIEIMVVVAILGILAALIVPKIMSRP
FT                   DEARRIAAKQDIGTIMQALKLYRLDNGRYPTQEQGLNALIQKPSTDPIPNNWKDGGYLE
FT                   RLPNDPWGNPYKYLNPGVHGEIDVFSYGADGKEGGDGNDTDIGSWQ"
FT   gene            62277..62687
FT                   /locus_tag="Bmul_0060"
FT   CDS_pept        62277..62687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13755"
FT                   /protein_id="ABX13755.1"
FT                   /translation="MNALSIRILSLALFAALCATATYWVVTLSAREAPLPAAAARPPIR
FT                   TEDAAALFGGQLERNPVQDIHLFGILALQHGGAAIVGVGGEPPRAVSLGAELTPGAKLA
FT                   EVRNRSIVVERNGARAEIQLPANTPSPAIYMR"
FT   sig_peptide     62277..62369
FT                   /locus_tag="Bmul_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.550 at
FT                   residue 31"
FT   gene            complement(62718..63935)
FT                   /locus_tag="Bmul_0061"
FT   CDS_pept        complement(62718..63935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0061"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: bch:Bcen2424_0060
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13756"
FT                   /protein_id="ABX13756.1"
FT                   /translation="MPAFRFEAIDAAGRTQKGVVDADSARAARGQLRTQGLTPLVVEPA
FT                   GSATRGARSQRLALGRKLSQREQAILTRQLASLLIAGLPLDEALGVLTEQSERDYIREL
FT                   MAAIRAEVLGGHSLANALSQHPRDFPEIYRALVSAGEHTGKLGIVLSRLADYIEQRNAL
FT                   KQKILLAFTYPAIVTVIAFGIVTFLLSYVVPQVVNVFASTKQQLPLLTIVMMALSGFVR
FT                   HWWWAILIAVALVVWFVKATLSRAGPRLAFDRWLLTAPLAGKLVRGYNTVRFASTLGIL
FT                   TAAGVPILRALQAAGETLSNRAMRANIDDAIVRVREGSALSRALNNVKTFPPVLVHLIR
FT                   SGEATGDVTTMLDRAADGEARELERRTMFLTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   gene            complement(63940..65436)
FT                   /locus_tag="Bmul_0062"
FT   CDS_pept        complement(63940..65436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0062"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: bvi:Bcep1808_0069 general secretory pathway
FT                   protein E; TIGRFAM: general secretory pathway protein E;
FT                   PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13757"
FT                   /protein_id="ABX13757.1"
FT                   /translation="MSDLLSSAHDGAPGERQPPSPLAARLLPYGFAKNGQVLIAHQLDD
FT                   TLEVWISDRTNDAALAEIARNFGSIVVQRVPADELAQAINHAYARQDGSAAQIVGEVEG
FT                   EVDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFR
FT                   VDGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLP
FT                   TGHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLISRPHGIVLVTGPTGSGKTTTL
FT                   YASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDVIMIG
FT                   EIRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRL
FT                   VRQLCPVCKEERHEDGRSVWHPVGCDKCGHSGYTGRRGVYELLIVDDAIRTLIHRNAAD
FT                   AEILAAGRAQGMRTLRDDAERWLAAGATSLEEVLRVTGGA"
FT   gene            complement(65433..67760)
FT                   /locus_tag="Bmul_0063"
FT   CDS_pept        complement(65433..67760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0063"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: bam:Bamb_0052 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13758"
FT                   /protein_id="ABX13758.1"
FT                   /translation="MTRNRFVMRRVATTLIIAGIIGSQAAYAQVTLNFVNADIDQVAKA
FT                   IGAATGKTIIVDPRVKGQLNLVAERSVPEDQALKTLQSALRMQGFALVQDHGVLKVVPE
FT                   ADAKLQGVPTYVGNVPRARGDQVITQVFELHNESANNLLPVLRPLISPNNTVTAYPANN
FT                   SIVVTDYADNVRRIAQIIAGVDSAAGAQVQVVPLRNANAIDLASQLQKMLDPGAIGNSD
FT                   ATLKVSVTADPRTNSLLLRASNASRLAAAKRLVQQLDAPSAVPGNMHVVPLRNADAVKL
FT                   AKTLRGMLGKGGNDTGSSASSNDANSFNQNGSSSSGNFSTGTAGTPPLPSGGLGGTSSS
FT                   SSYGGTSSSGGLGNAGLLGGDKDKNDDNQPGGMIQADAATNSLIITASDPVYRNLRAVI
FT                   DQLDKRRAQVYIEALIVELNSTTAGQLGIQWQVASGALLAGTNLAATAGSVAGNSIINL
FT                   TTGSVNSSTGTATGVGLPANLANLNQGLNIGWLHNMFGVQGLGALLQYFAGVSDANVLS
FT                   TPNLITLDNEEAKIVVGENVPIPTGSYSNLTSGTTSNAFNTYDRRDVGLTLHVKPQITD
FT                   GGILKLQLYTEDSAVDTATTNSQTGPSFTKRSIQSTILADNGEVIVLGGLMQDAYNVSN
FT                   SKVPLLGDIPWIGQLFRSESKQRKKTNLMVFLRPVIIADRDTAQAVTSNRYDYIQGVTG
FT                   AYKSDNNVIRDKDDPVVPPMPLGPSQGGTAAGNLFDLDKMRRQQMQRQIAPPAAEQAPA
FT                   QSQGVPAQTVPQQPLTAPGASQ"
FT   sig_peptide     complement(67674..67760)
FT                   /locus_tag="Bmul_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            68123..68569
FT                   /locus_tag="Bmul_0064"
FT   CDS_pept        68123..68569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0064"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bam:Bamb_0053 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13759"
FT                   /protein_id="ABX13759.1"
FT                   /translation="MKRRFASLVWIAAGAWFASANAHADCFDEAARYQKVNPLILRAIA
FT                   WQESRNRPSALNKNTNGSVDYGLMQINSVHLSTLSRYGIDRDTLMEPCKNVYIAAWHLR
FT                   QKMNRYGNTWQAVGAYHSETPALRDKYARQIAAILAQWKLLPPQ"
FT   sig_peptide     68123..68197
FT                   /locus_tag="Bmul_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.765 at
FT                   residue 25"
FT   gene            68733..70034
FT                   /locus_tag="Bmul_0065"
FT   CDS_pept        68733..70034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0065"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bch:Bcen2424_0064
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13760"
FT                   /protein_id="ABX13760.1"
FT                   /translation="MKQPLPVTVLSGFLGAGKTTLLNHILANRAGLKVAVIVNDLAAVN
FT                   IDASIVRDAQALSHVEERLVEMSNGCICCTLRDDLLVEIRQLAAEGRFDAIVIESTGIA
FT                   EPMPIAETFTFVDDDGTSLGDTARLDTLVTVVDAFNFLRDYGSDDALATRGIAASEDDD
FT                   RTLVELLIEQIEFCDVLVINKADLVSADELARLQHILARLNPRAHQVVSTFGNVPLDAV
FT                   LNTGRFDFDEAANAPGWLASLDRDHAYCDDPDCDAHHHAHVHGEADEFGIANFVYRARR
FT                   PFHPARLWALLHQQWPGVLRSKGFFWLATRNDIAGSLSQAGGVCRHGPAGLWWAAQDRA
FT                   EWPDDDELLAEIRTEWEGDFDDRSIGDRRQELVLIGIALDADAWRAKLDACLLTDAEFA
FT                   LGAAGWAAFDDPFPAWDVDAHDDEDPGDAQIVRP"
FT   gene            complement(70150..70428)
FT                   /locus_tag="Bmul_0066"
FT   CDS_pept        complement(70150..70428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0066"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bam:Bamb_0055 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13761"
FT                   /protein_id="ABX13761.1"
FT                   /translation="MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLI
FT                   GFGSFGSGKRAARTGRNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR"
FT   gene            70818..72791
FT                   /locus_tag="Bmul_0067"
FT   CDS_pept        70818..72791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0067"
FT                   /product="tRNA U-34 5-methylaminomethyl-2-thiouridine
FT                   biosynthesis protein MnmC"
FT                   /note="TIGRFAM: tRNA U-34 5-methylaminomethyl-2-thiouridine
FT                   biosynthesis protein MnmC; PFAM: FAD dependent
FT                   oxidoreductase; protein of unknown function DUF752; KEGG:
FT                   bvi:Bcep1808_0075 protein of unknown function DUF752"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13762"
FT                   /db_xref="GOA:A9AJC5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJC5"
FT                   /protein_id="ABX13762.1"
FT                   /translation="MPDRLVPATLAFRDDGTLVSPAYGDIYHSAAGAIAQANHVFVAGN
FT                   GLPARWQQRRTFTIVETGFGTGCNFLATWAAWRDDPARCERLHFVSVEKHPFSREDLRR
FT                   AAAHIVANTTISASVDALADAWPPLVPGLHRLEFDAGRVVLTLVFGDALERLPTLVARA
FT                   DAFYLDGFAPSKNADLWSIDVFRALARMADEHATFATYSSSGVVKRALDEAGFAYRKVD
FT                   GFAGKRAMLVGEYAPRWRMRRHEPPRAWPNAAARRALVIGAGVAGCAVVERLAARGWNV
FT                   TLIERHERIASEASGNPAGVFHPLMTRDDNVASRLTRAGFLYALARWRALEAGGHAFAR
FT                   STHGMVHLAESADDFARMRDAFDALGAPSDYARLLDTDAARAYLNLPVAHGGLLFPHGG
FT                   AVWPAALADAQCAAAGDRVQRLTRTEVARLERNGDEWHALDAHGRTLAQAPVVVLANAG
FT                   DAVRLAGLRHVALQPVRGQLTLLPAASASPPPCPAIGDGYAVPLDDGTLLIGATFEPDD
FT                   VDPAIRVAGHAENLERVRRLLPGLIGDVPALDTLRGRVAFRWVAGDRLPLIGPLADEAQ
FT                   AVANARALSGAKARDLPRMPGLYGAFGYGSRGLVWAALGAELIASQLDGEPWPIERELA
FT                   EAVDPARFLIRALRARQVSAAD"
FT   gene            73325..74680
FT                   /locus_tag="Bmul_0068"
FT   CDS_pept        73325..74680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0068"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   bur:Bcep18194_A3249 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13763"
FT                   /protein_id="ABX13763.1"
FT                   /translation="MAVQADPMSRRREPQQSHSGRYPAGAHSFLTLDPASLAVASKGEV
FT                   TTMKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRITGYAVIGLIAGSF
FT                   GFGVIDSSTDETSRLLINVALGLLLFELGSRLDLRWIRRNPWLIASSLAEATLTFVLVL
FT                   FVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLITLTALNSVYAIVL
FT                   TKLVTSWLHQEAYGNVFATILQPVYLLVGSFIVAYLVARSCNYLFRHMTSTMRDEHSFV
FT                   ALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGTAGWLLTVVLFVL
FT                   TLTSFTWSDIAIGGLFAIVLIVTRLVAKLGGVVAFAKPSGIGMKQGVALGIALTPMSAL
FT                   SYLLVDDTYQLYPNFDPHLRAIVMCTIVILQLVSPFVVYRCLSAVGERSDGN"
FT   gene            74698..75813
FT                   /locus_tag="Bmul_0069"
FT   CDS_pept        74698..75813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0069"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   bch:Bcen2424_0069 uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13764"
FT                   /db_xref="GOA:A9AJC7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJC7"
FT                   /protein_id="ABX13764.1"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHTHEQALGELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFALTWHDFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLIDRPLTLTEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAELGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT   gene            76324..76962
FT                   /locus_tag="Bmul_0070"
FT   CDS_pept        76324..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0070"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; regulatory protein
FT                   ArsR; KEGG: bam:Bamb_0061 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13765"
FT                   /protein_id="ABX13765.1"
FT                   /translation="MSEGVYGNQAAGRVTHSLLRLSTAMRSEAWDWAEGAGLTPTQGEI
FT                   LVLLLQRKGPMRLGEIARETQLTAATTSDAVSTLEMKGLVEKRRALDDGRALAVRLSAR
FT                   GRTAAKKALQWPEFLTKAVGKLGADEQGALYRALLKTLRELQVAGATPPQRMCLTCVHF
FT                   QPAKPSKKAVHHCASFGTPLADGDLRLDCSMHEEADVATQKKTWKIFAG"
FT   gene            76991..77701
FT                   /locus_tag="Bmul_0071"
FT   CDS_pept        76991..77701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0071"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   bur:Bcep18194_A3252 glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13766"
FT                   /protein_id="ABX13766.1"
FT                   /translation="MNAEVVAVRHVHFEDLGSFEQVLGERGRRVRYVDVGSSRVEVLDA
FT                   LEPSLLVVLGGPLSVYDDAQYPTIAPLAALVKQRIDAALPILGICLGAQFIARALGARV
FT                   YPAAQVELGWSPLTLTDAGRASPLRHLDGATTSMLHWHGDTFDLPGGAIHLASTPACRH
FT                   QAFSWGQHVLALQCHPEIRADRFEPWLIANAGEIASTPGIDARQLRDDTAQHGPTLEIA
FT                   ARTMFGEWLDSVGL"
FT   gene            77885..78997
FT                   /locus_tag="Bmul_0072"
FT   CDS_pept        77885..78997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0072"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bch:Bcen2424_0072 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13767"
FT                   /protein_id="ABX13767.1"
FT                   /translation="MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGHL
FT                   ALSGAALLCIEATAVEPDGRITHGDLGLWDDATEAALKPVLAAIRRYSPIRVAMQLSHA
FT                   GRKASSEVPWKGGQLVPVAEGGWLPHAPSAVPHKDGETPPLALDAAGLNRVREAFAASA
FT                   KRAARLGIDAIEVHAAHGYLLHQFLSPLANRRTDEYGGSRENRMRFPLEIFDIVRAAFP
FT                   EDRPVGVRVSATDWVEGGWELEDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPLSPGYQ
FT                   VPFAQAVKRAVDMPTIAVGLINEPAHANRLIEAGDADFVAMARAMLYDPRWPWHAAAEL
FT                   GAQVSAPPQYWRSQPREHKALFGDIAFGQR"
FT   gene            79203..79736
FT                   /locus_tag="Bmul_0073"
FT   CDS_pept        79203..79736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0073"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: bch:Bcen2424_0073
FT                   nuclear protein SET"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13768"
FT                   /protein_id="ABX13768.1"
FT                   /translation="MSSRRIAVRRSGVHGKGVFAVAPIKAGERVVEYKGERISWKEALR
FT                   RHPHDPNEPNHTFYFALEEGGVIDGKVNGNSARWINHSCAPNCEAEEVGGRVYIHALRD
FT                   IEPEEELFYDYGLVIDAKLTKKLKREYACHCGTDACRGTLLATSDESGKKKKKKDGKSD
FT                   ASAKDKSKDKKKKK"
FT   gene            complement(79780..81261)
FT                   /locus_tag="Bmul_0074"
FT   CDS_pept        complement(79780..81261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0074"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: bvi:Bcep1808_0084 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13769"
FT                   /protein_id="ABX13769.1"
FT                   /translation="MSSDPAVTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHVI
FT                   DRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKLP
FT                   LQGINVRRMHHAYVFEAEYDNRAVRVAQVRVDNVEGGKPMVVEVAQPVRHRYRIAAEFL
FT                   VAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRPL
FT                   TSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDTQQTYAALREL
FT                   RAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALAAHVDLGFQ
FT                   RSDDPGEDETLPVRGNPVLLREVIANLLDNALKYVPLARPSGARITVNVARGTLDDGQP
FT                   AAEIVVEDNGPGVPANQQADLFKRFFRGDAHNGNGVETGAGLGLAIVHDIVAMHGGTVS
FT                   YEDAPEGGSRFVVKVPLAARAATPVSATPAAAPTH"
FT   sig_peptide     complement(81160..81261)
FT                   /locus_tag="Bmul_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.954 at
FT                   residue 34"
FT   gene            complement(81392..82084)
FT                   /locus_tag="Bmul_0075"
FT   CDS_pept        complement(81392..82084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0075"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bam:Bamb_0066 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13770"
FT                   /protein_id="ABX13770.1"
FT                   /translation="MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRH
FT                   ELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFE
FT                   PAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEM
FT                   LLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQ
FT                   EIRQTASV"
FT   gene            82178..82438
FT                   /locus_tag="Bmul_0076"
FT   CDS_pept        82178..82438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13771"
FT                   /protein_id="ABX13771.1"
FT                   /translation="MAASARLQPIMSDISIHDLEAAINFWRARSPSSGDELKLCEEASA
FT                   LSKPYALLIVQRESALQLEGLDPKARKAYETYVRLKDGLES"
FT   gene            complement(82547..82855)
FT                   /locus_tag="Bmul_0077"
FT   CDS_pept        complement(82547..82855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0077"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: bur:Bcep18194_A3258
FT                   pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13772"
FT                   /db_xref="GOA:A9AJD5"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJD5"
FT                   /protein_id="ABX13772.1"
FT                   /translation="MVHKLTSEERKTRLERLPQWSAVPGRDAIQRSLRFADFNEAFGFM
FT                   TRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDADGLTERDIELALFIDAVAAHARPAS"
FT   gene            complement(82972..83946)
FT                   /locus_tag="Bmul_0078"
FT   CDS_pept        complement(82972..83946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0078"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /note="TIGRFAM: phenylalanine-4-hydroxylase; PFAM: aromatic
FT                   amino acid hydroxylase; KEGG: bch:Bcen2424_0078
FT                   phenylalanine-4-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13773"
FT                   /protein_id="ABX13773.1"
FT                   /translation="MRQFCAQAARNPLYTCMHPKPQHAERLMSTVVTAKLQEQFDAGLE
FT                   TRADFTIDQPLQRYGRVDHAVWQQLYARQSALLRGRACDAFVAGLGNIDLPADRVPSFA
FT                   DVNRQLMPATGWQIVAVPGLVPDRVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDL
FT                   FGHVPLLIEPVFADYMQAYGRIALAVADDEAALARLARLYWYTVEFGLIRDGRGPGGLS
FT                   IYGAGIVSSKGESLYSVESAAPNRLGFDLERVMRTRYRIDTFQKTYFVIDDFAQLFALA
FT                   ELDGRALAARLAGLPEFDAGAVLDTDRVLHRGTGEGWPDDADA"
FT   gene            84005..84490
FT                   /locus_tag="Bmul_0079"
FT   CDS_pept        84005..84490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0079"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bam:Bamb_0070 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13774"
FT                   /protein_id="ABX13774.1"
FT                   /translation="MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRLE
FT                   AAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVVGD
FT                   ADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGALPLAHLAPGAA"
FT   gene            complement(84581..85114)
FT                   /locus_tag="Bmul_0080"
FT   CDS_pept        complement(84581..85114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0080"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: bam:Bamb_0071
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13775"
FT                   /protein_id="ABX13775.1"
FT                   /translation="MARNIEIKARAREFDRLRERAAALATEAPLFYRQQDFFYDVPRGR
FT                   LKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHALLATALTTRGIVTKER
FT                   HVYLAGRTRIHLDRVDGLGDFIELEVVLGPDDDEAGGEAEAHDVFAKLGVAHDDLVALA
FT                   YVDLLNAAERETAA"
FT   gene            complement(85253..86191)
FT                   /locus_tag="Bmul_0081"
FT   CDS_pept        complement(85253..86191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0081"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_0072 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13776"
FT                   /protein_id="ABX13776.1"
FT                   /translation="MLNCVISGAHITTMDLTLLRAFATVAREGNLTRAAAQLHLTQPAV
FT                   SLQIKHLQETLGVALFTRTSRGLALTRDGQTLLPHAERALAAAADVERAAAALRHEVRG
FT                   RLRIGTILDPGFLRLGGFLRALVETHPQIETALRHGMSGWVLDQVRAQALDVGYYIGRP
FT                   GDDDPRDGAPFHTVTLTHFQYRVLAPAGWKERVQRAHDWRALAALPWIWAPPASAHNRL
FT                   LSRCFAQAGVQPLKVAEVDQEQSMLDLVKSGIGLTLARDAIALAEAHAHALTIVERVTV
FT                   PTELTFVTLAERRDEPAIAAALRLIEAQWAI"
FT   gene            86400..88136
FT                   /locus_tag="Bmul_0082"
FT   CDS_pept        86400..88136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0082"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bch:Bcen2424_0082
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13777"
FT                   /protein_id="ABX13777.1"
FT                   /translation="MLCIESARTPIDRRHIVSTERTLEGEFDYVIVGAGTAGCVLANRL
FT                   TEDPDVRVLLLEAGGKDDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAGLNGRALSYPRG
FT                   RVLGGCSSINGMIYMRGQRDDYDRWARETGDAGWSWDSVLPVFKRSEDHHAGASDAHGA
FT                   GGYWRVEKQRLRWEILESFAQAAQQTGIPATDDFNRGDNTGVGYFEVNQKRGVRWNTSK
FT                   AFLRPAMARANLTVITGAHAQRVIFEGRRAIGVEYRGGGTEYVARARIEVLLTSGAVNS
FT                   PQLLELSGIGDGRRLQALGIEVVQDLPGVGENLQDHLQLRMAFRVQGVRTLNTLSARWW
FT                   GKLMIGAEYALLQRGPMSMAPSQLGAFAKSDPDDPTLASPDLEYHVQPLSLDRFGEPLH
FT                   SFNAFTASVCHLRPTSRGSVHVASADPHAAPVIAPNYLSTDYDRHVAANALRLTRRIAS
FT                   APALARYRPEEILPGTRYQTEAELQEAAGAVGTTIFHPVGTCRMGRADDPRAVVDSRLR
FT                   VRGIAGLRIVDASVMPFITSGNTNSPTLMIAERASDMIRADRRAARDAAASVHTDAVVT
FT                   PA"
FT   gene            88572..89351
FT                   /locus_tag="Bmul_0083"
FT   CDS_pept        88572..89351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0083"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0083 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13778"
FT                   /protein_id="ABX13778.1"
FT                   /translation="MILGDTILETRGLTKEFRGFTAVNGVNLRVRRGAIHALIGPNGAG
FT                   KTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLTALQNVR
FT                   IGLQRALGTEFHFWRSERTLKRLDDRAMDLLTQVGLTDFAHVRTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVASGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA"
FT   gene            89348..90103
FT                   /locus_tag="Bmul_0084"
FT   CDS_pept        89348..90103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0084"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0084 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13779"
FT                   /protein_id="ABX13779.1"
FT                   /translation="MKHSEREERELSGVESGTPALEITGLEAWYGESHILHGVDLTVHR
FT                   GEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGNETIGLATHRIAHFGVGYCPEER
FT                   GIFSSLSCEENLMLPPMIGARENAMSLDDIYAMFPNLASRRQSQGTRLSGGEQQMLAVA
FT                   RILRTGANLLLLDEISEGLAPVIVQALARMIVALKSRGYTIVMVEQNFRFAAPLADRFY
FT                   VMEHGRIVEHFRASELEGKMPVLHDLLGV"
FT   gene            90180..91379
FT                   /locus_tag="Bmul_0085"
FT   CDS_pept        90180..91379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0085"
FT                   /product="ABC branched-chain amino acid family transporter,
FT                   periplasmic ligand binding protein"
FT                   /note="KEGG: bvi:Bcep1808_0095 ABC branched-chain amino
FT                   acid family transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13780"
FT                   /protein_id="ABX13780.1"
FT                   /translation="MKMKTLAHACLALATAAFTAGAAHAADTVKIGFITDMSGLYADID
FT                   GQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTN
FT                   SATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQG
FT                   GKTWFFLTADYAFGKALEKNTSDVVKANGGQVLGSVRHPLSASDFSSFLLQAQSSKAQI
FT                   LGLANAGGDTINSIKASKEFGITKTMKIAALLMFIDDVHSLGLETTQGLVLTDSWYWNR
FT                   DAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELKKMKISD
FT                   FYAKGYIRQDGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGEQAFATKQESRCALWK
FT                   "
FT   sig_peptide     90180..90257
FT                   /locus_tag="Bmul_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            91512..92396
FT                   /locus_tag="Bmul_0086"
FT   CDS_pept        91512..92396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0086"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bvi:Bcep1808_0096 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13781"
FT                   /protein_id="ABX13781.1"
FT                   /translation="MEIFGIPLPAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLSYFGLPYWAMLVLAPLIVGAFGIAIERSMLRWLYKLDHLYGLL
FT                   LTFGLTLVVEGVFRSIYGSSGQPYDVPSQLSGATNLGFMFLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMITLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLLLGVIEGFTRVFYPEASATVVFVIMAIV
FT                   LLIRPAGLFGKEK"
FT   gene            92396..93370
FT                   /locus_tag="Bmul_0087"
FT   CDS_pept        92396..93370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0087"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_0087 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13782"
FT                   /protein_id="ABX13782.1"
FT                   /translation="MQRKVLYGVLLAALLVAPFVGAYPVFVMKVLAFALFAAAFNLLIG
FT                   YTGLLSFGHAMFLATAGYATGYSMQTLGFTPELGVLAGTAIATLLGLVVGLFAIRRQGI
FT                   YFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGLLDLSNDLALYYVVLVVIVA
FT                   ACAFIVRIVHSPFGQVLVAIKENEARAISLGYDTDRFKLLAFVLSAGLAGLAGSLKVLV
FT                   LGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVALEDRLGDIGEWLASTTGI
FT                   GWFHSLGESATIVTGLIFIACVLAFRRGIVGEMIARIKPLGAS"
FT   sig_peptide     92396..92464
FT                   /locus_tag="Bmul_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            93418..94374
FT                   /locus_tag="Bmul_0088"
FT   CDS_pept        93418..94374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13783"
FT                   /protein_id="ABX13783.1"
FT                   /translation="MLRNGAEAACGTRRAAKWCPIFVRQCTIGVNAKLPADLSFFKLRF
FT                   SSDAPRIEFAGGERGDNRGTKCPDPKALLDGIQQRFFICAWIFTAFQCACNGRFGMAVR
FT                   IRRTAFGRVFFVFLRISVFAYASAYGAQPRAYRPGLPGWRAQKASVTLSFRRPSGRRNG
FT                   RQSSYKQNAEDGVRLNEKRRTMERGDPRGTGCARAGRHAGAGRVAHVAAPGPHDIARVG
FT                   RRRILAVRLGIACRLLGVPSRMSLSRRFPVPDSWPVVAFAPILSHISRCFILTTLRSRT
FT                   VTGVVRRSQADRRDVAGFAAHTVFRGKTSVGTAMRDS"
FT   gene            94451..95608
FT                   /locus_tag="Bmul_0089"
FT   CDS_pept        94451..95608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0089"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bam:Bamb_0080 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13784"
FT                   /protein_id="ABX13784.1"
FT                   /translation="MKMNRWMEALLAAGLACAAATASAQVKIGVTLSATGPAASLGIPE
FT                   KNTIALLPKEIAGKSVQYIVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLAML
FT                   DPVSQAKTPTISLAASAQIISPMDAKRAWMFKVPQNDQLMADAIAGYMAKHGVKTVGFI
FT                   GFADAYGDSWYNTFSAAAQKNGIKIVSNERYNRTDASVMGQVLKLVGSNPDAVLIAGSG
FT                   TPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCDGELLPAGPVLVTDQLPDSNP
FT                   VKKPALAYKAAYEKAYGAGSLSTFGGHAWDAGLLLQRAIPDALKKGQPGTEAFREALRA
FT                   SLESVKDLPVSHGVINMTPTDHNGFDSRARVMVQIVDGKWKLQAE"
FT   sig_peptide     94451..94525
FT                   /locus_tag="Bmul_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 25"
FT   gene            95798..96853
FT                   /locus_tag="Bmul_0090"
FT   CDS_pept        95798..96853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0090"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_A3272 ABC branched-chain amino acid family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13785"
FT                   /protein_id="ABX13785.1"
FT                   /translation="MDLSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFV
FT                   AYGALTLAALQAQKFPATCWLLFVMGIACFLLEVGGLIRHRERRRPLGRTLATLGSRYV
FT                   LLPLAVFAVTRSFAAQPLPMLAQIALTLAIVVPMGPFVYRLVYQPIAEGTTLLLLIVSV
FT                   AVHFAMVGLGLVMFGAEGSRTNAFSDAALSIGSMTVSAQSIVVIVTALVLIAALYVYFG
FT                   RTIAGKALRATSVNRLGARLVGIGTTEAGRLAFTFAAGLGVLSGILVGPLTTIYYDSGF
FT                   LIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASSYKEVIVFTLIIPVLLWRS
FT                   FATPHAEEEEE"
FT   gene            96858..98642
FT                   /locus_tag="Bmul_0091"
FT   CDS_pept        96858..98642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0091"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: bch:Bcen2424_0091 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13786"
FT                   /protein_id="ABX13786.1"
FT                   /translation="MKTMLRNKTFWAFLVVLFALPVLPGALHVPEYWITLLNYIGLYAI
FT                   VAIGLVLLTGVGGMTSFGQAAFVGVGAYATAFLTTRYGVSPWLALIVGVALTALVALVL
FT                   GAVTMRLSGHFLPLGTIAWGLALFYLFGNLEVLGKYDGINGIPALSLFGLELDSGRSLY
FT                   FLIWAVVLAAIVSVQNLLNSRPGRAIRALRGGGVMAEAMGVNTAWMRVVIFVYAAVLAA
FT                   VSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVSHVWGAVLGAAILTVLQDYLQTLL
FT                   PKLLGSEGNFEIIVFGVLMVLLLQYARQGVWPFVARLFPRGPRAHVPEHADPLPQRAKP
FT                   VAGEPLLVVDNARKQFGGLVAVNDVSFDVKAGQIVGLIGPNGAGKSTTFNLVTGVLQPT
FT                   GGRITFRGERIDGLTSRQIVQRGIGRTFQHVKLLPGMTVLENVAIGAHLRGHTGVWRSI
FT                   ARLNAHEEAQLLAEAARQIRRVGLEQHMYDEAGSLALGQQRILEIARALCCDPTLLLLD
FT                   EPAAGLRYQEKQQLAELLRRLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLP
FT                   QDVQQDPAVLEAYLGGVE"
FT   sig_peptide     96858..96938
FT                   /locus_tag="Bmul_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.458 at
FT                   residue 27"
FT   gene            98642..99397
FT                   /locus_tag="Bmul_0092"
FT   CDS_pept        98642..99397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0092"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0092 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13787"
FT                   /protein_id="ABX13787.1"
FT                   /translation="MTDTTMPILDVRGLAVRYGKVEALHGAAIKVGAGQIVSVIGPNGA
FT                   GKSTLLNAIMGALPVTGHASGAVVYRGEDVGALPVEQRVARGMCLVPEKRELFGTMTVE
FT                   DNLVLGAYRRKQAGEANFLDQLDPVFALFPRLKERRKQAAGTLSGGERQMLAVGRALMG
FT                   KPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETG
FT                   EFALEGPAAELAQNPRVIETYLGLARKTA"
FT   gene            99741..101711
FT                   /locus_tag="Bmul_0093"
FT   CDS_pept        99741..101711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0093"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG:
FT                   bch:Bcen2424_0093 glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13788"
FT                   /db_xref="GOA:A9AJF1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJF1"
FT                   /protein_id="ABX13788.1"
FT                   /translation="MLYPTEFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDEAGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRRLENQPNLWLFQQAVDDLMVEGDCVVGAVTQIGIRFRARAVVLTAGTFLDGKI
FT                   HVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRTIDFSKLEEQPGDL
FT                   DPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLEQAHILRP
FT                   GYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGVNAGRYVQEK
FT                   DAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGL
FT                   VDDVRWDAFCRKRDAVSRETERLKTTWVTPKTLPPEEATALLGKPIDHEYSLAELLRRP
FT                   GVDYDGVCGLKGGECGPAEPLADDPVLLAQIKEQVEIGIKYQGYIERQATEIERNDANE
FT                   NTRLPDGIDYREVRGLSFEVSQKLNQFRPETIGQASRISGVTPAAISLLMVHLKRRGLG
FT                   RRNGAAAPAAEQGDGAVPTQQ"
FT   gene            101708..102394
FT                   /locus_tag="Bmul_0094"
FT   CDS_pept        101708..102394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0094"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: bam:Bamb_0085
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13789"
FT                   /db_xref="GOA:A9AJF2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJF2"
FT                   /protein_id="ABX13789.1"
FT                   /translation="MTARRAPAVNRDVLERMLVDGAASLDVALSDTQRNRLLDYVALLG
FT                   KWNAVYNLTAIRDPQQMLIQHILDSLSIVPHLRGRASARVLDVGSGGGLPGLVLAIVEP
FT                   DWQVTLNDIVQKKSAFQTQTRAELKLTNLSVVTGRVETLRPGVEVPEKFDIIVSRAFAD
FT                   LSDFVKLARHLVAPGGSIWAMKGVHPDDEIARLPEGSRVKQTMRLAVPMLDAERHLIEV
FT                   AVDEAI"
FT   gene            102447..103226
FT                   /locus_tag="Bmul_0095"
FT   CDS_pept        102447..103226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0095"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bch:Bcen2424_0095 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13790"
FT                   /protein_id="ABX13790.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNA
FT                   TMGSGIDKAACEATVYEVLVDGVSVADARIRPEAVTYDVLPANRELSGAEIELIGIENR
FT                   ERQLKAALERVEDDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRSSRGAQAYLQFGAEMIERVRAFEAS"
FT   gene            103257..104150
FT                   /locus_tag="Bmul_0096"
FT   CDS_pept        103257..104150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0096"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bam:Bamb_0087 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13791"
FT                   /protein_id="ABX13791.1"
FT                   /translation="MNAVPKKKGLGRGLEALLGGSADITEAVKIEGAPNTLALGKLQAG
FT                   KYQPRTRMDEGSLQELAASIRAQGVMQPILVRPISSDKYEIIAGERRFRAARLAGLEEV
FT                   PVLVKEVSDQAAAAMALIENIQREDLNPLEEAHGIQRLLDEFGFTHEQAAESVGRSRSA
FT                   VSNLLRLLNLAAPVQTMLLAGDLDMGHARALLAVDAATQITLAHQVVNKRMSVRETEKL
FT                   VAQTTKEAPAVKARAKDDGGRDTRRLEEELSDLLASTVKIKLGRRGRGQVTIDFGNLDA
FT                   LEGILVRLRGNVAAEE"
FT   gene            104158..105294
FT                   /locus_tag="Bmul_0097"
FT   CDS_pept        104158..105294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0097"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: bur:Bcep18194_A3279
FT                   Na+/H+ antiporter, NhaD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13792"
FT                   /protein_id="ABX13792.1"
FT                   /translation="MSIHDTGAPAPRRWLGWLAQEPVLSVLALGLIVLEWLRPQPIRVL
FT                   AERVDWQTVATLAGLLMLTKALELSGCLMWLAHRIVHHVRSERGLAMLLVVFAAVLSMW
FT                   LTNDVALFVVVPLMVSLRELTPLPFRRLVIVVALAVNAGSIATPLGNPQNLFLWQLSGV
FT                   SFGRFVVTLGPLAVALMVLLLALTACAFRAKPLDLSGDVAGVDVHRAHALIAAVLFAAF
FT                   VLLADAHHPLPALIAVTIVLLAVQRKAVLKIDWLLLLIFVLMFVVLRTAAALPWIHDAI
FT                   AHARLDSPLRVFAAGAILSQGISNVPAAILLSEFTHDWRALAFGVSVGGFGFAIGSLAN
FT                   LIAVRLAKEPRMWLPFHLVSIPFALVSAVLGAWLLAHL"
FT   gene            105422..105667
FT                   /locus_tag="Bmul_0098"
FT   CDS_pept        105422..105667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13793"
FT                   /protein_id="ABX13793.1"
FT                   /translation="MVRLQPMRANLRIRESGERPAMQLQAISASDDARFTRSIVCHAFH
FT                   RIATTPNADHSTIDVSRRTPVRIAATIALPYIFFDR"
FT   gene            105882..106406
FT                   /locus_tag="Bmul_0099"
FT   CDS_pept        105882..106406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0099"
FT                   /product="F0F1-type ATP synthase subunit I-like protein"
FT                   /note="KEGG: bvi:Bcep1808_0108 F0F1-type ATP synthase
FT                   subunit I-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13794"
FT                   /protein_id="ABX13794.1"
FT                   /translation="MAGQAPNDRHDDHRAQRTASAAGERRESDDDWDVEQQDNNIVPLT
FT                   RAEAEKLFGPNVSKPSRVTPYKVVIAQVALSLVATLAWWLFSKSPGAAAQSAFLGGAIG
FT                   WVPSALFVARLKAGGSATVMSWVAGEALKLGVTIGMFAAVAYGYAGVHWPALLVTYLVV
FT                   LKTYWIALAWR"
FT   gene            106517..107368
FT                   /locus_tag="Bmul_0100"
FT   CDS_pept        106517..107368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0100"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   bte:BTH_I3314 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13795"
FT                   /protein_id="ABX13795.1"
FT                   /translation="MAASEGTRSPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWS
FT                   IVCGIVTIVLLRLAARKATPGVPGRFQCAIEMLVEMVEDQSKAIVHGNRTFIAPLALTV
FT                   FVWVALMNSLDFLPVDLPGRVIGWLGLSNVISHHRIVPTADLNGTLGIALGVFVLMIYY
FT                   SIKIKGPGGFAHELLSAPFGAHPLLWIPNLALNVVEYVAKTVSLGMRLFGNMYAGELLF
FT                   LLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHD
FT                   KH"
FT   gene            107445..107714
FT                   /locus_tag="Bmul_0101"
FT   CDS_pept        107445..107714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0101"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   bte:BTH_I3313 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13796"
FT                   /protein_id="ABX13796.1"
FT                   /translation="MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
FT   gene            107844..108314
FT                   /locus_tag="Bmul_0102"
FT   CDS_pept        107844..108314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0102"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   bch:Bcen2424_0102 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13797"
FT                   /db_xref="GOA:A9AJG0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG0"
FT                   /protein_id="ABX13797.1"
FT                   /translation="MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLA
FT                   AAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQ
FT                   AKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL"
FT   gene            108317..108856
FT                   /locus_tag="Bmul_0103"
FT   CDS_pept        108317..108856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0103"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: bch:Bcen2424_0103 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13798"
FT                   /db_xref="GOA:A9AJG1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG1"
FT                   /protein_id="ABX13798.1"
FT                   /translation="MAELATIARPYAEALFRVAEGGDIAAWSTLVQELAQVARLPEVLS
FT                   VASSPKVTRAQVAELLLAALKSPLAAGAEAKNFVQMLVDNHRIALLPEIAEQFEALKNE
FT                   REGAADAEIVSAFPLDGADLDSLVASLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLD
FT                   TSVRARLASMQAALTA"
FT   gene            108901..110442
FT                   /locus_tag="Bmul_0104"
FT   CDS_pept        108901..110442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0104"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: bam:Bamb_0095 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13799"
FT                   /db_xref="GOA:A9AJG2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG2"
FT                   /protein_id="ABX13799.1"
FT                   /translation="MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLS
FT                   DVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELI
FT                   GRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQ
FT                   RELIIGDRQTGKTAVALDAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMAYTI
FT                   VVAASASDSAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDD
FT                   LDVKQVLPFEKGLREFLKTSHADLIKRIEDTKDLSKDDEGALRAAIESFKKSGAY"
FT   gene            110562..111437
FT                   /locus_tag="Bmul_0105"
FT   CDS_pept        110562..111437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0105"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: bur:Bcep18194_A3287 H+-transporting two-sector
FT                   ATPase, gammasubunit; TIGRFAM: ATP synthase F1, gamma
FT                   subunit; PFAM: H+transporting two-sector ATPase gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13800"
FT                   /db_xref="GOA:A9AJG3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG3"
FT                   /protein_id="ABX13800.1"
FT                   /translation="MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPY
FT                   ADKVRAIAAHMSRANPEYRHPFMVANEGAKTAGIILVTTDKGLCGGLNTNVLRASVQKF
FT                   KELEEKGQKVEATAIGGKGLGFLNRFGAKVLSQVVHLGDTPHLDKLIGAVKTQLDLYSE
FT                   GKLSAVYLAYTRFINTMKQEAVIEQLLPLSSEHFEADDGTPATSWDYIYEPDAQAVVDE
FT                   LLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLVYNKSRQAAITKEL
FT                   SEIVGGAAAV"
FT   gene            111504..112898
FT                   /locus_tag="Bmul_0106"
FT   CDS_pept        111504..112898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0106"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: bmn:BMA10247_3015 ATP synthase F1,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13801"
FT                   /db_xref="GOA:A9AJG4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG4"
FT                   /protein_id="ABX13801.1"
FT                   /translation="MSTAALVEGKIVQCIGAVIDVEFPRDSMPKIYDALILDGSELTLE
FT                   VQQQLGDGVVRTICLGASDGLRRGLTVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IESETKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEFFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARK
FT                   IQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
FT   gene            113145..113570
FT                   /locus_tag="Bmul_0107"
FT   CDS_pept        113145..113570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0107"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: bur:Bcep18194_A3289 H+-transporting two-sector
FT                   ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13802"
FT                   /db_xref="GOA:A9AJG5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJG5"
FT                   /protein_id="ABX13802.1"
FT                   /translation="MATIKVDVVSAEEQIFSGEAKFVALPGETGELGILPGHTPLITRI
FT                   RPGAVRIEVEGGSDEFVFVAGGILEVQPGAVTVLADTAIRGKDLDAAKAEEARKRAEET
FT                   LQNAKSDLDLAKAQSELATAMAQLEAIQRLAKIRSRH"
FT   gene            113817..115544
FT                   /locus_tag="Bmul_0108"
FT   CDS_pept        113817..115544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bam:Bamb_0099 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13803"
FT                   /protein_id="ABX13803.1"
FT                   /translation="MAADLGVRALIAPENGLSYVRGATDVPLSEATIGRFLRDTAERFP
FT                   ERPAVVFREQQVRWTWREFAAEIDVLAAGLAALGIRKGDRVGIWSPNRSEWLLTQFATA
FT                   RIGAILVNINPAYRLAELEYALNKVGCTAVIAAERFKSSAYVEMLQTIAPELANAAPGE
FT                   LRAARVPSLRTVVSMGDVAPPGMFRFADVIARGRATVDSAALDALGATLAATDPINIQF
FT                   TSGTTGSPKGATLTHRNVVNNARFIARAMRFSEQDALCIPVPLYHCFGMVLAVLACVST
FT                   GAAMVFPGEAFDPVATLAAVAEERCTALHGVPTMFIAELDHPEFAKFDLSTLRTGIMAG
FT                   SPCPIETMKRVVSQMHLSEITIAYGMTETSPVSFQSSTDDPLEKRTTTVGRVQPHLEVK
FT                   IVDPSGEIVPVGVTGELCTKGYSVMLGYWDDDAKTREVLIDGWMHTGDLATLDAEGYCN
FT                   IVGRLKDMVIRGGENVYPREIEEFLFRHPKIQSAQVFGVPDPKYGEELCAWIVLRADEQ
FT                   MTEDDVRAFCQGQIAHYKIPRYIRFVDELPMTVTGKVQKFVMRERMIDELKLDVQKTA"
FT   gene            115724..115894
FT                   /locus_tag="Bmul_0109"
FT   CDS_pept        115724..115894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13804"
FT                   /protein_id="ABX13804.1"
FT                   /translation="MPLGRASVRDRLARSASRPLTLGTRDRIRVETVEAIVGELMDYRG
FT                   NKVFQVVTPAG"
FT   gene            complement(115958..116221)
FT                   /locus_tag="Bmul_0110"
FT   CDS_pept        complement(115958..116221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13805"
FT                   /protein_id="ABX13805.1"
FT                   /translation="MRALRLTRFASRVGRRARVCIHLADRPRVEPAERPTVFVDDHVSK
FT                   SFQRMNRRSSPFARRAFSGVQTDISSSVMRVKTALYARDENA"
FT   gene            complement(116239..117015)
FT                   /locus_tag="Bmul_0111"
FT   CDS_pept        complement(116239..117015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0111"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bur:Bcep18194_A3291 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13806"
FT                   /protein_id="ABX13806.1"
FT                   /translation="MKTLATIAAAAMLCCAGAAQAEGAGASRLDDVLARGTLRVCTTGD
FT                   YKPYSYYRTDGRFEGIDIDMAESLAKSLGVKPDYVKTSWSNLTADFVAKCDIAVGGVST
FT                   TLERQKRAFFTQPYVVDGKTPIVRCGDVDKYQTVAQIDRPETRVIVNPGGTNERFAKQY
FT                   FTHANLTVYPDNVTIFKQILAGKADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKA
FT                   YMVPRGDVVFQQYVDQWLHLALSTGEYQAISDKWLK"
FT   sig_peptide     complement(116950..117015)
FT                   /locus_tag="Bmul_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            117080..118258
FT                   /locus_tag="Bmul_0112"
FT   CDS_pept        117080..118258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0112"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: bch:Bcen2424_0111 uroporphyrinogen
FT                   decarboxylase; TIGRFAM: uroporphyrinogen decarboxylase;
FT                   PFAM: Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13807"
FT                   /protein_id="ABX13807.1"
FT                   /translation="MAAIARARAVGARLSGKMPVCLRTVAHTVAHTLLNDTFLRALLRE
FT                   PTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKNPDYATEVTLQPLERFPLDAAILF
FT                   SDILTIPDAMGLGLDFQVGEGPKFAHPVRTEADVAKLAVPDIGATLGYVTDAVREIRRA
FT                   LTDGQGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARPDLMHRILDVNAQA
FT                   VAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRYSLDYIRRVVAQLKREHDGQRVPVIT
FT                   FTKGGGLWLEEIAATGVDAVGLDWTVNVGAARERVGGRVALQGNLDPTILFAPPAVVRE
FT                   QARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAIRSGAAR"
FT   gene            118711..120984
FT                   /locus_tag="Bmul_0113"
FT   CDS_pept        118711..120984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0113"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: bur:Bcep18194_A3293 primosomal protein N;
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13808"
FT                   /protein_id="ABX13808.1"
FT                   /translation="MSGTYLRVALDHPLATLFDYRCDVDPPPGPGTLVQVPFGKRRAVG
FT                   LVCEVTTHTDVPPSRLRAIDAVCTELPPLSTDWLALVSFAADYYQRGRGEVALPALPQA
FT                   LRDAERWGRLLAPEVRYRLTDAGRAALPDALPARAAALRRLAQALADTDALTLPDARAL
FT                   HPKAAATLDDWAARGWVDVQEIGWSDAAVGNPVPNGVDNLSTSGGRTVPPALTDQQAEA
FT                   LDAIRAARGFAPFLLHGVTGSGKTEVYLHALASLLDTRPDAQALVLVPEINLTPQFEAA
FT                   FRARFAGTLADDAIVTLHSGLAEGERARNWLAAHTGRARIVLGTRLAVLASLPTLALIV
FT                   VDEEHEPAYKQQEGLRYSARDLAVWRAKHLDIPVVLGSATPSLESWWQAEQGRYTRLTL
FT                   SRRAVADAVLPTVRLIDLEEERRRGRASTGGLSGPLIAALKTRLERGEQSLVFLNRRGY
FT                   APQLACDACGWVAGCPRCSAYVVLHKPEHALRCHHCGWEARIPRSCPECGNVDIAPLGR
FT                   GTQRIEETLAEAVPGARVLRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDF
FT                   QRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLVQTRYPRHALYH
FT                   ALARQDYVGFANSTLGERRDAHLPPFVYQALLRAEARTLDAALAFLQQAAAALPGLPGA
FT                   DRVTVYDAVPMTIVKVANVHRAQLLLESASRAALQHALRAWQPELRALKGVLRWSVEVD
FT                   PLDI"
FT   gene            121323..125255
FT                   /locus_tag="Bmul_0114"
FT   CDS_pept        121323..125255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0114"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase; KEGG: bch:Bcen2424_0113
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13809"
FT                   /protein_id="ABX13809.1"
FT                   /translation="MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLERIE
FT                   HGQLPPELSGHSGVADLADGHATDGEDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPE
FT                   PECVPFLIGQARLPANLQADVQSLATRLVEALREKSSGGGVEGLIHEFSLSSQEGVALM
FT                   CLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSE
FT                   AGLSSALTRLIGRGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSY
FT                   DMLGEAATTEEDAQRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHPRYSRSQQE
FT                   RTMTELLPRVRALALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPDLAGWNGIGFV
FT                   VQGYQKRCPFVIDYLIDLARRSRHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIY
FT                   TDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPL
FT                   YEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKSVSVKELVA
FT                   DPVDEASKVVPLGAPHPKIPLPRNLYGDERPNSMGLDLSNEHRLASLSSALLASAHHPW
FT                   RAAPMLADDALADAPARDVRNPADQRDIVGTVSEATAEHVSAALAHAVTAAPIWQATPV
FT                   DARADCLVRAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYAAQIRGEFS
FT                   NDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLREA
FT                   GVPAGAVQLLPGDGETVGAALVADPRTRAVMFTGSTEVARLINKTLSTRLDPDGKPIPL
FT                   IAETGGQNAMIVDSSALAEQVIADVMQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKG
FT                   AMQELSLGNPDRLSTDVGPVIDADAKRTIDAHIATMKDKGHAVTQLAMPEACAHGTFVP
FT                   PTLIEIGSIDELKREVFGPVLHVVRYRRSQLDKLLEQIRATGYGLTLGIHTRIDETIAH
FT                   VISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPSGLPRSL
FT                   AQSLVADGAAEGGERAHPAAALTALRDWLIEQREPALAARCDGYLAQVPAGATAVLTGP
FT                   TGERNTYTLGPRGTVLCVAATPSGARAQLAAVLATGNRALFSGAAGEALVAALPASLKA
FT                   HATVRKQADAAFDAVLFEGDSDELLTLVKEVAQRPGPIVSVQGVSAGAFEHGDAEDYAL
FT                   ERLLTERSVSVNTAAAGGNANLMTIG"
FT   gene            125340..126479
FT                   /locus_tag="Bmul_0115"
FT   CDS_pept        125340..126479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0115"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bam:Bamb_0104 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13810"
FT                   /protein_id="ABX13810.1"
FT                   /translation="MQHTMKKLAGATFVAVMSLAGTAHADDVKIGYAGPMTGAQAHYGK
FT                   DMQNGIVLALEDFNATNPKIGGKPVKFVLETADDQADPRTGTTVAQKLVDDGIKGMLGH
FT                   FNSGTTIPASRIYANAGIPEIAMATAPEYTQQGYKTTFRMMTSDTQQGSVAGTFASKDL
FT                   GMKRIAIVDDRTAYGQGLADQFEKAAKAGGATIVDREFTNDKAVDFKAILTKLKAAKPD
FT                   LIYYGGADSQAAPMVKQMKALGITAPLMSGEMVKTPTFLKIAGNAAEGTIASLAGLPLD
FT                   EMPGGKTYAEKYKKRFGEDVQTYSPYSYDGAMAMLNAMKKADSTDPAKYLPVLAKTDMA
FT                   GVTSTHVAYDAKGDLKNGGITMYKVEKGEWKPLKSIGGK"
FT   sig_peptide     125340..125417
FT                   /locus_tag="Bmul_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(126697..128349)
FT                   /locus_tag="Bmul_0116"
FT   CDS_pept        complement(126697..128349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0116"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_0107
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13811"
FT                   /protein_id="ABX13811.1"
FT                   /translation="MSEPTHVVTNQFDELVDYNPFATDIALRDALARAGADWAVPQLDA
FT                   YGARLGSADTARLADEANRHTPELNVFDRRGRRIDRVEFHPAWHALLGLYRNEGFVSLA
FT                   FRDTRRGRWAATAAGFYLHGQIEAGTLCPATMTQAAIPVLQKEPALWEALRDKLYSDDY
FT                   DARDVPIADKRSIWFGMGMTEKQGGSDVRANTTLATPVGAGGRGGEYRLRGHKWFFSAP
FT                   MCDAHLVVARTEAGSPSCFYVPRWRPDGTKNAVEIQRLKNKVGNRSNSSSEIELDDAWG
FT                   IMLGDEGRGIPTIIDMATYTRLNCVLGSAAMLRQGVVQAIAYTRQRHAFGRALAEQPLM
FT                   RTVLADLALESEAALVLAMRLADAFEHDDSPRERAWKRIVTPAAKFWVCKRAVELTGEV
FT                   MEVFGGNGYVDDGPIARLFREAPVNSIWEGSGNVMCLDVLRAVSREPDSAAALFAELSE
FT                   LGAGEPRIRAALDALRAMLAAPADTLEASARLFAERLALTAQACLLRRDAPAAVSDAFI
FT                   ATRLGEASWGRVAGAFDPHAIDVGALLERAYPQ"
FT   gene            128439..129107
FT                   /locus_tag="Bmul_0117"
FT   CDS_pept        128439..129107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0117"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_A3298 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13812"
FT                   /protein_id="ABX13812.1"
FT                   /translation="MPPRHVQVPAPSGSPAAPSAPVLRRRPRQPRALASSDALQQAFVQ
FT                   LLRERGYAKTTIREIAAVAGVSVGTFYEYFGDKQSLAAFCIHRHVLALAERLREAAHAL
FT                   RGESRAALTAAFVDLQIDAVAGDAALWSLLFALERQVSSLAAYRRHYDAYVALWRDALA
FT                   GTADPPPAARLDAVARMAHSICYGGISQALLTLGPAWDVAALRGELHAALRAYLAVLPA
FT                   "
FT   gene            129325..130479
FT                   /locus_tag="Bmul_0118"
FT   CDS_pept        129325..130479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0118"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bch:Bcen2424_0119 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13813"
FT                   /protein_id="ABX13813.1"
FT                   /translation="MRSATAPRSKLPDVGTTIFTVIGQLAAQHDALNLSQGAPNFAPDP
FT                   ALVEGVARAMRDGHNQYAPMAGVAALRERLAEKTETLYGTRYDPATEITVIASASEGLY
FT                   AAISALVHPGDEVIYFEPSFDSYAPIVRMQGATPVAIKLSPEDFRVNWDEVAAAITPRT
FT                   RMIIVNTPHNPTATVLSGDDLARLAQLTRGTDIVILSDEVYEHVVFDGALHQSMARHRE
FT                   LAERSVIVSSFGKSFHVTGWRVGYCLAPAALMDEIRKVHQFMVFSADTPMQIAFADILA
FT                   RPDSYLGLSAFYQAKRDLLARELAGSRFELLPSAGSFFMLARFRHFSDERDSDFVLRLI
FT                   RDARVATIPLSAFYTDGTDAGLIRLSFSKDDATLIEGARRLRSL"
FT   gene            130522..131310
FT                   /locus_tag="Bmul_0119"
FT   CDS_pept        130522..131310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0119"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bam:Bamb_0110 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13814"
FT                   /protein_id="ABX13814.1"
FT                   /translation="MKPTHCLKLAIALACALGSAAAVADAQTLRFGLEAQYPPFESKAP
FT                   NGELQGFDIDVGNAVCETAKLTCKWVETSFDGLIPALKGRKFDAINSAMNATEQRRQAI
FT                   DFTTIIYRVPTQLIARTGSGLLPTPESLKGKRVGVLQASIQETYAKAHWEPAGVAIVAY
FT                   QDQNQAYADLVAGRLDATLVLAPAGQRGFLSRPDGKGFSFVGQPVRDDRILGSGIAFGL
FT                   RKGDDALKAKLDAAIDKLKADGTVKSLGRKYFGDIDISAK"
FT   sig_peptide     130522..130596
FT                   /locus_tag="Bmul_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 25"
FT   gene            131324..132754
FT                   /locus_tag="Bmul_0120"
FT   CDS_pept        131324..132754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0120"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bch:Bcen2424_0121 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13815"
FT                   /protein_id="ABX13815.1"
FT                   /translation="MPMPDTAAACGTPREARLSDAALEAALVAELGDACVTRAADIEPR
FT                   YFTAYNERPGVRPRALVRPRSVDEVSRALALCARLAQPVVPQGGLTGLARGAVALGGEV
FT                   VLSMERFAGIDALDAAAGTLTVRAGTPLQVVQEAADAAGFTFGVDLGARGSCQIGGMLA
FT                   TNAGGTRAIRYGTMREQVLGLEAVLADGTVVSSMNRMLKNNAGYDLKQLFIGSEGTLGV
FT                   VTRAVLRLHPKLAAPATALCRVRDYEAVVALWNRMRTLPELVSFEAMWPAFYDYVARHT
FT                   PGVAAPFAADGGFAVLIECATSAPGRDARAALETALADAIDAGLADDAALATSERQARD
FT                   LWALREGLAIDALPNLVNFDVSLPTGDLGAFAARCDAALRARWPDIVCLFFGHVGDGNV
FT                   HIGVSLTATTDADADEIDRRTYAIVREMGGSVSAEHGIGVLKRDYLAHTRSDAEIALMR
FT                   TLKAALDPGGILNPGKVL"
FT   gene            complement(132783..133355)
FT                   /locus_tag="Bmul_0121"
FT   CDS_pept        complement(132783..133355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0121"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: bam:Bamb_0112 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13816"
FT                   /protein_id="ABX13816.1"
FT                   /translation="MPAARPSPLALAVLAMLTEAPMHPYGMLQQLKARGYDEVVNVRQR
FT                   TSLYQTIERLLRDGLIVVHDTERDGAFPERTLYTLTEAGHTAGQAWLYALLAEPVREFP
FT                   AFGAGLAFLPLLDADDARQQLERRIAALEAERARVEALRHAAQADQVPRLFLLHNEHAL
FT                   VLLDAELDWTRSVVEHLKIGALRWVDA"
FT   gene            complement(133424..133855)
FT                   /locus_tag="Bmul_0122"
FT   CDS_pept        complement(133424..133855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0122"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: bch:Bcen2424_0123
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13817"
FT                   /protein_id="ABX13817.1"
FT                   /translation="MKIGELAKAARCTPETIRFYEKEGLMPDAQRTDSNYRNYTDVHLE
FT                   RLRFIRNCRALDMAHDEIRALLRLTDTPGDRCDSINALLDEHIGHVDARLAELTHLRDQ
FT                   LTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRTHLG"
FT   gene            133939..136527
FT                   /locus_tag="Bmul_0123"
FT   CDS_pept        133939..136527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0123"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: bur:Bcep18194_A3304
FT                   heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13818"
FT                   /protein_id="ABX13818.1"
FT                   /translation="MSDAQRLRDPRDDTDGGGTCCTGPARSAPAQRTADAACRAHGDAA
FT                   SCGASSHAGSRDHDAAPAVGTDAHRKHEHHAAHEHGHDEAGHEHSHAHAHDHSHEHQHD
FT                   HDHDHDHDHDHDHDHDHDHDHEDSCCAPPAPTLAPLPAAEATAAGNVRSAFRIMQMDCP
FT                   TEETLIRKKLGGMDEVSALEFNLMQRMLTVEHVPGAQPAIERAIRTLGMTPEAASAGTP
FT                   ASAAPAEAPAKPWWPLALAGAAAIASEAGSWAGLPAWLSALLAIVAVLSCGLTTYRKGW
FT                   IALRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGLM
FT                   RLAPDTATVQDADGTWRTIDAARVVLGAVVRVKPGERIGLDGEVVSGRSTVNQAPITGE
FT                   SLPVEKATGDAVYAGTINESGSFDYRVTALASNSTLARIIHAVEEAQGAKAPTQRFVDR
FT                   FARIYTPIVFAVALLVAVAPPLVVGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGL
FT                   AAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDVDAHAADIDLSRARHLA
FT                   ASLAARSDHPVSQAIAAAARDASAPAFADVQDFEALLGRGVRGTIDGVRYWLGNHRLVE
FT                   ELERCSPALEAKLDALERQGKSVVMLIDDARVLAIFAVADTIKDTSRAAIADLHALGIR
FT                   TAMLTGDNPHTAQAIAAQAGIDDARGNQLPEDKLAAVDELARGGAGAVGMVGDGINDAP
FT                   ALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGV
FT                   KLVFLGLTVAGLGTMWMAVFADAGASLIVVGNGLRLLSNARAFGGAPAAR"
FT   gene            complement(136917..137396)
FT                   /locus_tag="Bmul_0124"
FT   CDS_pept        complement(136917..137396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0124"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: bam:Bamb_0116 transcription activator, effector
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13819"
FT                   /protein_id="ABX13819.1"
FT                   /translation="MFKHEVEIRRLPTQHGYAVAHVGAYMKVGDAFAQIGAWAARHGLV
FT                   GRGAKMVGIYYDDPDTVPEAQLRAQACIVPPDGAPAVEPDAPVERVTIAGGDYAVLLHT
FT                   GPYAELKAAYQWLYGEGLRQAGRAPAAAPPFERYLNTPLDTAPADLLTEIHVPVR"
FT   gene            137714..139177
FT                   /locus_tag="Bmul_0125"
FT   CDS_pept        137714..139177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0125"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: bur:Bcep18194_A3307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13820"
FT                   /protein_id="ABX13820.1"
FT                   /translation="MDASSFITSLQTTLGGYLPKIAGAIGILVIGWLIAVIVRAGALRL
FT                   LGALKVDQRITESTGQGACVERIVAGGLFWLVLLVTAVGIFNVLNLYAVSNPFSLLVTH
FT                   IVDYLPNLIGGAALTLVAWLIASLLRSVANRALKASKVDDKLSGSAGMQPMSGYLGDVL
FT                   FWLVILMFLPAILSAFALSGLLSPVQGMIDRLLAIVPNLFAAAVIGVVGWIVARVLRGL
FT                   VTNLLVAAGADRLTQRLDSPAPVRVSSLVGTIVYVFVFVPTLISALDALKIDAISVPAT
FT                   NMLNEFLSAVPDIVAAIVIVLVTFYFARFVAALAQRLLEAAGADGLPAVLGVERVFSGM
FT                   LLPSVLVARLIVFFAMLFAAVEAANRLGFTQVRDVVTLFIEFGGHVLTGGVILVIGVWL
FT                   AGLARRVIEQADREHSVLFARIAQFAILGLVFAMGLRAMGIANEIVQLAFGLVLGAIAV
FT                   AVALSFGLGGREAAGKLLDRWFNQRGGGQ"
FT   gene            139375..140760
FT                   /locus_tag="Bmul_0126"
FT   CDS_pept        139375..140760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0126"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: bch:Bcen2424_0128
FT                   ethanolamine transproter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13821"
FT                   /protein_id="ABX13821.1"
FT                   /translation="MKAESKGQPALQQTLGTWQLWGIAVGLVISGEYFGWSYGWASAGT
FT                   LGFVITALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARRAFGPTGGYLAGVATLVEFV
FT                   FAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAATFELVVTLLAIFE
FT                   LLVFMGVVSPGFAWSNFTKGGWAGADHFSVGAFHGMFAAIPFAIWFFLAIEGVAMAAEE
FT                   AKNPKRSIPVAYVAGILTLVALAIGVMVFAGGAGDWTKLANINDPLPQAMKYIVGANSG
FT                   WMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWLAKVHPRFRTPYRAILAGG
FT                   VVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIVSMAALFKLRRSQPNLARPFRA
FT                   PLYPLFPAFAIVAALVCLGTMVYFNGLVALVFVVFLALGYAYFLATRAQRAANAPADAL
FT                   LED"
FT   gene            140852..142249
FT                   /locus_tag="Bmul_0127"
FT   CDS_pept        140852..142249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0127"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: bch:Bcen2424_0129 ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13822"
FT                   /protein_id="ABX13822.1"
FT                   /translation="MSYTETIGSRTYRFADLKTLLAKASPLRSGDQLAGVAAASEEERV
FT                   AAKIALAGVPLRAFLNEAVIPYEADEVTRLIVDDHDAHAFAEIAHLTVGDFRNWLLSPA
FT                   ADGAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLPGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAIVKLLAMIDAFRERYRVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEQANASFGISLALLAEAREAALSLKRGTVG
FT                   DNLMYFETGQGSALSANAHHGVDQQTCEVRAYAVARKFEPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDNLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEIADAHGVLRTATSRVPLLAGAN
FT                   DWMGLSA"
FT   gene            142246..143052
FT                   /locus_tag="Bmul_0128"
FT   CDS_pept        142246..143052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0128"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   bvi:Bcep1808_0136 ethanolamine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13823"
FT                   /protein_id="ABX13823.1"
FT                   /translation="MSDAVEKNPWSELKSFTNARIALGRAGSSLPTAPLLAFNLSHAQA
FT                   RDAVHQPLDADALRRELDAAGFATLGVQSAAPDRQHYLRRPDLGRKLSDDGRALLAGYG
FT                   AALDDAPDIVFVVGDGLSAFAAAKQAVPLLRAVRPRLEADGWQIGPVIVATQARVALGD
FT                   EIGELLRAKLVAVLIGERPGLSSPDSLGVYLTWAPKVGCHDAQRNCISNVRPEGLSYDA
FT                   AAHKLHYLVTHARRLGLTGVGLKDDSDALLPAAQPERIGAACDRAT"
FT   gene            complement(143045..143929)
FT                   /locus_tag="Bmul_0129"
FT   CDS_pept        complement(143045..143929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0129"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_0121 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13824"
FT                   /protein_id="ABX13824.1"
FT                   /translation="MDNLNGIVAFVRAADALSFVAAGRTLGISASAVGKTIARLEQSLG
FT                   VRLFNRTTRRITLTDEGRHFYERCQRILEDLRDAEATVTASAQRPRGKLRVSLPVIGYR
FT                   FLLPVLPEFRQRYPDVELDLDFNDRMVDVVEGGFDAVIRSGPLSDSSLMSRRLGPFAFV
FT                   LCATPAYLARAGTPRAPCDLEAHDCVRYCFPTTGKLQDWALAADDGTPLKLRTAMTCNN
FT                   MEALRGAVLAGLGIGYMPDFLARDALERGALVTVLDDYRIAPGQFSIVWPSSRQLSPKL
FT                   RVFVDFLCERLFK"
FT   gene            144073..145665
FT                   /locus_tag="Bmul_0130"
FT   CDS_pept        144073..145665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0130"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_0122 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13825"
FT                   /protein_id="ABX13825.1"
FT                   /translation="MDQPFSAVSPRRRALVLFAVCAAAVALPLSFSGGAVATPAIGRDL
FT                   HGSAVAMNWITNAFMLAFGSFLMAAGALADQFGRKRVFAAGVGGFTLMSVALAFAPSIL
FT                   AVDLLRAAQGLAAAAALAGGTAALAQTFDGAERTRAFSLLGTTFGIGLAFGPVTAGWLI
FT                   EHYGWRAIFVTGALAGALSLAFGLPRMQESRDPHATGLDWPGTVAFTAALTLFTFGVIE
FT                   APARGWTAPLVVALLAGAALGAAAFVAIETRVARPMLDLSLFRIPRFVGVQVLPISTCC
FT                   CYIVLLVVLPLRFIGIDGFSEIDAGWLMLAISAPMLVVPIAAATLTRWWPAGIVSGLGL
FT                   LVAAAGLVWLEVALRGGAGPAAIAPMVAIGIGAGMPWGLMDGLSVSVVPKERAGMATGI
FT                   FSTTRVAGEGIALAIVGALLAALAHARLQHTAPGAPSDAVLHAAARLATGDLAGAAAAL
FT                   PGVDRAVLLASYTHAFDRLLIALAIVTVLCAAIVFAFLGARQTADGTHADTRASLPPNR
FT                   RARRPACAESNGR"
FT   sig_peptide     144073..144186
FT                   /locus_tag="Bmul_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 38"
FT   gene            complement(145711..146373)
FT                   /locus_tag="Bmul_0131"
FT   CDS_pept        complement(145711..146373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0131"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bch:Bcen2424_0133 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13826"
FT                   /protein_id="ABX13826.1"
FT                   /translation="MPSDRGGASARAHGTARGALARMRCATVSKLNTAAAQHGRAVFGI
FT                   FTTRACVPATIAWHAACVCTAHRPSPAAAPIRSMHAPAPLTDDAIAFIREQAFLIVATS
FT                   DDAGNSDCSYRGRQPRADGTPAPLVAIVDARTLVLPDFAGNNLFNTIGNLLVNPAIALL
FT                   FVDFVRQTTWLVQGRATIDEDAGRFAALWPDARRYVIVDVECAQPRTDATLPPLVLA"
FT   gene            146446..147972
FT                   /locus_tag="Bmul_0132"
FT   CDS_pept        146446..147972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0132"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bur:Bcep18194_A3314 aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13827"
FT                   /protein_id="ABX13827.1"
FT                   /translation="MNPFDLKQLGLDVEYPYRQQYDNYIGGKWVPPVKGEYFENVSPIN
FT                   GQPFCRVPRSGADDIELALDAAHAARRKWGKTSVAERANLLLAAADRMEKNLKLLAVAE
FT                   TIDNGKPLRETMAADLPLAIDHFRYFAGCIRAQEGGISEIDDNTVAYHFHEPAGVVGQI
FT                   IPWNFPLLMAAWKLAPALAAGCCVVMKPAEQTPASVLVLMELIGDLFPPGAVNIVNGFG
FT                   KEAGEALATSKRIAKIAFTGSTPVGKHILHAAADSLIPSTVELGGKSPNVFFADVLDQD
FT                   DAFLDKALEGLAMFALNQGEVCTCPSRILIQESIYDRFIEKAVARVERIKAGHPLDMQT
FT                   MIGAQASQQQLDKILSYIDIGRGEGAQCLTGGERTAPAAELNTGYYVKPTMLLGNNKMR
FT                   VFQEEIFGPVASVMTFKDEQEAIELANDTFYGLGAGVWTRNGTRAYRMGREIEAGRVWT
FT                   NCYHLYPAHAAFGGYKQSGIGRETHKMALSNYQQTKCLLVSYQAEALGFF"
FT   gene            148075..148677
FT                   /locus_tag="Bmul_0133"
FT   CDS_pept        148075..148677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13828"
FT                   /protein_id="ABX13828.1"
FT                   /translation="MQPAPGTTSAAALRAAVPSDMTDTPRSRHPVFHAGELDAHRRFGV
FT                   ADEAERMSDVVTTRLSIGVRQFVETQPFMFVGTSSGGGAPLVCDIVQGGRDLDGELLPV
FT                   VRVIDTKTLRFALPAQSGACRIDAAQCDGSGIGLLFVDFVRAIRYRINGRATLRTDLSD
FT                   ADAAPWPAGSPIVELAVAQAYGNCSTRVVRLQPAASR"
FT   gene            148840..149871
FT                   /locus_tag="Bmul_0134"
FT   CDS_pept        148840..149871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0134"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_0126 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13829"
FT                   /protein_id="ABX13829.1"
FT                   /translation="MDARQARHDEPTAEDTQRSAHGDDASAGQAVVSVAHDADEQARNL
FT                   IGWRQTYDQLAAGRFVGTLTELPLDTMKLFRESTSHVLRQACEVRGDAYWFGIPLAGDG
FT                   TARVDACRIGPGALAFRPGNVEFELLTPAQFSIYGVVVRGEVLRRYAEQVEHRALDERL
FT                   FAQRVIRIGDARLARLCALLGRRLDGAAAGGGPLPGAQRDALQAEVLAALFDACAQPGD
FT                   DGSGAAPSTRRWIVEQARDYVLAHRTRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPAS
FT                   YLRALRLNGARRDLCGRAAGSVQDVAEAWGFWHLSQFATDYRRLFGKRPSDTLRERDAL
FT                   AAG"
FT   gene            complement(149999..151096)
FT                   /locus_tag="Bmul_0135"
FT   CDS_pept        complement(149999..151096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13830"
FT                   /protein_id="ABX13830.1"
FT                   /translation="MTVATLAAPAAAAPAALSHDAALAFPGTLLAPDRTLVAPYDLEHG
FT                   TARASGYVPAAPALQLLHAAQRPFRLDYSRATQVHVINGMGVALGDSVIGLTALAALRD
FT                   AHPDLRFTLYRPARAPRYVEALYALAADVVAPTRALPCAADALPAHAPCIDIGNHLYWP
FT                   AFAHMPMIDFFLDALGADPAAVPASAKRNRWLARLQLPALPAAWRRPYVLFCADASTAV
FT                   RSVPPARRAMLVDRLAQRYGLPVVGFGPVAHPAYVDVSEEAAGDTARFIAWVKGASLLF
FT                   APDTAALHVAAGFDVPSVACFTTIEPALRVRDYPHCVPIELDVPAELRGLHRSAQPDDI
FT                   AAIDAAYGALDWDAVPWPAARTAAP"
FT   sig_peptide     complement(151040..151096)
FT                   /locus_tag="Bmul_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.977 at
FT                   residue 19"
FT   gene            complement(151093..152796)
FT                   /locus_tag="Bmul_0136"
FT   CDS_pept        complement(151093..152796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0136"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: bur:Bcep18194_A3318 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13831"
FT                   /protein_id="ABX13831.1"
FT                   /translation="MSHSKDLEQPATTGARLLVDALLANHVERVFCVPGESFLAVLDAL
FT                   ADDTARIQTVVCRHEAAAANMAEAVGKLTGRPGIAFVTRGPGATHASIGVHTAFQDSTP
FT                   MILFVGQCAREHLDREAFQEIDYRRMFGQMAKWVAQIDDPRRIPEYLSHAFHVATSGRP
FT                   GPVVLALPEDVLSDVCAPQPTVPAAKRVAAAPSPAQIDELRERLARAERPFAIVGGSGW
FT                   TPEACANLRTFAERWQLPVGCAFRYQDTFDNAHPNYAGDVGLGINPALAKRIRDADLLL
FT                   VLGPRLGEATTGGYTLLDIPKTRQTLIHVHQGADELGRVYAADLPIVSGMPEIAAPLAA
FT                   LEPPALLPWAGTAADAHRAYREWHAPLPMPGDVQLGDVMVQLRERLSHDAIVTNGAGNY
FT                   AIWLHRHFAYRHFRSQLAPTSGAMGYGVPAALAAKSLYPSRAVVALAGDGCFMMAGNEL
FT                   ATAMQYGLNIVVIVVNNGHFGTIRMHQERNYPGRVHGTGLTNPDFAAYARAFGAHGETV
FT                   VRTAEFAPALDRALTCGLPALIEIRIPQDASTPAATLEQIREQGRRARGA"
FT   gene            153026..153220
FT                   /locus_tag="Bmul_0137"
FT   CDS_pept        153026..153220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0137"
FT                   /product="SpoVT/AbrB-like protein"
FT                   /note="KEGG: bur:Bcep18194_A3319 SpoVT/AbrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13832"
FT                   /protein_id="ABX13832.1"
FT                   /translation="MRIPADLAYERSDIELEIERVGDEIRIRPARRPLTGVLGKFAKFG
FT                   PDFMAEGRGDQEQAERKGG"
FT   gene            153220..153621
FT                   /locus_tag="Bmul_0138"
FT   CDS_pept        153220..153621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0138"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bur:Bcep18194_A3320 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13833"
FT                   /protein_id="ABX13833.1"
FT                   /translation="MPRYMLDTNMCIYLMKNQPEQVARRFAQCYTGDVVMSAITYAELE
FT                   YGVTVCANPARERRNLAALIEDIPVAPFDGAAAQAYGPIREATRERKKDHLDKLIGAHA
FT                   VSLDVVLVTNHERDFAGYPGLRLENWLTG"
FT   gene            complement(153743..155131)
FT                   /locus_tag="Bmul_0139"
FT   CDS_pept        complement(153743..155131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0139"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bvi:Bcep1808_0147 L-serine dehydratase 1;
FT                   TIGRFAM: L-serine dehydratase 1; PFAM: serine dehydratase
FT                   alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13834"
FT                   /protein_id="ABX13834.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFVQGLERDGLLDATAH
FT                   VKVELYGSLGATGKGHGTDRGVMLGLLGDAPDTVDPDTIGARLEQVRTSKQLALLGKHA
FT                   VPFVLKENIAFYRQALPEHPNGMKLRASDANGAVLAERTYLSVGGGFVVTAGAPNTKVL
FT                   SAAEQMTHPFRTGAELLALTESTGKSIAQLMWENERAWHTEQETRDGLLKIWAVMQSCV
FT                   SRGCGVGNPDAEGNLPGPFQVKRRAPQLYRALTGNPERALQDPLSMVDWINLYAIAVNE
FT                   ENAAGGRVVTAPTNGAAGIIPAVLHYYTRFTPGANEQGVIDFLLTAAAIGILYKLNASI
FT                   SGAEVGCQGEVGVACSMAAGALAAVLGGTPRQVENAAEIGMEHNLGLTCDPVGGMVQIP
FT                   CIERNAMASVKAVNAARMALRGDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            complement(155158..156300)
FT                   /locus_tag="Bmul_0140"
FT   CDS_pept        complement(155158..156300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13835"
FT                   /protein_id="ABX13835.1"
FT                   /translation="MVRPMFPGHDATQTRRRTRAGRFVPTLAASLSFAAAGFGAAGSAH
FT                   AAMNFCAAPALQASETTHAEPGVQALIRSVDARIGEQPHAMARVHTEGTLPHEGIYDQS
FT                   VEALKDMDLMRDAALAWRVTNAPRYLQLVDRFLSAWVSTYQPSFNPIDETRFESLILAY
FT                   DMTASALPVKTRNATSAFIAKLGAGYVAQIDAQKRPLTGIWRNNWQSHRIKLIALSAFT
FT                   LGDRKMMNAAQRLFVEHLADNIGPDGATSDFGERDALHYAVYDLQPLVTAALAARRFNR
FT                   NWLRERGTNGATLAAALDWLVPYALGEKTHEEFVHSTVPFDAKRREAGLPGYTGQWDPK
FT                   NATELFHLAARLDGRYARVAQQLSPTPPAWLAACLPLQAR"
FT   sig_peptide     complement(156160..156300)
FT                   /locus_tag="Bmul_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 47"
FT   gene            complement(156447..159374)
FT                   /locus_tag="Bmul_0141"
FT   CDS_pept        complement(156447..159374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0141"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bch:Bcen2424_0144 glycine dehydrogenase;
FT                   TIGRFAM: glycine dehydrogenase; PFAM: aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; glycine cleavage
FT                   system P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13836"
FT                   /db_xref="GOA:A9ACU3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ACU3"
FT                   /protein_id="ABX13836.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFASRAALIDAVIPASIRRNETLPLGPFSQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   YDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVTDLTGLAISNASLL
FT                   DEATAAAEAMTLLQRVGKPKSNVFYVADDVLPQTLEVIRTRALPIGIDVKTGPAADAAQ
FT                   SNAFGVLLQYPGVNGDVRDYRALTDAIHAAGGHVVVAADLLALTVLTPPGEWGADVAVG
FT                   NTQRFGVPMGFGGPHAAYLAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPHGLKTIALRVNRIAALFAAGVKQLGFATVNDT
FT                   FFDTVTVDTGARTAQVHAFANAKRINLRRVSDARVGVSIDETTTRDDLADLLAVFAQAA
FT                   GGTAPSVDALDAGLGGEAALPASLVRTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKAEQHSANLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGAHLAKFLPNQR
FT                   STGYTRGEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKESSGITVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESKEELDRFIDAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAYPVASLGTNKYWPPVGRADNAYGDRNLFCACVPMSDYA"
FT   gene            complement(159516..159896)
FT                   /locus_tag="Bmul_0142"
FT   CDS_pept        complement(159516..159896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0142"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: bam:Bamb_0132 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13837"
FT                   /db_xref="GOA:A9ACU4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ACU4"
FT                   /protein_id="ABX13837.1"
FT                   /translation="MSNVPADLKYTEEHEWIRTEADGTLTVGITDHAQSTLGDIVFLEL
FT                   PEVGKQVTAGDAVGVVESVKAASDIYSPVSGEIVEINSAIVDTPDSVNSDAYASWLFKI
FT                   KLADGASTDKLIDAAAYGKLID"
FT   gene            complement(160011..161129)
FT                   /locus_tag="Bmul_0143"
FT   CDS_pept        complement(160011..161129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0143"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: bvi:Bcep1808_0151
FT                   glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13838"
FT                   /db_xref="GOA:A9ACU5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ACU5"
FT                   /protein_id="ABX13838.1"
FT                   /translation="MTALKHTPLNAAHRALNARMVDFGGWDMPVNYGSQIEEHEAVRTD
FT                   AGMFDVSHMCVVDFTGSRARAFFEYAIANNVGKLKTPGKALYSCLLNPQGGVIDDLIVY
FT                   YFTEDFFRVVVNAGTADKDIAWFNQLNEQGGYGLTIAPRRDFAIVAVQGPNAREKVWAT
FT                   VPAARAATSELKPFNAAQVAGTPFGDLTVARTGYTGEDGFEVIVPAVHVEALWNALQQH
FT                   GVRPCGLGARDTLRLEAGMNLYGQDMDDTVSPLDAGLAWTVDLSTPRAFVGREALERDG
FT                   TRAAFVGLILQKENGKAGGVLRAHQKVVTPHGEGEITSGTFSPSMQESIAFARVPTAVQ
FT                   VGDTVHVQIRDKQLPARVVKLPFVRNGKVLAA"
FT   misc_binding    complement(161381..161483)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   42.49"
FT   gene            complement(161595..161972)
FT                   /locus_tag="Bmul_0144"
FT   CDS_pept        complement(161595..161972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13839"
FT                   /protein_id="ABX13839.1"
FT                   /translation="MQRLVRAALCCVLISSLAACVVERPRPVRPAPAPAAPAPRPNPQA
FT                   AANERMQQVLGRIDILHRRIDTRVNGGAYPPPYGAQLHHRLDVIRQESSDMAGQHGGGL
FT                   SADEQRVLNQELDTVARAIGE"
FT   sig_peptide     complement(161907..161972)
FT                   /locus_tag="Bmul_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.834 at
FT                   residue 22"
FT   gene            complement(162218..163270)
FT                   /locus_tag="Bmul_0145"
FT   CDS_pept        complement(162218..163270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0145"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bam:Bamb_0135 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13840"
FT                   /protein_id="ABX13840.1"
FT                   /translation="MSSLLRIGLMGFGFAGATFHAPVIAASGRTEVAAIATGQPDRARA
FT                   AYPGARIVADLDALLALDDIDCVVIATPNDTHFALARRVLEAGRHVVVDKPVTLTADEA
FT                   LALARLANARSRLFAPFHNRRWDGDFLTVRRLVESGELGRLTYFASHFDRFRPTPRTRW
FT                   REEPARGGGLLLDLGPHLIDQALALFGLPETVSATVKTRRDNGTAPDFVHLLLGYPDKD
FT                   VALHASALSAIEPARFTLHGTRGSYQKYGLDTQEDQLKAGLTPDDVEFGGGNRPGVLRV
FT                   LEGEIEVERPVPTLDGQYAEFYRALAAAVQDAAPFPVTPQDAVDVMTIIELAAQSEHDG
FT                   RRLPFVRRTI"
FT   sig_peptide     complement(163193..163270)
FT                   /locus_tag="Bmul_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.962 at
FT                   residue 26"
FT   gene            163516..165681
FT                   /locus_tag="Bmul_0146"
FT   CDS_pept        163516..165681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0146"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bvi:Bcep1808_0155
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13841"
FT                   /protein_id="ABX13841.1"
FT                   /translation="MRVLRSLRRARHPPGPSPSTATSSDIMSAGLNPAQNEAVRYLDGP
FT                   CLVLAGAGSGKTRVITQKIAHLIEAKGFEPRHIAAVTFTNKAAAEMRERVSKLLEGKTL
FT                   TTPGKEGRKVPVNQLTVCTFHSLGVQILRQEAEHVGLKPQFSIMDSDDCFGMIQEQIGT
FT                   TDKGLIRKIQNIISLWKNGLVTPEEAMTIAANEDEHQAALVYRNYVATLHAYQAVDFDD
FT                   LIRLPTELFAKNEQVRDRWQNKLRYLLIDEYQDTNACQYQLLKLLAGPRAAFTAVGDDD
FT                   QAIYGWRGATLENLAQLGKDFPKLHVIKLEQNYRSTVRILTAANNVIANNPKLFEKKLW
FT                   SEHGMGDAITVTACNDEEHEAESVVFRLSAHKFERRAQFRDYAILYRGNFQARIFEQVL
FT                   RRERIPYVLSGGQSFFDKAEIKDLCAYLRLIANADDDPAFIRAVTTPRRGIGNTTLEAL
FT                   GAFAGQAKVSLFEAVYMGGIEARLSARQIEPLRMFCDFIQRLTERADKEPASVVLDDMM
FT                   EAIHYEAYLYDAFDERQAQSKWQNVLEFLEWLKRKGTKPETEAVDGEADGFHNADGLAD
FT                   TGKNLLGLIQTVALMSMLEGKEEDPDAVRLSTVHASKGLEYPHVFLVGVEEGIMPHRGG
FT                   SEDDGPIDDERIEEERRLMYVAITRAQRSLHLNWCKKRKRARETVVCEPSRFIPEMGLD
FT                   DAPPPTPEEAPMTPKDRLASLKALLQK"
FT   gene            complement(165770..166663)
FT                   /locus_tag="Bmul_0147"
FT   CDS_pept        complement(165770..166663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0147"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bam:Bamb_0138
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13842"
FT                   /protein_id="ABX13842.1"
FT                   /translation="MSEAPHESPVKTPGQLIALIIASFAIPIALIVLFATYANHAFRAG
FT                   AGTDALSDDQVARRIAPIAQVDVKDANAPRTYKTGEEVYKAVCVTCHGTGAAGAPKFGN
FT                   KDDWAPRIAQGFDTLLKTALAGKGAMPPRGGTNPDDVSDYEIARAIVYMANNDGANFPE
FT                   PAAPAANAAQPASGAAGASGAADAASAQIAAAQAAIAAIPKAGEKPAAAPTSADAASAG
FT                   KALYTQVCQACHAAGVLGAPKFGSKEDWAPRLKDSMDTVYNYALHGKGAMPPKGGSNAS
FT                   DADVKAAVDYMVNAAK"
FT   gene            166919..166994
FT                   /locus_tag="Bmul_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            166919..166994
FT                   /locus_tag="Bmul_R0002"
FT                   /product="tRNA-Arg"
FT   gene            167201..168778
FT                   /locus_tag="Bmul_0148"
FT   CDS_pept        167201..168778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13843"
FT                   /protein_id="ABX13843.1"
FT                   /translation="MPMATIPSSPIAGDMPADWQQALLARLNAYSPDDPHAPLPYSRRL
FT                   ADAEGWSHDHALAVIEEYKRFAFLAQAAGHPVTPSVAVDAAWHFHLQYTREYWEVFCAD
FT                   VLQAPLHHMPGTGAPDEARVYEQRYRDTLDSYRRLFGCEPPESVWPRPARSRVDAGSAR
FT                   ADGDSAAREPDERGAAASAARRSWRNRLPKLAWPAAAASVAATCASAHDLNVLDYSGPQ
FT                   FLAFYIPACIVALLLIVGLQQVEYRCRRRRVFTREAVPDLSAEQLAYIAGEETRVVQVM
FT                   TLSLIQAGAIDLRPAGRLGTRVTLVDPARAGAYADECEWLAAQPGGEVSFGAFRQVLAR
FT                   RAAQYADAVRRREWLWAPGEMRAARLAARAIVLIVLGTGVAKLAVGLSRGRPVLLLGIS
FT                   MAAFAIAYGIIAERLTGFGRGGLSVGGRATLDAHRNDRHDERSTPDDLLWATALFGAGA
FT                   LAGTAWGMHASALMEPPPLMTAAMRADGTSGSSPSSHASDFGPSCSSSSSCSSSSCAAS
FT                   CGGCSSNS"
FT   gene            complement(168978..169277)
FT                   /locus_tag="Bmul_0149"
FT   CDS_pept        complement(168978..169277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13844"
FT                   /protein_id="ABX13844.1"
FT                   /translation="MDQYQLIGRLNTLTDDIEHAASMADWAEAARLAEVRSPLVMALTA
FT                   NQPPEGLATIRRIQASNERIFAEAHLAQRELADEYHAAMGRVQAVGEYHDMARL"
FT   gene            complement(169299..170801)
FT                   /locus_tag="Bmul_0150"
FT   CDS_pept        complement(169299..170801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0150"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; KEGG: bch:Bcen2424_0240
FT                   flagellar hook-associated 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13845"
FT                   /protein_id="ABX13845.1"
FT                   /translation="MSTVNTNTSSASANSALQQAAQSIISGSTGNTTMDVNSLVTALVN
FT                   AKTAGQTAALTARQTSDNTQISAYGTLSSALSALQAGLTTLSNGTLQSTFTATASGNGL
FT                   TATAGQGAVAGTYNVNVSRIASAQALASAGFTDPNKGLGSGTLALSLGSQSFSVNIDSS
FT                   NNTVAGIAAAINGASGNPGITATVVTGTDGAHLVLSSSTTGAANTISVEVSNLSGDAGL
FT                   SNLGVKSVPGQNGGPSTYTSANSNAAWSQSTAAQDAAFTINNISATSSTNTVTSAITGV
FT                   TLNLTSAAVGDAQAQTLTIAPDTKSQATAINNFVSLYNTLVTTMGTLTQFTAGATTQGP
FT                   LLGDSTLNTVKNTLASLVTAGVKSGSSTLTLSSIGITLQADGTLQTDSTKLNAALQSNP
FT                   ASVAALFNSTNGVGAKMSTAITDFTKTGGLIDLRTTALNADLKSIAQQQSNLSDYATQL
FT                   TNQYQAQFTALNTLMATMNNNSQYLTQLFGGQNSAGALSNNK"
FT   gene            complement(170970..172520)
FT                   /locus_tag="Bmul_0151"
FT   CDS_pept        complement(170970..172520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0151"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   bvi:Bcep1808_0199 flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13846"
FT                   /protein_id="ABX13846.1"
FT                   /translation="MLGINSNINSLVAQQNLNGSQNALSQAITRLSSGKRINSAADDAA
FT                   GLAIATRMQTQINGLNQGVSNANDGVSMIQTASSGLSQITSSLQRIRQLAVQASSGSLS
FT                   SSDQQALQTEVTQQIAEVNRIASQTNYNGKNLLDGSAGNVSFQVGANVGQTIGLNLTQS
FT                   LSAASIGKGLVSSGSTLGTLNNLNIDSATGGVYNAATSTGYQVTSINVLADGKGGFTFT
FT                   DQNNQALSNTAVTALFGNTTQGTGTALQLTPQGALASGAVTASQTAAANAANNLANQIS
FT                   GANINASTATLAGQTVASGALGQITGLNLNADGTANVSGNPAAITSIQIYGDGAGGYVF
FT                   GINGSDATIAANQLSSAAQAALFTVNATTGANGGQSLDIVAGSPLATGSGFAQTGSNSI
FT                   NSEVSSINTTNVPTTVANIDISTAAGANLAMESIDNALATVNNMQANLGAAQNRFTAIS
FT                   TTQQAQSTNLSQAQSQIQDANFAQETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ"
FT   gene            173030..173242
FT                   /locus_tag="Bmul_0152"
FT   CDS_pept        173030..173242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0152"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG: bam:Bamb_0157
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13847"
FT                   /protein_id="ABX13847.1"
FT                   /translation="MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAVR
FT                   KRKKAAAVKRLHKRLRSQMLPKKLH"
FT   gene            173622..174860
FT                   /locus_tag="Bmul_0153"
FT   CDS_pept        173622..174860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0153"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bch:Bcen2424_0244 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13848"
FT                   /protein_id="ABX13848.1"
FT                   /translation="MNAFVRPLFVRLHRWFGLATALFLFVAGLTGALIAWDHELDAALN
FT                   RDFYVARSGGKPLSPLALAERIEAADSRVQVTYLPLAVEPGHTLQAGVMARTDPATGQP
FT                   YAIDFNQIAVDPATGAVQARREWGALSLARLDLIPFIYRLHYSLFLPVYGGVNFGFWVM
FT                   GVVGIVWAFDSLIALVLAFPSLKSWRKSFAFRVRRGGYPLVFDLHRSGGVWVWGLLLVV
FT                   AITSISMNLGNPVVRPLVSLFSPLSETPYTNPEHFPPAPPGSKVLARERIVELAGPAAR
FT                   DAGIAAPPGALLYAPAMNVYAVGFFEPGNDHGDAGLGNAWLYWDAVTGKPVAAQLPGRG
FT                   SLGDLFMQAQFPLHSGRIAGVAGRVAVSVLGIVIAMLSVTGICIWVKKRSARLRAARGA
FT                   SRTAVPASSRPAR"
FT   sig_peptide     173622..173729
FT                   /locus_tag="Bmul_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.636 at
FT                   residue 36"
FT   gene            complement(174897..175499)
FT                   /locus_tag="Bmul_0154"
FT   CDS_pept        complement(174897..175499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0154"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   bch:Bcen2424_0245 DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13849"
FT                   /protein_id="ABX13849.1"
FT                   /translation="MSQRCNWVKTEADAHYHDTEWGVPSHDDRHLFEMLILEGAQAGLS
FT                   WSTILNKRAGYRDAFADFDVDAVARFTPKRIEKLLENPGIVRNRAKVEAAVANARAVQR
FT                   IREEHGSLAHFLWSFVDHTPIQNAWQSYRDAPASTERSDALSKALKAYGCKFVGSTICY
FT                   ALMQATGMVNDHEVGCPCHARCAALGGKQPARARKAG"
FT   gene            175642..176523
FT                   /locus_tag="Bmul_0155"
FT   CDS_pept        175642..176523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0155"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   bch:Bcen2424_0246 ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13850"
FT                   /protein_id="ABX13850.1"
FT                   /translation="MTALLFAIGIDGGGTGTRAVLADRHGRELAQGRGGPSGLGLGIER
FT                   AWASIAAACADAFTRAGLAFDWAQCALGCGLAGVNNAAWLAAFRAQAPLAALAIESDAY
FT                   TTVLGAHGGAPGLIVALGTGSIAAALDADGACRIAGGFGFPSGDEASGAWLGMRALAYA
FT                   QQALDGRAPRDAFAEALLAETGAQDRDALVQWSCDANQTVYARLAPIVFAHGAHPVAHA
FT                   LIAQAGDEIGKMIDALDPGQALPVALCGGLADALAPAVPAPHTARLRAPFEDSAHGALQ
FT                   LALRTLRAAGDG"
FT   gene            177131..177952
FT                   /locus_tag="Bmul_0156"
FT   CDS_pept        177131..177952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0156"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: bch:Bcen2424_0247 Cof-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13851"
FT                   /protein_id="ABX13851.1"
FT                   /translation="MYKVIATDLDGTLLNSDHQLDPYTIETVRRLDRDGVQFVIATGRH
FT                   YADVAGIRDVLGIRPYLITSNGARVHAPDDTTIHAQDIDPAIVRRLVLPEVAGAHGRVI
FT                   VNLFTEHGWLIDRDAPHLLEFHQDSGFRYEVIDMFAHDGADIAKVLYIGEPADLAVVAE
FT                   QMRVQFGDALYVTYSLPDCLEVMTANVSKGRALRAVLGRLGVDAGHCVAFGDNMNDIDL
FT                   LETAGHAFMMNNANPDLIARLPHIPRIGNNFDAGVARHLRTLFALEDLAAS"
FT   gene            complement(178058..178804)
FT                   /locus_tag="Bmul_0157"
FT   CDS_pept        complement(178058..178804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0157"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: bur:Bcep18194_A3350 aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13852"
FT                   /protein_id="ABX13852.1"
FT                   /translation="MNLSQRLAAEVFGTFWLVLGGCGSAVLAAAFPGLGIGFAGVALAF
FT                   GLTVLTMAFAIGHISGCHLNPAVSVGLTVAGRFPARDLVPYIVAQVVGATIGAFVLYLI
FT                   ATGKPGFDVVGSGFATNGFGERSPGHYSLAASFICEVVMTGFFLFVILGATDKRGVPAG
FT                   FAPIAIGLCLTLIHLISIPVTNTSVNPARSTGPALFVGGDAIGQLWLFWIAPLIGAALA
FT                   GVIYPLVAGRDDAIDLLPTASARTSE"
FT   sig_peptide     complement(178670..178804)
FT                   /locus_tag="Bmul_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.504 at
FT                   residue 45"
FT   gene            179094..179390
FT                   /locus_tag="Bmul_0158"
FT   CDS_pept        179094..179390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0158"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bch:Bcen2424_0249 histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13853"
FT                   /protein_id="ABX13853.1"
FT                   /translation="MSQYAKLKAQIAELQAQADEVRRQEVEAVIADIRRLIDEYGLTAQ
FT                   DLGFAERARRGRPPKKAPLPPKYRDPKTGATWSGRGKPPNWIVGKNRDRFLME"
FT   gene            complement(179491..180609)
FT                   /locus_tag="Bmul_0159"
FT   CDS_pept        complement(179491..180609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0159"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bvi:Bcep1808_0208 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13854"
FT                   /protein_id="ABX13854.1"
FT                   /translation="MGPGQRCGANPGRHRRTSMRIAQIAPLYEAVPPKLYGGTERVVSY
FT                   LTEALVELGHDVTLFASGDSVTSARLEAAWPRALRLDPSIRDSMAPHMRLIEQVARVAH
FT                   EFDVLHFHLDYLPFPLMSRLDTPYVTTLHGRLDLPELQPVFDAFPNAPVVSISNSQRKP
FT                   LPQAAWAGTVYHGLPETLLTPQPDVKPEYLAFLGRICPEKRVDTAIRIAAQSGLPLKIA
FT                   AKVDKADADYFKEVIEPLLGQAHVEFIGEINEAQKPAFLSGAKALLFPIDWPEPFGLVM
FT                   IEAMACGTPVVAFNRGSVPEVIEDGVTGFIVEDVQGAVGALHRIDSLSRDAIRARFNTR
FT                   FSAKAMAQRYVETYEALCTNARRPALRRVAGA"
FT   gene            181390..181710
FT                   /locus_tag="Bmul_0160"
FT   CDS_pept        181390..181710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0160"
FT                   /product="flagellar transcriptional activator"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   bvi:Bcep1808_0210 flagellar transcriptional activator, FlhD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13855"
FT                   /protein_id="ABX13855.1"
FT                   /translation="MSATSEMLGEIKEVNLSYLLLAQRLLREDKAMGMFRMGISEELAD
FT                   VLANLTLAQTVKLAASNQMLCRFRFDDHALLSSLADKGRSDVVARAHSAILMAGQPVES
FT                   VR"
FT   gene            181759..182355
FT                   /locus_tag="Bmul_0161"
FT   CDS_pept        181759..182355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0161"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="PFAM: flagellar transcriptional activator FlhC;
FT                   KEGG: bur:Bcep18194_A3354 flagellar transcriptional
FT                   activator FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13856"
FT                   /protein_id="ABX13856.1"
FT                   /translation="MGAASEQRHANVITMASKSVVIEVKEITLAIELIELGARLQLLEA
FT                   ETSLSRDRLIKLYKELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMQDHGRCE
FT                   PIHAIVKAYRLYLEHVSLSGDEAALSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAH
FT                   DPQQGFVCGLCQPPSRAGKTRKAAAARAELAAAAA"
FT   gene            182555..183415
FT                   /locus_tag="Bmul_0162"
FT   CDS_pept        182555..183415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0162"
FT                   /product="flagellar motor component-like protein"
FT                   /note="KEGG: bch:Bcen2424_0253 flagellar motor
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13857"
FT                   /protein_id="ABX13857.1"
FT                   /translation="MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIAGAGIGAF
FT                   ILGNGSKTIKATVRVLPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDP
FT                   EKSPIFTQYPKILADRHIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAH
FT                   ALMRVGDAMPAFGIVAAVMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGP
FT                   LASLAEQRVAESTKMFQCIKVTILASLNGYAPAIAVEFGRKVLFSPERPSFAELEEHVR
FT                   RVKAK"
FT   sig_peptide     182555..182620
FT                   /locus_tag="Bmul_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.968 at
FT                   residue 22"
FT   gene            183429..184445
FT                   /locus_tag="Bmul_0163"
FT   CDS_pept        183429..184445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0163"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bam:Bamb_0167
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13858"
FT                   /protein_id="ABX13858.1"
FT                   /translation="MSKGKERAIVVKRVAPQKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSSVTPVQLKGIAEYFNTPLRAALFGSGDRSSQDSSIINGGGRDLSSADAGTLRRTDG
FT                   TTQLAERVAKPADDTAQARMQGALERREQVRLHDLQIKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDTQKRPMFAMSSDHVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEGGYSNWELSADRANASRRELIAGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SVIVLNRKSEEALMRDDTTTTTLSADAAGATQLAQQLAGAHPAPVAPVAPVAAAPKP"
FT   gene            184552..184929
FT                   /locus_tag="Bmul_0164"
FT   CDS_pept        184552..184929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0164"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bch:Bcen2424_0255 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13859"
FT                   /protein_id="ABX13859.1"
FT                   /translation="MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATT
FT                   AYDLVLTDQNMPRKSGLELIAALRQLSAYADTPILVLTTEGSDAFKAAARDAGATGWIE
FT                   KPIDPGVLVELVATLSEPAAN"
FT   gene            184963..187248
FT                   /locus_tag="Bmul_0165"
FT   CDS_pept        184963..187248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0165"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheY binding; KEGG:
FT                   bch:Bcen2424_0256 CheA signal transduction histidine
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13860"
FT                   /protein_id="ABX13860.1"
FT                   /translation="MTLDITQFYQTFFDEADELLAQMEQLLLNLDVGAPDAEDLAAIFR
FT                   AAHSIKGGAATFGFSALTDTTHILESLLDRARNHELTLTKEMVDAFLETKDVLSDQLAD
FT                   YRASAEPDAAAAAAICAKLERLQADSGGAAASVAAPAAVAVAAPASAAPAVAPAADGQR
FT                   APDHVVEQAVAAAHPSAAGAAAPQTDAADEGDSNGDGPHLKITLTGVDAKDQALLVEEL
FT                   GNLGRIVGRTEVGDALTLWLESDVPSDDIVAVCCFVIDESQIRIARGAAPAATQPAAAA
FT                   QVVAEPPHGEAAPQPAAPAAAPAATAAAPAATPAASTASAAPAAAPAAHAESPAPSAAA
FT                   QPAAHHDDKRARPAAAAAAGAEGSSIRVGVEKVDQLINLVGELVITQAMLAETASAFDP
FT                   ALHDRLFNGMAQLERNARDLQEAVMSIRMMPMDYVFSRFPRLVRDLAGKLGKQVELVTF
FT                   GQATELDKSLIERIIDPLTHLVRNSLDHGIETVDKRIAAGKDAVGQLVLSAAHHGGNIV
FT                   IEVSDDGAGLNRERILAKAAKQGMQIPENISDDEVWQLIFAPGFSTAETVTDVSGRGVG
FT                   MDVVKRNIQSMGGHVEISSQAGRGTTTRIVLPLTLAILDGMSVKVGSEIFILPLNFVME
FT                   SLQPSNDDIYTVGNGERVVRVRGEYLPLVALHEVFSVEGARTDPTQGIVTIMETEGRRF
FT                   AMLIDELVGQQQVVVKNLETNYRKVHGISAATILGDGSVALIVDVAALNRETRATHGAR
FT                   AGAELAMF"
FT   gene            187296..187820
FT                   /locus_tag="Bmul_0166"
FT   CDS_pept        187296..187820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0166"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bur:Bcep18194_A3359
FT                   CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13861"
FT                   /protein_id="ABX13861.1"
FT                   /translation="MINPAAANAANATTGRRDAEHGDATGQEFLVFTLGDEEYGIDILK
FT                   VQEIRGYDSVTRIANAPDFIKGVINLRGIIVPIVDMRIKFHLGRVEYDHQTVVIILNVA
FT                   HRVVGMVVDGVSDVLTLSAEQIMPAPEFGATLTTEYLTGLGTVDGRMLILMDIEKLMSS
FT                   REMALIETLGA"
FT   gene            187861..189840
FT                   /locus_tag="Bmul_0167"
FT   CDS_pept        187861..189840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0167"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bch:Bcen2424_0258
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13862"
FT                   /protein_id="ABX13862.1"
FT                   /translation="MLQNWSIRTTLTAVGLILVCLAAAIGGLGLFALNHASRSLDEIAH
FT                   VDLPAIHALDDTSSYLLRARVSLDRFRSLTEAGNAAEAAKVLDRAQELFAKSNQNWQTF
FT                   QSTPKLGVEQALVDELAARYATIVKEGVEPEFAAARAGDMAAYHAVADTKISPMFVAYD
FT                   QAAAAVIASLQQRANDRHASTQSQISLMIALIAAGIAIAFVVVIAIRFALRGLIVKPLE
FT                   DAIAHFERIAGGDLTQPVHVFSKNEIGRLFGGIKRMQDAVTAMVQAVHRGTESIDVGAR
FT                   EIATGNTDLSQRTEEQAASLQETASSMEQLTGTVRQNAENARQASQLAVNASDIATQGG
FT                   EVVGQVVSTMQDIAASSGKIVDIIGTIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRSLAQRSATAAKEIKQLIGDSAAKVDSGSALVARAGSTMDEIVQAVRRVTDIMGEI
FT                   SAASDEQSTGIEQVNRAVGQMDAVTQQNAALVEQAAAAAASLEEQTRQMKAIVSTWRVA
FT                   GGTALAPVRAARTVEAAAVPALPAGTPRDDAPVAALPAPGASNASHAASNGSNASNTAS
FT                   QPARRASGSAASSSAARTAADSAARTPAAKDAPAASGYGPRVAKAAAPADKPAAKPALV
FT                   RPVLNGEKPALATAGASDDDWETF"
FT   sig_peptide     187861..187959
FT                   /locus_tag="Bmul_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.332 at
FT                   residue 33"
FT   gene            189844..190830
FT                   /locus_tag="Bmul_0168"
FT   CDS_pept        189844..190830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0168"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   bam:Bamb_0172 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13863"
FT                   /protein_id="ABX13863.1"
FT                   /translation="MQAARVPFRPDAPDASPRAGEPGRDFAFTGADFARIRALIHRRAG
FT                   ISLSDHKRDMAYSRLARRLRARGLDSFREYLDLLEQENDAAEWEAFTNALTTNLTAFFR
FT                   ESHHFPILAEFVKGRAAPVSVWCSAASTGEEPYSIAITLIEALGESAARSASILATDLD
FT                   TQVLAKAEAGIYTYDQVKHLSPERLKRFFLKGTGAQAGRVKVRPELRAMIRFEQLNLTD
FT                   ADYGIAKPFDAIFCRNVMIYFDKPTQSQVLARFEPLVKPGGLLFAGHSENFTYVTQAFR
FT                   LRGQTVYELTRDAAGGARPRGAPPADAAPPRLRAHADAAAGASGGRG"
FT   gene            190827..191648
FT                   /locus_tag="Bmul_0169"
FT   CDS_pept        190827..191648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0169"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; PFAM: CheD
FT                   family protein; KEGG: bam:Bamb_0173 CheD, stimulates
FT                   methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13864"
FT                   /protein_id="ABX13864.1"
FT                   /translation="MSALPIATNRYFDNHFGLPGVKLLPNEFYTTADDMVLTTVLGSCV
FT                   AACLHDPFAGIGGMNHFMLPDDGADAGAPASESMRYGAYAMEVLINELIKAGARRDRFE
FT                   AKVFGGAAVLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGRA
FT                   MVKKLRLQVPGVTEREAALAREAERLRAARAHVELFRTKPPAAPQPARPRIELFGGRGA
FT                   STSAGAGGTAGAARTGSASGGSPYAGTGSPYAGSPFAGAAHPATPSKKQEA"
FT   gene            191645..192736
FT                   /locus_tag="Bmul_0170"
FT   CDS_pept        191645..192736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0170"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bur:Bcep18194_A3363 response regulator
FT                   receiver (CheY-like) modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13865"
FT                   /protein_id="ABX13865.1"
FT                   /translation="MNVVQKIKVLCVDDSALIRSLMTEIINGQPDMMVCATAPDPLVAR
FT                   ELIKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGA
FT                   VDFVTKPRVGIRDGMLDYAEKLADKIRAASRARVRQTPQPQAAARAAGGHPAAPMVNNP
FT                   LVSTEKLIIIGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIA
FT                   VKEAEHGERVLPGHAYIAPGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAAT
FT                   HAGKNALGVILTGMGRDGAAGLLEMKRAGAHTFAQDEASCIVFGMPREAIALGAADEVA
FT                   PLAEMSRRVMARLATMGDRVQRV"
FT   gene            192804..193199
FT                   /locus_tag="Bmul_0171"
FT   CDS_pept        192804..193199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0171"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bvi:Bcep1808_0221 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13866"
FT                   /protein_id="ABX13866.1"
FT                   /translation="MDKSMKILVVDDFPTMRRIVRNLLKELGYTNVDEAEDGAAGLARL
FT                   RGGGFDFVISDWNMPNLDGLAMLKEIRADASLAHLPVLMVTAESKKENIIAAAQAGASG
FT                   YVVKPFTAATLDEKLNKIIDKMAKAGS"
FT   gene            193201..193932
FT                   /locus_tag="Bmul_0172"
FT   CDS_pept        193201..193932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0172"
FT                   /product="chemotaxis phosphatase, CheZ"
FT                   /note="PFAM: Chemotaxis phosphatase CheZ; KEGG:
FT                   bam:Bamb_0176 chemotaxis phosphatase, CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13867"
FT                   /db_xref="GOA:A9AD42"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AD42"
FT                   /protein_id="ABX13867.1"
FT                   /translation="MNEPIHAGPGDAPFGGDSQPEGADLASDRILARIGQLTRTLRDSM
FT                   RELGLDKHVERAAEAVPDARDRLRYVATMTEQAAERVLNAIEIAKPVQERVQNEAEALD
FT                   ARWAQWYAAPIEHAEVRELMDDTRAFLRALPDATSATNAQLLEIMLAQDFQDLTGQVIK
FT                   KIMDMVYLIEQQLLTVLVENIAPERREQFAATAAALAAEKTSATGSPESLLNGPQIAPE
FT                   GKPDVVQDQAQVDDLLASLGF"
FT   gene            194124..194627
FT                   /locus_tag="Bmul_0173"
FT   CDS_pept        194124..194627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13868"
FT                   /protein_id="ABX13868.1"
FT                   /translation="MKLKRLGRAAAHAAVATGVLWATHAYAELGGAPMSPPANDPAATV
FT                   RAMQRAMRSADGTPTSAAAYTMREITLGSGTVIHEYTSSAGTVFGLAWRGPTVPDLASL
FT                   LGSYFPQYTAGVEAAHAARGWRAPVSVATGGLVIRTGGHMGAFSGQAWLPNALPAGLTG
FT                   NDIQ"
FT   sig_peptide     194124..194207
FT                   /locus_tag="Bmul_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.959 at
FT                   residue 28"
FT   gene            194644..195939
FT                   /locus_tag="Bmul_0174"
FT   CDS_pept        194644..195939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13869"
FT                   /protein_id="ABX13869.1"
FT                   /translation="MRIPRTFIRWVGVAGLAIATALTVVACGGGDGDGGGSAAGGGSST
FT                   GGGSTGGSGGTGGSGSGGGTANTANTAVITVNSGVASVINIPTVSVTVCAPGTTNCQVV
FT                   NNVLVDTASYGLRLVSTAVSGLLGSLPQTTSGGAPLAECGKFVSSYTWGSVRTVDLSIG
FT                   SEQASSLPVQIIGDLGTTNVPTSCTNGNTSANSASTLGANGILGIGPAPYDCGSNCVTS
FT                   TSSDYNNYYACPNGNASCTVALVPLAQQVANPVHRFATDNNGVIVQMPNISNSGQASAT
FT                   GLLTFGIGTQSNNALGASSTLTSTTAGDVTATFLGRTVTAFFDTGSNAYFFDDSSQTVC
FT                   SRNTSFYCPASSTTYSATLTGQNGTSAGVTMPVVNADAVFANTSTFAFNDIAGPFGSSQ
FT                   WLDLGLPHFYGKTIYFGMDRRSMGGAAPYVAF"
FT   sig_peptide     194644..194724
FT                   /locus_tag="Bmul_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.905 at
FT                   residue 27"
FT   gene            196178..197377
FT                   /locus_tag="Bmul_0175"
FT   CDS_pept        196178..197377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0175"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: bam:Bamb_0181 flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13870"
FT                   /protein_id="ABX13870.1"
FT                   /translation="MADESDLDRTEAATPRRREKAREEGQVARSRELASFALLAAGFYG
FT                   AWLLAAPSGAHLQAMLRGAFAFDRATAFDTHRMLSAAGSASLEGLAALLPILALTGAAA
FT                   LLAPMALGGWLISPKTFELKFDRLNPVAGLGRIFSIQGPIQLGMSIAKTLVVGGIGGVA
FT                   IWRSKDELLGLATQPLDTALVDALHLVAVCCGTTVAGMLVVAALDVPYQLWQYNKKLRM
FT                   TKEEVKREHRENEGDPHVKGRIRQQQRAIARRRMMAAVPKADVVVTNPTHFAVALQYAD
FT                   GEMRAPKVVAKGVNLVAARIRELAAEHNVPLLEAPPLARALYHNVELEREIPGALYSAV
FT                   AEVLAWVYQLKRFRAEGGAFPAAPVDLDVPAELDKGATVSADDARDEAEDALGTHGGAA
FT                   "
FT   gene            197374..199476
FT                   /locus_tag="Bmul_0176"
FT   CDS_pept        197374..199476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0176"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: bch:Bcen2424_0268
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13871"
FT                   /protein_id="ABX13871.1"
FT                   /translation="MSTPTTGLFAKRATLLAGTNLRALAGPILICMILGMMILPLPPLL
FT                   LDLLFTFNIALSVMVLLVSMYTMKPLDFAAFPSVLLFSTLLRLSLNVASTRVVLLEGHT
FT                   GPDAAGQVIEAFGHFLVGGNFAVGIVVFVILMIINFMVITKGAGRIAEVSARFTLDAMP
FT                   GKQMAIDADLNAGLINEEQARKRRQAVAQEAEFYGSMDGASKFVRGDAIAGLIIMAINV
FT                   IGGLIVGMIQHDMSFAAAGKNYTLLTIGDGLVAQIPSLVISTAAGVIVSRVATDEDIGT
FT                   QITGQLFTNPRVLTITGAIIVLMGLIPGMPHFAFLALGGGAIWLARTQTKRAAARKAAG
FT                   DVTEIAPPAALPSDSHEATWDDVQLIDPLGLEVGYRLIPLVDRNSDGELLKRIKSIRKK
FT                   FAQEIGFLPPVIHIRDNLELRPNAYRIALKGVEIGTGEVFPGQWLAINPGQVTAALPGA
FT                   ATQDPAFGLPAVWIDVAMREQAQVYGYTVVDASTVVATHLNHLVVQHAAELLGRQEVQA
FT                   LVERTGKDAPSLVEDLVPKTVSLTTLQKVLQNLLDEGVPIRDMRTILEAVSEHAGRGDA
FT                   YEITAAVRLALGRAITQQWYPGTGDMQVMGLDANLERVLSQALATGANPGLEPGLANTL
FT                   LTGTQQAMLRQQNLGLPPVLLVQHALRAMLARFLRRSLPQLKVLSYAEVPDTRTIKVVN
FT                   VIGGSA"
FT   gene            199473..201224
FT                   /locus_tag="Bmul_0177"
FT   CDS_pept        199473..201224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0177"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; SMART: AAA ATPase; KEGG: bur:Bcep18194_A3372
FT                   GTP-binding signal recognition particle SRP54, G-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13872"
FT                   /protein_id="ABX13872.1"
FT                   /translation="MNIRKFTGATSRDALRLVREALGADAVVLSNRALDDGSVEIVALA
FT                   DAELAAVAPPAAAAVRARLPESALPAAVPAAAVPGIVARPAAPARTVANPYATDEHGLP
FT                   DVFSSVFGASADTTQAAAGPAAPAADEPGAVRANAAAPAPAHAAPPAASGEPAAWLVEH
FT                   AKRLTQQRDALRARTQAAPAASAGAAHAPQDAAPDWMRDVAREAERRAPAAARTTDAAA
FT                   AKAADRARLSADTAAAVADAVKSGVERIVNDTVMHELGALRGMMEAQFDNLMWHDRQRR
FT                   SPVHGALSKHLFAAGFSAQLVRMLVDHLPAGDGAQTFDAALEWAQSVLAANLPVLGSED
FT                   ALMERGGVFALMGPTGVGKTTTTAKLAARCVMRFGASKVALLTTDSYRIGGHEQLRIFG
FT                   KILGVPVHAVKDAGDLSLALSELRNKHIVLIDTIGMSQRDRAVSDQIAMLHGASTPVQR
FT                   LLLLNATSHGDTLNEVVQAYRSAGDRADLAGPDLAGCILTKLDEATHLGGALDTVIRYK
FT                   LPVHYVSTGQKVPENLYVATTRFLLKSAFCVPRDGSPFVPQDDDMPLLLSALTARAAAD
FT                   LHEVRFG"
FT   gene            201217..202038
FT                   /locus_tag="Bmul_0178"
FT   CDS_pept        201217..202038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0178"
FT                   /product="flagellar biosynthesis protein, FlhG"
FT                   /note="KEGG: bch:Bcen2424_0270 flagellar biosynthesis
FT                   protein, FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13873"
FT                   /protein_id="ABX13873.1"
FT                   /translation="MDKRTIDQAEGLRRLLAGRGSRIVAVTGGPTGVGCTSTVVNVAAA
FT                   LAALGKDVLVVDERADVHSAAATLAGAWLRDGERTRVAAGFWLCASAQAARAGYGDAQL
FT                   SDFLDGPADIVLIDAQLGADGTLSTLAREAHDVLIVTRVAAHAITEAYACMKRLHFAHA
FT                   TAQFRVLVNHVGSHADAKTAFDNLAGVASRYLTVSIADAGCVSADPLVEHARALTRCTV
FT                   DAFPSSPAARDYRKIAADLLYWPMRPRAGTGAARELRGGQPSYRTGAAHAA"
FT   gene            202061..202795
FT                   /locus_tag="Bmul_0179"
FT   CDS_pept        202061..202795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0179"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: bur:Bcep18194_A3374 sigma 28
FT                   (flagella/sporulation); TIGRFAM: RNA polymerase sigma
FT                   factor, FliA/WhiG family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13874"
FT                   /protein_id="ABX13874.1"
FT                   /translation="MMYNAQGKISQADVLAQYAPLVRRLGLQLVAKMPASVDLDDLIQA
FT                   GMIGLMDAAGRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRKTSREVELAVHQ
FT                   VEQRLGRAASEAEIAQHLNMPLDEYQAMLQDLHGSQLIYYEDFDRAADDEPFLDRYRVD
FT                   HADPLSALLDEHLRGALVEAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQL
FT                   HSQAVARLRARLREQAWVGAES"
FT   gene            203146..204564
FT                   /locus_tag="Bmul_0180"
FT   CDS_pept        203146..204564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0180"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: bch:Bcen2424_0272 adenosylhomocysteinase;
FT                   TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13875"
FT                   /protein_id="ABX13875.1"
FT                   /translation="MSAVIDSKASQDYVVADMALAGWGRKELNIAETEMPGLVQIRDEY
FT                   KAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTP
FT                   VFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGAKAEKDRSVIAKPT
FT                   NEEEVALYKSIARHLDIDANWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNV
FT                   NDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGCAQSLRGLGATV
FT                   WVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVITHDHMKAMRHNAIVCN
FT                   IGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRIILLAEGRLVNLGCATGHPSFVMS
FT                   NSFANQTLAQIELFTRGDQYENKVYVLPKHLDEKVARLHLARIGAQLSTLSDEQAAYIG
FT                   VQKEGPFKPNHYRY"
FT   gene            204716..205069
FT                   /locus_tag="Bmul_0181"
FT   CDS_pept        204716..205069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0181"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   bam:Bamb_0187 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13876"
FT                   /protein_id="ABX13876.1"
FT                   /translation="MSLILTWVINALALLIITYLVPSIHIKSFGTALIIAVVLGLINTV
FT                   IRPVLILLTLPVTIVTLGLFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRNLG"
FT   gene            205089..205919
FT                   /locus_tag="Bmul_0182"
FT   CDS_pept        205089..205919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0182"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: bch:Bcen2424_0274
FT                   5,10-methylenetetrahydrofolate reductase; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13877"
FT                   /protein_id="ABX13877.1"
FT                   /translation="MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGG
FT                   STQQGTLDTVLDMQKDGLDAAPHLSCIGSSRDSLRAILDQYRSCGIRHIVALRGDLPSG
FT                   MGSVGELRYASELVSFIRAEHGDWFHIEVAGYPEYHPQARSPKADLENFARKVKAGANS
FT                   AITQYFFNADAYFRFVDDVRKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARR
FT                   LESFGDDRESIRAFGADVVTGLCQRLIDAGVPGLHFYTLNAAAATKAICERLDV"
FT   gene            complement(205985..207463)
FT                   /locus_tag="Bmul_0183"
FT   CDS_pept        complement(205985..207463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0183"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: bch:Bcen2424_0275 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13878"
FT                   /protein_id="ABX13878.1"
FT                   /translation="MHDDYLAHDAIGLATLVRERQASPLELLDAAIGQADAVNGAINAI
FT                   VLQDYDAARTRAAAASAATADAPFAGVPYLVKDLGAAVAGLPLSMGSRHYRYFVPGDDS
FT                   PFIAKSRAAGLNVFGKTNTSEIGQMPYTEPDLFGACRNPWSLDHTSGGSSGGAAAAVAA
FT                   GVVPLAHASDGGGSIRIPASCCGLFGLKPSRHPALVDLPTHGDLVVNHAVSRSVRDSAL
FT                   LLDVTTGATLPPGAPGTFLAALDTPPRPLRIGLVTDPMLAPALADDTRAALDDAAALVE
FT                   SLGHHVEPATLHIDYARAAETFLTLWATIAEEIVLGARALTGRTPRRGEFEAATWAMAV
FT                   VGRRLARARLPDVLEWQRQLTVQVSGLVSRYDAILCASLAGPPVKIGELQPTPLEAAQM
FT                   KLVAALPAKPLLRELLAKASQKAFAWAGCTELFNLTGQPAMSVPLYWNARGLPIGVQFV
FT                   ARHGDDALLLQLARQLEQARPWFDRRPPLLQAQR"
FT   gene            complement(207552..208244)
FT                   /locus_tag="Bmul_0184"
FT   CDS_pept        complement(207552..208244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0184"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bam:Bamb_0190
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13879"
FT                   /protein_id="ABX13879.1"
FT                   /translation="MTAQWIDIPTGNDSFGGYLALPKRGKGPAVIIIQEIFGVNSHIRA
FT                   VADQYAADGYVALAPDVFWRTQPRVELTYDGADRDKGIELMKKTDIGLAVADLGAAADA
FT                   LRARTETTGKIAAIGYCFGGQLAYRTAAAGKVDAAVAYYGGGIQNALDLAGKIAQPILF
FT                   HYAENDHAIPLDAVEQVKAAFAGRDNAAFHVYPGAEHGFNCPERASYQQRASALAHGRT
FT                   LTFLAEHL"
FT   gene            208476..209552
FT                   /locus_tag="Bmul_0185"
FT   CDS_pept        208476..209552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0185"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bam:Bamb_0191 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13880"
FT                   /protein_id="ABX13880.1"
FT                   /translation="MSARPFSTPFAERFGLRLPLVQAPMVGATTAAMVAAASNAGALGS
FT                   LGAGAFDPDRIAAEVDAIRAATDRPFAVNLFVLPDTAADAATVARALAAIDPLNAALGL
FT                   PPGSAPARYAPDFRAQLDALVALRVPVASFTFGVLDAADVARLKAAGTYVIGTATHVAE
FT                   GLAWQAAGADALSAQGAEAGGHRGTFIGPAEHALIGTLALVPQLVDATGLPVLAAGGIM
FT                   DGRGIAAALALGAQAAQLGTAFLPCAESAVAADWKARLLACDDTSTQVTRAITGRHARG
FT                   LRNALMTRLGERLDDVAPYPVQNALTQPLRQAAARANDGDYLSLWAGQGAALARRRGDA
FT                   LTTAQLVDALAAEWRAAA"
FT   sig_peptide     208476..208598
FT                   /locus_tag="Bmul_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.407 at
FT                   residue 41"
FT   gene            209969..211111
FT                   /locus_tag="Bmul_0186"
FT   CDS_pept        209969..211111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0186"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bch:Bcen2424_0278 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13881"
FT                   /protein_id="ABX13881.1"
FT                   /translation="MNIKMQKLLPITAAAMLCAAAASNASADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKITLQLDPQDDAADPRQATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   HSKGIKSVAVVDDSTAYGQGLANEFEKKAKALGLKVVSHDATNDKAVDFRAILTKIKGE
FT                   NPDAIMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNVVCSEAGA
FT                   SLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIVDAMKRANSTDPAKIVAAMPAT
FT                   NYTGVIGTTTFDSKGDLRHGVISLYNYKSGKKTLLDEVKM"
FT   sig_peptide     209969..210052
FT                   /locus_tag="Bmul_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.953 at
FT                   residue 28"
FT   gene            complement(211191..212510)
FT                   /locus_tag="Bmul_0187"
FT   CDS_pept        complement(211191..212510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0187"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_0193 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13882"
FT                   /protein_id="ABX13882.1"
FT                   /translation="MCSVVAGRRARQARKRFDRIGQIRRAPVIRRIQISNERSVSQSSS
FT                   DLAAAPDAHRMLSLPVRQRARTATMALFFVAGMMYASWGVHVPTVRDKFALSPALLSIA
FT                   LFAVAGGSIAAMLTIARWIARVGSRVACLAGGLVMSACAALILVVPDYPMLLVVLALFG
FT                   FSMATLDVAMNAEASAVELALGKPIMSSLHGMFSIGGMAGAAAGGALLSAGMAPAVHLA
FT                   LAAATCAAVLVAASPAVLPHVPHHDEAHGSGNRWRSPALWMLGGIALVALVAEGAMYDW
FT                   ATVYMRDVVAASPAAASAAYAAFSGGMAAARFAGDAVRARFGAPQLVFASASLACAGMI
FT                   GALLMPNAAAVLIGFTLMGLGLANMMPVLFAAAARVKGIHAAEGLAHVAGLAYFGLLFG
FT                   PVVIGAVAQAANLSIGLSVVALCAALVAIVAPKVLAHLKI"
FT   gene            212522..213286
FT                   /locus_tag="Bmul_0188"
FT   CDS_pept        212522..213286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0188"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bur:Bcep18194_A3383 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13883"
FT                   /protein_id="ABX13883.1"
FT                   /translation="MTAAGPTADARHARPRVTSEHRRRADAPRVHRGAILNIDPALALH
FT                   LLHRCALGTLATHAREPQGFPYPTVVPFAPDAAHRPVILVSALAEHTRNLVADPRAGFL
FT                   VVDAPDGDVLNAERATLLGRFVELDDDPHLAARYCRYEPDAARYLALGDFTFRALDVER
FT                   LRYIGGFGRMGWVEGTDLDTLPPLSFDDEQELWAAYEAGAERRDGLDLLGVDRYGADWR
FT                   YEGRRIRTPFDLPQTDVRALRERLLRCARDAA"
FT   gene            213587..214753
FT                   /locus_tag="Bmul_0189"
FT   CDS_pept        213587..214753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0189"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sme:SMc03982
FT                   transposase for insertion sequence element ISRM5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13884"
FT                   /db_xref="GOA:P24575"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24575"
FT                   /protein_id="ABX13884.1"
FT                   /translation="MAMRVETNPLEAAYAALLENGLDGAGEALRILVNEAAKIERSAFL
FT                   GARPYERTETRRDYANGFKPKTVLTRHGELTFQVPQVRSSDFYPSALEKGTRTDQAVNL
FT                   ALAEMYVQGVSTRRVIDVLQRLLGPEISLSSAQVSRAAAKLDEGLRAWRERPLGETPYL
FT                   FLDARYEKVRLEGRIVDCAVLIAVGIEASGKRRVLGCEVATSEAEINWRRFLESLLARG
FT                   LKGVTLIIADDHAGLKAARRAVLPSVPWQRCQFHLQQNAGALTTRQEARKTVAAQMRAI
FT                   FNAPDRTEAERLLKAALTLWCKEHPKLAEWAETAIPESLTVFDFPAAHRIRLRTTNGLE
FT                   RINRELRRRTRVASIFPNPDSCLRLVSALLAELDDEWMTGKVYLNFNP"
FT   gene            215009..215302
FT                   /locus_tag="Bmul_0190"
FT   CDS_pept        215009..215302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0190"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bur:Bcep18194_A3384 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13885"
FT                   /protein_id="ABX13885.1"
FT                   /translation="MSSYKDLLAQREKLEKQIEEAKAREYAEVLNDVKQKIADYGFSLA
FT                   ELGLSRAKAGKVGRPRAGVAAKYRDPESGATWSGRGEPPRWIAGKNREQFAI"
FT   gene            215555..216709
FT                   /locus_tag="Bmul_0191"
FT   CDS_pept        215555..216709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0191"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bur:Bcep18194_A3385 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13886"
FT                   /protein_id="ABX13886.1"
FT                   /translation="MSTFTGDAQSADKHAVARKSTFVSIVLNVVLATFQIAVGVIAHSQ
FT                   ALIADGVHSISDLISDFVVLVANRHSGAVPDADHNYGHSRYETVASLFLGAILIAVGIG
FT                   MLWRGGERLVHLDTIPPVHFSALLVALTVLVSKEALFRYMLREARRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGIVGSLFGFRLLDPIAAAIVGFMVARMGWTFGYDALQDLSDRALSLA
FT                   ETAEIRALLAATPGVRDVHDLRTRKMGDAALVDAHILVDPMISVSEGHYIAETARARVL
FT                   TDPRVLDALIHVDPENDAARRPALALPPRDEIATRLEAALAQRGLRATAINLHYLSTGL
FT                   EIDVTLPAETDSDAALADKLDIDALKRQFGARRIGFTRALPAHA"
FT   gene            complement(216755..217225)
FT                   /locus_tag="Bmul_0192"
FT   CDS_pept        complement(216755..217225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0192"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bam:Bamb_0197 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13887"
FT                   /protein_id="ABX13887.1"
FT                   /translation="MEAQVTLDSFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIK
FT                   DMEQSGVIQRYTALLDREKLGLHVCALAHVHLTRHNEGGVEQFEREIATCPEVTECYST
FT                   TGEADYILKIVAPDIKAYDVFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
FT   gene            complement(217305..217964)
FT                   /locus_tag="Bmul_0193"
FT   CDS_pept        complement(217305..217964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13888"
FT                   /protein_id="ABX13888.1"
FT                   /translation="MNQTAIPEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIATF
FT                   SANLETLPGAHAHPVQEAWWKTEPEAWAACRENLQAPETALVAYVEWVEALPGKPVFVA
FT                   MPAGFDFTFMFWYMMRFAGRCPFSWSALDIKTLAFAMTGLPYRKAIKPRFPKHWFDDHP
FT                   HTHVALDDAIEQGALFCNMLADLRRQQAALAGLAVSDTDRSDDAGAGRSPTDPRTN"
FT   gene            complement(217961..218605)
FT                   /locus_tag="Bmul_0194"
FT   CDS_pept        complement(217961..218605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0194"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bur:Bcep18194_A3388 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13889"
FT                   /protein_id="ABX13889.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEKTGRAAVVDPGGDLERIEQEIARQ
FT                   NVQVDKVLLTHGHIDHCAGAKTLATHYGVPIEGPQEDERFWIEKLPTQSERFGFPAAEA
FT                   FEPDRWLNDGDTVQFGDETLEVYHCPGHTPGHVVFFSRAHRVAIVGDVLFAGSIGRTDF
FT                   PRGNHADLVRSIKEKLWPLGDDVTFVPGHGPVSTFGDERRTNPFVSDKVFG"
FT   gene            219261..219869
FT                   /locus_tag="Bmul_0195"
FT   CDS_pept        219261..219869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0195"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: bur:Bcep18194_A3389 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13890"
FT                   /protein_id="ABX13890.1"
FT                   /translation="MNLRLPNRFGTIALFFALAGCAVPPSQTTGSASQKNAVDKTAAAA
FT                   KADDQQPLNFDSALASMPATGSDDAKKSSLADAEPIDGKDVSDFRQTGRASWYGKGFHG
FT                   RRTANGERFNMNAFTAAHRTLPLSSYIKVTNASNGKWVVVKVNDRGPFKRGRVLDLSYA
FT                   AAKVIGLVHAGTGRVKIEGLSPQEAREARDEMLASISSK"
FT   sig_peptide     219261..219347
FT                   /locus_tag="Bmul_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.458 at
FT                   residue 29"
FT   gene            complement(219951..220829)
FT                   /locus_tag="Bmul_0196"
FT   CDS_pept        complement(219951..220829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0196"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bam:Bamb_0201
FT                   protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13891"
FT                   /protein_id="ABX13891.1"
FT                   /translation="MTALLELAHTQHYPEAALYVVATPIGNVADITLRALHVLGLVDRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHEHNEREAALRVIELLRAGERIAYVSDAGTPGISD
FT                   PGARLVDAVRAAGFAVIPLPGASAAVTALSVAGDWAGAFTFAGFLPPKAKQRAAALQAL
FT                   ASHPYALVFYEAPHRIAETVDALADAFGPARRLLIARELTKLHEQLFAGTLAEGQSWLA
FT                   GDANRQRGEFVLVVEGAPAARDDADDTAHDALLKLLLEEVPVKSAAKLAAALTGASRNA
FT                   LYARALALKEG"
FT   gene            220876..221289
FT                   /locus_tag="Bmul_0197"
FT   CDS_pept        220876..221289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0197"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bch:Bcen2424_0290 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13892"
FT                   /protein_id="ABX13892.1"
FT                   /translation="MCHARAARPDDACAADNFSGAARSKPIGAAFELRARQFLARRGLA
FT                   FVAANVTMRGGELDLVMRDADTLVFVEVRARRSTRHGGAAASVGARKRQRLVTAALRFW
FT                   AHHDPAAACRFDVIAFEAGRLVWLRDAFRADDA"
FT   gene            221426..222010
FT                   /locus_tag="Bmul_0198"
FT   CDS_pept        221426..222010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0198"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: bur:Bcep18194_A3392 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13893"
FT                   /protein_id="ABX13893.1"
FT                   /translation="MSVERIQQHFRDSAALHAQAADALSLPIAAAVDAMFAALANGNKI
FT                   VACGDGPSAAAAHYLAVSLVGGFERERPGLPAIALATDASQAGLAGAAAADQLFAQQVR
FT                   VLGQTGDILLVLDSGGASPRVLAAIDEAHEREMTVVALTGGGGHAVAAALSDTDIAISV
FT                   PAVRAARIHEVHLLTIHCLCDGIDAMLLGED"
FT   gene            222028..222825
FT                   /locus_tag="Bmul_0199"
FT   CDS_pept        222028..222825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0199"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   bam:Bamb_0204 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13894"
FT                   /protein_id="ABX13894.1"
FT                   /translation="MNQSRVKQTLVRTTLLAALTAGLAVSLQGCVLGVVGAAAGGGALI
FT                   ATDRRTLGAQTEDREIQVKALTQINNGLPDQSHVNVTVFNRRALLTGEVPNDASKQRAE
FT                   EIVRGINNVNGIVNELSVEPAASLSSRANDSYLEGRVKSELIATKGISANNYKVVSERG
FT                   NIYLMGLVTVDEGNRGAEAASQVPGVEKVVKVFQYIKPQDAQALQAAAPSDASGAQAAA
FT                   APADAATVGAVPDASVQSTPLQPPAPISNSSGVHPGNPKATPQ"
FT   sig_peptide     222028..222117
FT                   /locus_tag="Bmul_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.452 at
FT                   residue 30"
FT   gene            222822..223193
FT                   /locus_tag="Bmul_0200"
FT   CDS_pept        222822..223193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0200"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bch:Bcen2424_0293
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13895"
FT                   /protein_id="ABX13895.1"
FT                   /translation="MSAAPMKSFRQVARRVVQGAVAASLVGAWAASAHAQAGDGLRVAR
FT                   SNACLGCHAVDRKLVGPSFKDIAARYKGDPQAVAKLSKKVKDGGSGVWGAIPMPAHPRM
FT                   SDADLRSVVEWVLAGAPQK"
FT   sig_peptide     222822..222929
FT                   /locus_tag="Bmul_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.873 at
FT                   residue 36"
FT   gene            223294..223369
FT                   /locus_tag="Bmul_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            223294..223369
FT                   /locus_tag="Bmul_R0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(223429..224826)
FT                   /locus_tag="Bmul_0201"
FT   CDS_pept        complement(223429..224826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0201"
FT                   /product="Glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bam:Bamb_0216 glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13896"
FT                   /protein_id="ABX13896.1"
FT                   /translation="MSEARHAGTPRVTRMQVIPVAGRDSMLLNLCGAHAPYFTRNLVIL
FT                   DDSSGRTGVGEVPGGEGIRHALERMTDLVVGQPIGRYQATLNAVRAALSGAAAGAGRTI
FT                   RHEVTSAGEAAVLRQPHEINLRLDNVITAIEAALLDLLGQYLDVPVAALLGEGQQRDAV
FT                   PMLAYLFYIGDRRRTDLPYRDEAHASDPWFRLRNDEALTPAAIARQAEAAVERYGFADF
FT                   KLKGGVMDGADEMEAIAAIKARFPDARVTLDPNGAWSLDEAIALCRGQGHLLAYAEDPC
FT                   GPEAGYSGREVMAEFRRATGIPTATNMIATDWRQMDHAVRLQAVDIPLADPHFWTMQGS
FT                   VRLAQLCRDWGLTWGSHSNNHFDVSLSMFTHAAAAAPGTITAIDTHWIWQEGDARLTRE
FT                   PLEIVGGKVAVPERPGLGIELDLAQVEAAHALYRQVGGTARDDAVAMRYLVPGWTYDPK
FT                   RPSFGRR"
FT   gene            complement(224885..226225)
FT                   /locus_tag="Bmul_0202"
FT   CDS_pept        complement(224885..226225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0202"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: General
FT                   substrate transporter; major facilitator superfamily MFS_1;
FT                   KEGG: bur:Bcep18194_A3397 D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13897"
FT                   /protein_id="ABX13897.1"
FT                   /translation="MNPLHALPASASATARRTRVRWLVLTVLFAVTTINYADRAAISIA
FT                   GPSLARALHLNHVQIGFIFSAFGWSYVVAQLPGGWLLDRYGSRIVYAFSIFFWSLFTLL
FT                   QGAIGFFGGAAAFALLFGLRFLVGAAEAPSFPANSRIVSAWFPAAERGTASAIFNAAQY
FT                   AATVVFAPLMGWLVHAFGWQSVFAVMGVLGFAFVAVWRRTVYDPKDHPQINRAELDYLA
FT                   DGGALVNIDQTSGARDGGPSLRHVKALLKSRMLIGVYVAQYCINALTYFFITWFPVYLV
FT                   QARGMSILNAGLVASIPAVCGFLGGILGGIVSDALLRHGRSLSVARKVPIVFGMLLSMS
FT                   MIVCNYTDSHVLVVLFMALSFFGKGLGALGWAVNADTAPRQIAGLSGALLNTCGNLSSI
FT                   TTPIAIGYIVDRSGSFNGALVYVGAHALVAVICYLFVVGEIRRVELR"
FT   gene            226516..227151
FT                   /locus_tag="Bmul_0203"
FT   CDS_pept        226516..227151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13898"
FT                   /protein_id="ABX13898.1"
FT                   /translation="MTATPFLPSYTAFDGHRRIASGPLATVALAVKCIAGDGMAGTVLI
FT                   FDDATGRSIDLDLRGTADEVRARYAPPARDVAQDAGTAGDPAGAAEQRGRGRPKLGVVS
FT                   REVTLLPRHWDWLAAQPGGASVALRKLVEDARRTHAAADRRRDAQARAYHFMSALAGDL
FT                   PGFEEATRMLYANDLTRMAERIAGWPDDVRDHALALARGELPPSTEAC"
FT   gene            complement(227176..228342)
FT                   /locus_tag="Bmul_0204"
FT   CDS_pept        complement(227176..228342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0204"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bch:Bcen2424_0301 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13899"
FT                   /protein_id="ABX13899.1"
FT                   /translation="MAIPLTYIARNLWARRLTTALTAGGMALVIFVFATVLMLDAGLTQ
FT                   TLVSTGEPDNVVVIRKGAETEIQSAIDHQQANALEMHPAVALGADGRPLVSKEAVVLIS
FT                   LVKTSTGKPSNVVIRGVSPAGLALRPRVQLKAGRMFAPGSSEIIVGSAVAKGFSGTQLG
FT                   DRLHFAQRDWTIVGVFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMVLRIPSADGFARF
FT                   KADIDVDPRLTDEAKREQTFYGDQSKALSTFINILGITLSTIFSIAAMIGATITMYASV
FT                   ANRTAEIGTLRALGFKRANVLAAFLLEALLLGFVGGVAGLACASLMQFASFSTTNFQTF
FT                   SDLSFRFVLTPAIVVKTLLFSLVMGLVGGFLPALRAARLNIVDALRAR"
FT   sig_peptide     complement(228238..228342)
FT                   /locus_tag="Bmul_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.589 at
FT                   residue 35"
FT   gene            complement(228353..229507)
FT                   /locus_tag="Bmul_0205"
FT   CDS_pept        complement(228353..229507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0205"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bch:Bcen2424_0302 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13900"
FT                   /protein_id="ABX13900.1"
FT                   /translation="MFVLKLIARNALRHRLRTLLTVLGLTIAVLAFGLLHTVVDAWYAG
FT                   AAAASSGRLVTRNAISLVFPLPVSYENRIRGVDGVTAIVRSNWFGGIYRDPKNFFASFA
FT                   VSDNYLDLYPEFIVPAQQRADYARDRRGCLVGRQLATQFGFKVGDVIPLKGTIYPGTWD
FT                   FVVRGILDGRDESTITRQLVFHWDYLNETVRQRTPKQADQVGVFVLGVANPDDGAAIAR
FT                   NVDATFRNSLAETLTETEQAFQLGFVAMSNQIIAAIRLVSYVVILIIMAVMANAMAMSA
FT                   RERTAEYATLKALGFGPGFLALLVFGESVVIAAIGGSLGILATPPAASLFKQAAGGIFP
FT                   VFHVSARTLALQAACSVAVGVAAALVPAWQAARVRVVEGLRAIG"
FT   sig_peptide     complement(229394..229507)
FT                   /locus_tag="Bmul_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.478 at
FT                   residue 38"
FT   gene            complement(229529..230227)
FT                   /locus_tag="Bmul_0206"
FT   CDS_pept        complement(229529..230227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0206"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0303 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13901"
FT                   /protein_id="ABX13901.1"
FT                   /translation="MSAAPPPLVEISHVAKSYRRGSQVVPVLTDITLDIGEGDFVALMG
FT                   PSGSGKSTLLNLVAGIDRPDAGELRVGGLDITQLAEAQLAEWRAANVGFIFQFYNLMPV
FT                   LTAFENVELPLMLTPLSRRERRERVELVLDMVNLGERTAHYPSELSGGQQQRVAIARAL
FT                   ITDPALIVADEPTGDLDRASATDVLAMLQRLNAELGKTIIMVTHDAHAAAAAKSLVHLE
FT                   KGELIDGHAR"
FT   gene            complement(230229..231431)
FT                   /locus_tag="Bmul_0207"
FT   CDS_pept        complement(230229..231431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0207"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_A3403 secretion protein HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13902"
FT                   /protein_id="ABX13902.1"
FT                   /translation="MPDHNLDKLKIDRGPIAAPRRRRWVRYAAVAALAVVALLAGLTVT
FT                   RRPTVDTTAVTSAYPYQNDTQLNATGYVVPQRKAAVASKGQGRVEWLGVLEGTRVKKDE
FT                   IIARLESRDVEASLAQALAQVKVARANLGVQQAELKDAEIALRRTAALAPRGAVPAAQL
FT                   DTDTARVNKARASVNSGEAAVASAEANARAAQVAVDQTVIRAPFDGIVLAKHANVGDNI
FT                   TPFSSASDSKGAVVTIADMDTLEVEADVAESNIAKIRAGQPCEIQLDALPDMRFAGRVS
FT                   RIVPTVDRSKATVLVKVRFVDRDDRVLPDMSAKIAFLSKPVSAQDRQPVTAVQASAVVE
FT                   RDGRPVVFALQDDTVHAVPVARGARIGELVAVRGVKPGDTVVLAPGAALKDGAKVTVAK
FT                   K"
FT   gene            231742..232008
FT                   /locus_tag="Bmul_0208"
FT   CDS_pept        231742..232008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13903"
FT                   /protein_id="ABX13903.1"
FT                   /translation="MNFFSAKGRTMKKTLASIMTAAFALASVSAFAQASAPAADTSASA
FT                   PAPAKKKDHSKPKHQLKHHGSAKGKAKAAAASAAGTNDAGTQN"
FT   sig_peptide     231742..231840
FT                   /locus_tag="Bmul_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.872 at
FT                   residue 33"
FT   gene            complement(232083..232823)
FT                   /locus_tag="Bmul_0209"
FT   CDS_pept        complement(232083..232823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0209"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   bch:Bcen2424_0306 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13904"
FT                   /protein_id="ABX13904.1"
FT                   /translation="MATATFRFHGELNAFLAREQRERAFAHACARDATVKHAIEALGVP
FT                   HTEIGRLSVNDAPAALERRVDDGDRIDVYPERARGAASAPPPDAWRFVADAHLGGLAQL
FT                   LRLAGFDTRYDNHFRDDEIAALAEREGRIVLTRDRELLKRRAIVRGCYVHAQQPAEQLR
FT                   ELFARLDLAPHMQPFRLCLRCNAPLHALDAAAAAPRVPPGVRQRHRRFAACDVCRRVFW
FT                   EGSHWRRMQALVEAMRAQPGASGG"
FT   gene            232938..233807
FT                   /locus_tag="Bmul_0210"
FT   CDS_pept        232938..233807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0210"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   bch:Bcen2424_0307 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13905"
FT                   /protein_id="ABX13905.1"
FT                   /translation="MDLGFIGLGEMGQAIATNLLKAGHTVRVWNRSRDRAAPLAALGAQ
FT                   IVDAPADAFRGDAVFSMLADDAAARAVFDDALLAQAPRGLIHVNMATISVALAESLAHA
FT                   HASRGLQYVAAPVMGRPDVAAAGRLTIMAGGPAEAIDRVQPLFDAIGQKTWRFGALPQH
FT                   ANVAKIAANFTLASAIETLGEASALLGAHGVAMRDFLDVITHSVFPGPVYEGYGAMIAE
FT                   RRYEPARFKARLGLKDVRLALEAGDAASVPLPVASVVRDSLLDVLAHGGGDLDFAALGD
FT                   AALRRAAR"
FT   gene            233884..234522
FT                   /locus_tag="Bmul_0211"
FT   CDS_pept        233884..234522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0211"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bvi:Bcep1808_0290 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13906"
FT                   /protein_id="ABX13906.1"
FT                   /translation="MNLHTWWLFVATVFVVSAIPGPNMLLVMTHGARHGLRRSAATMAG
FT                   CLSALVLMLSVSAAGLGVFLEAWPAMFNALRFAGAAYLIYLGVKAWRASADDVPAADAE
FT                   PALRHAANASRWALFRNGFLVAGSNPKAILFAAALLPQFINAAEPTLPQFGMLVVTFAV
FT                   IEVSWYLVYASFGTRIGATLKSRSVAKIFNRLTGGLFVGFGAMMALVRH"
FT   sig_peptide     233884..234060
FT                   /locus_tag="Bmul_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.618) with cleavage site probability 0.391 at
FT                   residue 59"
FT   gene            complement(234598..235881)
FT                   /locus_tag="Bmul_0212"
FT   CDS_pept        complement(234598..235881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0212"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_0309 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13907"
FT                   /protein_id="ABX13907.1"
FT                   /translation="MNCPAPSCPGAARAAHDARPTLSAGMTLFFAATVGVIVIDLFAAQ
FT                   PLTGPISADLQLPASLAGLVAMLPQLGYAAGLALLVPLVDLLENRRVIVATLAVCAAML
FT                   ALPAVTHSGTVFLCATLIAGAASSVIQMLVPMAASMAPEAQRGRAVGNVMSGLMLGILL
FT                   SRPLASLIAGSIGWRAFYALAAAADVAIAAVLALRLPTRTPPVTASYRALLASMGRLLA
FT                   DEPVLRRHALSAALAMAAFSAFWTAIGLRLAQPPFGLDLHGIALFAFAGASGAIVTPLA
FT                   GRAGDSGRGPLAQRAAFGAMLAALVVLGIAGAGWLGFDAHAHRGLALALLAGGAALLDA
FT                   GVIVDQTLGRRAINLLNPAARGRLNGLFVGLFFVGGAIGAALAGSAWAWGGWSAVCTVA
FT                   LVFAGASGLAGRSAVRATGSAALPDTQT"
FT   gene            235979..236908
FT                   /locus_tag="Bmul_0213"
FT   CDS_pept        235979..236908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0213"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_0229 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13908"
FT                   /protein_id="ABX13908.1"
FT                   /translation="MNTRDLQAFVAVVDSGSMVAAATRLHLTQPGLTRRVQNLETLLGV
FT                   PLLDRQSKPLKPTAAGRDVYALARNVLSAVDALLAAGTPDSEPTGELRIGVPPFLSELA
FT                   LEQPIDRLREAFPRLTLRVTAGWSPALLQGVERGTLDMATVMVPVGTTLPDTLSATRLG
FT                   TQPTVLVAARDFPLPDGPLTLDALSRFPWVLSQDGCGMRSALSRALGAAGLPFDVAVEA
FT                   FGSELQLSLVARGAGIGIAPPNALARSAHRDALKIVPTEGLDTRIGVWMVHGALPGRLM
FT                   RPAALLREALGAVLAREIETGSDVSATA"
FT   gene            complement(237122..237955)
FT                   /locus_tag="Bmul_0214"
FT   CDS_pept        complement(237122..237955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0214"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bur:Bcep18194_A3410
FT                   OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13909"
FT                   /protein_id="ABX13909.1"
FT                   /translation="MKKTFLCAAAGAAALAPLAAHAQSAGSNVVTLGWFHVMPQQSSTP
FT                   MTTNVAPTPINTPLRLPPSFTSPGTGLHTSGADTVGLTVSHFLTDHIAVTSVAGVPPVF
FT                   KVSGKGTINPPGPAGALGTQNIGIAAVNPIVKSVRQWSPAVLLQYYFGQATARFRPFLG
FT                   LGVSYNWFSDLQLNSNFIKQTQDNLGAILAAGAGKPGTTSVEAKASSSWQPVFNAGVQY
FT                   NMTEHFGLVASVTYIPLKTTSTVTIKAADGTVLAESKSELKADPIISYVGLTYKF"
FT   sig_peptide     complement(237887..237955)
FT                   /locus_tag="Bmul_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(237971..239218)
FT                   /locus_tag="Bmul_0215"
FT   CDS_pept        complement(237971..239218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13910"
FT                   /protein_id="ABX13910.1"
FT                   /translation="MKRNLVLAAAFAAPLLSACGGGGAGDNPPPLVEERLCPATLDYNT
FT                   VYTGGAGSGELVKLQLDTTKMTWQVTYVESPVPRTTGTVTPTRAGTVDSGTLTQETLLP
FT                   TNKLNQCAFRLNGASLDASRPARIFVGYGVAGGTIPGKEIQFGGVLGQAAVPDTKFPYY
FT                   PFIGFSQIETNIANVAGTYSHVGFGEVPSQNFAPVSIDAKVTINADGTWSKCDSTGQFA
FT                   GAACVQRGTNFVQSADGSGAFETDHYQSQIKPTLSATPQGKGFMVVGKLRNQLVPILVR
FT                   TGVANPNPTPDSNGVPGLTADDESSISILAPQTAVSVGSQNGEYIGVDSQFDYRTTALI
FT                   NAQATLLDPFQPSQASLATALDLDYTQKVPGTVTTIHTGSGSTSPTGKFIFTGGVFGFL
FT                   DNAGSTPYFTIGAFVQ"
FT   sig_peptide     complement(239144..239218)
FT                   /locus_tag="Bmul_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 25"
FT   gene            complement(239359..240792)
FT                   /locus_tag="Bmul_0216"
FT   CDS_pept        complement(239359..240792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13911"
FT                   /protein_id="ABX13911.1"
FT                   /translation="MSHTLSKGVATAFAIAPLLVACGGGDSGGSLAPIDAPQCSGSSCG
FT                   TQGPPPSQPVNGALCPANADIVKSTYLGGAGSGEIVSVNIDAVAMTYTLKWLESPIPLK
FT                   TGNVTPSRAGTTITGKVVHPPAGTLPTAEQTRCAFVLTPGTGTAPDGSTYSTAADFNQA
FT                   NPPMLLVGMGVAGGGIPGATVQYDGLTISVIGFPVFKNVGQVPNRHFDFYPFLGFANTT
FT                   TDLTKLPGTYNALIYHLVPSGDYATKGTNSSETFDANGACTSTGGTCQTTGDPWTVNTA
FT                   NGGYLDSKNAPQILPQTKLPLIGATGKSASAHMVIGQLNGATVPVIVRTGSVYLGTDAA
FT                   VHTDAKVDDESGIAVLGAASTIQSGAIDGGYAGADSNFKYTAALIRGSNASFINPSTQA
FT                   EEDGFTLDYGQSTPGLLAATTTPASGASYPSASGVVIATGGLYAALVQGTVNGGVTSTS
FT                   ANATTSSTPYFGVGAQISK"
FT   sig_peptide     complement(240727..240792)
FT                   /locus_tag="Bmul_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.353 at
FT                   residue 22"
FT   gene            complement(241226..242221)
FT                   /locus_tag="Bmul_0217"
FT   CDS_pept        complement(241226..242221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0217"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: bcn:Bcen_2792
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13912"
FT                   /protein_id="ABX13912.1"
FT                   /translation="MSVFGPRRPRFSESEMSTKVFVDGQEGTTGLKIFEYLSARNDIEI
FT                   LRIDEAKRKDVDERRRLINASDVTFLCLPDVASRESASLVENPATTLIDASTAFRTHAD
FT                   WAYGLPELARGQREKIRTSKRIAVPGCHASAFVLAMRPLVEAGIVAPTFAAHSYSITGY
FT                   SGGGKSMIADYENAAPGGKLASPRAYALGLTHKHLPEMAAHTGLANPPIFTPIVGPFLK
FT                   GLAVTTYFTPEQLAKRATPQDVQRVFAEYYADEPFVRVAPFNADANLDGGFFDVQANND
FT                   TNRVDLFVFGNEERFVTVARLDNLGKGASGAAIQCMNINIGAAEDTGLKR"
FT   gene            complement(242371..242961)
FT                   /locus_tag="Bmul_0218"
FT   CDS_pept        complement(242371..242961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0218"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: bam:Bamb_0235 YbhB
FT                   and YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13913"
FT                   /protein_id="ABX13913.1"
FT                   /translation="MRVDRRIAPPAPSGRPRAFVVTAACAMLACAFAHAQAPFTVSSED
FT                   LTPGGRVGTANLFDRGDCKGENRSPQLSWRNPPPGTQGYAVTMFDPDAPGRGWWHWAVT
FT                   GIPRTVTSLPADASASGFLRRIGASEARNDFGTDGYGGPCPPPGRPHRYVITVYALKAT
FT                   DLRVAQGRPAPMFEHEIGTETIGTARLVVHYGQ"
FT   sig_peptide     complement(242854..242961)
FT                   /locus_tag="Bmul_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 36"
FT   gene            complement(243187..243873)
FT                   /locus_tag="Bmul_0219"
FT   CDS_pept        complement(243187..243873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0219"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: bam:Bamb_0236 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13914"
FT                   /protein_id="ABX13914.1"
FT                   /translation="MTGYDRQSISDTTAKILLEVQAVHFNAEKPFIFTSGWASPVYIDC
FT                   RKLISYPRVRRALMEMAETTIMRDVGFEQIDAVAGGETAGIPFAAWIADRMMLPMQYVR
FT                   KKPKGFGRNAQIEGHLEEGSRVLLVEDLTTDSRSKINFVNALRTAGAKVNHCFVLFHYN
FT                   IFKESVSVLKDIDVDLHALATWWDVLRVAKASGYFETKTLDEVEKFLHAPAEWSAAHGG
FT                   ATGAQE"
FT   gene            244331..246601
FT                   /locus_tag="Bmul_0220"
FT   CDS_pept        244331..246601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0220"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   bam:Bamb_0237 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))/phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13915"
FT                   /protein_id="ABX13915.1"
FT                   /translation="MDEQLKQAALAYHQNPKPGKISVTPTKPLSNQLDLSLAYSPGVAA
FT                   ACEAIHADPLDAQKYTSRGNLVGVVTNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGI
FT                   DVFDIELSESDPDKLVEAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQ
FT                   HGTAIIASAAILNGLKVVGKNLADVKLVCSGAGAAAIACLDLLVNLGLTKSNILVTDSK
FT                   GVIYEGRGNLDPSKQRYAATTDARTLADAIVGADVFLGCSSAGVLKQDMVKAMADKPLI
FT                   LALANPEPEIRPEDAKAVRPDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEE
FT                   MKLACVRAIAELAQETDQSEEVAKAYEGHSLEFGPEYLIPKPFDPRLIIKIAPAVAQAA
FT                   MDSGVATRPIQDMDAYREQLGATVYRTGMVMRPVFATAKKAAARIVFAEGEDERVLRAA
FT                   QFVLLEKIAKPIIIGRPSVVEMRLAKIGSKLKAGVDFEIVNPEDDTRYHRYWQAYHGIG
FT                   ARDGVTPEVAKAALRKFNTLIGAMLVHLGDADGMICGMIDTYHSHLKFIEQVLGRAKGA
FT                   EHFAAMNLLMLPGRNLFVCDTYVNELPSAEQLADMTIQAAAEIERFGIVPKAALLSNSN
FT                   FGSAPSASSRRMAEARKLIVERAPNLEVDGEMHGDAALSEAVRKAAFPGTTLSGEANLL
FT                   IMPNVEAANIAYNLLKMVGGEGVTVGPFLLGAAKPVHILTPAATVRRIINMTAVAAANV
FT                   NTK"
FT   gene            complement(246743..250333)
FT                   /locus_tag="Bmul_0221"
FT   CDS_pept        complement(246743..250333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0221"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: bam:Bamb_0238 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13916"
FT                   /protein_id="ABX13916.1"
FT                   /translation="MNAPLDAGQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRLP
FT                   MLQQERDRAAGLNTAGFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAATA
FT                   VWGSQQVNLYPGAKYDGVFGMWYGKGPGVDRTGDVFKHANSAGSSKHGGVLVLAGDDHA
FT                   AKSSTLAHQSEHIFKACGLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVES
FT                   SASVDIDPHRTEILLPTDFVMPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLD
FT                   RIEIDSPHARFGIMTGGKAYLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQ
FT                   AFARGLDEILVVEEKRQILEYAIKEELYNWPDAQRPRVYGKFDEKDGAGGEWSVPMGNW
FT                   LLPAHYELSPAIIAKAIATRLEKFELPSDVRARIAARIAVINAKEMALAKPHVQTERKP
FT                   WFCSGCPHNTSTNVPEGSRAIAGIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDE
FT                   KHVFANLGDGTYFHSGLLAIRAAISSKANITYKILYNDAVAMTGGQPVDGVLTVPQITH
FT                   QLASEGAKKIVIVTDEPEKYDSQKALLAPGVTIHHRDQLDDVQRELREIEGTTILIYDQ
FT                   TCATEKRRRRKRGAYPDPAKRVVINEAVCEGCGDCSVQSNCLSVEPLETEFGTKRQINQ
FT                   SSCNKDFSCVKGFCPSFVTVEGGQLKKPKAVAVDGSALPPIPEPALPAIDRAYGVLVTG
FT                   VGGTGVVTIGALLGMAAHLENKGVTVLDVTGLAQKGGAVMSHVQISHTPTDIHATRIAM
FT                   GEADLVIGCDAIVTAGDECTSRMRHGATRVVVNSAQTPTAEFIKNPNWAFPGVSAEHDI
FT                   RTAAGDMVDFVDANRFAVALLGDAIYTNPFVLGYAWQKGWLPLTLASLQRAIELNGVSV
FT                   DKNRAAFEWGRRAAHDLASVPQAAAGEPRTAQGATVIALHTKKAVDALIAKRVEFLTAY
FT                   QNAGYAARYAAFVDKVRAAERALADGDAMQEPLTEAVARNLFKLMAYKDEYEVARLQSD
FT                   PAFLARLSAQFEGDWKLKFHLAPPLFAKKDAHGHLVKKAYGPWMMSAFRLLAKAKFLRG
FT                   TAFDPFGRTEERRTERALIGEYEALIDEVLAKLTAGNRPLAVELASLPDGIRGYGHVKD
FT                   NNLRAVRQKWNTLLAQWRSPTGGQSRQQVA"
FT   gene            250653..250847
FT                   /locus_tag="Bmul_0222"
FT   CDS_pept        250653..250847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13917"
FT                   /protein_id="ABX13917.1"
FT                   /translation="MNTRHIQSFLIVSAAFFAMTGPVRAQGASALAAAGAQMRQTASAQ
FT                   NADAQPAVARAAASKASVR"
FT   sig_peptide     250653..250730
FT                   /locus_tag="Bmul_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 26"
FT   gene            complement(250987..252084)
FT                   /locus_tag="Bmul_0223"
FT   CDS_pept        complement(250987..252084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0223"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: bvi:Bcep1808_0303 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13918"
FT                   /protein_id="ABX13918.1"
FT                   /translation="MQIPTWDNPVGTDGFEFIEYTAPDPKALGQLFERMGFTAIARHRH
FT                   KDVTVYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYKRALELGAWGF
FT                   DNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAQPGAIGDISIYDVDFEPIPGAEPNP
FT                   VGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGK
FT                   IRIPINEEGSDTAGQIQEYLDAYHGEGIQHIALGTNNIYGAVDGLRSKEVKLLDTIDTY
FT                   YELVDRRVPNHGESLEELKKRKILIDGARDDLLLQIFTENQIGPIFFEIIQRKGNQGFG
FT                   EGNFKALFESIELDQIRRGVVQDKA"
FT   gene            252153..252809
FT                   /locus_tag="Bmul_0224"
FT   CDS_pept        252153..252809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0224"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bmv:BMASAVP1_A3119 putative leucine-responsive regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13919"
FT                   /protein_id="ABX13919.1"
FT                   /translation="MARETIEYVRQSVAGRVERKLANLVARSYDGAISSLETTFGGQKM
FT                   AQVELDAIDRRILAILQENGRLSNQEIAERVNLSPSPCLRRIRRLEEIGVITGYVALLD
FT                   PQKLGLDLLAYVSVRLEKRGGVVPVRADETAARAGATHAELFRAAVQAWPEVVACHAMT
FT                   GDMDYLLRVQVEDMAHFSRFVQEQLLHHPSVIDVKTSFSLECFKETTALPIRSMR"
FT   gene            complement(252883..253530)
FT                   /locus_tag="Bmul_0225"
FT   CDS_pept        complement(252883..253530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0225"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_A3422 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13920"
FT                   /protein_id="ABX13920.1"
FT                   /translation="MNTQFHGSADVVGTAGNAPVLVRELASKDREQMLTHFLSLNEDDR
FT                   LLRFGQMVPDHVIENYVRTIDFGRDTVFGVFDHDLELIGVGHLAYLPADGDKRTAEFGV
FT                   SVLERARGRGVGTKLFERAAIRSRNTRVTTLYMHCLSRNATMMHIAKKSGMRIEYAYGE
FT                   ADAYLSLAPADHSTILAEMLQEQAAVFDYAMKRQAHRASKFIESLMPAALSA"
FT   gene            complement(253763..254368)
FT                   /locus_tag="Bmul_0226"
FT   CDS_pept        complement(253763..254368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0226"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_0324 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13921"
FT                   /protein_id="ABX13921.1"
FT                   /translation="MARTRAPDHESQREQILDLAAEKFAQTSYPSTSMSDLATASGTSK
FT                   ARLYHYYESKEAILFDLLDRYTKRLMLIIAEVEGTSQRRGLSEREAFAELVRAFLAEYE
FT                   TSHSRHVALLNDVKYLEDAQREIVLDRQRDIVAAFARQLARAYPDRISKENQTSVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIDMIERGLSSAA"
FT   gene            complement(254385..255209)
FT                   /locus_tag="Bmul_0227"
FT   CDS_pept        complement(254385..255209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0227"
FT                   /product="Domain of unknown function DUF1835"
FT                   /note="PFAM: Domain of unknown function DUF1835; KEGG:
FT                   bch:Bcen2424_0325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13922"
FT                   /protein_id="ABX13922.1"
FT                   /translation="MSTIHVIQGGTAAASLREALAAAGRDERVVGLLDDLGVGPLKGAD
FT                   ETSDVRAAFWQRVLGDQIPDWKAEIEGEFARLDELATDTGQVVVWHAPCVGDKLLLRRV
FT                   AYHLRSVPQRLNEVRLSAADLDATQRTALARADHACSTGMFSPTQLGKRRPAAAPISVL
FT                   RIGRLALEWQEAKHLNAELRYWISNTIKSGHYADLDAQIVARASTDWQPARQLVGRIMA
FT                   EADRGGLFVSDAVAWWRCRELAAVGRLELQDDAPAALSVTHVRAARAANASR"
FT   gene            complement(255341..256429)
FT                   /locus_tag="Bmul_0228"
FT   CDS_pept        complement(255341..256429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0228"
FT                   /product="phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit; PFAM: ferredoxin; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein; KEGG: bch:Bcen2424_0326
FT                   phenylacetate-CoA oxygenase/reductase, PaaK subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13923"
FT                   /protein_id="ABX13923.1"
FT                   /translation="MATPQFHPLRIRDVRPETADAVTVSFEVPPELRDAYRFTQGQFVT
FT                   LKTHIDGEETRRSYSICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDTLKPGHTIDVMT
FT                   PDGRFFTHLNADHGKQYVAFSGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDAIMF
FT                   AEELEDLKNRYMNRFVLYHVLSDDLQDVELFNGVLDQAKCAAFLDTLVPADSIDEAFIC
FT                   GPAPMMDAAEAALKAAGVPPAKVHVERFGTPLPQAGVPVVEITEQTPAADLEIVLDGKK
FT                   RKLRLPYEGVSLLDVGLRAGLALPYACKGGVCCTCRAKVLEGEVRMEKNYTLEEHEVND
FT                   GFVLTCQCHPVSDKVVVSFDER"
FT   gene            complement(256431..256994)
FT                   /locus_tag="Bmul_0229"
FT   CDS_pept        complement(256431..256994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0229"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaJ subunit;
FT                   PFAM: protein of unknown function DUF59; KEGG:
FT                   bch:Bcen2424_0327 phenylacetate-CoA oxygenase, PaaJ
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13924"
FT                   /protein_id="ABX13924.1"
FT                   /translation="MSIETAAPTHAAPGAHHDDPLLARAWDVLEAVPDPEIPVVSIREL
FT                   GILRDVRRAADGTLEVVITPTYSGCPAMSQIAEDIAAALQGAGLPSHRIETVLAPAWTT
FT                   DWITQDAREKLRAYGIAPPVGQCGRAAPRENVVRFVPRPVAAPVCPRCGSANTERLAQF
FT                   ASTACKALYRCVDCREPFDYFKPY"
FT   gene            complement(257017..257820)
FT                   /locus_tag="Bmul_0230"
FT   CDS_pept        complement(257017..257820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0230"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaI subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bam:Bamb_0247 phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13925"
FT                   /protein_id="ABX13925.1"
FT                   /translation="MTITPEHLSYVLRLADNALILGQRNAEWCGHGPVLEEDIALTNMS
FT                   LDLIGQARMLYTHAAELERQLNGATKTEDDYAYFRTEREFANFTLAELPHYGPLAGTAH
FT                   ADKDYAVTIVRNFLYATLMLHVWSALETSTDAQLAAIAAKSVKETRYHVQHAREWLVRF
FT                   GDGTDESHRRAQAALDYLMPYTREFFAADAIDAAVAAQGIGPAPASLEPAWRADVEAAL
FT                   VEATLALPAPVQHVPTGKQGEHSEHMGYLLAEMQSLARQHPGATW"
FT   gene            complement(257829..258113)
FT                   /locus_tag="Bmul_0231"
FT   CDS_pept        complement(257829..258113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0231"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaH subunit;
FT                   PFAM: phenylacetic acid degradation B; KEGG:
FT                   bur:Bcep18194_A3428 phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13926"
FT                   /protein_id="ABX13926.1"
FT                   /translation="MNKEWPIWEVFVRSKQGLDHKHCGSLHAADATMALRMARDVYTRR
FT                   QEGVSIWVVPSSAITASDPNEKAEMFEPAGDKIYRHPTFYTLPDEVNHM"
FT   gene            complement(258223..259221)
FT                   /locus_tag="Bmul_0232"
FT   CDS_pept        complement(258223..259221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0232"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaG subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bvi:Bcep1808_0312 phenylacetate-CoA oxygenase, PaaG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13927"
FT                   /protein_id="ABX13927.1"
FT                   /translation="MYTQSLDIPGNVAPLDAAAESPEQARFDAVMAADGKIEPQDWMPD
FT                   AYRKTLIRQISQHAHSEVVGMLPEGNWITRAPSLKRKAILLAKVQDEAGHGLYLYSAVE
FT                   TLGVSRESLIDALHAGKAKYSSIFNYPTPTWADVGVIGWLVDGAAIMNQVPLCRCTYGP
FT                   YARAMIRVCKEESFHQRQGFDALLTMMKGTDAQRAMVQQAVNRWWWPVLMMFGPSDADS
FT                   VHSHQSAKWGIKRISNDDLRQKFVDATVEQAKVLGVTLPDPDLKWNEARGHYDYGAIDW
FT                   DEFWRVVNGDGPCNKERLATRVKAHEDGAWVREAALAYEAKRRARAEQHAA"
FT   gene            259411..260676
FT                   /locus_tag="Bmul_0233"
FT   CDS_pept        259411..260676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0233"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bur:Bcep18194_A3430 lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13928"
FT                   /protein_id="ABX13928.1"
FT                   /translation="MSFRSSLAATVLGASVLLSPFAVCAAPAGWVAAWATALQPIPELA
FT                   SPPPLYRAPDVAGRTVRQIVYPTASGRAARIRVSNAYGRSPLVIEAASLGRAGEGAALA
FT                   DGAAAPVRFGGKASVTLAPGQELDSDPVALDVVAGRPYAISFHMGPKQRMTVWHRVSNQ
FT                   LNYVSSAGDHVNDAGAAAFRTRFTQYAWVTELAVEAGGAHASVAAIGDSITDGLRSSLN
FT                   RNRRWPDAFARRLADAGATSIGVVNLGISGNRLLSDSPCYGAALASRFERDALSRAGVK
FT                   AAIVLIGINDINFAAMPPRAGLDCDDPHTQVTAAALIDGYRRLIDAAHRRGVKVFGATL
FT                   TPADLPPAREAIRLEVNRWIRSGGAFDGVVDFDAALRDPARPSVLQHRYDSGDGIHPSD
FT                   AGYAAMAEAVPLERLKAIAAGE"
FT   sig_peptide     259411..259488
FT                   /locus_tag="Bmul_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            261319..262844
FT                   /locus_tag="Bmul_R0004"
FT   rRNA            261319..262844
FT                   /locus_tag="Bmul_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            262907..262983
FT                   /locus_tag="Bmul_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            262907..262983
FT                   /locus_tag="Bmul_R0005"
FT                   /product="tRNA-Ile"
FT   gene            263024..263099
FT                   /locus_tag="Bmul_R0006"
FT                   /note="tRNA-Ala2"
FT   tRNA            263024..263099
FT                   /locus_tag="Bmul_R0006"
FT                   /product="tRNA-Ala"
FT   gene            263392..266273
FT                   /locus_tag="Bmul_R0007"
FT   rRNA            263392..266273
FT                   /locus_tag="Bmul_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            266388..266500
FT                   /locus_tag="Bmul_R0008"
FT   rRNA            266388..266500
FT                   /locus_tag="Bmul_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            267591..267676
FT                   /locus_tag="Bmul_R0009"
FT                   /note="tRNA-Tyr1"
FT   tRNA            267591..267676
FT                   /locus_tag="Bmul_R0009"
FT                   /product="tRNA-Tyr"
FT   gene            267720..267793
FT                   /locus_tag="Bmul_R0010"
FT                   /note="tRNA-Gly1"
FT   tRNA            267720..267793
FT                   /locus_tag="Bmul_R0010"
FT                   /product="tRNA-Gly"
FT   gene            267819..267893
FT                   /locus_tag="Bmul_R0011"
FT                   /note="tRNA-Thr1"
FT   tRNA            267819..267893
FT                   /locus_tag="Bmul_R0011"
FT                   /product="tRNA-Thr"
FT   gene            267957..269147
FT                   /locus_tag="Bmul_0234"
FT   CDS_pept        267957..269147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0234"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG:
FT                   bmn:BMA10247_3476 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13929"
FT                   /protein_id="ABX13929.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGETAIMNLADALDTYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRVERGVIKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            269207..269282
FT                   /locus_tag="Bmul_R0012"
FT                   /note="tRNA-Trp1"
FT   tRNA            269207..269282
FT                   /locus_tag="Bmul_R0012"
FT                   /product="tRNA-Trp"
FT   gene            269326..269706
FT                   /locus_tag="Bmul_0235"
FT   CDS_pept        269326..269706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0235"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bur:Bcep18194_A3433
FT                   SecE subunit of protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13930"
FT                   /protein_id="ABX13930.1"
FT                   /translation="MANPSVETVNTSGDKLMLALGVLLVLAGFVGFFWLGNQQWYVRGA
FT                   ALAVGIIAGVAVGLMSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMA
FT                   IFLWLSDKSIEWVIFSVILGWK"
FT   gene            269708..270265
FT                   /locus_tag="Bmul_0236"
FT   CDS_pept        269708..270265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0236"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: bam:Bamb_0254 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13931"
FT                   /protein_id="ABX13931.1"
FT                   /translation="MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDKFGQ
FT                   ILVPTEEVVEVKGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRP
FT                   TPISPKEVEKIMSQMQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGTVEEVNYEKSRVR
FT                   VSVTIFGRSTPVELEFGQVEKV"
FT   gene            270406..270837
FT                   /locus_tag="Bmul_0237"
FT   CDS_pept        270406..270837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0237"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: bte:BTH_I3080
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13932"
FT                   /db_xref="GOA:A9ADI1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI1"
FT                   /protein_id="ABX13932.1"
FT                   /translation="MAKKIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQGMEPGLPVPVVITAYADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRA
FT                   QAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV"
FT   gene            270838..271536
FT                   /locus_tag="Bmul_0238"
FT   CDS_pept        270838..271536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0238"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: bam:Bamb_0256
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13933"
FT                   /db_xref="GOA:A9ADI2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI2"
FT                   /protein_id="ABX13933.1"
FT                   /translation="MAKISKRRQAFAAKVDRQKLYAIDDALALVKECASAKFNESIDVA
FT                   VQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQI
FT                   KAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIIHATIGRASFEPAALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGV
FT                   RVDQATLAAQ"
FT   gene            271842..272339
FT                   /locus_tag="Bmul_0239"
FT   CDS_pept        271842..272339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0239"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: bte:BTH_I3078
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13934"
FT                   /db_xref="GOA:A9ADI3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI3"
FT                   /protein_id="ABX13934.1"
FT                   /translation="MPLNREDKQAVVAEVAAQVAKAQTVVLAEYRGIAVGDLTTLRAKA
FT                   REQKVYLRVLKNTLARRAVEGTPFAPLAEQMTGPLIYGISEDAIAAAKVVNDFSKSNDK
FT                   LVIKAGSFDGKVMDKAGVQALASIPSREELLSKLLFVMQAPVSGFARALAALAEKKQAE
FT                   AA"
FT   gene            272403..272777
FT                   /locus_tag="Bmul_0240"
FT   CDS_pept        272403..272777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0240"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bpd:BURPS668_3755 50S ribosomal
FT                   protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13935"
FT                   /db_xref="GOA:A9ADI4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI4"
FT                   /protein_id="ABX13935.1"
FT                   /translation="MAIAKEDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPAG
FT                   GGAAAAAEEKTDFTVVLAEAGSNKVAVIKAVREITGLGLKEAKDLVDGAPKPVKEGVDK
FT                   AAAEEAKKKLEDAGAKVELK"
FT   gene            273156..277262
FT                   /locus_tag="Bmul_0241"
FT   CDS_pept        273156..277262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0241"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG:
FT                   bvi:Bcep1808_0322 DNA-directed RNA polymerase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13936"
FT                   /db_xref="GOA:A9ADI5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI5"
FT                   /protein_id="ABX13936.1"
FT                   /translation="MQYSFTEKKRIRKSFAKRPIVHQVPFLLATQLESFSTFLQADVPA
FT                   TQRKPEGLQAAFTSVFPIVSHNGFARLEFVSYALSAPAFNIKECQQRGLTYCSALRAKV
FT                   RLVILDKESPNKPVVKEVKEQEVYMGEIPLMTPTGSFVINGTERVIVSQLHRSPGVFFE
FT                   HDKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKAIGLTP
FT                   EQILANFFVFDNFTLMDEGAQLEFVPERLRGEVARFDITDRDGKVIVQKDKRINAKHIR
FT                   DLEAAKTKFISVPEDYLLGRVLAKNVVDGETGEVIANANDEITESVLEKLREAGIKEIQ
FT                   TLYTNDLDQGPYISSTLRVDETTDKTAARIAIYRMMRPGEPPTEEAVEALFNRLFYSEE
FT                   AYDLSKVGRMKFNRRVGRDEITGPMTLQDDDILATIKILVELRNGKGEVDDIDHLGNRR
FT                   VRCVGELAENQFRAGLVRVERAVKERLGQAESENLMPHDLINSKPISSAIREFFGSSQL
FT                   SQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSLALYAHLNEYGFLETPYRKVVDGKVTDQIDYLSAIEEGRYMIAQANAAIDDEGRL
FT                   TDELVSSREAGETMMVTPDRIQYMDVAPSQIVSVAASLIPFLEHDDANRALMGSNMQRQ
FT                   AVPCLRPEKPVVGTGIERTCAVDSGTTVQAFRGGVVDYVDAGRIVIRVNDDEAVAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPIVKMGDKVSRGDVLADGASTDLGELALGQNMLIAFMP
FT                   WNGYNFEDSILISEKVVADDRYTSIHIEELNVVARDTKLGPEEITRDISNLAEVQLGRL
FT                   DESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGM
FT                   SGTVIDVQVFTREGIQRDKRAQQIIDDELKRYRLDLNDQLRIVEGDAFQRLARMLVGKV
FT                   ANGGPKKLAKGTKIDQAYLEDLDHYHWFDIRLADDEAAAQLEAIKNSIEEKRHQFDLAF
FT                   EEKRKKLTQGDELPPGVLKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKIVPIEDMPYM
FT                   ADGRPADVVLNPLGVPSRMNVGQVLEVHLGWAAKGLGWRIGEMLQRQAKIEELRAFLTK
FT                   IYNESGRAEDLDSFSDDEILELAKNLREGVPFATPVFDGATEDEMAKMLDLAFPDDIAK
FT                   QLDMNPSKNQVRLYDGRTGEPFERRVTVGYMHYLKLHHLVDDKMHARSTGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVTGRTKVYENLVKGDHVIDA
FT                   GMPESFNVLVKEIRSLGIDIDLDRN"
FT   gene            277284..281525
FT                   /locus_tag="Bmul_0242"
FT   CDS_pept        277284..281525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0242"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: bvi:Bcep1808_0323 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13937"
FT                   /db_xref="GOA:A9ADI6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI6"
FT                   /protein_id="ABX13937.1"
FT                   /translation="MKALLDLFKQVQQEEVFDAIKIGLASPDKIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAYVVIDPGMTPLKARQIMTEE
FT                   DYYNKVEEYGDEFRAEMGAEGVRELLRAINIDEQVEQLRTELKNTGSEAKIKKYAKRLK
FT                   VLEAFQRSGIKPEWMILEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFNKLEVMGVATTIKAAKK
FT                   EVENQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDIVLGLYYATREA
FT                   INGKGEGLTFTGVSEVIRAYENKEVELASRVNVRITEMVRNEDKSEGAPEFVPKISLYA
FT                   TTVGRAILSEILPPGLPFSVLNKPLKKKEISRLINTAFRKCGLRATVVFADQLMQSGFR
FT                   LATRAGISICVDDMLVPPQKETIVGDAAKKVKEYDRQYMSGLVTAQERYNNVVDIWSAT
FT                   SEAVGKAMMEQLSTEPVIDRDGNETRQESFNSIYMMADSGARGSAVQIRQLAGMRGLMA
FT                   KPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDL
FT                   VVVEDDCGTSNGVAMKALVEGGEVVEALRDRILGRVAVADVVNPETQETLYEAGTLLDE
FT                   TAVEEIERLGIDEVRVRTPLTCETRYGLCASCYGRDLGRGTLVNVGEAVGVIAAQSIGE
FT                   PGTQLTMRTFHIGGAASRAAVASSVEAKSNGTVRFSPSMRYVTNAKGEQIVISRSGEAL
FT                   ITDDIGRERERHKIPYGATLLQLDGAAIKAGTQLATWDPMTRPIITEYGGTVKFENVEE
FT                   GVTVAKQIDDVTGLSTLVVIDAKRRGSQASKSVRPQVKLLDANGDEVKIPGTEHSVQIG
FT                   FQVGALITVKDGQQVQVGEVLARIPTESQKTRDITGGLPRVAELFEARSPKDAGILAEV
FT                   TGTVSFGKDTKGKQRLVITDLEGNQHEFLIAKEKQVLVHDGQVVNKGEMIVDGPADPHD
FT                   ILRLQGIEALSRYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQITDNGDSRFIPGE
FT                   QVERSDMLDENDRMIAEGKRPASYENVLLGITKASLSTDSFISAASFQETTRVLTEAAI
FT                   MGKRDDLRGLKENVIVGRLIPAGTGLAFHKARKAKEMSDRERFDQIAAEEAFDFGTPST
FT                   PAEEPQHPAAE"
FT   gene            281753..283600
FT                   /locus_tag="Bmul_0243"
FT   CDS_pept        281753..283600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0243"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: bch:Bcen2424_0342 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13938"
FT                   /protein_id="ABX13938.1"
FT                   /translation="MSRALEILDEVFGYSAFRGQQGEIVEHVASGGDCLVLMPTGGGKS
FT                   LCYQIPALMRREAGHGAGIVVSPLIALMQDQVAALREVGVRAAYLNSTLSGAEAAATER
FT                   ALREGEIDLLYVAPERLMTGRFLELLERAKIGLFAIDEAHCVSQWGHDFRPEYIQLSVL
FT                   HERFPTVPRIALTATADAITRDEIIHRLALDDARVFVSSFDRPNIRYRIVEKDNARAQL
FT                   LDFIRAEHTNADGTTDAGVVYCLSRRKVEETAEWLKAQGIRALPYHAGMDFEVRQKHQE
FT                   MFQREEGIVMCATIAFGMGIDKPDVRFVAHLDLPKSVEGYYQETGRAGRDGLPANAWMA
FT                   YGLGDVVQQRKMIDESDADDAHKRVQTSKLDALLGLCETISCRRVRLLNYFGEASQPCG
FT                   NCDTCLEPPASWDATREAQMALSCVFRAQRASGFNFGASHLIEILRGARTEKVLQRGHD
FT                   QLSTFGIGAALSEPEWRAIFRQLVAYGYLAVDHGGFGALVLTEAAKPVLKGDEKVTLRR
FT                   YVKPQRTRQSSGRSGTRVDPTAGMGTRERARWDALRAWRAETAKADGVPAYVIFHDATL
FT                   AEIARNAPETIDDLRHIPGMGVRKLERFGDEIIDVVESA"
FT   gene            283828..284208
FT                   /locus_tag="Bmul_0244"
FT   CDS_pept        283828..284208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0244"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: bam:Bamb_0262 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13939"
FT                   /db_xref="GOA:A9ADI8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI8"
FT                   /protein_id="ABX13939.1"
FT                   /translation="MPTINQLVRKGRQSETTKSKSPALQDCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDT
FT                   QGVKDRKQARSKYGAKRAKAAK"
FT   gene            284381..284851
FT                   /locus_tag="Bmul_0245"
FT   CDS_pept        284381..284851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0245"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: bte:BTH_I3072
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13940"
FT                   /db_xref="GOA:A9ADI9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADI9"
FT                   /protein_id="ABX13940.1"
FT                   /translation="MPRRREVPKREVLPDPKYGNVDVAKFMNMLMLSGKKSVAERIVYG
FT                   AFEQIQTKGGKDPLEVFTVALNNVKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMRWL
FT                   REAAKKRSEKSMALRLAGELSEAAEGRGGAMKKRDEVHRMAEANRAFSHFRF"
FT   gene            284975..287077
FT                   /locus_tag="Bmul_0246"
FT   CDS_pept        284975..287077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0246"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: bvi:Bcep1808_0327 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13941"
FT                   /protein_id="ABX13941.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRLRLK
FT                   ANPVPVVVPIGAEENFKGVVDLLKMKAIIWDEASQGTKFDYVDIPAELVDTCQEWREKM
FT                   VEAAAEANEDLMNKYLEEGDLPEADIIKALRDRTIACEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDFLPSPVDIPPVKGELDNGETAERKASDDEKFSSLAFKIMTDPFVGQLIFFRVYSGV
FT                   VNSGDTVLNSTKGKKERLGRILQMHANNREEIKEVRAGDIAAAVGLKEATTGDTLCDPA
FT                   NPIVLERMVFPEPVISQAVEPKTKADQEKMGLALNRLAQEDPSFRVQTDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEATVGKPQVAYRETIRSTAKDVEGKFVKQSGGRGQYGHAV
FT                   ITLEPNEQGKGYEFFDEIKGGVIPREYIPAVDKGIQDTLKSGVLAGFPVVDVKVHLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRKANPVVLEPMMAVEVETPEEYMGNVMGDLSGRRG
FT                   IVQGMEDMVGGGKIVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKHYAEAPRNVADAI
FT                   ISAKSK"
FT   gene            287120..288310
FT                   /locus_tag="Bmul_0247"
FT   CDS_pept        287120..288310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0247"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bte:BTH_I3084
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13942"
FT                   /protein_id="ABX13942.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGETAIMNLADALDTYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRVERGVIKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPKDKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            288597..288908
FT                   /locus_tag="Bmul_0248"
FT   CDS_pept        288597..288908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0248"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bte:BTH_I3069
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13943"
FT                   /db_xref="GOA:A9ADJ2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ2"
FT                   /protein_id="ABX13943.1"
FT                   /translation="MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTR
FT                   IQRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            289086..289736
FT                   /locus_tag="Bmul_0249"
FT   CDS_pept        289086..289736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0249"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bch:Bcen2424_0348
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13944"
FT                   /db_xref="GOA:A9ADJ3"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ3"
FT                   /protein_id="ABX13944.1"
FT                   /translation="MSLGLVGRKVGMTRIFTAEGDSIPVTVVDVSDNRVTQIKTVETDG
FT                   YTAVQVAFGSRRASRVTKPLAGHLAKAGVEAGEILKEFRIDAAKAAELSNGAIVGPDLF
FT                   EVGQKVDVQGVSIGKGYAGTIKRYNFGSGRASHGNSRSHNVPGSIGMAQDPGRVFPGKR
FT                   MTGHMGDVTVTVQNLEIARIDAERKLLLVKGAIPGAKGGKVFVTPAVKTKGAK"
FT   gene            289736..290356
FT                   /locus_tag="Bmul_0250"
FT   CDS_pept        289736..290356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0250"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   bvi:Bcep1808_0331 ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13945"
FT                   /db_xref="GOA:A9ADJ4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ4"
FT                   /protein_id="ABX13945.1"
FT                   /translation="MELKLLNENGQEGAVVNASDVVFGRDYNEALIHQIVVAYQANARQ
FT                   GNRAQKDREQVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSHKVNKK
FT                   MHRAGLCSIFSQLAREGRLSVVEDIVLEAPKTKLLADKFKAMGLDSVLIITDTVDENLY
FT                   LASRNLPHVAVVEPRYADPLSLIYFKKVLVTKAAVAQIEELLS"
FT   gene            290353..290667
FT                   /locus_tag="Bmul_0251"
FT   CDS_pept        290353..290667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0251"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG:
FT                   bur:Bcep18194_A3449 ribosomal L23 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13946"
FT                   /db_xref="GOA:A9ADJ5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ5"
FT                   /protein_id="ABX13946.1"
FT                   /translation="MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQ
FT                   EVKAAVELLFKVEVDSVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK
FT                   "
FT   gene            290670..291497
FT                   /locus_tag="Bmul_0252"
FT   CDS_pept        290670..291497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0252"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: bte:BTH_I3065
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13947"
FT                   /db_xref="GOA:A9ADJ6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ6"
FT                   /protein_id="ABX13947.1"
FT                   /translation="MAIVKVKPTSPGRRAMVKVVNKDLHKGKPHAALLDTQSSKAGRNN
FT                   NGRITTRHQGGGHKHHYRVIDFRRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGVTVGQQLMSGSEAPIRAGNTLPIRNIPVGTTIHCIEMLPGKGAQMARSAGTSAM
FT                   LLAREGVYAQVRLRSGEIRRVHIECRATIGEVGNEEHSLRQIGKAGANRWRGIRPTVRG
FT                   VAMNPIDHPHGGGEGRTAAGRDPVSPWGTPTKGFRTRRNKRTTTMIVQRRHKR"
FT   gene            291508..291783
FT                   /locus_tag="Bmul_0253"
FT   CDS_pept        291508..291783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0253"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bte:BTH_I3064 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13948"
FT                   /db_xref="GOA:A9ADJ7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ7"
FT                   /protein_id="ABX13948.1"
FT                   /translation="MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYISENMVGHKLGEFALTRTFKGHAADKKAKK"
FT   gene            291796..292125
FT                   /locus_tag="Bmul_0254"
FT   CDS_pept        291796..292125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0254"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: bte:BTH_I3063 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13949"
FT                   /db_xref="GOA:A9ADJ8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ8"
FT                   /protein_id="ABX13949.1"
FT                   /translation="MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAG
FT                   IVKKVVLSAIANAEHNEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHIT
FT                   VTVGN"
FT   gene            292137..292937
FT                   /locus_tag="Bmul_0255"
FT   CDS_pept        292137..292937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0255"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: bmn:BMA10247_3484 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13950"
FT                   /db_xref="GOA:A9ADJ9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADJ9"
FT                   /protein_id="ABX13950.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKK
FT                   KLKNASVGRVVIERPAKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIE
FT                   EIRKPETDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAED
FT                   KRPRRNARPGDRRPRRDGEGGAPGARRGAPRRGAGKPEDGKTGE"
FT   gene            292940..293356
FT                   /locus_tag="Bmul_0256"
FT   CDS_pept        292940..293356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0256"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: bch:Bcen2424_0355
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13951"
FT                   /db_xref="GOA:A9ADK0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK0"
FT                   /protein_id="ABX13951.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLY
FT                   EMDGVSEELAREAFRLAAAKLPIQTTFIVRQLGA"
FT   gene            293366..293560
FT                   /locus_tag="Bmul_0257"
FT   CDS_pept        293366..293560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0257"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: bam:Bamb_0275
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13952"
FT                   /db_xref="GOA:A9ADK1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK1"
FT                   /protein_id="ABX13952.1"
FT                   /translation="MKASELLQKDQAALNKELADLLKAQFGLRMQLATQQLTNTSQLKK
FT                   VRRDIARVRTVMTQKANQK"
FT   gene            293557..293829
FT                   /locus_tag="Bmul_0258"
FT   CDS_pept        293557..293829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0258"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: bpd:BURPS668_3737
FT                   30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13953"
FT                   /db_xref="GOA:A9ADK2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK2"
FT                   /protein_id="ABX13953.1"
FT                   /translation="MNDSVKTSLKRTLIGRVVSNKMDKTVTVLVEHRVKHPIYGKYVVR
FT                   SKKYHAHDEANTYNEGDLVEIQETRPVSKTKAWAVARLVEAARVI"
FT   gene            294022..294510
FT                   /locus_tag="Bmul_0259"
FT   CDS_pept        294022..294510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0259"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bte:BTH_I3058 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13954"
FT                   /db_xref="GOA:A9ADK3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK3"
FT                   /protein_id="ABX13954.1"
FT                   /translation="MAGFVCRRCCSNPSSRSADGTKTDRMHHGGASGLSWERQTMIQTE
FT                   SRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVR
FT                   TAKGVRRQDGSLIKFDGNAAVLLNNKLEPIGTRIFGPVTRELRSERFMKIVSLAPEVL"
FT   gene            294520..294828
FT                   /locus_tag="Bmul_0260"
FT   CDS_pept        294520..294828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0260"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: bam:Bamb_0278 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13955"
FT                   /db_xref="GOA:A9ADK4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK4"
FT                   /protein_id="ABX13955.1"
FT                   /translation="MNKIRKGDEVIVIAGKDKGKRGVVLAVAADRVTVEGINLVKKHVK
FT                   PNPMKGTTGGVEAKTMPLHISNVAVVDANGKASRVGIKVEEGKKVRFLKTTGAVLSA"
FT   gene            294845..295384
FT                   /locus_tag="Bmul_0261"
FT   CDS_pept        294845..295384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0261"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: bpd:BURPS668_3734
FT                   50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13956"
FT                   /db_xref="GOA:A9ADK5"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK5"
FT                   /protein_id="ABX13956.1"
FT                   /translation="MARLQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVA
FT                   DKKIIENAVGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGAMVTLRGRAMYEFLDRLV
FT                   TVALPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIDYDKIDALRGLNISITTTAKTD
FT                   DEAKALLASFKFPFRN"
FT   gene            295392..295697
FT                   /locus_tag="Bmul_0262"
FT   CDS_pept        295392..295697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0262"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: bam:Bamb_0280
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13957"
FT                   /db_xref="GOA:A9ADK6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK6"
FT                   /protein_id="ABX13957.1"
FT                   /translation="MAKLALIEREKKRARLVAKFAAKREALKAIIEDQSKSEEERYEAR
FT                   LELQQLPRNANPTRQRNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW"
FT   gene            295712..296107
FT                   /locus_tag="Bmul_0263"
FT   CDS_pept        295712..296107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0263"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bte:BTH_I3054
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13958"
FT                   /db_xref="GOA:A9ADK7"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK7"
FT                   /protein_id="ABX13958.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKVSVAMPSSKVKVAIAQVLKDEGY
FT                   IDDFAVKTEGAKAELNIALKYYAGRPVIERLERVSKPGLRVYRGRNEIPQVMNGLGVAI
FT                   VSTPKGVMTDRKARATGVGGEVICYVA"
FT   gene            296126..296656
FT                   /locus_tag="Bmul_0264"
FT   CDS_pept        296126..296656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0264"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: bpd:BURPS668_3731
FT                   50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13959"
FT                   /db_xref="GOA:A9ADK8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK8"
FT                   /protein_id="ABX13959.1"
FT                   /translation="MSRVGKSPIALQGAEVKLADGVITVKGPLGTITQAVNPLVKVANN
FT                   DGTLNLAPADESREANALSGTMRAIIANAVHGVTKGFERKLTLVGVGYRAQAQGDKLNL
FT                   SLGFSHPVVHQMPEGVKAETPTQTEIVIKGIDKQKVGQVAAEVRGYRPPEPYKGKGVRY
FT                   ADEVVILKETKKK"
FT   gene            296669..297034
FT                   /locus_tag="Bmul_0265"
FT   CDS_pept        296669..297034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0265"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bte:BTH_I3052 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13960"
FT                   /db_xref="GOA:A9ADK9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADK9"
FT                   /protein_id="ABX13960.1"
FT                   /translation="MDKTQSRLRRARQTRIKIAELQVARLAVHRTNTHIYAQVFSPCGT
FT                   KVLASASTLEAEVRAELADKSGKGGNVAAATLIGKRIAEKAKAAGIESVAFDRSGFRYH
FT                   GRVKALAEAAREAGLKF"
FT   gene            297049..297567
FT                   /locus_tag="Bmul_0266"
FT   CDS_pept        297049..297567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0266"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   bmn:BMA10247_3495 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13961"
FT                   /db_xref="GOA:A9ADL0"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL0"
FT                   /protein_id="ABX13961.1"
FT                   /translation="MAKMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAP
FT                   AKDGTGVIAGGPMRAVFDVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKR
FT                   GKSVEEILG"
FT   gene            297574..297765
FT                   /locus_tag="Bmul_0267"
FT   CDS_pept        297574..297765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0267"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: bam:Bamb_0285
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13962"
FT                   /db_xref="GOA:A9ADL1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL1"
FT                   /protein_id="ABX13962.1"
FT                   /translation="MVTMSEKTVKVQLVKSLIGTRESHRATVRGLGLRRLNSVSELQDT
FT                   PAVRGMINKVSYLVKVIA"
FT   gene            297792..298226
FT                   /locus_tag="Bmul_0268"
FT   CDS_pept        297792..298226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0268"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: bam:Bamb_0286
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13963"
FT                   /db_xref="GOA:A9ADL2"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL2"
FT                   /protein_id="ABX13963.1"
FT                   /translation="MELNNLKPAAGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFTSLTKEFVGEVRLGDLEKLPVDEIDLLALKQAGLVGEL
FT                   TKSAKIIATGELKRKIVVKGLGATKSARAAIEAAGGSFAE"
FT   gene            298269..299618
FT                   /locus_tag="Bmul_0269"
FT   CDS_pept        298269..299618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0269"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: bvi:Bcep1808_0350 preprotein
FT                   translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13964"
FT                   /protein_id="ABX13964.1"
FT                   /translation="MANSPSLAKPGRSTAKFGDLRRRAMFLLLALIVYRIGAHIPVPGI
FT                   DPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIMPYISASIIMQLLAIVSPQLE
FT                   ALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQPGLVIDPGMLFRLTTVVTLV
FT                   TGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVSGLFELVRTGSMSIISAIIIV
FT                   VLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMSGVIPPIFASSI
FT                   ILFPATILGWFSTGQPSGSWISNTLHNVAEALKPGQPVYVLLYTLAIVFFCFFYTALVF
FT                   NSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIYIVFVCLLPEFLVLRWN
FT                   VPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKGGNIPMR"
FT   gene            299626..299844
FT                   /locus_tag="Bmul_0270"
FT   CDS_pept        299626..299844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0270"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bte:BTH_I3047 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13965"
FT                   /protein_id="ABX13965.1"
FT                   /translation="MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   gene            299866..299982
FT                   /locus_tag="Bmul_0271"
FT   CDS_pept        299866..299982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0271"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG:
FT                   bur:Bcep18194_A3469 ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13966"
FT                   /db_xref="GOA:A9ADL5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL5"
FT                   /protein_id="ABX13966.1"
FT                   /translation="MKVMASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQG"
FT   gene            300021..300386
FT                   /locus_tag="Bmul_0272"
FT   CDS_pept        300021..300386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0272"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG:
FT                   bur:Bcep18194_A3470 ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13967"
FT                   /db_xref="GOA:A9ADL6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL6"
FT                   /protein_id="ABX13967.1"
FT                   /translation="MARIAGVNIPNHQHTEIGLTAIFGIGRTRSRSICVAAGVDFSKKV
FT                   KDLTDADLEKLREEVGKFVVEGDLRREVTMNIKRLMDLGCYRGVRHRKGLPMRGQRTRT
FT                   NARTRKGPRRAAQALKK"
FT   gene            300415..300816
FT                   /locus_tag="Bmul_0273"
FT   CDS_pept        300415..300816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0273"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG:
FT                   bur:Bcep18194_A3471 ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13968"
FT                   /db_xref="GOA:A9ADL7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL7"
FT                   /protein_id="ABX13968.1"
FT                   /translation="MAKASNTAAQRVRKKVKKNVAEGVVHVHASFNNTIITITDRQGNA
FT                   LAWATSGGQGFKGSRKSTPFAAQVAAESAGRVAMEYGVKNLEVRIKGPGPGRESAVRAL
FT                   HGLGIKITAISDVTPIPHNGCRPPKRRRI"
FT   gene            300972..301595
FT                   /locus_tag="Bmul_0274"
FT   CDS_pept        300972..301595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0274"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: bvi:Bcep1808_0355 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13969"
FT                   /db_xref="GOA:A9ADL8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL8"
FT                   /protein_id="ABX13969.1"
FT                   /translation="MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTS
FT                   GARTSDYGTQLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGENLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKSITVNGIVANVPSQQVKAGDVIAIREKAKKQARIIEALSLA
FT                   EQGGMPSWVAVDAKKFEGTFKQVPERADIGGDINESLIVELYSR"
FT   gene            301720..302697
FT                   /locus_tag="Bmul_0275"
FT   CDS_pept        301720..302697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0275"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bam:Bamb_0293 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13970"
FT                   /db_xref="GOA:A9ADL9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADL9"
FT                   /protein_id="ABX13970.1"
FT                   /translation="MQTSLLKPKIIAVESLGENHAKVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVTIAGVVHEYSTLDGVQEDVVNLLLNLKGVVFKLHNRDEVTVTLRKEGE
FT                   GVVTAGDIELAHDCEVINPDHVIAHLSKGGKLDVQIKVEKGRGYVPGNVRRYGEDTAKI
FT                   IGRIVLDASFSPVRRVSYAVESARVEQRTDLDKLVMNIETTGVITPEEAIRQSARILVD
FT                   QLSVFAALEGTETAAEAPSRAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQR
FT                   TENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDK"
FT   gene            302837..303232
FT                   /locus_tag="Bmul_0276"
FT   CDS_pept        302837..303232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0276"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG:
FT                   bur:Bcep18194_A3474 ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13971"
FT                   /db_xref="GOA:A9ADM0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADM0"
FT                   /protein_id="ABX13971.1"
FT                   /translation="MRHRHGLRKLNRTSSHRLAMLRNMSNSLIEHEVIKTTLPKAKELR
FT                   KVVEPLITLGKKPSLANRRLAFNRLRDRDSVAKLFDVLGPRFANRPGGYLRILKFGFRV
FT                   GDNAPMALVELLDRPEVDETENVQEAE"
FT   gene            303445..303771
FT                   /locus_tag="Bmul_0277"
FT   CDS_pept        303445..303771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0277"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   bam:Bamb_0295 CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13972"
FT                   /protein_id="ABX13972.1"
FT                   /translation="MVVVLMLTTVPDAATAAALADGALGARLAACVSELGAIKSRYHWQ
FT                   GKVETADEIQLLFKTSAVRALELERFIVAHHPYDTPEILSWQATASDAYGQWVAGETQR
FT                   LFHV"
FT   gene            303764..305608
FT                   /locus_tag="Bmul_0278"
FT   CDS_pept        303764..305608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0278"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: bur:Bcep18194_A3476
FT                   protein-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13973"
FT                   /protein_id="ABX13973.1"
FT                   /translation="MFNGMALPVRARALQFLAFLLSVLCMLGGMSIARAADDFLDPAVA
FT                   FKFSASEAPGQVDVHFKVADGYYLYRERFAFAVKSGQATLGEPQLPAGHVKFDQTFGKN
FT                   VETYRGDVVIHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVVKIDGAALGTASNGAG
FT                   NAAAQGSWFDKVTSADFAQSLLEGQGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIII
FT                   GQGTRATHARGFALSLTYVVGMALVYTVLGIAAALIGQSLGAWLQNPWVLGAFAVLLTA
FT                   FAVSLISGKDIALPQRWQNGAAEASGARQGGHFAAVAAMGALSALVVGACMTAPLFAVL
FT                   AFIAHTGNAWLGGAALFAMGMGLGVPLLVVGVGAGTLLPRAGAWMDGVKVFFGIVLLAA
FT                   ALWIVWPVLGGGLKMMLAALWLLVAAAALGLFTPNAGAASIWRRLARGLGAALAIWAAT
FT                   LLVGLAAGSTDPVKPLAVLASRAAAPGGDAAAAAAHEGPAFAAVRSSGELDALLKTSAQ
FT                   PVMLDFYADWCVSCKEMEHLTFTDARVQARLAQLHLVRADVTANNADDQALLKRFGLFG
FT                   PPGIIFFDRNGKEIARVVGYQAAETFLRSLDRAAVPTV"
FT   sig_peptide     303764..303871
FT                   /locus_tag="Bmul_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 36"
FT   gene            complement(305718..306716)
FT                   /locus_tag="Bmul_0279"
FT   CDS_pept        complement(305718..306716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0279"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   bam:Bamb_0297 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13974"
FT                   /protein_id="ABX13974.1"
FT                   /translation="MSFHPLHRPRRMRRDDFSRRLMRENRLTTDDLIYPVFVVEGTNER
FT                   QPVPSMPGVERVSVDLLMQVAEQCVELGVPVLSLFPAIEPALKTPDGREAGNPEGLIPR
FT                   AVRELKKRFPELGVLTDVALDPYTSHGQDGVLDENGYVINDDTIEILIEQARAQAEAGV
FT                   DIVAPSDMMDGRIGAIREMLESDGHIHTRIMAYSAKFASAFYGPFRDAVGSASNLGKGN
FT                   KMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSG
FT                   EYAMLKAAAMNGWLDHDKVVLESLLAFKRAGADGVLTYFALDAARLLKAQR"
FT   gene            complement(306966..307625)
FT                   /locus_tag="Bmul_0280"
FT   CDS_pept        complement(306966..307625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0280"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   bch:Bcen2424_0379 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13975"
FT                   /db_xref="GOA:A9ADM4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADM4"
FT                   /protein_id="ABX13975.1"
FT                   /translation="MAFLLHQARFYTTVNHLRDLPPTVQPEIAFAGRSNAGKSTAINVL
FT                   CNQKRLAFASKTPGRTQHINYFSVGPAAEPVANLVDLPGYGYAEVPGAAKAHWEMLLST
FT                   YLATRSQLCGLILMMDSRRPLTELDRRMIEWFAPTGKPIHTLLTKCDKLTRQESINALR
FT                   TTQKGLDAYRDQGVQGKLTVQLFSALKRTGLDEAHALIESWVRPSVADEKNEPVAQ"
FT   gene            307840..308493
FT                   /locus_tag="Bmul_0281"
FT   CDS_pept        307840..308493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0281"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bch:Bcen2424_0380
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13976"
FT                   /protein_id="ABX13976.1"
FT                   /translation="MNRLCKSLMVLQVAAGFVGFVAEASAADAAKPDLERGKAIAGQVC
FT                   ASCHGADGNSASGNFPKLAGQHPEYLVKQLNDFKAQPGAKGPARNNAVMVGFASALSPD
FT                   DMRNVAAYYGSQAAKPGTARNAATVALGQKIYRGGIADKGVPACASCHGPTGQGIPVQY
FT                   PRLSGQWADYTVAQLTAFQQGAGARNNNEAMHQIASRLSDSEIKAVADYIAGLH"
FT   sig_peptide     307840..307920
FT                   /locus_tag="Bmul_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.702 at
FT                   residue 27"
FT   gene            308615..310831
FT                   /locus_tag="Bmul_0282"
FT   CDS_pept        308615..310831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0282"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: bur:Bcep18194_A3480
FT                   ResB-like/cytochrome c biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13977"
FT                   /protein_id="ABX13977.1"
FT                   /translation="MSVTTSGLQSKSGHGASKRAVELLSSMRFAIALLVVLSIASIIGT
FT                   VLTQDDPYPNYVNQFGPFWADIFRALGLYNVYSAWWFMLILIFLVVSISLCVIRNAPKM
FT                   LADAKSWKDKVREGSLRAFHHKAEYSASGTRAAATATLAAFVAKAGYKHVVRETDGATL
FT                   ISAKRGAMTKWGYISAHLAIVVICIGGLLDSNLPIKFQMWLFGKSPVNTSATISEISAD
FT                   HRLSASNPTFRGYAWVPEGQFVSTAILNQPSGSLIQDLPFSIQLNKFIVDYYSTGMPKL
FT                   FASDIVVIDRETGRKIPARVEVNKPFTYKGVSIYQSSFQDGGSQMQMTAYPMTGGSAKP
FT                   FAVQGTIGSSTPLQMPGVDGDTIEFADFRAINVENMADANGKPDVRGVAKTASLKEAFD
FT                   ERLGSGAKTSKPMQLHNIGPSVQYKIRGKDGQAREFNNYMLPVDMNGERVFLAGVRASP
FT                   NDPFRYMRIPADGQDSIGEWMRLRAALEDPAVRAEAAARFAQRSLPGTDASLRARLQDS
FT                   AQKVLTLFAASDDSVGRGADGQPIGGFQAVATFIDRSVPKAEQEKAANLMLRMLEGSMW
FT                   EVWQIARERAGEPAAQQGNDTLRFVQNALNALSDSFLYGAPVYLQLDSFKQVQASVFQL
FT                   TRAPGKNLVYLGSLLLVAGIFAMFYVRERRLWFWLKDAGSGVDVVMAMSTARKTFDFEK
FT                   EFVQTRDAAGAALHAAPRDAAPAGAASAARPPVGGDSDSENSTR"
FT   gene            310836..312026
FT                   /locus_tag="Bmul_0283"
FT   CDS_pept        310836..312026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0283"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG:
FT                   bch:Bcen2424_0382 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13978"
FT                   /protein_id="ABX13978.1"
FT                   /translation="MDLTQVSSSRPASAKAPAPAASFDERPFLARLSPLDWLFALALVV
FT                   GAGYALVHYNAHMDYYDKAVLIGTVPALVALGWRWKPARLMMASIAVLSLLSIQIYQGD
FT                   LARADSAFFLKYFLSSQSAILWMSALFVLATLFYWIGLLARSATGSAIGQKLTWVAVLM
FT                   GFTGLMVRWYESYLIGADVGHIPVSNLYEVFVLFSLITALLYLYYEGHYGTRALGAFVL
FT                   LVISAAVGFLMWYSVARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVSVAYL
FT                   MKERGVLADRLPTLEVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKETW
FT                   ALIVWLNYAAWLHMRLMKGLRGAVAAWWALTGLLVTTFAFLGVNMFLSGLHSYGKL"
FT   gene            312181..313176
FT                   /locus_tag="Bmul_0284"
FT   CDS_pept        312181..313176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0284"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   bur:Bcep18194_A3482 sulfite oxidase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13979"
FT                   /protein_id="ABX13979.1"
FT                   /translation="MWIKRSFRHLLTGDDIARSEITPRALFEHRRRVLQAAGAAAAGGL
FT                   LGGSGAAFAAYASPDARAAKLAAKTNAKFVAADKVTPFKDITSYNNFYEFGTDKGDPAQ
FT                   NAGTLRPRPWRVSVEGEVLHPKVFDIDELLKLAPLEERVYRLRCVEGWSMVIPWIGVPL
FT                   SELIKRVQPTGNAKYVQFVTLADPSQMPGLSTPVLDWPYSEGLRMDEAMHPLTLLTMGV
FT                   YGQVLPNQNGAPVRVVVPWKYGFKSAKSLVKIRFVDKQPKTSWNTYAPNEYGFYSNVNP
FT                   NVDHPRWSQATERRIGEDGFFTPKRKTLMFNGYGDLVASMYQGMDLKKNF"
FT   sig_peptide     312181..312345
FT                   /locus_tag="Bmul_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.778 at
FT                   residue 55"
FT   gene            313197..313898
FT                   /locus_tag="Bmul_0285"
FT   CDS_pept        313197..313898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0285"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: bur:Bcep18194_A3483 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13980"
FT                   /protein_id="ABX13980.1"
FT                   /translation="MTPTPLSSSHAARSRVASGAARTAVPRWLAAAKVLVFAAGLYPLA
FT                   RLVLFGMTDRLGANPIEFVTRSTGLWTLVMLCVTLAITPLRRVTGVTALLRFRRMIGLF
FT                   AFFYATLHFTTYFWFDKWFDVAAILKDVGKRPFITVGFAAFVLLIPLAATSPRAMVRRL
FT                   GRHWATLHRAIYAIAAFAVLHFWWMRAGKHDLAQPKLYAAVVAALLGWRLVAWAVGRLH
FT                   AARDAQKNERR"
FT   gene            complement(313958..314230)
FT                   /locus_tag="Bmul_0286"
FT   CDS_pept        complement(313958..314230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0286"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bam:Bamb_0304 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13981"
FT                   /protein_id="ABX13981.1"
FT                   /translation="MRVVFRMSAIVAALAILAGCGQRGPLYLPTVPPLPQKPIQQQDTP
FT                   PSDVAPTDENASDTPDSSGTPLTLSPELSDGTAKAPAAASGTSVQ"
FT   gene            314267..314593
FT                   /locus_tag="Bmul_0287"
FT   CDS_pept        314267..314593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0287"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: bur:Bcep18194_A3485 frataxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13982"
FT                   /db_xref="GOA:A9ADN1"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADN1"
FT                   /protein_id="ABX13982.1"
FT                   /translation="MSDTEYLTRAEAVLAAVERTVDAANDGDHDIDLERNGSVLTLTFE
FT                   NGSKIIVNLQPPMKEVWIAAKAGGFHYRYVDGAWRDTRTGTEFFAALSEYATQQAGLPI
FT                   TFTA"
FT   gene            complement(314693..315529)
FT                   /locus_tag="Bmul_0288"
FT   CDS_pept        complement(314693..315529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0288"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bam:Bamb_2714 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13983"
FT                   /protein_id="ABX13983.1"
FT                   /translation="MRELRQHHPVAALLKVAGLARSTFYYQLGTLNADDRHADLKAKIR
FT                   TVFEHHKGRYGYRRVTAAIRQAGHLVNHKAVQRLMQQLQLKSLVRPKKYRSWRGEIGQA
FT                   APNLLQRQFSATQANQKWVTDVTEFNVGGQKLYLSPVMDLYNGEIVAYQMDQRPSFELV
FT                   SGMLKKALAKLRRKDKPLLHSDQGWQYRMPAYRRELKKRKLTQSMSRKGNCLDNAAMES
FT                   FFGTLKSECYNGHCFTCVEQLRDTLDHYIHYYNHERIKLKLKGLSPVQYRTQPLGA"
FT   gene            complement(315529..316053)
FT                   /locus_tag="Bmul_0289"
FT   CDS_pept        complement(315529..316053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0289"
FT                   /product="HMG-I and HMG-Y DNA-binding domain protein"
FT                   /note="PFAM: HMG-I and HMG-Y DNA-binding domain protein;
FT                   KEGG: bam:Bamb_6206 HMG-I and HMG-Y, DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13984"
FT                   /protein_id="ABX13984.1"
FT                   /translation="MTKYDEQFKQRVVSAYLRGDSGFDALAARHGIHSGMLQRWVAAYR
FT                   AHGRAGLQSKYSSYDARFKLRVLQHMQRDELSLREVSALYDIRDAGSVARWARLYDEGG
FT                   INALTPRPRGRPRKMVTSLPPKPTEAGTPDERSREELLKENEYLRAEVAYLKKLDALLA
FT                   KKQAAQKKKRK"
FT   gene            complement(316135..318528)
FT                   /locus_tag="Bmul_0290"
FT   CDS_pept        complement(316135..318528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0290"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: bch:Bcen2424_0387 penicillin-binding protein,
FT                   1A family; TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13985"
FT                   /protein_id="ABX13985.1"
FT                   /translation="MPMQSTSPTPPPPSPEPKKRPWWQKALFGFAAMCVALVVAGGLVL
FT                   GYALVVAWPNMPSLDALTDYRPKVPLRIYTSDHVLIGEFGEERRDIVHFKDVPDSLKKA
FT                   ILAIEDARFYDHGGVDLTGILRAGVVALTNGHATQGASTITMQVARNFFLSSEKTYTRK
FT                   IYEMLLAYRIERALTKDQILEVYMNQIYLGQRAYGFASAARVYFGKDLKDITLAEAAML
FT                   AGLPKAPSAYNPVVNPKRAKVRQEYILQRMLELNFITREQYDEAVAQPLVVKGAGREYS
FT                   VHAEYVAEMVRQMMYAQYREETYTRGFNVITTIDSADQQVAYTALRKGIMDYERRHGYR
FT                   GPEGFIELPSGADEREQAIDDALLEHPDNGELIAAVVTAASPRQITVAFIDGSSATIEG
FT                   ENLRFAAGALSANAQPNRRIRPGAIVRVVKNDAGKWSITQLPQVEGAFISIVPQDGAIR
FT                   SLVGGFDYNKNKFNHVTQAWRQPGSSFKPFIYSASLDKGLGPATVINDGPLYFSAAETG
FT                   GQPWEPKNYGGGFEGPMSMRTALQRSRNLVSIRILNHIGTKYAQQYITRFGFDADRHPA
FT                   YLPMALGAGLVTPLQMAGAYSVFANGGYRVNPYLIAEVTDPNGAIVARAQPLIAEQNAP
FT                   RAIDARNAYVMNSLLQSVAQRGTGAKTNVLKRTDLAGKTGTTNDSHDAWFAGYQHTLAA
FT                   IAWIGYDNPRSLGDRETGGGLALPVWIDYMGAALKGVPDFKPTMPDGVESLGGELYFTD
FT                   FTPGHGFVSTVGVPQAPASQEADDAVPHVDEQEKQDIMNLFRGH"
FT   sig_peptide     complement(318406..318528)
FT                   /locus_tag="Bmul_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.323 at
FT                   residue 41"
FT   gene            318744..319667
FT                   /locus_tag="Bmul_0291"
FT   CDS_pept        318744..319667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13986"
FT                   /protein_id="ABX13986.1"
FT                   /translation="MTGRWAAARFVPGRHRSTGIDVGAGEVRIVVLSRRGRVADVRIEA
FT                   LEREPLVLPEGADARWAAVARALSAAVARLTGAGVRCDTRGVMALRDDEMRTATLDLAG
FT                   RDDVADAARQAAERISGLAPDSIAFDWRHDDGACAQEIAVAAAPLALLERRIDVAAQAG
FT                   IDLTAVDSESAAALRALRYAAQFELDAQGPYAALWFSDAGVRGWRIDGALAAPMLALPA
FT                   DMPGALADALRAGAPEPVGCVLVAGDERCVARFGLSLADIGDALGATSVPFDCTGWDGR
FT                   PIAPAGVPSAPAFAVAFGLALRGVWE"
FT   gene            319664..320290
FT                   /locus_tag="Bmul_0292"
FT   CDS_pept        319664..320290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0292"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   bch:Bcen2424_0389 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13987"
FT                   /protein_id="ABX13987.1"
FT                   /translation="MIVKRSHAAGPLPLDGFNLLPYRERVARALRRRQAAQCGAAILLA
FT                   ALGVGLWTAGCTWRRLDMDAERTRLDARLRQLEPQAAAAKRAARTAGAVTQRDAQAVEQ
FT                   AEPHRRVSALLATLAHVRDDTVRIDALHATRSGVVLDVRAASYRAGARWLASVAREQKD
FT                   ARIDVDALKPASAAAPVAAGAPIAFSAHVRWRDATPRRATPGDGA"
FT   gene            320287..321144
FT                   /locus_tag="Bmul_0293"
FT   CDS_pept        320287..321144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13988"
FT                   /protein_id="ABX13988.1"
FT                   /translation="MTTIAIAGGPLAAAWPRIRRRVSPAAMHAAGCALAFAVVLAGGIH
FT                   LSNAADWSGLARSGTLLQAARTRVADLERALETAAPQRNARPRAAAGDGTPPVREWGAL
FT                   MLELADLVASSGLHVISVEPLKADRAAADGRRTVRLVAAGEPAAPARAIGALADFSVLA
FT                   VPATLRVERGPDGVRIDMSVDVFPTLPGIASSGAATPALDGDPFGGAEAFATADGRLPR
FT                   LAGLIRDMRSALVLFDDGDGGFTAVRAGDALGALRVARVDAGAVTLSTSDGPRRLALED
FT                   GGRS"
FT   gene            321141..322862
FT                   /locus_tag="Bmul_0294"
FT   CDS_pept        321141..322862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0294"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: bur:Bcep18194_A3488 type
FT                   II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13989"
FT                   /protein_id="ABX13989.1"
FT                   /translation="MTKLNRYGIAVWFGIGVGAVGLGLGAATANAALPPLPAAWPVAST
FT                   MAEAREAPLPPGVPDGAIDDAIDGAAGRAASYPQTDRTHEAASPPAPPPPFEHASRVAQ
FT                   HAQPAAPAPALEGPPIPLPPPARMNDAAAHRAGDADDTRRISLNLQRADLTAAFDAFAR
FT                   FTGLNIVVSEQVRGTVTLRLNNVRWRDAFDTLLDTHGLAMSRRGDIVWVTRAAELAVRE
FT                   RERFETHARAADLEPLESRRFELHYARAQDVQRLLAGATGQRLLSKRGAAAADARTNLL
FT                   FVTDLAPRIAQIADLIAALDRPSRQVRIEARIVEGEQGFSRHLGARLALRAQGRPAAAE
FT                   AGASPAGARTALDLAARPLAGFDAATAGFTLLAAPLSRVLDVELSALEAQGRGQIVSSP
FT                   RVVTADRAKALVEQGAELPYQAKVGNGVTGVQFRRATLKLEVEPQITPDGRVVLDLDVT
FT                   KDSVGEPTAAGPAIHTKHVQTRVEVDDGGTVAIGGIYERLHRHDVTRVPLLGKIPVLGA
FT                   LFRHRAQREQRSELVVFITPTIVSAGCGPPGTADENAEKSGPEGGGAGSTRQSLCQ"
FT   sig_peptide     321141..321236
FT                   /locus_tag="Bmul_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            322969..323457
FT                   /locus_tag="Bmul_0295"
FT   CDS_pept        322969..323457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0295"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: bvi:Bcep1808_0374
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13990"
FT                   /protein_id="ABX13990.1"
FT                   /translation="MGRAVARRLDRTFFDSDHEIEARTGARIPVIFELEGEAGFRDREA
FT                   QMIAELTQRENIVLATGGGAVLRAENRACLKGNGIVVYLRANPHDLWLRTRKDKNRPLL
FT                   QTDDPKARLEALYEVRDPLYRECADFVIETGRPSVNGLVNMVLMQLELAGVVAKPLQA"
FT   gene            323454..324533
FT                   /locus_tag="Bmul_0296"
FT   CDS_pept        323454..324533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0296"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   bur:Bcep18194_A3490 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13991"
FT                   /db_xref="GOA:A9ADP0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ADP0"
FT                   /protein_id="ABX13991.1"
FT                   /translation="MITVNVDLGDRAYPIHIGAGLIGRAELFAPHIKGSSVTVVTNTTV
FT                   DPLYGDALRAALAPLGKHVSTVVLPDGEAYKNWETLNLIFDGLLGERADRKTTLVALGG
FT                   GVIGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAV
FT                   IADIGALTTLPERELAAGIAEVIKTGAIADAAFFDWIEANVDALNRRDPAALAHAVKRS
FT                   CEIKASVVAADEREGGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAADLSVR
FT                   LGLLDDASRQRLDAVIAAAHLPTRGPALGDARYMELMRVDKKAEAGAIKFILLKRFGDT
FT                   LITQAPDEAVFATLAHTTR"
FT   gene            324574..325782
FT                   /locus_tag="Bmul_0297"
FT   CDS_pept        324574..325782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0297"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="KEGG: bur:Bcep18194_A3491 deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13992"
FT                   /protein_id="ABX13992.1"
FT                   /translation="MSETSSRHLPETGRGPAAAVVEPPTLAALEAHLAPYAAHASQSRG
FT                   RRYPEAPPAARTEFQRDRDRIVHSTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIA
FT                   RSVARNLRLNEDLVEAISLAHDLGHTPFGHAGQDALNACMREYGGFEHNLQSLAVVDEL
FT                   EEHYGAFNGLNLCFETREGILKHCSRENARKLGALGERFLQGRQPSLEAQLANIADEIA
FT                   YNNHDVDDGLRSGLITIEQLAEVELWQRHYEQALAEFPHLEGRRLVHETVRRIINTLIV
FT                   DLIDETTRNLARVAPASIDDVRAAPPLVSHSEPVAAQAAALKRFLFKNLYRHYKVMRMA
FT                   SKAQRVVTGLFDAFIDDPRLLPPPYQSDDRAQQPRLVAHYIAGMTDRFALKEYQRLFVI
FT                   NDN"
FT   gene            325871..327205
FT                   /locus_tag="Bmul_0298"
FT   CDS_pept        325871..327205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0298"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bam:Bamb_0314 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13993"
FT                   /protein_id="ABX13993.1"
FT                   /translation="MKKKPAGTVVRSIVLGGALMFGVQHAAFAVTEIQFWHAMEAALGE
FT                   RVNELATQFNASQSDYKIVPVFKGTYDQTLAAGIAAYRSGNAPAILQVYEVGTATMMQA
FT                   KKAVVPVYDVFKQAGVPLDEKAFVPTIASYYSDAKTGHLVSMPFNSSTPVLYYNKDAFK
FT                   KAGLDPNQPPKTWADVKADSEKLRKAGMTCGFTTGWQGWIQLENYSAWHALPFASRNNG
FT                   FDGSDAVLEFNKPQQIAHIAFLQAMAKDGTFTYAGRKDEASAKFYSGDCGIMTTSSGAL
FT                   ANVQKFAKFSYGTGMMPYDANVKGAPQNAIIGGASLWVLAGKDPATYKGVAKFLAFLAS
FT                   PPIAAKWHQETGYLPVTTAAYDLTRQQGFYAKNPSAETAIKQMLNKPPLPYTKGLRLGN
FT                   MPQIRTVVDEELEQVWAQKKSPKDALDAAASRGNELLRRFEKSGG"
FT   sig_peptide     325871..325960
FT                   /locus_tag="Bmul_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.934 at
FT                   residue 30"
FT   gene            327241..328182
FT                   /locus_tag="Bmul_0299"
FT   CDS_pept        327241..328182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0299"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bam:Bamb_0315
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13994"
FT                   /protein_id="ABX13994.1"
FT                   /translation="MRRAPRRGFVSVSSDRIFAMQSRSRFGTSLLPYLLIAPQLAITAV
FT                   FFLWPAGVALWQSTQMQDAFGTSSEFVGLANFTHLFADPLYLDSFRTTLVFSALVTVSG
FT                   LIVSLLLAACADRVTRGARAYRTLLIWPYAVAPTIAAVLWAFLFNPSIGLVTYALAKQG
FT                   IVWNHALNGGQAMFLVVLASVWKQVSYNFLFFYAGLQAIPRSLIEAAAIDGAGPVRRFF
FT                   NIVLPLLSPTSFFLLVVNLVYAFFDTFPVIDAATGGGPAQSTKTLIYKIFAEGFQGLDI
FT                   GSSGAQSVVLMIIVVGLTVIQFRFVERRVQYA"
FT   gene            328179..329024
FT                   /locus_tag="Bmul_0300"
FT   CDS_pept        328179..329024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0300"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_A3494 ABC
FT                   sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13995"
FT                   /protein_id="ABX13995.1"
FT                   /translation="MIENRKGFDLFCHAVLIAGVVLIVFPVYVAFCAATMNAQEVFTVP
FT                   LSLVPSTHLFENVAYIWGHGSGGTTAPFGRLLLNSFAMALGIAVGKIAVSILSAYAIVY
FT                   FRFPFRNAAFWLIFVTLMLPVEVRIFPTVQVVSTLHLTNSYAGLTLPLIASATATFLFR
FT                   QFFMALPDELMDAARIDGAGPLRFFWDVVLPLSKTSIAALFVITFIYGWNQYLWPILIT
FT                   TEASLSTAVVGIKTMIASGDAATEWQYVMAATLLAMVPPLVVVLAMQRWFVRGLVDSEK
FT                   "
FT   gene            329056..330141
FT                   /locus_tag="Bmul_0301"
FT   CDS_pept        329056..330141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0301"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   bur:Bcep18194_A3495 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13996"
FT                   /protein_id="ABX13996.1"
FT                   /translation="MAALSLKGVRKSYDGKQHVLHGIDVEIADGEFIVLVGPSGCGKST
FT                   LLRMIAGLETVTDGEIAIGGRVVNALEPKDRDIAMVFQNYALYPHMTVAQNMGYGLKIR
FT                   GIDRATIDARVAAAAKILELEPLLARRPRELSGGQRQRVAMGRAIVREPSVFLFDEPLS
FT                   NLDAKLRVQMRLEIQRLHARLATTSVYVTHDQIEAMTLAQRVIVMNRGYAEQIGAPVDV
FT                   YERPATVFVAGFIGSPAMNLLHGRLSDDGATFTVAGGGPALPVAGAPGIGGAIAAGRDW
FT                   VLGVRPEHMTPQPGVPHATLPVDSCELLGADNLAHGRWGSHDVAVRLPHAERPARGSAL
FT                   VVALPAHRLHFFDPETGRRAD"
FT   gene            330161..330937
FT                   /locus_tag="Bmul_0302"
FT   CDS_pept        330161..330937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0302"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bam:Bamb_0318 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13997"
FT                   /protein_id="ABX13997.1"
FT                   /translation="MTSRSDWPYPRVVAHRGGGTLAPENTLAALDEGARRGHRMVEFDA
FT                   KLSADDVTFLLHDDTVERTSNGRGAAAGMRYAALAALDAGAWRDARFAGERMPTLEAAA
FT                   ARCIALGLAANVEIKPCPGRERDTGRRVAADAAAYWRGAAVPPLLSSFSFEALREARET
FT                   APELPRGMLYETVPPDWHAQVVDALGCVSLHADHTRLDETQVRAIKAAGLRILVYTVND
FT                   LARARELVRWGVDAVCTDRIDLIGPHALDDVVQGAT"
FT   gene            complement(331078..331809)
FT                   /locus_tag="Bmul_0303"
FT   CDS_pept        complement(331078..331809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0303"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bvi:Bcep1808_0382
FT                   OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13998"
FT                   /protein_id="ABX13998.1"
FT                   /translation="MKRKLAITGAAALAFALAGGTAHAQSAGSFYVSTGWFHLSPQDSS
FT                   DPLFVYGVGGTPVNQSVPNTGAGINDADTLGLATGYFLTDHISTEFVLGVPPKFDITGK
FT                   GQFANFGVLGRAYQWSPALLLRYHFNDANAKFRPYVGIGATYVWFTGAKITNTAFENGV
FT                   LGGPTSATTSNQWAPVFNAGFTYNFTKHWFAGLSISYVPVSVTATFTTARRTQVGTLTE
FT                   TSKAHISLNPIVTYLNVGYRF"
FT   sig_peptide     complement(331735..331809)
FT                   /locus_tag="Bmul_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            332002..332715
FT                   /locus_tag="Bmul_0304"
FT   CDS_pept        332002..332715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0304"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   bam:Bamb_0320 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX13999"
FT                   /protein_id="ABX13999.1"
FT                   /translation="MARLARLYVPDQPQHVILRGLDQQPAFVDDQDYELFIDCLKAAAR
FT                   DHHLSVHAYVLLPRQVQLLVTPSDEASLPKAMQAVGRRYVAHFNRRYSRRGTLWEGRYR
FT                   ATVIEGERYFLLASRVVELSPVRAQLVATPDAYRWSSYRHHVGLTVDSLITDHPLYWAL
FT                   GNTPFERQRAYKELCEQPLDERQADQLQQATLKGWVLGGETYREWAARTANRRVSPLPR
FT                   GRPRKVRENTPPIQQ"
FT   gene            332819..337708
FT                   /locus_tag="Bmul_0305"
FT   CDS_pept        332819..337708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0305"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase; KEGG: bcn:Bcen_2705
FT                   glutamate synthase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14000"
FT                   /protein_id="ABX14000.1"
FT                   /translation="MGFDQAVFVAIPLIRRVYSEFRWPGRSAPFHRRPRRLPPGAGSAA
FT                   NNKMVQRPSGPLYDGVPMNDHQQPLAAVPAAQGLYDPQNEHDACGVGFVAHIKGKKSHE
FT                   IIQQGLKILENLDHRGAVGADPLMGDGAGILIQIPDAFYREEMAKQGVTLPPAGEYGVG
FT                   MIFLPKENASRLACEQELERTVKAEGQVVLGWRDVPVDHTMPISPAVKASEPLIRQIFI
FT                   GRGKDIMVTDALERKLYVIRKTASHRIQALKLKHGKEYFVPSMSARTVVYKGLLLAGQV
FT                   GVYYRDLQDERVVSALALVHQRFSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWLNAR
FT                   TGAIASHVLGDDLPKLWPLIYPGQSDTASFDNCLELLVMAGYPLVHAVMMMIPEAWEQH
FT                   TLMDENRRAFYEYHAAMMEPWDGPAAIAFTDGRQIGATLDRNGLRPARYIVTDDDLVIM
FT                   ASEAGTLPIPESKIVKKWRLQPGKMFLIDMEHGRIIDDKELKDNLANAKPYKSWIDAVR
FT                   IKLDEIEPKAEEVAAGRAQGASLLDRQQAFGYTQEDLKFLMAPMAQQGEEAVGSMGNDS
FT                   PLAVMSNKNKTLYHYFKQLFAQVTNPPIDPIRENMVMSLVSFIGPKPNLLDTNNINPPM
FT                   RLEVSQPVLDFKDIAKIRAIDQYTGGKFSAYELNICYPVAWGKEGIEARLASLCAEAVD
FT                   AVKSGYNILIVSDRKTDAEHVAIPALLATSAIHTHLVQQGLRTSTGLVVETGSARETHH
FT                   FALLAGYGAEAVHPYLAMETLAKMAEGLSGDLSPEKAIYNFTKAIGKGLQKVMSKMGIS
FT                   TYMSYTGAQIFEALGLSSDLVEKYFKGTASKVGGIGLFEVAEEAIRLHRDAFGDNPVLR
FT                   DMLDAGGEYAYRVRGEDHMWTPDSIAKLQHATRSNSYQTYKEYAHLINDQTKRHMTFRG
FT                   LFEFKVQPTKAIPIDDVEPAKEIVKRFATGAMSLGSISTEAHATLAIAMNRIGGKSNTG
FT                   EGGEDENRYRNELRGIPIKAGETLKSVIGDEVVSDIPLKEGDSLRSKIKQVASGRFGVT
FT                   AEYLASADQIQIKMAQGAKPGEGGQLPGHKVSEYIGKLRYSVPGVGLISPPPHHDIYSI
FT                   EDLAQLIHDLKNVNPAASISVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPLS
FT                   SVKHAGTPWELGLAETQQTLVLNRLRGRIRVQADGQMKTGRDVVIGALLGADEFGFATA
FT                   PLVVEGCIMMRKCHLNTCPVGVATQDPVLRAKFKGQPEHVVNYFFFVAEEVREIMAQLG
FT                   IAKFDDLIGRADLLDMRKGIEHWKAKGLDFSRVFYQPEGCEEVARRHVESQDHGLERAL
FT                   DHVLIEKAKAAIENGEHVSFIQPVRNVNRTVGAMLSGVIAKKHGHDGLADDAVHIQLKG
FT                   TAGQSFGAFLAKGVTLDLVGDGNDYVGKGLSGGRIIIRPTNDFRGKSEENIICGNTVMY
FT                   GALEGEAFFRGVAGERFCVRNSGATAVVEGTGDHGCEYMTGGTVVVLGETGRNFAAGMS
FT                   GGVAYVYDPDGTFAAKCNKSMVALDPVLQQAEQERTVDRALWHAGMTDEALLKGLVERH
FT                   FQFTGSPRAKSLLENWDAARRQFVKVFPHEYKRALGEIGAKKAAKEALAA"
FT   gene            337794..339260
FT                   /locus_tag="Bmul_0306"
FT   CDS_pept        337794..339260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0306"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bch:Bcen2424_0403 glutamate
FT                   synthases, NADH/NADPH, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14001"
FT                   /protein_id="ABX14001.1"
FT                   /translation="MGKATGFLEFERRHEAYEAPLTRVKHYKEFVAALSDADAKIQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDFNDLVYRQDWQQAIEVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLGINDDPVGIKSIEHAIIDKAWAEGWVKPQPAAHKTGKKVAVVGSGPAGLAAAQQLA
FT                   RAGHDVTVFEKNDRIGGLLRYGIPDFKLEKWLIDRRMRQMEAEGVTFRTSVFIGKDPLP
FT                   ESIGNLAKETISPETLKEAFDAVVIAGGSETPRDLPVPGRELAGIHFAMDFLPQQNRVN
FT                   AGDKLVDQLLAKGKHVVVIGGGDTGSDCVGTSNRHGAKHVTQFELLPQPPEEENKPLVW
FT                   PYWPIKLRTSSSHEEGCERDWAVATKRFEGKNGKVEKLVAARVEWKDGKMQEVPGSEFE
FT                   MKADLVLLAMGFTQPAAPVLEAFGVAKDARGNARAATEGDRAYYTSVDKVFAAGDMRRG
FT                   QSLVVWAIREGRQCARSVDAYLMGHSELPR"
FT   gene            339584..341071
FT                   /locus_tag="Bmul_0307"
FT   CDS_pept        339584..341071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0307"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: bch:Bcen2424_0404 amino
FT                   acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14002"
FT                   /protein_id="ABX14002.1"
FT                   /translation="MEALVHGLIDAVNGVLWNYVLIALLLGVGAWFTLRFRMIQLKALF
FT                   LSIRLVGSKGEPGSISSFQAFATGLASRVGTGNIAGVAVALTVGGPGAIFWMWMTALVG
FT                   MSSAFVEATLAQIFKVSHPDGSYRGGPAYYIQTGLRSRGFGVLFSLSLILAFGFVFNAV
FT                   QANAIADAFNTSFGWRRETVGLGLVLLTAPIIFGGIRRIASVAQVIVPVMAIGYLALAV
FT                   YAVATHIALVPEVIALIVKSAFGVGQAAGGVTGYAVSQAIAIGVKRGLFSNEAGMGSAP
FT                   NAAATASTRHPVTQGLIQMLGVFVDTIVICSATAFVILLSGQYELGTGMEGAALTQRAI
FT                   SSHVGDWGGIYMAVAIFFLAFSSVIGNYAYAEGNVDFITKRRGVLALFRVAVLGMVMFG
FT                   SVGQLPLVWAMADTSMGLMAIINLIAIVALGKYAHAAWRDYRRQRAAGVADPVFTRNTI
FT                   PELARVLPADVWGEHGPLPQRPAAEAVSEPRVAVRES"
FT   gene            341068..341643
FT                   /locus_tag="Bmul_0308"
FT   CDS_pept        341068..341643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0308"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: bvi:Bcep1808_0387 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14003"
FT                   /protein_id="ABX14003.1"
FT                   /translation="MNGDRLRVFVALMPDAASRDALHALPVTRGARRTLAAQLHVTLAF
FT                   IGAIERDRCDALAARLPVLAAAHPLPPQPVERIAWWPSLPRARLIVAELAREPACAALN
FT                   AALAASLAELGLPADPRPFRPHVTLARLPRDAVGQPAHGGAPGRPVALRFDALTLFESR
FT                   LSHEGVSHRPIVSAPIACLEHRVPGERT"
FT   gene            complement(341640..342932)
FT                   /locus_tag="Bmul_0309"
FT   CDS_pept        complement(341640..342932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0309"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bch:Bcen2424_0406 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14004"
FT                   /protein_id="ABX14004.1"
FT                   /translation="MHVIVLGAGVIGVATAWHLREAGCDVTVIEREADVAQATSFGNAG
FT                   VIAPGYVTPWAAPGMPGKLVKYLFRPASPLIFRPTLDPAQWRWIARWLRECEFERFRAN
FT                   KQRMQRIAYYSRACLHAFRERHPFDYGASRGYLQLLRSAFDVDMVQPALNVLRDAGIAF
FT                   HELDAAGCIAVEPGLRWARQAPVGGIHLPDDEAGDCARFTRELRALCEANGVAFRFGTD
FT                   VRALDVAGRRARGVCIAPAGPHGGNGDARGDAMLAADAIVVALGVDSADLLDRYGIDVP
FT                   LYPVKGYSATLSVVDDERAPRAALMDESLKTAITRFGPTLRVAGTAELGNRRAALRQRA
FT                   LDTLMTVLDDWFPHAADRSSVRFWAGRRPMTPDGPPLLGASGIDGLWLNVGHGSTGWAM
FT                   SMGSGKVLADLVTGREPEIDLSGLTLARYAR"
FT   gene            complement(342958..344220)
FT                   /locus_tag="Bmul_0310"
FT   CDS_pept        complement(342958..344220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0310"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_0407
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14005"
FT                   /protein_id="ABX14005.1"
FT                   /translation="MQAIQWFRELSSRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIAT
FT                   WGMTKSEAGMIATSSLISSAIGGWVAGILADRYGRVRVLQWTIATFALFTCLSGFTHSF
FT                   WQLLATRTLQGFGFGGEWSVVTIMMAETIRSPEHRAKAVGTVQSSWSFGWAAAAILYWA
FT                   FFALLPEQVAWRACFWIGIAPALWILYIRRNVSDPDIYTATRRARDEGRVSGHFLEIFS
FT                   PPHLRATLFGSALCTGMLGGYYAITTWLPTYLKTVRHLSVFNTSGYLVVLIVGSFVGYV
FT                   VGAILSDRLGRRASFILFAIGSFTLGMAYTMLPITDTAMLALGFPLGIVVQGIFAGVGA
FT                   YLSELYPGAIRGSGQGFCYNLGRGLGSFFPILVGSLSQSMSLVKAIGFVAGGGYLLVIV
FT                   AALVLPETRGKSLADDPAVAS"
FT   gene            complement(344390..345157)
FT                   /locus_tag="Bmul_0311"
FT   CDS_pept        complement(344390..345157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0311"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bur:Bcep18194_A3506 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14006"
FT                   /protein_id="ABX14006.1"
FT                   /translation="MSARAARIALITGAGSGIGAALARRLAAPGVALALHARGADDASR
FT                   TRLADVVHACTASGAQCIALTGDLADPGVAARLVDATAAQFGGLDHLVANAGFAARQSL
FT                   SDLSADALASAFAAMPGAFATLASRARPLLEASAAARIVAVSSFVAHRYRADTPFAATA
FT                   AAKAALESLVRSAAAEFAPAAITVNAVAPGFTRKDRGPSADNAGAWAHAAHATPLGRIA
FT                   EPDDVAALIAFLLSDAARQITGQVVHVDGGLTL"
FT   sig_peptide     complement(345086..345157)
FT                   /locus_tag="Bmul_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.665 at
FT                   residue 24"
FT   gene            complement(345154..346923)
FT                   /locus_tag="Bmul_0312"
FT   CDS_pept        complement(345154..346923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0312"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A3507 ABC transporter, fused ATPase and
FT                   inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14007"
FT                   /protein_id="ABX14007.1"
FT                   /translation="MTQSIDPVRSASDAPQDERPVSAWSLIKPYWVSSEWKVAWALLVT
FT                   IIAINLCVVWINVQLNKWNAQFYNALQTKNVHDFPHLMMQFSMLAFGFIILAVYGLYLR
FT                   QMLGFRWRQWLTDRFLGEWLGDRAFYRIERDRLADNPDQRVADDLQAFATTTLSLSLDL
FT                   LSTVVTLASFITILWTLGGALTLSLGATPVSIPGYMVWAAALYAVIGSLVIQKVGRPLV
FT                   SINYQQQRVEADFRFGLIRVRENAEQIAFYDGEDTENRNAQGLFLRIRDNWWRVMKYTK
FT                   RLTFVNAFYGQIAIIFPFVVAAPRYFAGAFTLGVLMQISSAFGTVSDSFSWFLNSYRTL
FT                   VEWRATVNRLREFKRVMRTSHLKESLSPATEHGGINLHYVNAAKLSTSSLKLALPNGNA
FT                   LANIGSVTIEPGSRWLVVGKSGSGKSTFMRALAGLWPFGDGAIDAPVGARMMFVPQSSY
FT                   LPIGTLKAALAYPSAPDAFGDDACRDALRACHLEDYVDRLDETAHWTRVLSPGEQQRLA
FT                   GARVLLHKPDFLFLDEATSALDADNEARLYRLFAERLPKAAIVSIAHRESLAAFHGGTI
FT                   NVERVNDSDKVAA"
FT   misc_binding    347192..347313
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 59.99"
FT   gene            347535..348671
FT                   /locus_tag="Bmul_0313"
FT   CDS_pept        347535..348671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0313"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bam:Bamb_0328 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14008"
FT                   /protein_id="ABX14008.1"
FT                   /translation="MNVHDSRPDFAILGGGLVGRLIAWRLAGDGHRVALYERGGPDGER
FT                   SAAWIAAAMLAPLAEAASAELLITELGAASLARWPQWLAELPEPVFFQQHGTLVVWHHA
FT                   DRAEAPLFERRVRANAPADLFDGGFITLAGAQVDAAEPALAGRFARGLLLPREGQLDNR
FT                   QALHALAAGLAERGVDTHWHAAVDEGHLPDAHFTIDCRGLGAKPALPALRGIRGEVARV
FT                   HAPGIGLTRPVRLLHPRYPLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFS
FT                   VHPAFGEARILELNAQCRPTLPDHRPAVIWDGASTLAVNGLYRHGFMIAPEVAHAAVAL
FT                   AQAALDGTLRDSDAFAAWRDAARWPTLLHHRDDARQPA"
FT   gene            348704..348901
FT                   /locus_tag="Bmul_0314"
FT   CDS_pept        348704..348901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0314"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: bch:Bcen2424_0411 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14009"
FT                   /protein_id="ABX14009.1"
FT                   /translation="MDIQINQQTLTLPDGATVADALAAYGARPPYAVAVNGNFVARTQH
FT                   AARTLAAGDRLDVVHPVAGG"
FT   gene            348939..349754
FT                   /locus_tag="Bmul_0315"
FT   CDS_pept        348939..349754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0315"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   bam:Bamb_0330 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14010"
FT                   /protein_id="ABX14010.1"
FT                   /translation="MTSLTPADALTLYGETFASRVLLGTSRYPSLQSLSDSIAASRPGM
FT                   VTVALRRQMTGGTAEAGFFDLLKRHAVPLLPNTAGCQTVAEAVTTAHMAREVFETDWIK
FT                   LELIGDDYTLQPDPVGLIEAAAQLIKDGFKVLPYCTEDLVIGRRLLDVGCEALMPWGAP
FT                   IGTGKGVVNPYGLRVLRERLPDVPLIVDAGLGVPSHACQVMEWGFDGVLLNTAVSQATH
FT                   PEIMARAFAQGVEAGRAAYLAGPMDARETAHASTPVVGMPFWHQDGGGA"
FT   gene            349751..350866
FT                   /locus_tag="Bmul_0316"
FT   CDS_pept        349751..350866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0316"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: bur:Bcep18194_A3511 thiamine-phosphate
FT                   diphosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14011"
FT                   /protein_id="ABX14011.1"
FT                   /translation="MSARFADAFWPPADELAEAAERIRARLGDWPRAAAPWRLCMTAPD
FT                   APADGDVLIVSRGDRAGQARASAVSRPASPNAVAIEFDERGAALHAADARYALDAAHAL
FT                   ADDWIAALAAFLDCGFAPLDALVLALAWRDGDETRADDAWPVDAAQFPRVAGLPAAAEP
FT                   AFAPCPARLGLYPVVPDAEWVERVLDCGVQTIQLRVKGAAPDVLRREIARAVAAGRRYP
FT                   DARVFINDHWQIAADEGAYGVHLGQEDLETADLAALARAGLRLGLSSHGYYEMLRALHE
FT                   RPSYLALGPVFATATKAVAAPPQGLARIARYARFASPRVPLVAIGGVGLDALPAVLATG
FT                   VGSVAVVSAVTGAGDYRAAIAALQRCFASPI"
FT   gene            350961..351782
FT                   /locus_tag="Bmul_0317"
FT   CDS_pept        350961..351782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0317"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_0414 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14012"
FT                   /protein_id="ABX14012.1"
FT                   /translation="MSPSPTETLLELRDVDFGYGDRLVLSNLNMRFGRGQVVAVMGGSG
FT                   CGKTTVLRLIGGLVRARRGQVLFDGADVGAQTRDGLYALRRKMGMLFQFGALFTDMSVF
FT                   DNVAFALREHTDLPEELIRDLVLMKLNAVGLRGARDLMPSEVSGGMARRIALARAIALD
FT                   PQLIMYDEPFAGLDPISLGITANLIRTLNQALGATSILVTHDVPESFAIADYVYFLANG
FT                   GVLAQGTPDELRASTDPSVRQFIDGAPDGPFKFHYTSPPLAADFGLGGGRA"
FT   gene            351779..352546
FT                   /locus_tag="Bmul_0318"
FT   CDS_pept        351779..352546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0318"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bvi:Bcep1808_0394 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14013"
FT                   /protein_id="ABX14013.1"
FT                   /translation="MISAIGRYVIGGLERAGYGTRLFVRLVLEFFPLLRRPRLVTKQIH
FT                   FLGNYSFVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVTALLF
FT                   AGRAGTSLTAEIGLMKAGEQLTALEMMAVDPIKTVIAPRMWAGIITMPLLAAIFNAVGV
FT                   LGGYFVGVVLIGVDPGAFWSQMQGGVEVWADVGNGVLKSIVFGFAVTFIALFQGYEAKP
FT                   TPEGVSRATTKTVVFASLAVLGLDFLLTALMFS"
FT   gene            352577..353140
FT                   /locus_tag="Bmul_0319"
FT   CDS_pept        352577..353140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0319"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bam:Bamb_0334 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14014"
FT                   /protein_id="ABX14014.1"
FT                   /translation="MKKTALDFWVGLFVVVGFVALLFLALKVGNMSSLSFQPTYSVRMK
FT                   FDNIGGLKPRAAVKSAGVVVGRVKSIGFDPNTYQAVVTVDLDSQYPFPKDSSAKILTSG
FT                   LLGEQYIGLDPGGDTEMLKSGDTIAMTQSAIVLENLIGQFLYSKAADAGGSKPAAGAAG
FT                   APGAPAAPAPVPVPASAVAGSAAQ"
FT   gene            353171..354148
FT                   /locus_tag="Bmul_0320"
FT   CDS_pept        353171..354148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0320"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: bam:Bamb_0335
FT                   VacJ family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14015"
FT                   /protein_id="ABX14015.1"
FT                   /translation="MQTIRIRHAALAAAAVAALSGCATVQTPTKGDPLEGFNRTMYKFN
FT                   DTVDTYALKPVAKGYQYVVPQPVRDSVTNFFSNIGDVYIAANNLVQLRIADGVGDLMRV
FT                   VINTVFGVGGLFDVATIAKLPKHTADFGITMGRYGVPSGPYLVLPLLGPSTLRDAAGLG
FT                   VDYVGNPLTYVKPDSVSWGLYGVNLVNTRANLLGAGDVLDAAALDKYSFVRNAYLQRRQ
FT                   MLINNARGEAGAPASNDALPQYELPEDTAAPAAAGAAGSAGAAAAGSAGAAAVGGAAAP
FT                   AGASAAEPASGAAAPNPASATTVPPMQVTPPAPGGLRLPSFRLH"
FT   sig_peptide     353171..353248
FT                   /locus_tag="Bmul_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 26"
FT   gene            354257..354889
FT                   /locus_tag="Bmul_0321"
FT   CDS_pept        354257..354889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0321"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   bch:Bcen2424_0418 toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14016"
FT                   /protein_id="ABX14016.1"
FT                   /translation="MMKKLFLIPVFAALFSFGSAAHAQVDQSNPQALIKTATQQVLDEV
FT                   KQQTIKPGDTNRIISIVNKDILPYTDFRRTTQLAMGRNWRTATPEQQQQVQEQFKLLLI
FT                   RTYSGALAQLKPDQQIQYPPFRADPADTDVVVRTVAMNNGQPVQIDYRLYKTANGWKVY
FT                   DLNVLGAWLIQTYQQQFNEKIQQSGVDGLIKFLTQRNQELAAGKQAS"
FT   sig_peptide     354257..354328
FT                   /locus_tag="Bmul_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT   gene            354886..355161
FT                   /locus_tag="Bmul_0322"
FT   CDS_pept        354886..355161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14017"
FT                   /protein_id="ABX14017.1"
FT                   /translation="MSGFEAGPSLTVASAKTALAAGLAHVAAGATTVDCASLAQFDSSA
FT                   LAVLLAWQRAAKARGATLDILHLPPKLASLARAYGVDALIDGNARH"
FT   sig_peptide     354886..354948
FT                   /locus_tag="Bmul_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.672 at
FT                   residue 21"
FT   gene            355354..356280
FT                   /locus_tag="Bmul_0323"
FT   CDS_pept        355354..356280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0323"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bvi:Bcep1808_0399 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14018"
FT                   /protein_id="ABX14018.1"
FT                   /translation="MSAIEIRHVKKRYKSLQALKGVSLSVEEGEFFGLLGPNGAGKTTL
FT                   ISILAGLARADEGSISVRGHDVVKDFRGARLALGVVPQELVFDPFFTVRETLRIQSGYF
FT                   GLRRNDDWIDEVMANLDLTEKADANMRALSGGMKRRVLVAQALVHRPPVIVLDEPTAGV
FT                   DVELRQTLWKFISRLNREGHTIVLTTHYLEEAQSLCDRIAMLRRGEVVALDRTDALLRR
FT                   FAGLQLYLRFATGALPAELRGLETDPAARAPREHLLRLSSYDDVERILAQCRAAGCTFD
FT                   EIEVRKADLEDVFVQVMNGGEVIEGLA"
FT   gene            356277..357098
FT                   /locus_tag="Bmul_0324"
FT   CDS_pept        356277..357098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0324"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bch:Bcen2424_0421 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14019"
FT                   /protein_id="ABX14019.1"
FT                   /translation="MKQQPTQPLRALPADAAARQVAGSGFRTLFYKELLRFWKVSFQTV
FT                   LAPVVTALLYLTIFGHALSGRVEVYPGVEYVSFLVPGLVMMSVLQNAFANSSSSLIQSK
FT                   ITGNLVFVLLPPLSYRDIFGAYVLASVVRGLTVGAGVFVVTIWFIPMHFAAPLFIVAFA
FT                   LLGSAILGTLGLIAGIWAEKFDQLAAFQNFLIMPLTFLSGVFYSTHSLPPVWREVSRLN
FT                   PFFYMIDGFRYGFFGASDIHPFTSLAIVAGFFVLLAMFAMRLLATGYKLRH"
FT   gene            357150..357389
FT                   /locus_tag="Bmul_0325"
FT   CDS_pept        357150..357389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0325"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: bur:Bcep18194_A3520
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14020"
FT                   /protein_id="ABX14020.1"
FT                   /translation="MLPTPEQVKQYIAGGLACTHLEVEGDGQHFFATIVSPAFEGKRPI
FT                   QRHQLVYAALGDRMKQEIHALSMKTLTPAEWQNA"
FT   gene            357403..358752
FT                   /locus_tag="Bmul_0326"
FT   CDS_pept        357403..358752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0326"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bam:Bamb_0341 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14021"
FT                   /protein_id="ABX14021.1"
FT                   /translation="MQVTVNERDAVQSVATAHPAANGETQGQGMDKLVIEGGRRLAGEI
FT                   VVSGAKNAALPILCAGLLSAEPVHLDNVPNLQDVRTTLKVLGQMGVKSETDGCRVQLDA
FT                   SRVDNLVAPYELVKTMRASILVLGPLLARFGEAKVSLPGGCAIGARPVDQHIKGLQAMG
FT                   AEISIEHGFIEARAKRLKGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVSD
FT                   LAHLLVAMGAKIDGIGTDRLVIQGVERLHGAHHAVIPDRIEAGTFLCAVAAAGGDVTLT
FT                   GVRPHILDAVIDKLREAGVTVEEGDRWLRVKMDRRPNAVTIRTSEYPAFPTDMQAQFMA
FT                   LNSVATGTAQVVETIFENRFMHVQELNRLGANITVDGNTALVTGVDKLSGANVMATDLR
FT                   ASASLVIAGLRAEGETRVDRIYHLDRGYDRMEAKLTAVGANVRRVSGSQA"
FT   gene            358749..359402
FT                   /locus_tag="Bmul_0327"
FT   CDS_pept        358749..359402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0327"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: bam:Bamb_0342 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14022"
FT                   /db_xref="GOA:Q845V4"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845V4"
FT                   /protein_id="ABX14022.1"
FT                   /translation="MTAPLTLALSKGRIFEETLPLLAAAGVQVAEDPETSRKLILPTTD
FT                   PNLRVIIVRASDVPTYVEYGAADFGVAGKDVLVEHGGSGLYQPIDLNIARCRMSVAVPA
FT                   GFDYANAVRQGARLRVATKYVETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDL
FT                   VSSGGTLKANNLVEVEEIMAISSRLVVNQAALKLKRAALKPFLDAFERASQNGV"
FT   gene            359427..360743
FT                   /locus_tag="Bmul_0328"
FT   CDS_pept        359427..360743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0328"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG:
FT                   bch:Bcen2424_0425 histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14023"
FT                   /db_xref="GOA:Q845V3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845V3"
FT                   /protein_id="ABX14023.1"
FT                   /translation="MSITIRKLDSTSEGFDAALRAVLAFEASEDEAIERSVAQILADVK
FT                   SRGDAAVLEYTNRFDRLNADSVAALELPQDALQAALDGLEPKARAALEAAAARVRGYHE
FT                   KQKIECGTHSWQYTESDGTVLGQKITPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVG
FT                   EIVMVVPTPDGVKNDLVLAAALLGGVDRVFTIGGAQAVGALAYGTATVPAVDKICGPGN
FT                   AYVASAKRRVFGTVGIDMIAGPSEILVLCDGTTDPSWVAMDLFSQAEHDELAQSILLCP
FT                   DASFIERVEKAIAELLPSMPRQDVIRASLEGRGALIKVRDMTEACRIANDIAPEHLEIS
FT                   ALEPQQWSQQIRHAGAIFLGRYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRS
FT                   SLIEVSAEGAHTLGEIAAELAYGEGLQAHAKSAEFRMKG"
FT   gene            360832..361926
FT                   /locus_tag="Bmul_0329"
FT   CDS_pept        360832..361926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0329"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG:
FT                   bch:Bcen2424_0426 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14024"
FT                   /db_xref="GOA:Q845V2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845V2"
FT                   /protein_id="ABX14024.1"
FT                   /translation="MHAGLPTMTTPQDIIRRDVLAMTSYPVPDASGFVKLDAMENPYPL
FT                   PEPLAAALGERLARVALNRYPAPRPAALLDKLRHAMGVPGTCDVLLGNGSDEIISMISV
FT                   ACAKPGAKVLAPVPGFVMYELSARFAQLDFVGVPLKADLTLDVDAMLAAIAEHRPAIVY
FT                   LAYPNNPTGTLYDDADIERILRAATHSLIVIDEAYQPFAQHSWLPRAGEFDNVVVMRTV
FT                   SKLGLAGIRLGYLVGRPAWLNEFDKVRPPYNINVLTQATADFLLDHLDVLDAQAAELRA
FT                   ERARLAQAVAALPGATVFPSAGNFLLVRVPDAAAVFDALLTERVLVKNVSKMHPLLAEC
FT                   VRLTVGSPDENARLLAALKLALPD"
FT   gene            361992..362579
FT                   /locus_tag="Bmul_0330"
FT   CDS_pept        361992..362579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0330"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   bam:Bamb_0345 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14025"
FT                   /db_xref="GOA:Q845V1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845V1"
FT                   /protein_id="ABX14025.1"
FT                   /translation="MRVAEVVRNTSETQIRVKLDLDGTGRQKLATGVPFLDHMLDQIAR
FT                   HGLVDLEVEAHGDTHIDDHHTVEDVGITLGQAVAKAIGDKKGIRRYGHAYVPLDEALSR
FT                   VVIDFSGRPGLEFHVPFTRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGINAHHQL
FT                   ETVFKAFGRALRAAVELDERAAGQIPSTKGSL"
FT   gene            362642..363262
FT                   /locus_tag="Bmul_0331"
FT   CDS_pept        362642..363262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0331"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bvi:Bcep1808_0407 multiple antibiotic
FT                   resistance (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14026"
FT                   /protein_id="ABX14026.1"
FT                   /translation="MDLLKSFISLLALINPVGAVPFFLSLTAQQNEAERRRTIRIASVS
FT                   VFCVMTVTVLLGQQIIRFFGISVGSLEVGGGIIMLLMAISMLNAQIGNTRSTPEERDEA
FT                   ELKDNIAVVPLAIPLLTGPGSISTAIVYAANAHHWYERAGLVAIGAILALLCFVAMRLA
FT                   EPIANWIGRTGINIATRLMGLMLSALAVEFIVNGLRALLPALR"
FT   sig_peptide     362642..362728
FT                   /locus_tag="Bmul_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.433 at
FT                   residue 29"
FT   gene            363259..363900
FT                   /locus_tag="Bmul_0332"
FT   CDS_pept        363259..363900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0332"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: bam:Bamb_0347 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14027"
FT                   /db_xref="GOA:Q845U9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845U9"
FT                   /protein_id="ABX14027.1"
FT                   /translation="MKTSIAIVDYGMGNLRSVAQALKKAEPAADVAIVDTPAAIRAADR
FT                   VVLPGQGAMPDCMRCLGESGLQEAVVEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLL
FT                   PGKVVRFELDGRLQDDGSRFKVPQMGWNRVRQSRAHALWDGVPDDAYFYFVHSYYVMPD
FT                   DPAHTVGETAYGAPFTSAVARDNIFATQFHPEKSAEVGLRLYRNFVHWKP"
FT   gene            364064..364819
FT                   /locus_tag="Bmul_0333"
FT   CDS_pept        364064..364819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0333"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: bam:Bamb_0348
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14028"
FT                   /db_xref="GOA:Q845U8"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845U8"
FT                   /protein_id="ABX14028.1"
FT                   /translation="MLLIPAIDLKDGQCVRLKQGDMDQATIFSEDPAAMARKWVDLGAR
FT                   RLHLVDLNGAFAGKPKNLDAIEAILDEVGDEIPVQLGGGIRSLETIEKYLDAGLSYVII
FT                   GTAAVKDPGFLRDACTAFQGNIIVGLDAKDGKVATDGWSKLTGHEVIDLAQKFEDYGVE
FT                   SIVYTDIGRDGMLQGINIDATVKLAQAVGIPVIASGGLSNLEDIDKLCEVEEEGVEGVI
FT                   CGRAIYSGDLDFAAAQRRADELNGELDDA"
FT   gene            364948..365721
FT                   /locus_tag="Bmul_0334"
FT   CDS_pept        364948..365721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0334"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: bur:Bcep18194_A3529 histidine biosynthesis protein
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14029"
FT                   /db_xref="GOA:Q845U7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845U7"
FT                   /protein_id="ABX14029.1"
FT                   /translation="MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDEQGA
FT                   DELTFLDITATSDQRDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKVSMN
FT                   SSAVANPQLVRDAADKYGSQCIVVAIDAKRVSADGEAPRWEVFTHGGRKGTGLDAIEWA
FT                   RKMAEFGAGEILLTSMDRDGTKSGFDLALTRGVSDAVPVPVIASGGVGSLQDLADGIKD
FT                   GRADAVLAASIFHYGEHTVGEAKRFMAEQGIPVRL"
FT   gene            365721..366137
FT                   /locus_tag="Bmul_0335"
FT   CDS_pept        365721..366137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0335"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   bam:Bamb_0350 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14030"
FT                   /db_xref="GOA:Q845U6"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845U6"
FT                   /protein_id="ABX14030.1"
FT                   /translation="MNTETKPLPAWLDKVRWDDNGLVPVIAQEASTNDVLMFAWMNREA
FT                   LAKTIETQRAVYYSRSRKRLWFKGEESGHVQHVHEVRLDCDEDVVLLKVEQVSGIACHT
FT                   GRHSCFFQKFEGTVDAGDWVAVDPVLKDPEHIYK"
FT   gene            366134..366499
FT                   /locus_tag="Bmul_0336"
FT   CDS_pept        366134..366499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0336"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   bvi:Bcep1808_0412 phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14031"
FT                   /db_xref="GOA:Q845U5"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845U5"
FT                   /protein_id="ABX14031.1"
FT                   /translation="MTQSTEDTLLRLAGVIDSRKGGDPEQSYVSRLFHKGDDAVLKKIG
FT                   EEATEVVLAAKDVRQGGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERREGLSG
FT                   IEEKALRKRREREANGG"
FT   gene            366571..366963
FT                   /locus_tag="Bmul_0337"
FT   CDS_pept        366571..366963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0337"
FT                   /product="membrane protein"
FT                   /note="KEGG: bch:Bcen2424_0434 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14032"
FT                   /protein_id="ABX14032.1"
FT                   /translation="MTDTSSQFPPPAVSAAAEAERLKGLRTLTHVLYALYAIHWLTGGI
FT                   TGIIAIIINYVKRGDVAGTPYADHFEWQIRTFWRALIAYVIGFALAFVAVGFAVMFVTW
FT                   IWTLYRIIKGWLYLNDNKALDPQAWF"
FT   gene            366995..367360
FT                   /locus_tag="Bmul_0338"
FT   CDS_pept        366995..367360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0338"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bch:Bcen2424_0435 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14033"
FT                   /protein_id="ABX14033.1"
FT                   /translation="MSHDPNCLFCKIAAGEIPSTKVHEDDEFVAFRDIRPAADTHVLVI
FT                   PRRHLPTLSAATDDDAPMLGRLMVLVARLADQLGVAYTGGETGFRTVINTGPGGGQEVY
FT                   HLHAHILAGPRPWQRMG"
FT   gene            367451..367681
FT                   /locus_tag="Bmul_0339"
FT   CDS_pept        367451..367681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0339"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: bur:Bcep18194_A3534 twin-arginine
FT                   translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14034"
FT                   /db_xref="GOA:A9AE12"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE12"
FT                   /protein_id="ABX14034.1"
FT                   /translation="MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKD
FT                   GDAPADAQQLPRSGTVDVNAKEATRSDSNKA"
FT   gene            367706..368242
FT                   /locus_tag="Bmul_0340"
FT   CDS_pept        367706..368242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0340"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: bch:Bcen2424_0437 twin-arginine
FT                   translocation protein, TatB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14035"
FT                   /protein_id="ABX14035.1"
FT                   /translation="MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYIND
FT                   VKAEVSREIELDALRTMKSDFETAARNVETTIHDNLREHEKHLNESWNAAIGGLNDAVH
FT                   GTSASSESEPQPAAPAWRGSVAASAPKRRNWRVKQSATPVWYKRATTRRTHVQSGAARV
FT                   ARHQPASLRRPARFF"
FT   gene            368284..369066
FT                   /locus_tag="Bmul_0341"
FT   CDS_pept        368284..369066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0341"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: bvi:Bcep1808_0417 sec-independent
FT                   protein translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14036"
FT                   /protein_id="ABX14036.1"
FT                   /translation="MSDPQQNPDDAPEETFISHLVELRDRIIRAGLAVIVVFLGLVYWA
FT                   PDIFRLLARPLMENLPKGGKMIVTDVTGSFFVPMKVTMLVALVIALPVVLYQIWAFVAP
FT                   GLYQHEKKLVAPLVGSSYVLFLCGMAFAYFLVFPTIFRVMAHYNAPLGAEMSTDIDNYL
FT                   SFVLGMFIAFGVTFEVPIVVVLLVRMGVLTLQKLKEIRPYVIVGAFVVAAVVTPPDVFS
FT                   QLMLALPLVVLYEAGILAARFFVPKPSAEAEAENGAAS"
FT   gene            complement(369239..370447)
FT                   /locus_tag="Bmul_0342"
FT   CDS_pept        complement(369239..370447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0342"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bam:Bamb_0357 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14037"
FT                   /protein_id="ABX14037.1"
FT                   /translation="MLRRFWLFFAQAVTVLLALMFIVVTLKPQWLQRQGQLGKQLATPI
FT                   VALREVAPGSIGGAAATTSYADAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGD
FT                   RNARKQQDEPAANLGSGVIVSPEGYILTNQHVVDGADQIEVALADGRTATAKVIGSDPE
FT                   TDLAVLKINMTNLPTITLGRSDQARVGDVVLAIGNPFGVGQTVTMGIISALGRNHLGIN
FT                   TFENFIQTDAPINPGNSGGALVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARTVLE
FT                   SIITTGSVTRGWIGVEPQDVTPEIAESFGLQQKSGAIVAGVLQGGPADKAGIKPGDILV
FT                   TVNGEDITDTTKLLNVVAQIKPGTSTKVHVVRKGKQFDVNVVIGKRPPPPKQTLDDQDS
FT                   DTE"
FT   sig_peptide     complement(370367..370447)
FT                   /locus_tag="Bmul_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.421 at
FT                   residue 27"
FT   gene            370469..371215
FT                   /locus_tag="Bmul_0343"
FT   CDS_pept        370469..371215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0343"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   bur:Bcep18194_A3538 protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14038"
FT                   /protein_id="ABX14038.1"
FT                   /translation="MDRIELELYLNNTLETARFKDYCPNGLQVEGRRKIEKIATGVTAS
FT                   VAFLEAALEWGADAVLVHHGYFWRNEAPQITGRKYQRLKLLLANDLNLFAFHLPLDAHP
FT                   EFGNNAQLGAKLGLIGESHFGDGDLGWMATLPMPVTLEHFVAKVENTLGRAPLVLGDRD
FT                   MQLRRIAWCTGAAQSYFDAAIEAGADVYLTGEVSEFVTHTVAESGVAYVAAGHHATERY
FT                   GIQALGTHLSEQFDLEHLFIDIHNPV"
FT   gene            371434..372054
FT                   /locus_tag="Bmul_0344"
FT   CDS_pept        371434..372054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0344"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: bch:Bcen2424_0441 ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; TIGRFAM:
FT                   ubiquinol-cytochrome c reductase, iron-sulfur subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14039"
FT                   /protein_id="ABX14039.1"
FT                   /translation="MRDKEEKRVDSGRRTWLIATSVAGGVGGVATVIPFAASLAPSAKA
FT                   KAAGAPVEVDISGLKPGEMITVPWRGKPVWVLNRTDAMLADVVKADKEVADPNTKSPYS
FT                   MPLPAYCANEYRSRADRKNILVVMAVCTHLGCTPSQRFTPGPQPNLPDDWPGGFLCPCH
FT                   GSTYDLAGRVFKNKPAPQNLDIPPYMFTSATTLVIGKDEKGEA"
FT   gene            372054..373433
FT                   /locus_tag="Bmul_0345"
FT   CDS_pept        372054..373433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0345"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG:
FT                   bvi:Bcep1808_0421 cytochrome b/b6, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14040"
FT                   /protein_id="ABX14040.1"
FT                   /translation="MADNKEVSTTGLTGWIDQRFPLTTTWKKHVSEYYAPKNFNFWYFF
FT                   GSLALLVLVNQIVTGIFLTMNYKPDSMLAFASVEYIMREVPWGWLIRYMHSTGASMFFV
FT                   VVYLHMFRGLMYGSYRKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNL
FT                   FSAIPFVGPDLSLWIRGDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSNN
FT                   PDGIEIKAKKDANGIPLDGIPFHPYYSVHDFFGVCVFLMVFALIVFFAPEMGGYFLESN
FT                   NFVPANPLQTPPEIAPVWYFTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWKI
FT                   GLPVLAAAIVVFMYLTESKFWGVVVMGSAVITLFFLPWLDRSPVKSIRYRPLFHKVFLG
FT                   IFVAAFLTLAFLGTRPPSPAATLIAQGCALIYFAFFLGMPVWTPLGTFKQPPERVRFKP
FT                   H"
FT   gene            373455..374213
FT                   /locus_tag="Bmul_0346"
FT   CDS_pept        373455..374213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0346"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: bam:Bamb_0361 cytochrome
FT                   c1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14041"
FT                   /protein_id="ABX14041.1"
FT                   /translation="MKKLLSTLALIGATACALLGAPAASAEGNFPLDRAPDNTENLVSL
FT                   QHGAQLFVNYCLNCHSANLMRYNRLTDLGISQKEIEKNLLFTTDKVGNTMTVAMRPEDA
FT                   KNWLGTTPPDLSVEERARGRDWLYTYLRSFYRDDTRPTGWNNAVFENVGMPHVLWQLQG
FT                   QRAAKFEEKTDEETGEKVRTLVGFQQVTPGTLSPPDYDAAVADLVAYMTWMAEPAQQTR
FT                   KRLGVWVLIFLGVLTFLAWRLNAAYWKDIK"
FT   sig_peptide     373455..373535
FT                   /locus_tag="Bmul_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 27"
FT   gene            374308..374919
FT                   /locus_tag="Bmul_0347"
FT   CDS_pept        374308..374919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0347"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bam:Bamb_0362 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14042"
FT                   /protein_id="ABX14042.1"
FT                   /translation="MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVH
FT                   VSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRL
FT                   DHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            374991..375512
FT                   /locus_tag="Bmul_0348"
FT   CDS_pept        374991..375512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0348"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   bch:Bcen2424_0445 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14043"
FT                   /protein_id="ABX14043.1"
FT                   /translation="MQEISTKPYLLRALYEWCTDNGYTPHIAVRVDNSTRVPRQFVRDG
FT                   EIVLNISFEATSQLQMGNEWVEFTARFSGKAHKIEIPVANVLAIYARENGQGMAFQVDA
FT                   VAGEGEDSGAFDDDAEHADDAQRGESSAGLTPVGDAGANEEPSEGADEPPKSDGDGSKG
FT                   SSRPRLKIVK"
FT   gene            375532..375607
FT                   /locus_tag="Bmul_R0013"
FT                   /note="tRNA-Thr2"
FT   tRNA            375532..375607
FT                   /locus_tag="Bmul_R0013"
FT                   /product="tRNA-Thr"
FT   gene            complement(375732..376685)
FT                   /locus_tag="Bmul_0349"
FT   CDS_pept        complement(375732..376685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_01120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14044"
FT                   /protein_id="ABX14044.1"
FT                   /translation="MEINSNLLTTLQNSGAAKSPAILATSDSTSAAAYASTLAQSTATQ
FT                   GDSVTLSGEAIMLSRLYGGSEKGIPTTPLVGSKDVGAADPVMWLNAEDRSALSDLYGYA
FT                   RQTGADLHYVDDIAFQLAYYRQTAGTVVSNWTTNPMYDTEGHRLTSSFSDKDVASAKII
FT                   QINSNNTKLDKGFLSYILDQGYGQNHIMNFQFLEKFVTRGSTGDNTNANVAEFATYVVT
FT                   PRSIVTASKDVELHHPEPDFICINGVFTITAKGEKNGFVLVNGQPTQQPKTDSFQVKNG
FT                   HLAVNIEKPSFAKTILAMLTGTAAKPSSAPHHKKVT"
FT   gene            377518..377721
FT                   /locus_tag="Bmul_0350"
FT   CDS_pept        377518..377721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A3547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14045"
FT                   /protein_id="ABX14045.1"
FT                   /translation="MLSPHEFSMLLRVARAPDSVDRSNPAFIVLVEKRLVDDTQARTSA
FT                   VAARPALTPIGQMLLARFDEAA"
FT   gene            complement(377829..378629)
FT                   /locus_tag="Bmul_0351"
FT   CDS_pept        complement(377829..378629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0351"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG:
FT                   bur:Bcep18194_A3548 ABC amino acid transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14046"
FT                   /protein_id="ABX14046.1"
FT                   /translation="MKRTKFLLSGLLLASALGFTAVAAHAEDLLDSVKKAGVLRVGLEG
FT                   TYPPFNSRGTSGQLEGFDVDVANAVAGKLGVKTQFIPTEWSGIIAGLQAGKFDVIVNQV
FT                   TITPQRKEALDFSEPYTYSAAQLIQRKDDKRDFKSLEDFKGKKLGVTLGTNYDQMARSV
FT                   PGIEVQTYPGAPEKLRDLAAGRIEATLDDRLMLPYMIKTSNLPLRAGAVLNGGKQEMAI
FT                   PFRKGNPKFEKAINDALESLRKDGTLKKISMHWFGSDVTVPVAQ"
FT   sig_peptide     complement(378549..378629)
FT                   /locus_tag="Bmul_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            378961..382140
FT                   /locus_tag="Bmul_0352"
FT   CDS_pept        378961..382140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0352"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG:
FT                   bch:Bcen2424_0459 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14047"
FT                   /protein_id="ABX14047.1"
FT                   /translation="MNMQNTIAALRGGLLQQDRLLKLDTPLGANVLTVQRAVGRSRIGR
FT                   AYEFALDVLSTDSDLELKKLIAQPITLWLQQANRSYRPINGYVHTARRLGADGGLTTYQ
FT                   LTFADFTHFLKFRRDQRIWNDAAVDQIISDVLNCHPQAQGHFRFALSKPLPSRSYTRQH
FT                   DTDWHFIHRLMEDEGLYCTWQQADDGKSHTLVITDNLQAFAPLSPETVRFYRGGAASET
FT                   DAFTQWSGTRTLQSVTRTTRTFDYKNPSQPSNPKGTSLPTMGGQGELPDQLEVYEYTGA
FT                   YTYLDQSRGDHLTKIRMEEWESQARRFHGAGGVRAIDAGRRFTLADHPEHDRDPADQRE
FT                   FATIEAAWWIENNLPVSSGSADFPYSLRDALTRAQEGYGADSAFRVPHPDGSVGFYLVE
FT                   VEAQRTSVPYRSPFEHAKPKMHLETAIVVGPQGEEVYTDELNRIRVQFVWDRLNPGNEN
FT                   ASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDYVGGDCDRPLAVGRVYNGANKPQWHSDG
FT                   ILSGYRSKEYAGGGYNQLVMDDATGQNRVQLMSSSANSLLHLGYIIDQNGNARGSYLGS
FT                   GFDLRSDAYGALRASQGLYVTTHPKAANSQPLDVKEAQQQLVTGESLIEAMSGVSEQHQ
FT                   AESLKEAHDTMRAFADATQSSVSGSASGGRTAGGGTGSANAFKEPVMLFGSPSGIAMST
FT                   QQSVHMVANDHVNVASGQSVHVAAGKSLIASIGQKLSLFVQNAGMRLFAGKGKVEIQAQ
FT                   SDNVEVTAQKTVKVVSATDRIEIAADQGILLTSGGGYIRIQGGNIEIHTPGAVDVKGAS
FT                   HTFAGPASMGYPLPSPRPDQPGQLELFHKYANGEAVKGGLFTVKDVNGAVLKKGALDNS
FT                   GYTVVSGLPPGAVRVEFGKDPRESDQPANYFKEAKWPAEPVTPSPEAAQAAATGQLASQ
FT                   LKGMAPAAATAAAGLASGGGAGAALGGLASSALPAAAAALGGAGAVSALQTASSLGSAA
FT                   KQVAGMVQAARQGGLAALAAPAANAASGALQGALPGVAGIAGKGATAMASAGGAAGMKL
FT                   PTSGFGGPLKS"
FT   gene            382197..386840
FT                   /locus_tag="Bmul_0353"
FT   CDS_pept        382197..386840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0353"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: bvi:Bcep1808_0452 YD
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14048"
FT                   /protein_id="ABX14048.1"
FT                   /translation="MAQQLPPGAEKEQAVTWLSDVSPKDVAAVGNRFDAWLRRISGNHI
FT                   TFEDVKTFAGAVPIVGNIMAMVDALGDIAEIVEKRGGQVLDYMSLAINLLGIIPIPPTL
FT                   APFRMSARPLLALVRHELLATRNNLGAAIISVLVTHINATCATEIEDFLNKLKAGLTEL
FT                   LDGCASKCEEIMIALANGMDKALHGQLFDAGGNLRRQQQLAKKIADDRPWYSPSRVGDG
FT                   IQFAYEGTKALGKKVANKTAGTMAKLAPDAWLEPFRGTVTFLRTEAPKVATSIRSLAGS
FT                   EEGKMMWLVLQLIEAVGRVKARAKLHEQSADVKAAGKSQAKKTRGQEGLEKTDAQAPAE
FT                   GQGKSKCKACGIGGSPASIDFAFGDETFSHVDFDLPGALPLVWERTYRSRLSAYDSGEL
FT                   GARWITPYTTRIDIKNDRWIYRDAEGRSIDYPALAAGAVHDDLSENLTLSRLDDTWATI
FT                   AYGHDVLHVYERRGDAFRLAMQKDRAGNTVTLDYDALDRLARLIDASGNVLALEHDRHG
FT                   RIVQIEQVLKDGERRTLASYEYDANGDLVRAVDRHGNARTYQYHRHLVTRYTDRTGRGM
FT                   SLEWDGADAEDNADAKCIREYADDGSLDIRLAWNPNIRLTYVTDALGQMTRYYFNIHGY
FT                   VYRIVYPDGNQEWFRRDANHNLVLHIRQDGSIEHREYDARGNLVRHERADGSIIEMAYD
FT                   DKDQMIRLVDPNGHVWQRKYDDAGNLVEEIDPLEHATKYAYNDKGLPTQITDAKGGTKT
FT                   LEYNDAGQLTSYTDCSGKKTEWRYDDIGRVVEAKDAAGGVVAYGYGPNGQLSEIRSPAG
FT                   VEHVQYDAEGRLLRHTDQLNRSTRYSYDAAGRIASRADALGQTIAYRYDRLGRLTALTD
FT                   ANFATYQFHYDPAGRLIEEIGFDGKSTRYQYDKESGSLVSVDEAGCVTSVDLDANGRLL
FT                   KRASGESEERFAYDRSGRLIDAVNRYSRVQFFFDPVGNLVREHHAYNLFGERRSYVWHH
FT                   EYDELGNRRRTVRPDGHAIDWLMYGSGHVHGMLLDGDERVQFERDDLHRETVRMLSSKV
FT                   GQRTHYDPAGRVLQQTIQRSSSPAPLVERRYRYDAAGQLSRIEDSRKGGIDYRYDPVGR
FT                   LIEAISPVAKERFAFDPASNIVDPVRSSDTPASRPSPVRPDSTLPAEVPKVLGNLLKAY
FT                   AGMHFEYDARGNLVRKRTPAGEQEYEWDAFNRLLSARVAETSRQSEARYFYDAFGRRIA
FT                   KEVNGERTVFGWDGDTLAYESDGERGTHYIYEPGTFVPLAQYVAEPVVGIETPEWKSSD
FT                   RYVPEADPLQKVPQRRADAKLFYYHCDQIGTPQLLTDDDGDVVWEASYKAWGEAREVIA
FT                   RASKAAGIVARNSLRFQGQQEDEETGLHYNRYRYYDPNSGRFVSKDPVGMVGGINVYQY
FT                   APNAVAWVDPLGLRKRIGCPGKFHSFHDFDLPQDKLFASDGVQFRLANKALIERMNTDE
FT                   AFRRNLLSRNPALLDWSKKAKDLGSSPPGMTWHHNDEVGRLNLVDRSDHGDNHGIYHPD
FT                   GTGGRDKWGGGQLGRKGKLDSVTGCPL"
FT   gene            386837..387187
FT                   /locus_tag="Bmul_0354"
FT   CDS_pept        386837..387187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14049"
FT                   /protein_id="ABX14049.1"
FT                   /translation="MNNFVVNAFYKIDDLIALVRDKRDRDAIYMVYVEKDTGDLRSGMD
FT                   VYVGDVPDFDDEDNEVLPESVVELGLEQGYMREHLQDVVDLAYKQKPTASIDEVIKCLN
FT                   HYSKYDDFLDLN"
FT   gene            387305..388549
FT                   /locus_tag="Bmul_0355"
FT   CDS_pept        387305..388549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0355"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: bch:Bcen2424_0460 YD
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14050"
FT                   /protein_id="ABX14050.1"
FT                   /translation="MPCWKTRRRRFRSWRGQSIGCLQTSPVSRPVERHAFVAIEPGATG
FT                   KCVADRWARGPGLASEGVCGDTSSPVRPDSTLPPEVPKVLGNLLKAYAGMHFEYDARGN
FT                   LVRKRTPAGEQEYEWDAFNRLLSARVAETSRQSEARYFYDAFGRRIAKEVNGERTVFGW
FT                   DGDTLAYESDGERGTHYIYEPGTFVPLAQYVAEPVVGIETPEWKSSDRYVPEDDPLQKV
FT                   PQRRADAKLFYYHCDQIGTPQLLTDDDGDVVWEASYKAWGEAREVIARASKAAGIVARN
FT                   SLRFQGQQEDEETGLHYNRHRHYDPQLGRFTSRDPIGLNGGINVFRYAPNPVGWVDPLG
FT                   LTCCDCLYTGVSANHPAIDDAKRGIVRPADPSATLTPEHYAEGGLTGQSQFASWTPIRI
FT                   WLCSMPIKMVRAGRC"
FT   gene            complement(389207..390466)
FT                   /locus_tag="Bmul_0356"
FT   CDS_pept        complement(389207..390466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0356"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: bte:BTH_II0431
FT                   transposase, mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14051"
FT                   /protein_id="ABX14051.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRATINEQLAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPVGRTNHRNGTSRKRIATDDDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYQAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   gene            391800..395372
FT                   /locus_tag="Bmul_0357"
FT   CDS_pept        391800..395372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0357"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: bch:Bcen2424_2940 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14052"
FT                   /protein_id="ABX14052.1"
FT                   /translation="MTARLPIDGTPALSDYRLTDNLTATRGRIFLTGTQALIRLLLMQR
FT                   ASDTAQGLNTAGFVSGYRGSPLGMVDQQLWKAKKLLDASGVRFLPAINEELGGTAVLGT
FT                   QRVEADPERTVDGVYAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPIVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALQTQWPAPQGYTPPAGGLHNRWPDLPSLTIEARLAAKLDAVRHFARTNSIDKWIA
FT                   PSARANVGIVTCGKAHLDLMEALRRLDLTVDDLDAAGVRIYKVGLSYPLELTRIDTFVD
FT                   GLDEVLVIEEKGPVIEQQIKDHLYNRTEGARPRVLGKHDAAGACLLSELGELRPSRILP
FT                   VFAEWLARHKPALDRRERVVDLVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMDRDTTGLIQMGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAI
FT                   RQAVAAKANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPQKY
FT                   DGHHGLFPAGTTFHHRSELDAVQRELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDK
FT                   RLFINDAVCEGCGDCGVQSNCLSVEPLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTV
FT                   EGAALKKAAGAAFDEAALAARVDALPVPATHLDAAPYDMLVTGVGGTGVVTVGALISMA
FT                   AHLEGKSASVLDFMGFAQKGGSVLSFVRIASSDRWLNQVRIDTQQADVLLACDMVVGAS
FT                   AEALQTVRRERTRIVVNTHSIPNASFVQNPDANLHADALLAKMRHAAGDGFMSSCDAQA
FT                   LAAKFLGDTIGANILMLGYAWQLGLVPVSLAAMMRAIELNNVAVPMNKLAFSVGRMAAG
FT                   DPAALDALWNARHAVAVHAAPQTLDELIADREARLHAYGGARYVERYRALVGAARAKGD
FT                   DALTHAVATTFYRLLAVKDEYEVARLYADDAFRASLEAQFEGVPGQDYRVKFNLAPPTV
FT                   AKAGSDGGAPKKRVFGQWMWPVLGMLARVRNLRGTWLDPFGRTVERRMERALADDYETT
FT                   LTRAFAAMTTDNAARVVQLADLHARVRGFGHVKLRNLAGVKRAERELALQLGIDAATSA
FT                   AVREALDELKGAGMLKGIPVVVAK"
FT   gene            complement(395477..397372)
FT                   /locus_tag="Bmul_0358"
FT   CDS_pept        complement(395477..397372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0358"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: bcn:Bcen_2325 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14053"
FT                   /protein_id="ABX14053.1"
FT                   /translation="MNPRFIRPAPDGEQASSKLRASVDHARAARCTRCCTSTAQRSCTV
FT                   CVHPHRRTGAQRSREHATLRTVVSFPAFAVSMEIVFTVLILLLTVALSGALTRVLPLRL
FT                   PLPLMQIAFGAALAWPQLNLHVTFDPEIFMLLFIPPLLFADGWRIPKRELYLQRRAILM
FT                   LAFGLVFMTVLAVGYFAHWLIPELPLPIAFALAAVLSPTDAVALSGIAGKGRIPPQLMH
FT                   ILEGEALMNDASGLVALKFAIAAALTGVFSLRDASLTFVVVAAGGLATGAAVSWLFSAL
FT                   STRFLNAEQEGDPAPGIVMTLLVPFAAYLFAEHFDLSGVLAAVSAGMMMNYTSFSRKST
FT                   VASRVRAESTWAMIEFVFNGMVFIMLGLQLPHIIGRALVEAHHTSDALVGRMIFNVGAM
FT                   MLSLYAIRFLWVWLLRWFASRRAARQGLAGTMAGVRTIAVMTVGGVRGAVTLAGVLSIP
FT                   VALSSGAPLPGRDTAIFIASAVILGSLIVAVIGLPLLLRGVRTTRNPLAGEERAARAAA
FT                   AQAAIRAIDASHDAISAELDESGAARCADISARVMDQYRRRLAALAEDGPTPRAEAKQA
FT                   ETMELQMRIAAVRAERSMLYRLRTESKISDETLTKLIREIDLSETALSTRKKGIV"
FT   gene            397451..398722
FT                   /locus_tag="Bmul_0359"
FT   CDS_pept        397451..398722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0359"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bam:Bamb_2985
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14054"
FT                   /protein_id="ABX14054.1"
FT                   /translation="MTTEQQERPVVASPYRFEREVSSGFERFATRHRELTLTTVFQPIF
FT                   SLAHQRAVGYEALLRAHDTLDRAVSPLDVFGDAARHGELLQLDRLAQALHLENFALLGA
FT                   SREWLFLNVHPGVLTDPFQAAALLANLKRLGIPPRRIVLEVLEQRADDVERLADAVRAC
FT                   RAQGFLIALDDFGAGHANVERIWQLDPDIVKLDRILLSQAAHRTGPTAILHGLVALLHE
FT                   AGKLVLVEGIETEHDAQVALACEADFVQGYYFGRPAPGLPDSAAATGCIGELTERFREQ
FT                   ADARERRDAQRLAPYLRAFERAAERLAAGEPLDDVCWNFLALDDAARCFLLDARGRQAG
FT                   RNIVLRADRAPRETRFSPLSEAQGANWLRRPYFRTAIAEPGRVQVTRPYLSINEAQPCV
FT                   TLSIAIRIGDAQCVLCGDIDWIDG"
FT   gene            398791..399513
FT                   /locus_tag="Bmul_0360"
FT   CDS_pept        398791..399513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0360"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bur:Bcep18194_A6287
FT                   CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14055"
FT                   /protein_id="ABX14055.1"
FT                   /translation="MNRPAAAAVLLEVIATTVADAKAAARAGADRLELVTAIGEGGLTP
FT                   SIGLIEAVVAAVSIPVNVIVRPHSRAFVYDADDLRVIERDVRAAVAAGANGVVFGALDA
FT                   RGDVDADALARVAAAADGRDLTFHRAFDVARDLNAAFDTLLRVPAVTSVLTSGGHPSVL
FT                   DATATITRMVRHAAGTTCTVLAGSGLTVDAVGEFVRTTGVRAVHFGSGVRPRGEVLAPV
FT                   DERLVAKVRAVLDRATQA"
FT   gene            complement(399552..399953)
FT                   /locus_tag="Bmul_0361"
FT   CDS_pept        complement(399552..399953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_A0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14056"
FT                   /protein_id="ABX14056.1"
FT                   /translation="MKHIAVAVLGIAAATAHAAEPKCSSQTLNGHTTELCVVSIPFQHD
FT                   YYTLKVDRALIFTLPDDYVEDVALTHTIPQDAAIEFPLSRQGTPTVKIAGGCTPVSETR
FT                   DGTAVEVGRRCAFKWGNVDILKDLTIRYD"
FT   sig_peptide     complement(399897..399953)
FT                   /locus_tag="Bmul_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(400141..400380)
FT                   /locus_tag="Bmul_0362"
FT   CDS_pept        complement(400141..400380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0362"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated; KEGG:
FT                   bam:Bamb_2983 biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14057"
FT                   /protein_id="ABX14057.1"
FT                   /translation="MRTIAVARITMPKAVVRLSAGREQLDDGLQALCFLAGANSMFYGD
FT                   QLLTTSNPQTQKDRALFERLGIRASEADALAEHA"
FT   gene            400476..400610
FT                   /locus_tag="Bmul_0363"
FT   CDS_pept        400476..400610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0363"
FT                   /product="CutC family protein"
FT                   /note="KEGG: bur:Bcep18194_A6287 CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14058"
FT                   /protein_id="ABX14058.1"
FT                   /translation="MRTTGVRAVHFGSGVRPRGEVLAPVDERLVAKVRAAIDGAARNG"
FT   gene            complement(400630..401985)
FT                   /locus_tag="Bmul_0364"
FT   CDS_pept        complement(400630..401985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0364"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: bur:Bcep18194_A6285 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin tranporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14059"
FT                   /protein_id="ABX14059.1"
FT                   /translation="MANLAQARTDEDLDLSTLAIPDHARMPPFSLTMAWWAVCSAVFYI
FT                   VVGATLALTYGARNALIGMALSVVSYGAVNTIISRYAIRTGLSVALFSRVLFGSAGAAL
FT                   ATLIFFATAIYYAVFEGSVIAIAAHHLFPALDYKWAALLVVGYSVPLVFGSVQHWLDKF
FT                   NGVLLPFYLLGLLAAVGLATAEYGYHAAWLDIGPAGGAPAGGWWHCFVYYMGVWVLMMF
FT                   TFDYARFGRRQDARYHGRFNFGMPFYLVTFLLNGAAGIYLVGTIPGLGTLSEVSVVLAL
FT                   LKLMGLWGLLFVWVTQSRINTANYYLATVNMQAFFQKAAGLRAPKFVWALVVGAVVYAL
FT                   MMADVFSRILQALAYQGIFVVAWVGVALAHILSARYGELVGDDVECRDAHVPTFNPGGL
FT                   AAWFAGAFAGLALNHASGFAASLSAPATFAVSWIVYRALLAGAKRTWFVRNT"
FT   gene            complement(402222..403217)
FT                   /locus_tag="Bmul_0365"
FT   CDS_pept        complement(402222..403217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0365"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="6.3.4.6"
FT                   /note="KEGG: bur:Bcep18194_A6284 allophanate hydrolase;
FT                   TIGRFAM: urea amidolyase related protein; PFAM: Allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14060"
FT                   /protein_id="ABX14060.1"
FT                   /translation="MQADAHKLIEVVKPGLATSVQDMGRQGYYHVGIPPSGSLDQYASR
FT                   AANLLVGNPEQAAVLECTLLGPELLFHTDALIAVTGAEMTPKIDGVGQRCNVALRIRAG
FT                   SVLSFNYVKGGARAYLAVAGGIDVPVVLGSRSTYALGAIGGHAGRRLQKGDRLPVGAAR
FT                   EPGREGRELPSAVCRPLDSQVELRVLTGLYHYRLSDESAHTFFDDEWTVAPEADRIGYR
FT                   YKNGRPLQFRPREQPFGAGADPSNIVDACYPIGSIQVPAGLEPIILHRDAVSGGGYATI
FT                   GTVISADMDLIGQMQPNHRARFVRVTMADALAARREYQRRLALLRAMLQD"
FT   gene            complement(403207..404082)
FT                   /locus_tag="Bmul_0366"
FT   CDS_pept        complement(403207..404082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0366"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   bur:Bcep18194_A6283 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14061"
FT                   /protein_id="ABX14061.1"
FT                   /translation="MTTRYTFGGDEFVFVEISEAMSLDAFFKGTAITRELQRRAVPGIT
FT                   EICPANASYQVRYDPDTIAPDALVALLKSIEADVGEASLDLDTRIVEVPVLYNDPWTHE
FT                   TMMRFRERHQDPSSTDLEYAARINGKRDVDDFIAAHSGAPWFVSMVGFVAGLPFMYQMV
FT                   ERERQLEVPKYLRPRTDTPKLTVGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPEQRLD
FT                   YLRDFMVFFRPGDIVKFQPIDRAAYDAAVAAVEAGTFSLRVRPVKFSLDAFRRDPDAYN
FT                   RSLVEVLYAS"
FT   gene            complement(404079..405569)
FT                   /locus_tag="Bmul_0367"
FT   CDS_pept        complement(404079..405569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0367"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   bur:Bcep18194_A6282 acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14062"
FT                   /protein_id="ABX14062.1"
FT                   /translation="MNRATSCDAFYRPSRIRTVLVANRGEIAVRVIRAAHELGMRAVAV
FT                   VSDADRDSLAARMADEAIHIGSSHAAKSYLNPAAILDAARQCGADAIHPGYGFLSENAA
FT                   FAAQVEAAGLVFVGPDAQVIATMGDKARARDTARRANVPTVPGSDGVVQSLDAAREVAA
FT                   RIGYPVMIKAAAGGGGRGIRVAHDAAQLEAELPLAQREAQAAFGDGGVYLERFIARARH
FT                   IEVQVLGDGRDVVHLFERECSLQRRRQKILEEAPSPSLTPALRAELCASATRLAREVGY
FT                   RSAGTLEYLFDDTRGEFYFIEMNTRIQVEHPVTDAITGIDLVRETLRIADGEPLRFAQQ
FT                   DIAMRGAALECRINAEDPLQDFRPNPGRIDALVWPTGPGVRVDSLLYPGCVVPPFYDSL
FT                   LAKLIVHDESRAAALQRLSRALGELQVGGMKTTAPLHAALLADADVRAGRYHTNFLEAW
FT                   MPRWRAALDAAAAAASRSDSESANLNVNADATRVGEAL"
FT   gene            complement(405574..405816)
FT                   /locus_tag="Bmul_0368"
FT   CDS_pept        complement(405574..405816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0368"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: bur:Bcep18194_A6281 acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14063"
FT                   /protein_id="ABX14063.1"
FT                   /translation="MALHDIVSPLPGTFYRRPSPDADYYVAVDATVAAGAVVGLVEVMK
FT                   QFTEIESEVPGRVVELLVEDGEPVDAGQVLMRIEG"
FT   gene            complement(405834..406616)
FT                   /locus_tag="Bmul_0369"
FT   CDS_pept        complement(405834..406616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0369"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG:
FT                   bur:Bcep18194_A6280 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14064"
FT                   /protein_id="ABX14064.1"
FT                   /translation="MRKHSVDLNSDMGEGFGPWTIGDGVDEQIMPLISSANIATGFHAG
FT                   DPNIMARTVQLARDAGVGIGAHPGFRDLVGFGRRTIAESPQALVNDIVYQLGALREFAR
FT                   LNGVSLQHVKPHGALYMHAAASETFSRLLIETLQRIDPGLLLYCMEASATYRVAAEYGQ
FT                   PVVREFYADRDYDRSGSIVFTRRVGRLDARQVADKVLRACVDGKVRTVDGDDIDIDFDS
FT                   VCIHSDTPGALALVRETRDALSREGIRTAGPRPLAAQH"
FT   gene            406875..407792
FT                   /locus_tag="Bmul_0370"
FT   CDS_pept        406875..407792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0370"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_A6279
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14065"
FT                   /protein_id="ABX14065.1"
FT                   /translation="MALTLRQLKYFVATAELGQISQAAIQLTISQSAVTSAIKELEDSL
FT                   GTQLFLRTSAGVTLTDTGRRFLNHAYAILSSVDEAMRIPNLESTLTGTLAIAASYTVLG
FT                   YFLPHHVLRLNTLYPRLTIHLHELNRESIEEGLIAGRYDMAVLLTSNVSNPELVLEPVI
FT                   HSVRRLWVGAHHPLLRRESVTFAEVAREPFVMLTVDEAGQTAMRYWNETPYRPNVILRT
FT                   SSVEAVRSMVANGTGVAVLSDMVYRPWSLEGRRIETILLRDPVPPMSVGLAWRKNIELS
FT                   PAMHAVRDYFRHTFMEPRTIGGGA"
FT   gene            complement(407896..408915)
FT                   /locus_tag="Bmul_0371"
FT   CDS_pept        complement(407896..408915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0371"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: bvi:Bcep1808_3029 biotin synthase; TIGRFAM:
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14066"
FT                   /db_xref="GOA:A9AE44"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE44"
FT                   /protein_id="ABX14066.1"
FT                   /translation="MTQAQTAAAQPDAIPVAAPSPQRWRVADVVALFELPFNDLIFRAQ
FT                   QVHREHFDANAVQLSTLLSIKTGGCEEDCGYCSQSAHHDTGLKAEKLMDVDAVLDAARA
FT                   AKANGASRFCMGAAWRNPKERHMPALTEMVRGVKALGLETCMTLGMLEDEQAKQLADAG
FT                   LDYYNHNLDTSPEFYGQVISTRTYQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGL
FT                   ISQLANLNPYPESVPINNLVAIEGTPLAGTAPLDPFEFVRTIAVARITMPKAVVRLSAG
FT                   REQLDDGLQALCFLAGANSMFYGDQLLTTSNPQTQKDRALFERLGIRASEADAMSADA"
FT   gene            complement(408956..409675)
FT                   /locus_tag="Bmul_0372"
FT   CDS_pept        complement(408956..409675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0372"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   bvi:Bcep1808_3028 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14067"
FT                   /db_xref="GOA:A9AE45"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE45"
FT                   /protein_id="ABX14067.1"
FT                   /translation="MSTPLSLFVTGTDTEIGKTFVSAALLHGFARHGLRAAAMKPVAAG
FT                   AYERDGVWRNEDADQLDAAASVVLPPELRTPFLLKAPAAPHIVAAHEHVTLDIDTIVAC
FT                   HRDALTRADIVVVEGVGGFRVPLNDTQDTADLAVALGLPVVLVVGMRLGCISHALLTAD
FT                   AIAARGLTLAGWVANHVDPAMTYADENVATIRDWLAREHRAPLLGRIAHMAPADPESAA
FT                   ATLDIAALVDTLRAAQR"
FT   gene            complement(409672..410856)
FT                   /locus_tag="Bmul_0373"
FT   CDS_pept        complement(409672..410856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0373"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: bch:Bcen2424_2932 8-amino-7-oxononanoate
FT                   synthase; TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14068"
FT                   /db_xref="GOA:A9AE46"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="PDB:5VNX"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE46"
FT                   /protein_id="ABX14068.1"
FT                   /translation="MNLLDTLQRGLADLDAQGLRRVRRTADSACDAHMTVNGREIVGFA
FT                   SNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGGFSDAP
FT                   RALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLG
FT                   ALLEACTSQTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRG
FT                   ALAAAALRSPHLVYVGTLGKAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHA
FT                   VSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAA
FT                   MRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEAA"
FT   gene            complement(410853..412199)
FT                   /locus_tag="Bmul_0374"
FT   CDS_pept        complement(410853..412199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0374"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bam:Bamb_2980 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14069"
FT                   /protein_id="ABX14069.1"
FT                   /translation="MSTSAPDDWVARSLRAVWHPCTQMKHHERLPLVPVARGAGVWLYD
FT                   RDGRRYFDAISSWWVNLFGHANPDINAALKDQLDTLEHAMLAGCTHEPAIELAERLHAL
FT                   TANTLGHAFFASDGASAVEIALKMSFHAWRNRGRADKREFACVANGYHGETIGALGVTD
FT                   VALFKDAYDPLIRHAHVVASPDARGALPGETAADVAGRALADVRRLFVERGERIAALIV
FT                   EPLVQCAAGMAMHDPSYVRGLRALCDEFDVHLIADEIAVGCGRTGTFFASEQAGVWPDF
FT                   LCLSKGISGGYLPLSLVLTRDDVFAAFYDDDTTRGFLHSHSYTGNPLACRAAVATLDLF
FT                   ARDDVLASNARKSAALRAALAPLAAHPDVRHLRERGTLFAFDVALDGDAARGFSRRFFE
FT                   RALERELLLRPIGTTVYLMPPYVMSDDDIAWLAQRTRDTLEATLAEIAR"
FT   gene            complement(412731..414002)
FT                   /locus_tag="Bmul_0375"
FT   CDS_pept        complement(412731..414002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0375"
FT                   /product="dienelactone hydrolase and related enzymes-like
FT                   protein"
FT                   /note="KEGG: bch:Bcen2424_2930 dienelactone hydrolase and
FT                   related enzymes-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14070"
FT                   /protein_id="ABX14070.1"
FT                   /translation="MAFSKVVVGWMAACALSAAQAGTLPNANADAGAAGKSLAHAERFD
FT                   YGDSGLPQVAADLNERILRIPADASGTITLEATLFKPDGPGPFPLVVFNHGKNTGDLHQ
FT                   QPRSRPLAFAREFVRRGYAVIAPNRQGFAGSDGTYRQEGCNVEKNGLAQAADVAATIRY
FT                   MSQQSYVDASRIVVAGTSHGGLVSVAYGTEAAPGVRGIINFSGGLRQDLCDGWQKNLVD
FT                   AFDQYGAHTAVRSLWLYGDNDSVWTPALVSQMHDAYVAHGTQAQFIDFGRYKDDAHRLI
FT                   VDRDGVPVWWPAVHAFLAELNLPTAVRYAVASPHEPKATGYASIDAVDAVPYVDEAGRE
FT                   GYRRFLNQHPSRAFAVSSEGAWSWAEGGDDPMALALDNCAKQGAGPCRLYAVNDRVVWN
FT                   ANTQTADNDDTGAHGADTRALASR"
FT   sig_peptide     complement(413937..414002)
FT                   /locus_tag="Bmul_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            complement(414109..414546)
FT                   /locus_tag="Bmul_0376"
FT   CDS_pept        complement(414109..414546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14071"
FT                   /protein_id="ABX14071.1"
FT                   /translation="MIPNPPDTCPCGGASPAAAGKAAPPRYAACCGRFIDGGVPAPSAL
FT                   ELMRSRYTAYVLGAIDYLRATWDARTCPADLDIDPDAPDAPRWLGLAIKRHAALDETHA
FT                   EVEFVARYKVGGRAYRLHETSRFTRDEHGFWRYVDGDVSER"
FT   gene            complement(414586..415263)
FT                   /locus_tag="Bmul_0377"
FT   CDS_pept        complement(414586..415263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0377"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_A6271 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14072"
FT                   /protein_id="ABX14072.1"
FT                   /translation="MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALG
FT                   AHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNV
FT                   RGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQ
FT                   TRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVE
FT                   LSW"
FT   gene            complement(415358..416143)
FT                   /locus_tag="Bmul_0378"
FT   CDS_pept        complement(415358..416143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0378"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bam:Bamb_2976
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14073"
FT                   /protein_id="ABX14073.1"
FT                   /translation="MTDTTTMNTQDHPLSHLFDNNDAWVKRQLAEDPQFFARLADQQAP
FT                   EYLWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDILRVKHIM
FT                   VVGHYGCSGVNAALHNRRVGLADNWLHHVQDVRERHAALLDEWPVGEARYRRLIELNAI
FT                   EQVVNVCRTTIVNDAWARGQSLTVHALVYGVHDGRMRNLGMAVSNFDSLEETYRRCVAS
FT                   LTARGEHAPDNDIIAADAARLDAVAQSVADTLKHGDGNC"
FT   gene            complement(416180..417997)
FT                   /locus_tag="Bmul_0379"
FT   CDS_pept        complement(416180..417997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0379"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: bch:Bcen2424_2926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14074"
FT                   /db_xref="GOA:A9AE52"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE52"
FT                   /protein_id="ABX14074.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQSMLEYFDRHYRIFREAAVEAKALFERA
FT                   DWHGLQRLARERITSYDERVQECVEVLQDEYDAESIDDEVWQQIKLHYIGLLTSHRQPE
FT                   CAETFFNSVCCKILHRSYFNNDFIFVRPAISTEYLENDEPAAKPTYRAYYPGTDGLAVT
FT                   LERIVTNFQLEPPFEDLARDIACVMQAIHDEFGRFDEAPNFQIHVLSSLFFRNKSAYIV
FT                   GRIINADRVLPFAVPIRHVRPGLLALDTVLLRRDLLQIIFSFSHSYFLVDMDVPSAYVD
FT                   FLCTIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIVAPGIKGLVMLVFTL
FT                   PSFPYVFKIIKDHFPPPKETTRRQIMEKYLLVKRHDRLGRMADTLEYSSVALPLARLDH
FT                   ALVRELEKEVPSLLEYEGDNLVIKHLYIERRMTPLNLYLQNGTDAEVEHGVKEYGNAVK
FT                   ELMKANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRNEEDELSGEPW
FT                   YTVGPHDIFPETYGPFLLGDPRVRAAFLKHHADFFDPALWQASKDKLLQGELPDFFPYD
FT                   ASLRFCVRYPERFRATDERAPARGAQRAA"
FT   gene            418313..419392
FT                   /locus_tag="Bmul_0380"
FT   CDS_pept        418313..419392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0380"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bur:Bcep18194_A6268 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14075"
FT                   /protein_id="ABX14075.1"
FT                   /translation="MNALEHQLDYPFADTLPAAGDTFEVAPGVRWLRMPLPFSLDHINL
FT                   WLLRDEIDGQAGWTVVDCGIASDAIRTHWEQIFDAHLDGLPVLRVIVTHCHPDHFGLAN
FT                   WLCEGGDKRRWNVRLWMTLGEYMFGCLMAAGNGSNAGGAAAADHFARHGLTDAASLEKL
FT                   RNRRSYYSDLVPAVPPRYRRLRDGDAVTIGTRTWRVVTGYGHSPEHCALHSEADGVLIS
FT                   GDMVLPRISTNVSVFDLEPEANPLALYLQSLGRYETMAPDTLVLPSHGKPFRGVRTRIA
FT                   QLRAHHDARLDEVRVACAEQPMSAADIVPIMFRRRELDIHQMTFALGEAIAHLNLLWLA
FT                   GELVREQGDDGVLRFRIAR"
FT   gene            complement(419468..421063)
FT                   /locus_tag="Bmul_0381"
FT   CDS_pept        complement(419468..421063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0381"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bvi:Bcep1808_3018 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14076"
FT                   /protein_id="ABX14076.1"
FT                   /translation="MQVKLFAAAAVAAALAAPGLVAAKPLTVCTESSPDGFDVVQYNSL
FT                   VTTNASADVIFNTLVSYDEAAKKVAPALADKWEASADGLTYTFHLRPNVAFQTTDYFKP
FT                   SRPLNADDVVFTFSRMLDDANPWHKVAGASGFPHAQSMGLAKLVKSVSKVDDLTVKFVL
FT                   NEPNATFVPILTMGFASIYSAEYAAQLLKAGKQSDLNAKPIGTGPFVLKSYTKDALIRY
FT                   DVNPSYWGAKPKVDRLIYAITPDPSVRLQKLKAGECQIALSPKPQDVLAAKGESALKVV
FT                   QTPAFMTAFVALNTQKKPLDNAKVREALNLAFDRATYLKVVFDNTATAANNPYPPNTWS
FT                   YAKDVAPYPYDPAKAKQLLAQAGFANGFSTTIWTRPTGSVLNPNPKAGAELLQADLAKI
FT                   GVKADVKVIEWGELIKQAKLGQHDMLFMGWAGDNGDPDNYLTPLFSCNAVKSGINFARF
FT                   CDAQLDKLIADGKATADQGKRTKLYESAQKIIHDQALWIPLGYPTAAALTRANVSGYRV
FT                   SPFGRQNFATVAVQ"
FT   sig_peptide     complement(420992..421063)
FT                   /locus_tag="Bmul_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 24"
FT   gene            complement(421525..422298)
FT                   /locus_tag="Bmul_0382"
FT   CDS_pept        complement(421525..422298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0382"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bch:Bcen2424_2922 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14077"
FT                   /protein_id="ABX14077.1"
FT                   /translation="MTTPLKVFITGASSGLGLAMAEEYARQGAVLALVARRTDVLDAFA
FT                   RRFPKLSVSVYRADVRDADALAAAAASFIAAHGCPDVVIANAGISQGAVTGQGDLAAFR
FT                   DVMDINYYGMVATFEPFVGPMTAARHGTLVGVASVAGVRGLPGSGAYSASKSAAIKYLE
FT                   ALRVELRPAGVAVVTIAPGYIRTPMTAHNPYPMPFLMDADRFAAQAARAIARKHAFRVI
FT                   PWQMGVVAKVLHVLPRWLYDRLFERAPRKPRAGAH"
FT   sig_peptide     complement(422233..422298)
FT                   /locus_tag="Bmul_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(422318..422956)
FT                   /locus_tag="Bmul_0383"
FT   CDS_pept        complement(422318..422956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0383"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bvi:Bcep1808_3016
FT                   DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14078"
FT                   /protein_id="ABX14078.1"
FT                   /translation="MKKLLSTLLLSLGLAAGFAQASPAAPVAGKDFEVMKSPQPVSAPA
FT                   GKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGGNIEFKRVPVAFRDDFVPHSRLYYAVSA
FT                   LGIAEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQGQVKQSA
FT                   ELLKNYAIDGVPTIVVQGKYKTGPAYTNSIPGTAQVLDFLVKQVQDKKL"
FT   sig_peptide     complement(422891..422956)
FT                   /locus_tag="Bmul_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(423026..423904)
FT                   /locus_tag="Bmul_0384"
FT   CDS_pept        complement(423026..423904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0384"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   bch:Bcen2424_2920 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14079"
FT                   /protein_id="ABX14079.1"
FT                   /translation="MAQPRRTSKQSKQAGGTFLGIVLGLIVGLAIAVVVALYITRSPSP
FT                   FVSKVAPPPADNGASQAQPFDPNRALQGKTPGQPVPQAAQPAPPNTAPGQAANQTQGGL
FT                   LPEPQIVEVPPSGNTGSTGSSGTTASNNGSNNGVAVPPKTADNPPPKKPQPPAPDDDLG
FT                   RFAAQKQAQQQAAAQKQQQQQAANTAKPSSPTSSTSSTTAAAKPPTANDANTGYFLQVG
FT                   AYKTESDAEQQRARLGFQGFESKVSKRDVSGVTYFRVRVGPFSKFEDMNSARQRLSDAG
FT                   VDTAVIRFTKQ"
FT   sig_peptide     complement(423806..423904)
FT                   /locus_tag="Bmul_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.944 at
FT                   residue 33"
FT   gene            complement(424043..425839)
FT                   /locus_tag="Bmul_0385"
FT   CDS_pept        complement(424043..425839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0385"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bch:Bcen2424_2919 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14080"
FT                   /db_xref="GOA:A9AE58"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AE58"
FT                   /protein_id="ABX14080.1"
FT                   /translation="MLPAQKQTLEALLADSVQQVAHALKGADAANAGVAFVAPAITLER
FT                   PKVAAHGDVACNVAMQLAKPLGTNPRQLAEKIVAALTAQPGAQGLVESAEIAGPGFINL
FT                   RLSAAAKQAVIGAVLAQGRAFGTSDREKGKRVLLEFVSANPTGPLHVGHGRQAALGDAL
FT                   ANVIASQGYAVHREFYYNDAGVQIGNLAISTQARARGLKPGDAGWPEAAYNGEYIADIA
FT                   RDYMNGETVAAKDGEPVKGAGDVDDLDAIRKFAVAYLRREQDMDLQAFGVKFDQYYLES
FT                   SLYSEGRVEKTVDALIKAGMTYEQDGALWLRTTDEGDDKDRVMRKSDGTYTYFVPDVAY
FT                   HVTKWERGFTKVINIQGSDHHGTIARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQE
FT                   VKISKRAGSYVTVRDLIEWSGGAAPGQEAAPDLIDEATITRGRDAVRFFLISRKADTEF
FT                   VFDIDLALKQNDENPVYYVQYAHARICSVLNEWKSRYNGELAQLPQADLSQLTSPQAAS
FT                   LMQKLAEYPDMLTHAANELAPHAVAFYLRDLAGEFHSFYNAERVLVDDEAPRNARAALL
FT                   AATRQVLENGLAMLGVSAPEKM"
FT   gene            426041..426364
FT                   /locus_tag="Bmul_0386"
FT   CDS_pept        426041..426364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0386"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   bch:Bcen2424_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14081"
FT                   /protein_id="ABX14081.1"
FT                   /translation="MITFKSKAAQDLDVLKDFAVYVLGLVGKQLGERGVITHDELDHAI
FT                   AKLEDAVAQAKQERAEHAGHFHEDDADHAHHEVPPSLAQRVAPFLAMLREAKAAQADVH
FT                   WGF"
FT   gene            complement(426468..429185)
FT                   /locus_tag="Bmul_0387"
FT   CDS_pept        complement(426468..429185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0387"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: bvi:Bcep1808_3012 methionine synthase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; Methionine synthase B12-binding module cap
FT                   domain protein; Vitamin B12 dependent methionine synthase
FT                   activation region; cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14082"
FT                   /protein_id="ABX14082.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNGQ
FT                   FDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGEDAFVHHAKLIRRYGAAAVVMAFDEQGQADTFARK
FT                   TEICRRSYDVLVNRCGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYADLDPELRER
FT                   VEDVILNRRPDSTDRLLEIADKFKTGAAKKEENLEWRNQPVEKRLAHALVHGITNFIVE
FT                   DTEEARVKIAAAGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAEAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGATKYLDELKADYERIRDQHANRK
FT                   AQPMVTLAEARANKTKIDWANYTPVKPKFIGRRVFRNYDLNELANFIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANSVNDDDIEIYT
FT                   DESRTDVLLTWRNLRQQSMRPVVDGVMRPNRSLADFIAPKESGVADYIGMFAVTAGLGV
FT                   DVKEKQFEADHDDYSAIMLKALADRFAEAFAEAMHARVRRELWGYASDETLDNDALIAE
FT                   KYTGIRPAPGYPACPDHLVKRDMFAALHADEIGMSVTDSLAMLPAASVSGFYLAHPDSR
FT                   YFSVGKIGQDQLEDYARRMALSLDDARRALAPQL"
FT   gene            complement(429232..430335)
FT                   /locus_tag="Bmul_0388"
FT   CDS_pept        complement(429232..430335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0388"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   bam:Bamb_2965 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14083"
FT                   /protein_id="ABX14083.1"
FT                   /translation="MSVSRLRRSFAMSATPTAASAAPLDASYTRGAELPALLKSRILIL
FT                   DGAMGTMIQRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPQVIREIHDQYFAAGADI
FT                   VETNTFGATTVAQADYGMEDLVVEMNVESAKLARASAAQYATPDKPRFVAGAIGPTPKT
FT                   ASISPDVNDPGARNVTFDELRDAYYMQAKALLDGGVDLFLVETIFDTLNAKAALFALDQ
FT                   LFEDTGERLPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPY
FT                   IAELAKLCDTFVSCYPNAGLPNPMAETGFDETPDVTSGLLREFAQAGLVNLAGGCCGTT
FT                   PEHIAEIAKALADVKPRRWPSQYSEAA"
FT   sig_peptide     complement(430270..430335)
FT                   /locus_tag="Bmul_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(430669..430926)
FT                   /locus_tag="Bmul_0389"
FT   CDS_pept        complement(430669..430926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14084"
FT                   /protein_id="ABX14084.1"
FT                   /translation="MQMIYNSPNYCVVEFAPQAGHHLMNAGGYEIVDKNAQREIFIDGE
FT                   LAERFRAHVKQLIEEEPTLDEVDEFLGQFDSLMMMPVVLH"
FT   gene            complement(431169..432551)
FT                   /locus_tag="Bmul_0390"
FT   CDS_pept        complement(431169..432551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14085"
FT                   /protein_id="ABX14085.1"
FT                   /translation="MRATRRERAAHPTVRHAMTRASRVPTPFRLPMPHADTRPRPASLR
FT                   RWRRVGVALVVALVLHALAALWLARNRESFTPTPPADVPVQVELLKTQPIERAPAPQPP
FT                   AHTAPKPAAPEPAAPKPAPAAAQEQVLTSTQTDAHGAPPAAASAASGVPGASSAQPASA
FT                   PAGASGAATPGPASHGVKFAVPPSGDLQYDTFYNGMQNMIGTIHWRTDGRTYDLSVSMP
FT                   VPFIGPFDYRSEGRIDAFGLAPDRYVEKRGRRPEDIAVFNREQHQVVFTRTPNNAPLPD
FT                   GVQDRFSMLIQLSSLVRGNPSAYKPGVTQQFFVIDNNSGENWPIAVIGDESVQTQAGVV
FT                   QARHFMRLPRRDGDTRRIDMWLAPSVGWLPVRLVQTEPNGAQIELLWHGPLAPPDKPAD
FT                   AAPAAAASAAAASAAAMNAPAAATPPEPAPADASTPVASATVPAQPPPAPAEPAASAPG
FT                   TP"
FT   gene            complement(432551..433417)
FT                   /locus_tag="Bmul_0391"
FT   CDS_pept        complement(432551..433417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0391"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bur:Bcep18194_A6256 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14086"
FT                   /protein_id="ABX14086.1"
FT                   /translation="MSASPLPDDDLADSDTDDTAAGEHGEKVRSGIQSIEVGFRLLDVL
FT                   TSEPRAMMLRDLAQRAGMSPAKAHRYLVSFLRLGVVSQDPVSGRYELGGFALQMGLARL
FT                   ARVDGVKLARIALTEFRDRLDQTVGIAVWGNQGPTIVHWMESSHPAKASLKLGDVMPLL
FT                   GSATGLLFAAYLPRSKTAAMLERELADTRRSPHHGGPRTLDEVEAMLADVRAHEAARVE
FT                   GMLLPTIHAFCMPVFDAVGELALGIVALGHEGTFDIAWGGEIDTALRACARKLSYELGY
FT                   SPVARDA"
FT   gene            433545..434537
FT                   /locus_tag="Bmul_0392"
FT   CDS_pept        433545..434537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0392"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bur:Bcep18194_A6255 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14087"
FT                   /protein_id="ABX14087.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADTIAPTLQRVLDDWAFY
FT                   APQLRELYDALNHGRARRAFPFDPAHCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGARDDIVCPSEAWGIDFEAEVAVITGDVPMSASPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPATAFAPVAVTPDELGDAWSEGRVHRPMIV
FT                   HWNGKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMRYGDTVRIEMFDPSGKSIFGAIEQSVAPPDGVA"
FT   gene            434596..435483
FT                   /locus_tag="Bmul_0393"
FT   CDS_pept        434596..435483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0393"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bch:Bcen2424_2911 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14088"
FT                   /protein_id="ABX14088.1"
FT                   /translation="MFARAGLTTLDPTASTQEQRMADLAAYGGYQALKVTRREHGVLDI
FT                   VMSGEGANRSGLATANAQMHRELADIWRDVDRDPDTRVAVIRGEGKGFSAGGDLALVEA
FT                   MANDYDVRARVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIAAKDARI
FT                   IDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCEPVSGEEAERIGLVSLAVEPADLL
FT                   PKAYEVAERLANGSQSAIRWTKYALNNWLRTAGPTFDTSLALEFMGFSGPDVQEGLRSL
FT                   RERRPPAFPGDAPF"
FT   gene            435559..436347
FT                   /locus_tag="Bmul_0394"
FT   CDS_pept        435559..436347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14089"
FT                   /protein_id="ABX14089.1"
FT                   /translation="MTTDASGSNPFAGFAGFKPADMLERMWDMMRMSPFGAMAPFPGAA
FT                   SGLPPSLSSMSDMMAPLTNVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLA
FT                   TLRAFGAFAQSSMSAAEDAAVAAAKAATAPLGETAQPKPQAGDASAGAEAPPERDAAQQ
FT                   PNQSFDPAGWWNLLQAQFNQLASLAMAQPGMAPGAASPDGAAAAQGAEEPGDAPESTPE
FT                   PAPAAAPRKPAAKRAKPAGSAAARAAAASSPETRPPKRAT"
FT   gene            436369..437760
FT                   /locus_tag="Bmul_0395"
FT   CDS_pept        436369..437760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0395"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: bch:Bcen2424_2909 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14090"
FT                   /protein_id="ABX14090.1"
FT                   /translation="MRLALVLMGGGARAAYQVGVLKALAEIAREADPHRHTLPFAVVCG
FT                   SSAGAINATSIASHADDFSHGVRRLLEFWEHLRADYVYRTDWLGIAAAGARWLATMTFG
FT                   WAAHRSPRGLLDNTPLAHLLQRELSFHRIEQMLEARLLHALAVTALSYSSGRHLTFYQA
FT                   AEPIQAWRRAQRTARLVDLSASHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPL
FT                   SPAIHFGAQRIVVVGAADPRPKIPAANGAGRVRGYPTLAQIGQQVLASVFLDSIGSDIE
FT                   RIEHINRMIEHLPHQVEVDSGWRHVDVLAIAPSERIELIAAKHLKQMPATMRGLLGAIG
FT                   GSQPAGASFASYLLFEEPFTRELIELGYRDGRAQRDTLAAWIAAADGGGMGSGGMAGGA
FT                   MAGGGSVVGGSTVGGSTVGGSVVGSSAVRDDAPSAVPVAATRDASATAPDARVGDDRAA
FT                   GEMRV"
FT   gene            438211..439086
FT                   /locus_tag="Bmul_0396"
FT   CDS_pept        438211..439086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14091"
FT                   /protein_id="ABX14091.1"
FT                   /translation="MNTMLYPELYRSLEAVRWDMEKDIPWDKFDASLLTDEQAKTIKMN
FT                   AITEWSALPATEMFLRDNQHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPELVPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRCAADWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKALNNCGDVARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTVQSRL
FT                   PDPEWLERWLDEQIRFDGEWEKKVVDRILHNLSILFERTFATAQELNRYRKEVTNRLQS
FT                   ESGSSSAQPA"
FT   gene            439262..439744
FT                   /locus_tag="Bmul_0397"
FT   CDS_pept        439262..439744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0397"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   rfaE bifunctional protein; PFAM: cytidylyltransferase;
FT                   KEGG: bvi:Bcep1808_3002 RfaE bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14092"
FT                   /protein_id="ABX14092.1"
FT                   /translation="MPASFERKLITRDALVALRASLPSPVVFTNGVFDILHRGHVTYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINREDDRMALLAALESVDWVVKFEEKTPVS
FT                   LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQQ"
FT   gene            complement(439755..440000)
FT                   /locus_tag="Bmul_0398"
FT   CDS_pept        complement(439755..440000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14093"
FT                   /protein_id="ABX14093.1"
FT                   /translation="MLRWLIAVLFLANLIAFALATEMVGPRPAAGAREPGVVARQVRAD
FT                   ALRATPLAQATDQPVVGGPIAPPAVAAEPLAASSAR"
FT   sig_peptide     complement(439938..440000)
FT                   /locus_tag="Bmul_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.816 at
FT                   residue 21"
FT   gene            complement(440091..440879)
FT                   /locus_tag="Bmul_0399"
FT   CDS_pept        complement(440091..440879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0399"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bam:Bamb_2954 putative
FT                   transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14094"
FT                   /db_xref="GOA:A9AEF0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEF0"
FT                   /protein_id="ABX14094.1"
FT                   /translation="MSEPHLLIDAGNSRIKWALADAQRTLVRTGAFGHTRDGGADPDWA
FT                   DLPRPRGAWISNVAGADVGARLDALLDTRWPGLPRTTIRSRPAQCGVTNGYTTPEQLGS
FT                   DRWAGLIGARAAFPDEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRALGTHTA
FT                   QLPTLTTDIASGLLADAQAQPFQVDTPRSLSAGCLYAQAGLIERAWRDLAAAWQAPVRL
FT                   VLAGGAADEIARALTLPHTRHDALILSGLALIAAEASAQD"
FT   gene            440922..442079
FT                   /locus_tag="Bmul_0400"
FT   CDS_pept        440922..442079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0540 proteophosphoglycan 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14095"
FT                   /protein_id="ABX14095.1"
FT                   /translation="MPFGVSSSNWPAASMPVAMPRARSTPCSSSTTSRPAYACSACQRG
FT                   RNGASPSVANCASAGVSAFSDAASVSVRFALAHAIDSAAGGSPLANAASRARSASTCAA
FT                   TASAPRTLMPKPITTAVASAVVHTVSIRIPASLPTMRDVPPSSAAVSSRSFGHLSATRE
FT                   RASSGSVARPSASATPIAMLRPPSASTGRGTMQPTEHSSALPGCANHGRPWRPRPAVCS
FT                   NATRTSGAGSACAVRGSVFRRAARSALVEPVAATMSSGHARGAASRCASSRLRAMCAPS
FT                   VSGVSGEVGVFMALIVATSGGLPAGADCASASPSREPASPFVVISAKGDHGIGLAFICG
FT                   TSGGSTDRATRIRICAVGVAARSARGAALNRLAGCAARLVAAPPR"
FT   gene            complement(442084..442932)
FT                   /locus_tag="Bmul_0401"
FT   CDS_pept        complement(442084..442932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0401"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bch:Bcen2424_2903 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14096"
FT                   /protein_id="ABX14096.1"
FT                   /translation="MQPIRTMRPAESGFAAAARRLLRVKLPPAALLAAAAATVAIAVAA
FT                   AGWRGTTALTPSAAQLDEWQAMVAQAAEPHALARLRDLARAGSGAAQAALGIALVDARE
FT                   PGLRDEGRGWLETAAQAQGADNAPAARRAQLALGKALLLGSGDMPKDYARARALLSAAA
FT                   EHGDAAAAYYLGLIYRSGYGTAADPVQAARWFEIASQAEIPAADFMLANAYRDGSGVPR
FT                   DEARALALYRRAAEHELPEAVQTLAMAYRNGELGLRPDADAFHAQWIETAHALKHPVVG
FT                   P"
FT   sig_peptide     complement(442798..442932)
FT                   /locus_tag="Bmul_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.781 at
FT                   residue 45"
FT   gene            complement(442941..445010)
FT                   /locus_tag="Bmul_0402"
FT   CDS_pept        complement(442941..445010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0402"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: bur:Bcep18194_A6244 5'-nucleotidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14097"
FT                   /protein_id="ABX14097.1"
FT                   /translation="MRFPALPRRRVPAAAALASVAFTLAACGGDDVTSPPASQQPAQAP
FT                   AGTIATLAVLETTDLHTNVLSYDYFKLAADNSLGFERVSTLIAQARAQYPNTLLLDNGD
FT                   TIQGTALSDYQALVKPIGCDQTLAIYKVMNAAKFDGGGIGNHEFNYGLPYLSQVTGSTF
FT                   DVDGLPAPAQQKKCAGPNFPQVLANVISAKTGEPLFAPYTILTRTLTATTPDGKTVSAP
FT                   VKVGIIGFTPPAIMNWDKRWLDGKVYTTGLKEAAQKYIPEMRAKGAELIVAISHGGLDN
FT                   SAYSPTMENGSWWLSTVPGIDAMLIGHSHQVFPDATSTVPQFNLPGVDKVKGTVNGVPT
FT                   VMANYWGKHLGVIKLGLKFDGKTWTVDKSQTTVEARPIQNADKSYVAADPSVSAAIAAE
FT                   HQATIDYVKTPIGSTDYRMSTYFADVGDPGAIQIVNDAQADYVARYVQANLPQYASLPV
FT                   LSVSAPFKSGFGGGSDYTDVAPGALAINNAADLYLYPNTVYAVKVSGADVKNWLETAAK
FT                   RFNTIDPTRATVQPLVSSFPGYNFDMFTSTDLKYEIDVTQPVGSRIRNLTYKGAPIDPN
FT                   AEFIVATNNYRASGGGNFPGLDGSKTIFASPDANRDVLIAYIKQRGTIARATDGSHRSW
FT                   RFTKLASSVAHVRFASAPNRVADATAAGLTGITQVAADDGSGKNLATYEIDLTQ"
FT   sig_peptide     complement(444924..445010)
FT                   /locus_tag="Bmul_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.749 at
FT                   residue 29"
FT   gene            445353..446477
FT                   /locus_tag="Bmul_0403"
FT   CDS_pept        445353..446477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0403"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bch:Bcen2424_2901 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14098"
FT                   /protein_id="ABX14098.1"
FT                   /translation="MDFETPPGLSVDAGGQGQTVRLTGQWTALALARNRGAVVRRAESV
FT                   ATGSVSEWDLSGIGRLDHVGGQALWRVWGRKLPPGIALTATQRTIFERIERLDSQREAP
FT                   ERIVRVGPVTRLGLMLFAFAEHLHGGIAMFGRVILDALSVLRRPQTMPWKETSANIYSA
FT                   GAQALPITALVAFLIGIVLSYLSAQQLQMFGANRYIVNILGLAVIRELGPVLSAILVAG
FT                   RSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIVALTG
FT                   GALAAKMVLGIDVNYFVRSLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQ
FT                   SLGEGTTTSVVTSITVVILADAVFAILFQNVGLG"
FT   gene            446474..447352
FT                   /locus_tag="Bmul_0404"
FT   CDS_pept        446474..447352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0404"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A6242 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14099"
FT                   /protein_id="ABX14099.1"
FT                   /translation="MSASNEPASPSAVADAHDDRVIEVRNLTKRYGRNIVHQKLDFDVR
FT                   RGEIVSIVGGSGSGKTTLVRQILGLERPTSGTIKVFGQDTSTIDAASARLMRTRSGMLF
FT                   QHGALFSSMTVFDNVAQPLRELGRVPPDLLHDIVMLKLEMVGLPCKHASKMPAALSGGM
FT                   VKRVGIARAIALEPELLFLDEPTAGLDPQASDEFVELIATLHRTLGLTVVMVTHDLDTM
FT                   VALSTRVAVLADRKVLVAAPVEEAANVDHPFIHEYFLGLRGRRALQALPPERRAKLPKA
FT                   ALEPALSSVEL"
FT   gene            447376..448305
FT                   /locus_tag="Bmul_0405"
FT   CDS_pept        447376..448305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0405"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bur:Bcep18194_A6241 ABC transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14100"
FT                   /protein_id="ABX14100.1"
FT                   /translation="MENKSHAFWAGLFTILLTLAIVGAVFWFNVDRTVRVPYDLIARTN
FT                   VTGLFPDAAVRFRGLDVGKVQSIGFDRSHPGQIRIRILVDQDAPITQSTYGSLGFQGVT
FT                   GIAFVQLEDTGRDLSPLPSSPKAIAQIPMRPSLFDQLQSRGDVLLRQLELAAKSVNELM
FT                   SPEMREQLRATAESLQHAADGVTTLSKQLGPAVTALPETMTEVNRTMASANRLLQPNGP
FT                   LVANLNKAGTAAEQVGTALNDLNARVQYDTLPRFNALAGSVGDASRQFKDVAGELGRNP
FT                   SSLLFGSPGPAPGPGESGFVWPGASAGH"
FT   gene            448363..448986
FT                   /locus_tag="Bmul_0406"
FT   CDS_pept        448363..448986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0406"
FT                   /product="ABC-type uncharacterized transport system
FT                   auxiliary component-like protein"
FT                   /note="KEGG: bch:Bcen2424_2898 ABC-type uncharacterized
FT                   transport system auxiliary component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14101"
FT                   /protein_id="ABX14101.1"
FT                   /translation="MSRLLDRALRPAATALAVLTLVLAAGCAADRAVLSNIRYDLGPAT
FT                   PVGTVGSGPALKVLDVSAPEAFDSDKFVYRLAYADAQRMAVYRDSRWIAPPAQLLTQRL
FT                   RGALSARGAVLEGSDGVRAPTLKVDLSEFEQVFDGQSQSHGAVTARATLMQDGKVLGQR
FT                   TFVARAPSSTPDAAGGARALAAASDELVSQIAAWVGVQAYAGTP"
FT   sig_peptide     448363..448452
FT                   /locus_tag="Bmul_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.581 at
FT                   residue 30"
FT   gene            449006..450157
FT                   /locus_tag="Bmul_0407"
FT   CDS_pept        449006..450157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0407"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bch:Bcen2424_2897
FT                   VanZ like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14102"
FT                   /protein_id="ABX14102.1"
FT                   /translation="MNAPGTHRASSLARQAFAAYAALVVYASLYPFEGWVSLGIGPFDY
FT                   LFAPMQRYVTAFDVVTNVLGYMPFGALAVLALHPRHRGIAATLIAGALGVLLSGAMEAL
FT                   QTYLPTRVASNLDLGANALGALLGAALVAPATGALLDRGALRRLRTAWFEADGATPLLL
FT                   AAVWPFAILFPSPFLFGIGDWPAALWARADASMQDTLLAWLPAAWHVGEWPERVDGWLS
FT                   DSAWEAVIGGLMLFAALAVASLAMRAQAPRIRLLAAFLGAALVLKAAATFMQSATGLVV
FT                   VWATPGARLGIELGFAAALVALRVPATWRAALAAVALLAGIALVNLLPVNPFFDFTLSG
FT                   WRQGRYVHFNSLARWLAWIWPYAALIWLGQRVERAWLPAFARR"
FT   gene            450360..450677
FT                   /locus_tag="Bmul_0408"
FT   CDS_pept        450360..450677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0408"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: bvi:Bcep1808_2991 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14103"
FT                   /protein_id="ABX14103.1"
FT                   /translation="MDSYYQHHVFFCLNQREPGADRPSCAQCDAQTMQEYAKKRVKELG
FT                   LAGAGKVRINKAGCLDRCEEGPVMVVYPEGTWYTYVDKADIDEIVESHLRDGKIVERLK
FT                   I"
FT   gene            450691..451335
FT                   /locus_tag="Bmul_0409"
FT   CDS_pept        450691..451335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0409"
FT                   /product="hydrolase of the alpha/beta superfamily-like
FT                   protein"
FT                   /note="KEGG: bch:Bcen2424_2895 hydrolase of the alpha/beta
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14104"
FT                   /protein_id="ABX14104.1"
FT                   /translation="MNVHTQKSLIAGPVGQIEIAVDMPDAVREGSAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVQLDYVVYRSNFRGVGATEGVHDNGIGEADDLLAVVAHMRA
FT                   QPAYADLPLVLAGFSFGTFVLSHVAKRLRDAGEAIERMVFVGTAASRWQVADVPENTLV
FT                   IHGELDDTVPIASVYEWARPQELPVVVIPGAEHFFHRKLHVLKRIVIDAWR"
FT   gene            complement(451677..451919)
FT                   /locus_tag="Bmul_0410"
FT   CDS_pept        complement(451677..451919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14105"
FT                   /protein_id="ABX14105.1"
FT                   /translation="MRRETRTVERQGGRRFGHSPDTSDDAKRAGWTRADAFGSRPSRAD
FT                   GQAAKRAPHGPDRAAGDAKCGHYTWPRNAFSRSGG"
FT   gene            451945..453261
FT                   /locus_tag="Bmul_0411"
FT   CDS_pept        451945..453261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0411"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: bvi:Bcep1808_2989 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14106"
FT                   /protein_id="ABX14106.1"
FT                   /translation="MRLSSQGLKSLASSIAFGTAARNVALGVMLPVALASTIVVAEAKP
FT                   AAKAKAAHAAPAAAEQSTGAPATFMPGAVPPPGVNARSWVLVDATSNTVLASGNADERV
FT                   EPASLTKLMTAYLVFEALDKKKISMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLV
FT                   YGMIIQSGNDAAIALAELVGGSEAQFVTMMNDEAQRLGMKGTHFADVNGMPDPNHYTTA
FT                   GDLAKLSAHLIRDFPQYYGIFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGF
FT                   CLISSAKRPIPGASDAQRRLVAVMMGEPKESDRTQDSMKMLNYGYSAFDAVRLFKGGQA
FT                   ISTPRLYKGKENTVQVGVASDQWVTVPRGLGDKVKPEVDVNAPLIAPLAQGQQVGTVKV
FT                   VADGKTLSEFPVVALQAVPEAGIFGRIWDSILLMFSKKK"
FT   sig_peptide     451945..452070
FT                   /locus_tag="Bmul_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.622 at
FT                   residue 42"
FT   gene            453311..454237
FT                   /locus_tag="Bmul_0412"
FT   CDS_pept        453311..454237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0412"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   bvi:Bcep1808_2988 aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14107"
FT                   /protein_id="ABX14107.1"
FT                   /translation="MSPTEFEPIVYLSVASQEEMVPLSQARVPVLDRGFIFGDGVYEVV
FT                   PVYAHDGAHVPFRIAQHLERLERSLKKIGIDNPHDAAGWRALIERLVDANAQALGDSHA
FT                   LVYLQVTRGVAKRGHAFPANAVPTVFAMTSPLRLPSAEERAKGVRCVTAEDRRWLHCDI
FT                   KSTSLLGNVLMAQHAAERDAFETVQLRDGNLTEGSSSNVWVVKNGELYAPPRSNKILEG
FT                   IRYALLEELADECGIRFVAREISESELRAADEILITSATKEVLPVTSLDDLPVQGGKPG
FT                   PVFAALYDAYQRAKAREFEQFDLSRRK"
FT   gene            454237..454545
FT                   /locus_tag="Bmul_0413"
FT   CDS_pept        454237..454545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0413"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   bch:Bcen2424_2891 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14108"
FT                   /protein_id="ABX14108.1"
FT                   /translation="MSEPTKTVEVTGAIETPKESLLEFPCDFPIKIMGKAHPEFKDTIF
FT                   KVVSVHDNEIDLEKIEERASSGGNYTGLTVTVRATSQEQLDNIYRALTGHPMVKVVL"
FT   gene            complement(454529..455575)
FT                   /locus_tag="Bmul_0414"
FT   CDS_pept        complement(454529..455575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0414"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_2890 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14109"
FT                   /protein_id="ABX14109.1"
FT                   /translation="MDLRQLPALNAIRAFEAAARHENFSRAADELFVTHGAVSHQVRAL
FT                   EDELGVKLFTRNGKRLCLTDAGMRYAQQVRTALMMLADATRQVRASDRDRRLVVSMLSS
FT                   FAARFVTPRIGTFIERHPEIDVELQSTNALTDFARDDVDLAIRFGFGSYPGLYVEPLLD
FT                   EAFFPACAPTLNGGKLPQTPADLVHYNLLRSDDELWRPWFDAAGLDTLTEPKRGILYQD
FT                   SSNLLQAAIEGQGIALVRRSLALHDLLDGRLVRLFDIDGPSPWHYFFVCPPPLLGTPRV
FT                   QAFRTWILQEVAQFKLLCDELDARRAAGKCPQECAREGGWKGIAARSAGTGGTEDETHA
FT                   ATAVTARP"
FT   gene            455678..456004
FT                   /locus_tag="Bmul_0415"
FT   CDS_pept        455678..456004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14110"
FT                   /protein_id="ABX14110.1"
FT                   /translation="MQEISTSVTFEIPPGETVPMKVQRSTRLTVQCGPVWATRSNDVDD
FT                   YFLVDGETLRLRRGERLWLSAEGGQSACVAFSVSRPAKDVALGGLARLRERVSALFHDG
FT                   WRTV"
FT   gene            456087..456833
FT                   /locus_tag="Bmul_0416"
FT   CDS_pept        456087..456833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0416"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: bvi:Bcep1808_2984
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14111"
FT                   /db_xref="GOA:A9AEG7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEG7"
FT                   /protein_id="ABX14111.1"
FT                   /translation="MSVSPVAIVSTPVAAPESSAAVAVPPVVVRWRGVEPYETSFDAMR
FT                   AFTDARTADTVDEIWIVEHPPVYTLGQAGDPAHLLVGDSGIPLVKVDRGGQITYHGPGQ
FT                   IVAYLLLDLRRRKLTVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVHEGAKI
FT                   AALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGYAGLETVDMASLEVAADWNDVARTL
FT                   VRRLIANLDGESAAADTPHALEHSND"
FT   sig_peptide     456087..456158
FT                   /locus_tag="Bmul_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.569 at
FT                   residue 24"
FT   gene            456826..457818
FT                   /locus_tag="Bmul_0417"
FT   CDS_pept        456826..457818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0417"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: bam:Bamb_2937 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14112"
FT                   /protein_id="ABX14112.1"
FT                   /translation="MTDVTASPAPADSAATPAYNPTAKQKAQAKTARIPIKVVPIEKLK
FT                   KPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCT
FT                   RRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAAHFVECIR
FT                   EVREQSPETRIEILTPDFRGRLDRALSILNAAPPDVMNHNLETVPRLYKEARPGSDYAH
FT                   SLKLLKDFKALHPDVATKSGLMVGLGETEEEILQVMRDLRAHDVDMLTIGQYLQPSEHH
FT                   LPVRAYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV"
FT   gene            complement(457900..458316)
FT                   /locus_tag="Bmul_0418"
FT   CDS_pept        complement(457900..458316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14113"
FT                   /protein_id="ABX14113.1"
FT                   /translation="MEPSYSLSQMRAVWIDAYLNGDVDQLNFVESPHFFVKRGTQILTK
FT                   SQQLAHLQRHASEQTRRNCSWHAHGETTEYAESGQWASIRGAGSMLCDGKTVSAVNFFE
FT                   LWLVDDNRWQIAALCYDERENDRGVVAGRSNESS"
FT   gene            458635..459651
FT                   /locus_tag="Bmul_0419"
FT   CDS_pept        458635..459651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0419"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bch:Bcen2424_2886 taurine ABC transporter,
FT                   periplasmic binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14114"
FT                   /protein_id="ABX14114.1"
FT                   /translation="MSRFSFVRRAVVALTAFAALGAARAESREVVIAYQDMVVPWRYAQ
FT                   ASGEVEKATGYKVTFRKLDSGADVIRALASGSVQLGEAGSSPIAAGLSQGLDISLFWVL
FT                   DNINDAEALVARNGSGVTSIAALKGKKIGVPFVSTSHFHTLVALQAAGVNPNDVKIVNL
FT                   RPPEVAAAWTRGDIDATYIWDPVLAKVKQSGTVLTTSGQVAKESGKATFDGFVVNRKFA
FT                   RENPEFVTRFVKVLAAADADYRAHTAAWKVGSPQVAAVAKVSGANAQDVPASLALYAFP
FT                   TPAEQASSTWLGGGAQSGAAKSLAATAAFLKSQGTIQTVLSDYSVGVDPQFVQKAAR"
FT   sig_peptide     458635..458712
FT                   /locus_tag="Bmul_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 26"
FT   gene            459683..460480
FT                   /locus_tag="Bmul_0420"
FT   CDS_pept        459683..460480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0420"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_2885 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14115"
FT                   /protein_id="ABX14115.1"
FT                   /translation="MSTLEVRQLSVAYPGERGRASTQALAHVDLRIESGEFVVALGASG
FT                   CGKTTLLNCMAGFVAPTTGEVRVDGVPIEGPGADRGVVFQKYALLPWLDVLGNVALGLR
FT                   FARVPKAEREARARDMLALVGLEHHAHARVYELSGGMQQRVGIARALASDPRVLLMDEP
FT                   MGALDALTRGTMQALVLDVWARTGKTVFFITHDVEEALFLATRLVVMTPGPGRIAETFE
FT                   LPFARRYVESRDARAVKSSPEFIAWRERLIAYLHRDETLGEVA"
FT   gene            460480..461445
FT                   /locus_tag="Bmul_0421"
FT   CDS_pept        460480..461445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0421"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_2269
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14116"
FT                   /protein_id="ABX14116.1"
FT                   /translation="MGELARHGTSVGRGRIGILDRQDSMSTHDSWAADRAAARLDRHAG
FT                   ATPSRRVSRTARTSHRYRLPGHGNTAVLSAATVAALAVLWWVATHRQWLPPLFLPAPEA
FT                   VWTAFVDAWHGRIQGGLPLSEHLLWSAARVFGAFLLATVIGVPAGILMGVSRIARGVLD
FT                   PLLEFYRPLPPLAYLPLVVIWFGIDETAKLVVIFLACFAPIAMAARAGVRAATVEQINA
FT                   AYSLGGSLAQIVRHVVLPAALPEILTGLRIAIGFGWTTLVAAEMVAATAGLGQMVLNAS
FT                   SFLRTDIVVMGILIIGAIAWLFDLAMRWIERRVVPWKGRA"
FT   gene            complement(461467..463413)
FT                   /locus_tag="Bmul_0422"
FT   CDS_pept        complement(461467..463413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0422"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: bur:Bcep18194_A6223 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14117"
FT                   /protein_id="ABX14117.1"
FT                   /translation="MTIGAPRGDNSAPAASFDFIAAEGSMFDRLRPSSRPWTLIAAIAL
FT                   VAFNAACTSPATPPAAVVPVAASGAAAPLPGMHAPELATGWTDKPGWTAQHYMIAAANP
FT                   LATQAGYEMLKAGGTAVDAAIATQMVLALVEPQSSGIGGGAFMLYFDGKTTQAYDGRET
FT                   APAAATDRLFYGPTGQPMSFYEGVVGGRSVGTPGVLRMLEAAHRANGKLPWRRLFQPAI
FT                   RLAEHGFTISPRLATLIANDRYLMNDPAARAYFYNKDGTPKAAGTVLKNPALAAVLRQV
FT                   ADRGANAFYTGAIARDIVAKVRKHPTNPGLLSMQDLARYKAKVRAPLCADYRRSIVCGM
FT                   PPPSSGGLAIAQMLGILEAMPDWQQIGAQKPVRNEVGYEPTPFAAHVFSEAGRLAYADR
FT                   ARYVADPDFVPLPGGKWASLIDKSYLAQRAQLIGDNSMGVAQAGTPPGATLAMADDRSP
FT                   ELPSTSDIAIVDRYGHALSMTTSIEDAFGSRLMVRGFLLNNQLTDFSFVSSENGRPVAN
FT                   RVQPGKRPRSAMSPELVFDKKTKQVTLIVGSAGGPAIINHVAKALVGVLDWGMTMQQAI
FT                   ALPNFGSMNGPTQLERGRVSDALVEGLKGRGHDVQLVQMNSGLQGIQRLNVQGQTVWFG
FT                   GADPRREGVAMGE"
FT   gene            complement(463417..464343)
FT                   /locus_tag="Bmul_0423"
FT   CDS_pept        complement(463417..464343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0423"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_2977 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14118"
FT                   /protein_id="ABX14118.1"
FT                   /translation="MDLNALTLLVEILDAGNLSKAAQRLKMSRANVSYRLNQLERSIGQ
FT                   QLVRRTTRRIEPTEIGLKLYEHGRRIRNELLAAQESVTTLGQDLQGRVRLSVPSGYGQM
FT                   VMADWLLAFKRLHPGIVLDVVFENRVEDLMRDEIDIAVRVMPEPPPNLVARDMGAVRYV
FT                   ACASAAYAAAHGMPASLDALSAGPVVTATVMGRQLRIAAYLGDERHEVLLEPTLVSENF
FT                   LFLRQAILAGIGVGIVPDYVVQDDMRRGAIVTSLDAYRLSIFGTHMYMLYMPNRHHTRA
FT                   TSTFIEFILEQAGKTGRRGPDALRQGS"
FT   gene            464586..466718
FT                   /locus_tag="Bmul_0424"
FT   CDS_pept        464586..466718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0424"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bcn:Bcen_2265 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14119"
FT                   /protein_id="ABX14119.1"
FT                   /translation="MNSPAFSAPSNGTVTRERRDKVLVVTIDHPPVNALSADVRRGLAD
FT                   ALDAAQADDAIRAVLIVGAGRNFIAGADIREFGKPPVPPSLPDVCARIESSAKPVVVAL
FT                   HGATLGGGLEVALAAHYRLAVPGAKLGLPEVTLGLLPGAGGTQRAPRLIGAKAALDLML
FT                   TGRHASAEEALALGLVDRLAHSDDTLAEGLAYAQELVSLGAPARRTRDAQALADRAAAQ
FT                   AAIDAARAELPKKSRGLFSPAKIVDAVEAALTQPFDAGMKLERSLFLQCIDSPQRAGLV
FT                   HAFFAEREAAKVPEARRGTARPIERIGVVGGGTMGAGIAIAALDAGLPVTMIERDEAAL
FT                   ARGRAHVEKVYDALVAKGRMTPAAQAARIARLKGSTSYDALAQVDVVIEAVFEDMAVKQ
FT                   AVFAELARVCKPGAVLATNTSYLDIDALAASIDRPADVIGLHFFSPANVMKLLEIVVPA
FT                   RASADVVATAFALARQLKKMPVRAGVCDGFIGNRILAVYRTAADYLMEDGASPYQIDRA
FT                   VREFGFPMGPFQVVDLAGGDIGWATRKRRAATRDPRARYVEISDRLCERGWFGQKTGRG
FT                   YYLYPDGARVGTPDPEVEAIVEQERAKKGIVPRAFTDDEILRRYLAAMINEGANVVHEK
FT                   IALRPLDVDAVFLHGYGFPRYRGGPMHYADTVGLANVLADIRAFAEEDPLFWKPSPLLV
FT                   ELVERGANFASLNRID"
FT   gene            466780..467982
FT                   /locus_tag="Bmul_0425"
FT   CDS_pept        466780..467982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0425"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bam:Bamb_2933 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14120"
FT                   /protein_id="ABX14120.1"
FT                   /translation="MDLNFTPEEEAFRADVQRFLRTELPERTAQKVKHGLPLTRDDMQE
FT                   WHAILNARGWLASHWPREYGGPGWSVAQKFLFDNECALAGAPRIVPFGVNMLGPVLIKY
FT                   GSEAQKRHWLPRILDGTDWWCQGYSEPGAGSDLASVKTSAVRVGDHYVVNGQKTWTTLG
FT                   HYANMIFCLVRTATDVRKQEGISFLLIDMNTPGVEVRPIITLDGEHEVNEVFFTDVRVP
FT                   VENLVGEENHGWTCAKYLLTYERTNIAGVGFSTAALDRLRAVAAKVDKNGRPLADDPFF
FT                   AARIARVEIELENMRTTNLRVLAAVAGGGAPGAESSMLKIRGTQIRQEITSLMRRAMGP
FT                   YAQPFVDDALDADAGDGAEPIGPDGAARAAQQYFNNRKLSIFGGSNEIQKNIIAKMMLG
FT                   L"
FT   gene            467998..469134
FT                   /locus_tag="Bmul_0426"
FT   CDS_pept        467998..469134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0426"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_2932
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14121"
FT                   /protein_id="ABX14121.1"
FT                   /translation="MDFQHTEDRRMLADTLNRFIAEQYPFAVRDRIAQSADGFDRTMWR
FT                   RFAELGAVGALFPEADGGFGGAGFDIAVVFECLGRGLVVEPFLGTLLAGRALSLAGGDA
FT                   HRAMLAALIDGSASAAFAHDEPGSHYELTTVRTRAERTGDGWVLTGAKGVVDQAAQATF
FT                   FVVSARVAGRDDDAAGIALFVVPANAAGVSLRDYRKIDGGRAAEVRFERVALPADAALG
FT                   DHDGEQGAALLERVLGYGLLALSAEALGAMDVAKAHTLDYLRTRKQFGMPIGSFQALQH
FT                   RMADLLLEVEQARSAVINAAAQLDAPRDVRERALAAAKYTIGRIGTLVAEESIQLHGGI
FT                   GMTWELPLSHYAKRLVMIDHQLGDEDHHLARYIALSKR"
FT   gene            469165..470370
FT                   /locus_tag="Bmul_0427"
FT   CDS_pept        469165..470370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0427"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bur:Bcep18194_A6218 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14122"
FT                   /protein_id="ABX14122.1"
FT                   /translation="MTNEARALPLAGVKVLDVSRVLAGPWCAMVLADFGAEVVKVEHPA
FT                   RGDDTRDWGIRIGDTETTYFNSVNRSKRSLCIDLQTEAGQRIAQDLAAQADVLIHNFKL
FT                   GGAEKLGLGYETLAERNPRLVHCAISGYDRSGPEAARPGYDLVVQGEAGLMALNGEAGQ
FT                   PPLKFGVAAVDLFTGMYSAQAILAALYERHATGRGRRIEMALFDCGLMITAYYGLDALL
FT                   MEKDPPRYGNAHPSIVPYGVFDAADGPLVITVGNNTQFARFCDVLERPDLAVDPRYRTN
FT                   LGRSENRADLLPELRRELARRPRAALLAALADAGIPCGEVLGLHEALTSERATRAGLVT
FT                   RQPHPVAGGVHVLAPPYRFDGARLPVRGAPPVLGADTDAVLGSWLGLSADDVARLRADR
FT                   VV"
FT   gene            470458..470763
FT                   /locus_tag="Bmul_0428"
FT   CDS_pept        470458..470763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0428"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   bch:Bcen2424_2875 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14123"
FT                   /protein_id="ABX14123.1"
FT                   /translation="MELSVIESVTARRDYQQLVRARRRFSFALTALMIATYYGFILLVA
FT                   LAPQVLAAPLYRGATTTVGIAAGVAIIAIAVALTACYVLRANRAFDRRVDALLGRS"
FT   gene            470775..472460
FT                   /locus_tag="Bmul_0429"
FT   CDS_pept        470775..472460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0429"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bch:Bcen2424_2874 SSS
FT                   sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14124"
FT                   /protein_id="ABX14124.1"
FT                   /translation="MRRSSIALGALSVFVSSAAHAVSVAGPMPDKVELNPVAIAMFFAF
FT                   VFATLALTRWAARRTRSTRDFYTAGGGITGLQNGLAIAGDYMSAASFLGLSGMVFMFGF
FT                   DGLIYSIGFLVGWPFVMFLIAEPLRNLGKFTFVDVVAYRFAQRPIRLLTSANALTIVVL
FT                   YLVVQMVGAGKLIQLLFGLSYGSAELIVGVLMVVYVFFGGMTATTWVQVIKAVLLLAGA
FT                   SLLAWLALAEFGFSVDEMFRRAVAVHPGALSIMGPGKLIRDPANALSLGIALMFGTAGF
FT                   PHILMRFFTVPNAKEARKSVLYATGFIGYFYLLTFVIGFSAIVLLAQHPEFFRVAANGT
FT                   FNLTHDLLGGSNMVAVKLAQAVGGNVFYGFIAAVTFATILAVVAGLTLAGATTISHDLY
FT                   AQMWARGKPDERLEMRISRAATIVLSALAIGLSILFEHVNVAFMVGLVAAVAASANFPV
FT                   LAMSIFWRGMTTRGAVLGGGLGLVSAVVLTVLSKSVWVDVLHHAHAPVFLDNPALVSVP
FT                   LAFVAIVVGSLADRSERARREREAFTQQEFYAQTGVLAGPAVHH"
FT   sig_peptide     470775..470840
FT                   /locus_tag="Bmul_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            472829..474118
FT                   /locus_tag="Bmul_0430"
FT   CDS_pept        472829..474118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0430"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bur:Bcep18194_A6215 sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14125"
FT                   /db_xref="GOA:A9AEI1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEI1"
FT                   /protein_id="ABX14125.1"
FT                   /translation="MKKKPFYKVLYVQVIFAIVVGVILGHYYPSLATEMKPLGDGFIKL
FT                   IKMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGV
FT                   GFNIDPATLDGKAVASYAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGS
FT                   VLAHLGERGKVVTDFIDGLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLK
FT                   LIGTFYLTSVVFVLVVLGAIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKL
FT                   EKAGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLT
FT                   SKGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVV
FT                   SAWEKELDRAKLRQALKGGGEVAATETAGV"
FT   gene            474123..476129
FT                   /locus_tag="Bmul_0431"
FT   CDS_pept        474123..476129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0431"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bam:Bamb_2927
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14126"
FT                   /protein_id="ABX14126.1"
FT                   /translation="MNGQAAAPSARAAPRGGDRARDAYDTIGDPHRQEVPTVKRRLLVL
FT                   AVLAAMLAAACALTWTVTWRRGVAELQRNAAVRVDRTTNALKSTLDRYESLPYLLGSHP
FT                   YVQELLAAPKRADYVARTNRYLEDLNEHAHATVTYVIGADGLCVAASNWRAPDSFVGIE
FT                   YRFRPYFIDAMHGRVGRFFGIGTISRDPGYYISQPVWRDGGIAGVVVVKLNLEWFQGAD
FT                   ASEPLVVADEHGVVFLSSVPAWKYHTLKPLTEPVAASIFETRQYAQQPVTPLPMRVEQV
FT                   LGGDAEIVRVGSGRRAPRFLATRRRIGEPDWQLVTLAPIAPVDADARNATIVTGFGFVS
FT                   VALLAFYWRMRRARVREMIRSRALLQQAYAELNRRVEERTADLSEANEQLQKEVGDRIR
FT                   AEQELRAAHDELIQASKLAALGQMAAGITHELNQPLAALRSFSDNTRVLLDRGEQAAAR
FT                   ENLEAIAALTERMGKITNQLKLFVGRARPRNERALVVRALRGVLALLGERLRGVALTLT
FT                   LQDATVSPARDAPLDIAHDHPELVARCEDLRLEQVLINLLGNALDAVAAVAAPAIEVTV
FT                   AVSSATVAIEVRDNGPGIPPELLPRLFEPFFTTKEMGSGLGLGLAISSSIASDAGGSLT
FT                   ARNAPSGGALFVLTLRRAHTHHPDSVSEPAGLQ"
FT   gene            476219..477571
FT                   /locus_tag="Bmul_0432"
FT   CDS_pept        476219..477571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0432"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase; KEGG: bam:Bamb_2926 two
FT                   component, sigma54 specific, transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14127"
FT                   /protein_id="ABX14127.1"
FT                   /translation="MANRLQVIYIEDDALVRRASVQSLQLAGFDVAGFESAEAADKAIV
FT                   ADNAGVIVSDIRLPGASGLDLLAQCRARVPDVPVILVTGHGDISMAVQAMRDGAYDFIE
FT                   KPFAAERLIETVRRALERRELVLENHALRRELAGQNVVAPRIIGRSPAIEQVRKLIANI
FT                   APTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPGA
FT                   FTGAAKRRIGKLEYASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNCR
FT                   VVAAAKGDMSELVAAGTFRRDLLYRLNVVTIALPPLAERREDIVPLFEHFMLDAAVRYG
FT                   RPAPVLSDRQRASLMQRDWPGNVRELRNAADRFVLGVAEMPAEADVAGDAASEQTLKER
FT                   VEQFERAVIAEALNQTGGAVAATADRLHVGKATLYEKMKRYGLSAKGESER"
FT   gene            complement(477642..478181)
FT                   /locus_tag="Bmul_0433"
FT   CDS_pept        complement(477642..478181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0433"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bam:Bamb_2925 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14128"
FT                   /protein_id="ABX14128.1"
FT                   /translation="MNTTPSAPRRRAGPARYIVAAVVVAAIAVAGFFAFNGKSSAPDAT
FT                   FTLLSGQKISTAGDLKGKVYLVNFWATSCATCMQEMPQMVETYNRFKGQGLEFVAVAMN
FT                   YDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDRDGKILKRYVGAPQF
FT                   AELDALLKKALDGNAA"
FT   sig_peptide     complement(478071..478181)
FT                   /locus_tag="Bmul_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.340 at
FT                   residue 37"
FT   gene            478341..478916
FT                   /locus_tag="Bmul_0434"
FT   CDS_pept        478341..478916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14129"
FT                   /protein_id="ABX14129.1"
FT                   /translation="MPKPLADSFRHLFRPLRHFVALLCASAALAACSPSYDWRTLHNDA
FT                   GYTIDLPAKPTVDEHAVAVGGTPMPMRMQAAHVDGAVFAVGTLTLPDDRDDTRRAALEF
FT                   LRAGLSRNLAGAPQTAAVPVPLAAGGAVNGLELRVAGTAAGGDDTARKTIVARLVARGR
FT                   HAYQAVVIADRPLQQEQLDQFFGSFKLD"
FT   sig_peptide     478341..478433
FT                   /locus_tag="Bmul_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.615 at
FT                   residue 31"
FT   gene            complement(479239..480855)
FT                   /locus_tag="Bmul_0435"
FT   CDS_pept        complement(479239..480855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0435"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: bam:Bamb_2923 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14130"
FT                   /protein_id="ABX14130.1"
FT                   /translation="MSLAVVRSRAPAAGRAPDVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCGFEFPVRRITVNLAPADLPKESGRFDLPIALGILAANGQIPVDALAGR
FT                   EFAGELSLTGALRPMRGAFAMACGLARDAQPGGTDGDIAHDTHAGGGAEPRAACAPAGA
FT                   SRMPELYLPLASAAEAALVPGVTVFGAPDLPALCAHLAGAPDGRLSPVDAPCLDGLPAP
FT                   AAPDLADVVGQRPARRALEVAAAGGHHMLMVGPPGAGKSMLAARLPGLLPPLTDDEALT
FT                   SAALLSASRIGFSPAQWRRRPFRSPHHSSSAAALVGGRNPPQPGEITLAHLGVLFLDEL
FT                   PEFDRHVLEMLREPLEAGRITISRAAQQADFPAACQLIAAMNPCPCGWLGDPSGRCRCS
FT                   PDVAARYLRKLSGPLLDRIDIQIDLPALSPAELAARASTPGEPSAAVAARVAQARALQL
FT                   ARQGKTNHMLSGRETDDLCRPTDEGERLLREAGERFGWSARAYYRVLKVARTIADLAGE
FT                   PLPTASHIAEAIRYRRALAAL"
FT   gene            complement(481076..481327)
FT                   /locus_tag="Bmul_0436"
FT   CDS_pept        complement(481076..481327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0436"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   bam:Bamb_2922 protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14131"
FT                   /protein_id="ABX14131.1"
FT                   /translation="MKQPSDVFNDLQSRVSDLLKNSPAKDVERNVKAMLSQGFSKLDLV
FT                   TREEFDTQAQVLARTRVRLEELEKRVAELEQKLAASQA"
FT   gene            481681..482019
FT                   /locus_tag="Bmul_0437"
FT   CDS_pept        481681..482019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0437"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bam:Bamb_2921 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14132"
FT                   /protein_id="ABX14132.1"
FT                   /translation="MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKMKIEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTPIEQVIRIRT
FT                   GETGADAL"
FT   gene            482052..483554
FT                   /locus_tag="Bmul_0438"
FT   CDS_pept        482052..483554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0438"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bch:Bcen2424_2865
FT                   ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14133"
FT                   /protein_id="ABX14133.1"
FT                   /translation="MRKVLMSLLMAGSLIAAGVGPALADDAASAAAASAPAASAPDASA
FT                   AAAPAATASAAPDASAAAAAPASAAASAPADASAAAAPAAPTAPFSVDSSKISAGDTAW
FT                   MLTSTALVLFMTIPGLALFYAGMVRKKNVLATVMQSFAITALITVLWTVIGYSLAFTPG
FT                   NGFIGGLSRVFLHGMNYIKGDKATTLTVSHLASTIPESVYFVYQMTFAIITPALICGAF
FT                   ADRMKFSAMLVFMTLWSLIVYVPIAHMVWEPTGWLSADGVLDFAGGTVVHINAGIAGLM
FT                   SCLVLGKRVGYGRESMAPHNLVLTMIGGSMLWVGWFGFNAGSAVAADGRAGFAMLTTQV
FT                   ATACAALGWMFAEWIAKGKPSVLGIVSGAVAGLVAITPAAGFVGVAGALVIGIAAGVVC
FT                   FWSATWLKSKLGYDDSLDAFGVHGVGGILGALLTGVFAVKDIGGFDGSLLLQAKGVLIT
FT                   LVYSGVLSFVLLKLIDLTIGLRVTEEEEREGLDVILHGEHVE"
FT   sig_peptide     482052..482126
FT                   /locus_tag="Bmul_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            483796..485085
FT                   /locus_tag="Bmul_0439"
FT   CDS_pept        483796..485085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0439"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="TIGRFAM: glutamate--cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: bch:Bcen2424_2864
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14134"
FT                   /protein_id="ABX14134.1"
FT                   /translation="MVPHLVTALNGPLLELEQKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDANLFPGAFNNLPSEVLPLAVQAAMAAIEKICPDAKNLLVIPELPT
FT                   RNAFYLENVARLATIMRQAGLNVRFGSLDPSITDITPITLADGQKIVLEPLERSQRRLG
FT                   LKNFDPCSILLNNDLSAGIPSVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KMVGVDPWMVNPYFAHVEGVDWQAHEGEQALADAIDGVLKKIARKYREYGISEKPYVVV
FT                   KADAGTAGRGVMTVHDAAEIGRMSKAERAQMAESKAGLAVRDVIVQEGVYTFERVGDEV
FT                   AEPVVYMIDRYVVGGFYRTHGGRERDQNLNAPGMHYVPLGFEHTALPDAGAKPGAAPPN
FT                   RFYMYGVVARLSLIASSIELEKTDPEAIQV"
FT   gene            485113..486069
FT                   /locus_tag="Bmul_0440"
FT   CDS_pept        485113..486069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0440"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: bur:Bcep18194_A6192 glutathione synthetase;
FT                   TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase domain protein; glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14135"
FT                   /protein_id="ABX14135.1"
FT                   /translation="MDILFIADPLERFKIYKDSTYAMMAEAARRGHAIYACEPRELAWT
FT                   GSAVEADVRRITFVGELDDLHRETWYEAGPVDARRLESFGAVLMRKDPPFDMEYVTSTW
FT                   LLELAERAGARVFNRAQSIRDHSEKLAIGEFPQFVAPTLVTRDAKRLRAFHAEHGDVIL
FT                   KPLDGMGGMGVFRVKPDGMNLGSIIEMLSHDGTRSVMAQKFIPEIKAGDKRILLIGGEP
FT                   VPYSLARIPQGSEVRGNLAAGGLGVAQPLTARDREIAETLGPVLAARGLLLVGLDAIGD
FT                   WLTEVNVTSPTCFREIMEQTGFDVAAMFIDALERAAA"
FT   gene            486300..486770
FT                   /locus_tag="Bmul_0441"
FT   CDS_pept        486300..486770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0441"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: bch:Bcen2424_2862 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14136"
FT                   /protein_id="ABX14136.1"
FT                   /translation="MAGILIIAHAPLATALRDCIAHIYGGVPARIGCIDVQADSDPAQV
FT                   MAFAHAELARLKEENGAVVLTDMYGATPANIAGQLAKIADVRVLAGVNLPMLVRAVCYR
FT                   TMPLDKLVDKALSGGAKGVHEVAAGTPPPPSEVGCGQCAPIPPEPQPRTESH"
FT   gene            486846..487115
FT                   /locus_tag="Bmul_0442"
FT   CDS_pept        486846..487115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0442"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: bch:Bcen2424_2861
FT                   phosphocarrier, HPr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14137"
FT                   /protein_id="ABX14137.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGNFQSEVWMSRNGRKINAK
FT                   SIMGVMMLAAGIGSTITIETDGPDEKEAMDALLKLIADKFGEGQ"
FT   gene            487206..489089
FT                   /locus_tag="Bmul_0443"
FT   CDS_pept        487206..489089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0443"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: bcn:Bcen_2246
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14138"
FT                   /protein_id="ABX14138.1"
FT                   /translation="MLRCMQSADTRGFIIAIRGHKRIAAVCRGFSCTEEVRVSFTLHGI
FT                   PVSRGIAIGRAYLIAPAALDVAHYLIEANRIDAEVERFRTALDAVHRELEALRADLTDD
FT                   TPSEVGAFIDVHAMILGDAMLVQETIDLIRTRRYNVEWALTEQLDLLTRHFDDIEDEYL
FT                   RERKADIEQVVERVLKALAGAPSAAQALDGAAANGTSEMIVVAHDIAPADMMQFKTQSF
FT                   QAFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIRQDDLIIVDGDQGIVIVDPAPIV
FT                   LEEYSYRQSEKLLEQRKLQRLKFSPTQTLCGTPIALYANIELPDDAKAAVDAGAVGVGL
FT                   FRSEFLFMHQKEMPEEEEQFAAYKRAVEWMKGMPVTIRTIDVGADKPLEALDEGYETAP
FT                   NPALGLRAIRWSLSEPQMFLTQLRAILRASAFGQVKILIPMLAHAQEIDQTLDLIREAK
FT                   RQLDDAGLAYDPNVRVGAMIEIPAAAIALPLFLKRFDFLSIGTNDLIQYTLAIDRADNA
FT                   VAHLYDPLHPAVLHLIAYTLREAKRAGVPVSVCGEMAGDPALTRLLLGMGLTEFSMHPS
FT                   QLLVVKQEILRAHLKSLEKPTADVLAAFEPEEVQAALKRLAVAEPRADAAA"
FT   gene            complement(489143..489895)
FT                   /locus_tag="Bmul_0444"
FT   CDS_pept        complement(489143..489895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0444"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bam:Bamb_2914 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14139"
FT                   /protein_id="ABX14139.1"
FT                   /translation="MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAM
FT                   YLAASGVGTITLVDADTVDLTNLQRQILHATASVGRSKVESGRDTLARLNPDVVVQAVA
FT                   QRVDDAWLDAHVPNATVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQISTFDF
FT                   RDAAAPCYACVFPEDQPFEEVACATMGVFAPTVGIIGAMQAAEALRVIGAIGTTLNGRL
FT                   MMLDSLRMEWTTMKIARQPDCPVCGKRH"
FT   gene            complement(490017..491564)
FT                   /locus_tag="Bmul_0445"
FT   CDS_pept        complement(490017..491564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0445"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: bvi:Bcep1808_2958 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14140"
FT                   /protein_id="ABX14140.1"
FT                   /translation="MRIKLKNIGLIAAGLATGVFATLQISASAEQTVTAPLPLDQLRLF
FT                   AEVFGQIKREYVEPVDDKKLLTAAIKGMVSSLDPHSSFLDKTDYDELQEQTKGRFAGLG
FT                   IEISQEDGLVKVISPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDKAVKQMRGEPGTK
FT                   VTLTIFRKSDDRTFPVTVTRAIIKVQSVKMKMLDPGYAYIRITSFQERTTPDLAAKLQD
FT                   IARQQPNLKGLILDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQVYRDTYD
FT                   NYRLPSFDGDPLKSLPPIFKTVPMVVLTNAYSASASEIVAGALQDSKRALIMGKTTFGK
FT                   GSVQTVRPMTADTALRLTTAYYYTPSGRSIQNKGITPDLPVDQYADGDPDDVLVTREVD
FT                   YSNHLANTQDPNEKKEQEEREQRRMDQLRILEEQNDKKTPEQRQKDRDRKPIEFGSADD
FT                   FMMQQALNKLEGKPVQESKSLLAESTKTAAGKPAAAAKASGAAAKPAAAPKPASAPQ"
FT   sig_peptide     complement(491475..491564)
FT                   /locus_tag="Bmul_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.650 at
FT                   residue 30"
FT   gene            complement(491822..492634)
FT                   /locus_tag="Bmul_0446"
FT   CDS_pept        complement(491822..492634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0446"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: bch:Bcen2424_2857 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14141"
FT                   /protein_id="ABX14141.1"
FT                   /translation="MADPAAGPARRAPLPSLPTARSMYKLVLIRHGESTWNKENRFTGW
FT                   VDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDRMDLMYLPVVHS
FT                   WRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTPPPALEPTDERAPYNDPRYAKV
FT                   PREQLPLTECLKDTVARVLPLWNESIAPAIRAGKQVLIAAHGNSLRALIKYLDGISDSD
FT                   IVGLNIPNGVPLVYELDENLKPIKHYYLGDQEAIAKAQAAVAKQGKAG"
FT   gene            492704..493126
FT                   /locus_tag="Bmul_0447"
FT   CDS_pept        492704..493126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0447"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bam:Bamb_2911
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14142"
FT                   /protein_id="ABX14142.1"
FT                   /translation="MTFFTDYTNLALIAILLVSGGLLAWPALRRGRGGVSAAEATQLIN
FT                   RRNAVVIDLRAPAEFAAGHLPSARQVAAGELGAKIAQVAKNKSTPVLLVCQNGQQSQKA
FT                   AREVQAAGYAEVHVLDGGVAAWQQAGMPVVKQGVAK"
FT   sig_peptide     492704..492778
FT                   /locus_tag="Bmul_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            493138..493383
FT                   /locus_tag="Bmul_0448"
FT   CDS_pept        493138..493383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0448"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   bch:Bcen2424_2855 glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14143"
FT                   /protein_id="ABX14143.1"
FT                   /translation="MYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMARTG
FT                   RRTVPQIYIGETHVGGYDDLSKLDREGGLVPLLQAA"
FT   gene            493485..493967
FT                   /locus_tag="Bmul_0449"
FT   CDS_pept        493485..493967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0449"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: bam:Bamb_2909 protein-export
FT                   protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14144"
FT                   /db_xref="GOA:A9AEK0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEK0"
FT                   /protein_id="ABX14144.1"
FT                   /translation="MSDVENQPFFNIQRVYLKDMSLEQPNSPAIFLEQDMPSVEVEVDV
FT                   KAERLAESVFEVVVSGTVTAKVKDKVAFLIEAKQAGIFDIRNIPDEQLDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQLQQQQAGAAGAPNGTALN"
FT   gene            493994..494992
FT                   /locus_tag="Bmul_0450"
FT   CDS_pept        493994..494992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0450"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: bur:Bcep18194_A6182
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14145"
FT                   /db_xref="GOA:A9AEK1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEK1"
FT                   /protein_id="ABX14145.1"
FT                   /translation="MKVAVLGAGAWGTALAGHLAARHDTLLWARDAALIAGLQARHENS
FT                   RYLDGIALPDALRYDAELGAALAHGAADDALCVIAAPVAGLRTLCRAMRDAGCVPAHIV
FT                   WVCKGFEADTHLLPHQVIAAELPEQLSNGVLSGPSFAREVGQGLPVALTVASVSAACRD
FT                   RTLAAFHHGAMRIYTGDDVIGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRGLAE
FT                   MSRLGAALGGRTETFTGLTGLGDLILTATGDLSRNRTVGLQLAAGRSLNDILGALGHVA
FT                   EGVRCAQAVLALARAQSIEMPITEAVCGVLFDGVAPRDAVSGLLRRDARAE"
FT   gene            495087..495611
FT                   /locus_tag="Bmul_0451"
FT   CDS_pept        495087..495611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0451"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   bam:Bamb_2907 Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14146"
FT                   /protein_id="ABX14146.1"
FT                   /translation="MLQIGSTTLDAQCVDITTLEVDAIVNAANGSLLGGGGVDGAIHRA
FT                   AGPGLLAECRTLGGCDTGDAKLTRGHRLPARYVIHAVGPVWHGGDRGEPRLLASCYRRA
FT                   IELADEAGATSIAFPAISCGIYRYPADRAVDIAVGTVVEMLPQAPGITRVIFACFSPDI
FT                   YDLYRARLARA"
FT   gene            complement(495634..496104)
FT                   /locus_tag="Bmul_0452"
FT   CDS_pept        complement(495634..496104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0452"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bvi:Bcep1808_2951 RNA methyltransferase, TrmH family, group
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14147"
FT                   /protein_id="ABX14147.1"
FT                   /translation="MFNVVLVAPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMR
FT                   RAGLDYHEYAQMRVHRDWDAFVAAESPDPARIFAFTTRGSSRFHDRAFLPGDWFVFGSE
FT                   TRGLPAELLERFPAEQRVRLPMRPGNRSMNLSNTVAVVVFEAWRQAGFEGGA"
FT   gene            complement(496216..496989)
FT                   /locus_tag="Bmul_0453"
FT   CDS_pept        complement(496216..496989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0453"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: bur:Bcep18194_A6179 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14148"
FT                   /protein_id="ABX14148.1"
FT                   /translation="MVRRSVPHPLRVVLSQVSQLAARLAAAALPNRCALCGNLSHAVIC
FT                   AACDAAYWNEARLRCAVCAMPLGAGRPRSRGAHAYRCDACRNAAPPFDATLALADYRPP
FT                   LDRLARDLKFHARLALGTEFAARLARLIDDTPGAGTIDVVAPVPLSRSRLVRRGYNQAW
FT                   AIARPLARRLGVRADAALLVRVADTAPQSRLDRRARRDNVATAFAVCGDVAGRHVALVD
FT                   DVMTSGATLAASAHALKAAGAARVTNLVALRTARD"
FT   gene            497073..498038
FT                   /locus_tag="Bmul_0454"
FT   CDS_pept        497073..498038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0454"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bam:Bamb_2904 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14149"
FT                   /protein_id="ABX14149.1"
FT                   /translation="MSPASTPTGRPANDARRLRRIFDRRAAAFDAVAFLPREIAQRMCE
FT                   RLEYIKVNPTAVLDAGCGAGDDLPALRARFPEAPVFGVDLSHAMLARAAQRELEQTSWR
FT                   RWLPASLGRALGQRGPRVAQADFSALPFADGAFELVWSNLALHWHSRPDTVFPEWQRVL
FT                   RVNGLLMFSTLGPDTLRELRAACADAEAALGIAPAAARVIDFVDMHDLGDMLVESGFEI
FT                   PVMDQEVLTVTYKSAESLLADVRRWGAYPFARTAPLHASRRFRDALANALEARRRADGT
FT                   IPLTFEVIYGHAWKAVPRTTPEGHGIVRIEDIGKGRPKNR"
FT   gene            498162..498758
FT                   /locus_tag="Bmul_0455"
FT   CDS_pept        498162..498758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0455"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: bch:Bcen2424_2848 integral membrane
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14150"
FT                   /protein_id="ABX14150.1"
FT                   /translation="MPLNPPIMRQLVVPGSPQYGAASPMQACIACHSREAAMEAARVLA
FT                   ETANGEPVLKDWLMKRNCSVSPRQFVLFYASLACFSLAIAALLMWRGVWLVMPFTGIEL
FT                   LVVGVAFAIYARHAVDYERIRLFPHRLVIERMDAERFTQIEFNPRWVRVEPGATPRDPI
FT                   RLVSRGQTVVIGQHLAQYKRAQFADELRVALRRCG"
FT   gene            498813..500411
FT                   /locus_tag="Bmul_0456"
FT   CDS_pept        498813..500411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0456"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   OmpA/MotB domain protein; cytochrome C oxidase subunit II
FT                   transmembrane region; KEGG: bch:Bcen2424_2847 cytochrome c
FT                   oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14151"
FT                   /protein_id="ABX14151.1"
FT                   /translation="MEILGKDAMKTIKRALTGVLACSGLLFAGAALAVGDSPGGPRVNE
FT                   INLQPPVTKIAEELYDLHTMMLILCTVIFVGVFGVMFYSIFAHRKSKGHKAANFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKAVVAMKDTTNADLTIKVTGYQWKWGYDYVKGPGEGIS
FT                   FLSTLTTPRDEVMGKKPITETYLQEVDNPLVVPVNKKIRIITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKADKVGTFRGFCTELCGKEHAYMPVVVEVLSDDDYAKWVSAQKAKL
FT                   AGAAVDPNKVYTMAELVSHGEEVYKANCAACHQVNGKGLGAFPAMDGSPIVNGPIAGHL
FT                   ERVLHGKGAMPSWASLSDLDIASVITYERNSWGNHKNDLLQPKQVADARNGKMPEDTAG
FT                   GAATASAPAEAASAPAQAASGAAQQPAASAALSTIYFETGKSALPADAKAAIAAAADYA
FT                   NAHPDAKLALSGFTDKTGSADANAELAKHRAQAVRDALKAAGVAEDRIILKKPETITGG
FT                   ADAKEARRVEIGPAA"
FT   sig_peptide     498813..498914
FT                   /locus_tag="Bmul_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 34"
FT   gene            500455..502062
FT                   /locus_tag="Bmul_0457"
FT   CDS_pept        500455..502062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0457"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bam:Bamb_2901 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14152"
FT                   /protein_id="ABX14152.1"
FT                   /translation="MSSIGHDVAAGHAHDDHAHETPHGWRRWLFATNHKDIGTLYLLFS
FT                   FIMFLSGGVMALGIRAELFQPGLQIMRPEFFNELTTMHGLIMVFGAIMPAFVGFANWMI
FT                   PLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFAPGGATAAGWTLYAPLSTQMGPGMD
FT                   FAIFAVHIMGASSIMGGINIVVTILNMRAPGMTLMKMPMFAWTWLITAYLLIAVMPVLA
FT                   GAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPAFS
FT                   RKTLFGYSSMVYATASIAILSFMVWAHHMFATGMPVTGQLFFMYATMLIAVPTGVKVFN
FT                   WLATMWRGSMTFETPMLFAIGFLFVFTFGGLTGLMLAMAPLDIQYHGTYFVVAHFHYVL
FT                   VAGSLFALFSGWYYWSPKWTGWMYNETRGKIHFWASMIFFNLTFFPMHFVGLAGMPRRY
FT                   ADYPAQFTDFNQVATIGAFGFGLAQVYFLFAVVLPAYRGGGELEKASDKPWDGATGLEW
FT                   TVPSPAPFHTFEQPPHVE"
FT   gene            502133..502273
FT                   /locus_tag="Bmul_0458"
FT   CDS_pept        502133..502273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14153"
FT                   /protein_id="ABX14153.1"
FT                   /translation="MTRNPQQRRTPEQIRAGNKRLGFILLAIAAVFFVGVVIKQWWLST
FT                   H"
FT   sig_peptide     502133..502252
FT                   /locus_tag="Bmul_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.571 at
FT                   residue 40"
FT   gene            502309..502920
FT                   /locus_tag="Bmul_0459"
FT   CDS_pept        502309..502920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0459"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: bur:Bcep18194_A6174 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14154"
FT                   /protein_id="ABX14154.1"
FT                   /translation="MSKPEAGAADRAFNRSMLVKLFVVAALMFGFGFALIPMYRAICQV
FT                   TGINNLLQRDVSEREAKNTQVDTSRTVSVEFDANARGPLGFKPEHNSLDVHPGELTTIV
FT                   YDVTNRQGRPVVAQAIPSYAPKQATEFFKKIECFCFTQQTLAANESRKMPVVFVIDPKL
FT                   PKDVKTITLSYTFFELNTPAVAAPAAPGTSAQRAAAKPDA"
FT   gene            502937..503137
FT                   /locus_tag="Bmul_0460"
FT   CDS_pept        502937..503137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14155"
FT                   /protein_id="ABX14155.1"
FT                   /translation="MTEPTRSGGFGQALRAVLWSFFGVRKRRDLEADATQLNPLHVLIV
FT                   ALLAAAAFIGVLILIVRAVVG"
FT   gene            503268..504125
FT                   /locus_tag="Bmul_0461"
FT   CDS_pept        503268..504125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0461"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bvi:Bcep1808_2942 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14156"
FT                   /protein_id="ABX14156.1"
FT                   /translation="MSGQNQTPYYFVPHPSQHPISAAVGLLVMLGSVALWINGHDWAPY
FT                   TALLGLLWLLFTLYHWFGDSIAESEGGHYGKNVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIALHQLGSLDYKLIWPDFSAVWPNEGPAALAGHFKTMGPWPIPTLNTALLLSSG
FT                   ATLTVSHHALRDDHRKKAIAWLAATLVLGVCFLFLQGFEYFHAYNELNLTLGSGIYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRMIRGHFKPDHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(504297..504506)
FT                   /locus_tag="Bmul_0462"
FT   CDS_pept        complement(504297..504506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14157"
FT                   /protein_id="ABX14157.1"
FT                   /translation="MHILVPIAFVLIIASMGSALYFMMHDRGHTKRMVWSLATRVGLSI
FT                   SLFLFILFANWMGWIHSTGLPIGR"
FT   gene            504591..505301
FT                   /locus_tag="Bmul_0463"
FT   CDS_pept        504591..505301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0463"
FT                   /product="SURF1 family protein"
FT                   /note="KEGG: bam:Bamb_2897 SURF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14158"
FT                   /protein_id="ABX14158.1"
FT                   /translation="MKIRWLPALLILAVVAVTIRLGFWQRDRAHQKEALQANIVRYEHA
FT                   APVDVGAQPIPLAAIEFHRVRAKGRFIPEQAVFLDNRPYNDQPGFYVVMPFKLTGGGYV
FT                   LVNRGWLPRNIADRTAIEPFATPAGDIEIEGIARADATRAFELGEGGSAPHQKIRQNLD
FT                   VAAYAKETGLPLQPFVIQQTSDDGDKLVRDWPAATTGVERNYGYMFQWWGMAAAALGFG
FT                   LYAARRAAKKSAGA"
FT   sig_peptide     504591..504659
FT                   /locus_tag="Bmul_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.609 at
FT                   residue 23"
FT   gene            505356..505988
FT                   /locus_tag="Bmul_0464"
FT   CDS_pept        505356..505988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14159"
FT                   /protein_id="ABX14159.1"
FT                   /translation="MSIQSSRRDPAATPVSPAARKRGRWMLVLLGLVCAAPMLASYFTY
FT                   YVIKPKGGSTNYGTLIEPQRPIPANLVVTDEAGKQVPLASLRGVWLFVMTDRSACDEAC
FT                   VKKLYFMRQIRVTQAGERHRITMVWLRSDAGAVPQKVLDAYPDTRRLVADPAAVAAWLP
FT                   ADTGTQDTDHLYLVDPNGNLMMRFPKDPNPSKIKTDVTKLLKWSSIG"
FT   gene            506008..507120
FT                   /locus_tag="Bmul_0465"
FT   CDS_pept        506008..507120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0465"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   bam:Bamb_2895 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14160"
FT                   /protein_id="ABX14160.1"
FT                   /translation="MSYLLQLGLIGICIALLPLSYVWVKADDDKFRKLVWVTTFLTLDL
FT                   VMFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHR
FT                   YFAMAIGVLIIAQVVIAWSAKLRRRPLHVSPWWPTSLLLLIVVQGIFGAWTVTMKLQPV
FT                   IVTTHLLLGLTLLGTLGWLAARQTPLPAHDPEAGRYRAAALAALVLLVVQIALGGWVST
FT                   NYAVLACTDFPTCNGQWIPPMNFEQGFHLWRALGMTRDGEAITQDALVAIHWTHRTFAF
FT                   VVVAYLIAFALKMRRFESLRRPANGVLLVVVLQFVTGLTNIVLQWPLPVAVAHNGGAAI
FT                   LLLLVVMLNFRILSSRPGRVVQPARDAAAA"
FT   gene            507129..508031
FT                   /locus_tag="Bmul_0466"
FT   CDS_pept        507129..508031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0466"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: bch:Bcen2424_2837 protoheme
FT                   IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14161"
FT                   /protein_id="ABX14161.1"
FT                   /translation="MQSTLSQSPGSRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVP
FT                   WHVLIGGTVGIWLLAGAAFAINCLVEQKVDAMMRRTAWRPSARGEITTPQILLFSAVLG
FT                   SLGAWTLYTFTNALTMWLTIATFVGYAVIYTLLLKPMTPQNIVIGGASGAMPPALGWAA
FT                   VTGAVPGDAWILVLIIFVWTPPHFWVLALYRRKDYENAGLPMLPVTHGEKFTRLHILLY
FT                   TVILFAVTMMPFISGMSGAVYLTSAVLLGAVFLAYAWKIYRDYSDELARKAFRYSIVYL
FT                   SLLFAALLADHYARPLLGV"
FT   gene            508050..508667
FT                   /locus_tag="Bmul_0467"
FT   CDS_pept        508050..508667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0467"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: bvi:Bcep1808_2936 electron transport
FT                   protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14162"
FT                   /protein_id="ABX14162.1"
FT                   /translation="MLHSWFGRRARQRWALVCAFAAALLLAACDNAPKFQNLDITGNTQ
FT                   FGSDFALPDTSGKVRTLADFKGKAVVMFFGYTHCPDVCPTTMAELSEALKQLGPDAAKR
FT                   VQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADDAQLKKVTKDFRVYYAKVPGKTP
FT                   GSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLIG"
FT   sig_peptide     508050..508136
FT                   /locus_tag="Bmul_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.948 at
FT                   residue 29"
FT   gene            complement(508837..509127)
FT                   /locus_tag="Bmul_0468"
FT   CDS_pept        complement(508837..509127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0468"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bch:Bcen2424_2835
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14163"
FT                   /protein_id="ABX14163.1"
FT                   /translation="MYVIDIHYTASLERIDDALERHRAYLQPLLDKGIFIAAGPKVPRA
FT                   GGVILAARIDRDALEAILQTDPFVTEGLATYRVTEFRITRAATGFNVPALP"
FT   gene            509323..510972
FT                   /locus_tag="Bmul_0469"
FT   CDS_pept        509323..510972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0469"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bch:Bcen2424_2834 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14164"
FT                   /protein_id="ABX14164.1"
FT                   /translation="MSRMSLNRKLWLALALVWIGLLGVGAWSAYETRATMLAERKEGIT
FT                   NLVDAAAGIVKSYYALAQSGTLPEADAKRDALASLAAMRYGDAGYVFVMDSKPVVLMHP
FT                   TLPKLVGTQVGDYLDPDGKPLFVTILNAAKATGSGFAEYRGRLPHSETAVPKISYVTRF
FT                   APWDWNISSGVFVKDIDTVYYRTLAGHLVVVLVIGVLISAAMLVIIRNVRGSLGGEPDA
FT                   AAALAMRIAQGDLTQPVPVRTGDRTSMMAAMRDMQARLQATMGGIRQSAESIAAASRQI
FT                   AAGNDDLSQRTEEQAASLEETAASMEQLTATVKQNADNARQASGLANNASEIARTGHDV
FT                   VSRVIVTMGEIDDSSRKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRSLAQRSATAAKEIRELIVDSVERVRNGSTLVGQAGTTMGEILQAVARVTDIMGEIAA
FT                   ASEEQASGITQVGRAVTQMDQVTQQNAALVEQAAAAAASLQEQAGRLRDAIGAFRVGDS
FT                   AEAASRAARPARAHADEPAFERHDADSETVAA"
FT   sig_peptide     509323..509409
FT                   /locus_tag="Bmul_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.818 at
FT                   residue 29"
FT   gene            511213..512028
FT                   /locus_tag="Bmul_0470"
FT   CDS_pept        511213..512028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0470"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: bam:Bamb_2890 lipoprotein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14165"
FT                   /protein_id="ABX14165.1"
FT                   /translation="MKRRSLLKVFSVLAAGAALTMSAGAHAEDKVIKVGTVAGPDAEVW
FT                   QVVQKVAKEKEGLNVKVVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQVKQRGYKIVT
FT                   AGLTYISPIGVYSKKFKSLKELPQGAKIAVPNDPSNENRALLLLQAQGAIKLKAGAGTG
FT                   GNNATVLDIADNPKKLKISELDAAQLPRVLPDVDAAVINTNYALAANLQPTKDAIALES
FT                   LTSPYANVIAVRTKDKDQPWVKKLVKAYQSPEVKEFIKKQFKGSMVASF"
FT   sig_peptide     511213..511296
FT                   /locus_tag="Bmul_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(512236..512562)
FT                   /locus_tag="Bmul_0471"
FT   CDS_pept        complement(512236..512562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14166"
FT                   /protein_id="ABX14166.1"
FT                   /translation="MPPDLRSIATVAAISIAAALSPLPAAASGLADGDAQYDQCMLQAL
FT                   RESRNGAAAQLIQRSCDALYRNSAMLLPRERRYHECIVQSLPGVRDNYAIQQIMAICSR
FT                   RGEM"
FT   sig_peptide     complement(512479..512562)
FT                   /locus_tag="Bmul_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 28"
FT   gene            512827..513792
FT                   /locus_tag="Bmul_0472"
FT   CDS_pept        512827..513792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0472"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   bch:Bcen2424_2831 protein of unknown function DUF534"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14167"
FT                   /protein_id="ABX14167.1"
FT                   /translation="MKRFKTFAIRSITAGVAALALAGAAHAQTVKVLSIVDHPALDAIR
FT                   DGVRAELKAEGYGDDKLKWEYQSAQGNTGTAAQIARKFVGDQPDVIVAIATPAAQAVVA
FT                   ATKSVPVVYSGVTDPVAAQLVKGWGPSGTNVTGVSDKLPLDRQVALIKRVVPKAKTVGM
FT                   VYNPGEANSVVVVKELKEILAKQGMTLKEAAAPRTVDIGPAAKSLIGKVDVIYTNTDNN
FT                   VVSAYEALVKVANEAKIPLVAGDTDSVKRGGIAALGINYGDLGRQTGKVVARILKGEKP
FT                   GAIASETSSNLELFVNTGAAAKQGVTLSPDLVKEAKTVIK"
FT   sig_peptide     512827..512910
FT                   /locus_tag="Bmul_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            513930..514826
FT                   /locus_tag="Bmul_0473"
FT   CDS_pept        513930..514826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0473"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_A6160 ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14168"
FT                   /protein_id="ABX14168.1"
FT                   /translation="MSLFSFLGALEIGLIFSLVALGVLISFRILNFPDLTVDGSFPLGG
FT                   AVAATLISAGYDPFTSTCLAIVAGALAGFVTGWLNVRLKIMDLLASILMMIALYSVNLR
FT                   IMGRPNVPLITEPTVFTVLQPDWLPDYVLRPALLALVVVVAKLGLDWFFSSQLGLAMRA
FT                   TGANPRMARAQGIATGRATLAGMALSNALVALAGALFAQTQGGADISMGIGTIVIGLAA
FT                   VIIGETLLPARRLVLTTLAVVLGAIVYRFFIALALNSEFIGLKAQDLNLVTAALVTIAL
FT                   VLPATRKKLFARKNGGA"
FT   gene            514828..515622
FT                   /locus_tag="Bmul_0474"
FT   CDS_pept        514828..515622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0474"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A6159 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14169"
FT                   /protein_id="ABX14169.1"
FT                   /translation="MLSAQDLKLTFNPGTPIETRALRGLSLEIPDGQFVAVIGSNGAGK
FT                   STFLNAISGDQRVDSGRIAIDGADVTRQPAWDRAHLVARVFQDPMAGTCEALTIEENMA
FT                   LAMARGARRGFRAALDRTSRELFRDKLRLLNLGLENRLTDRIGLLSGGQRQAVSLLMAS
FT                   LRPSRILLLDEHTAALDPKTAAFVLELTARIVADSKLTTMMVTHSMRQALDYGDRTVML
FT                   HQGQVVLDVSGDARKGLDVPDLLQMFEKVRHEQLDDDALLLG"
FT   gene            515814..516524
FT                   /locus_tag="Bmul_0475"
FT   CDS_pept        515814..516524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14170"
FT                   /protein_id="ABX14170.1"
FT                   /translation="MMSASSLSPESLHPSLWRGSQLARGGPRTIDTGFATLSAELPGGG
FT                   WPVGGLIELLAAQPGCGEMRLLAPALARTVSARRPLALVAPPQWPHAAALAALGVPPES
FT                   LLWLRAGSRIDALWAAEQALKTGCCGALLLWQDARPDALRRLHLAAARTGDTLFVMLRP
FT                   LSAARQPSPAVLRVALYPAPGGVSLDIVKRRGPARSEPLELDLPSPIVESRYARLARHP
FT                   SAAPAARRVRRAAV"
FT   gene            516457..517944
FT                   /locus_tag="Bmul_0476"
FT   CDS_pept        516457..517944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14171"
FT                   /protein_id="ABX14171.1"
FT                   /translation="MRVLLGIHLPRLPLDVCAAPPSDGDAGGAGCAVLEQGVVLIADAA
FT                   ARRQGVRAGMKRGGVLTLAPDTQLVERDPAREADALRAVALALLRFSPNVALADEATLV
FT                   VDVGPSLRLFGGLPSLCRQVRATLAALGYAARMSAAPTAGGAWLLARASARVRSRRRVA
FT                   RRASLVRALDALPCVLLPDARPYAGWFDGLGCRTLADLRGLPRKGLQRRCGPALLAALD
FT                   RAYGDAVEPLAWMAVPPVFDVRLELAERVDYAEAVLFVARRLVVQLCGWLAARQLSLAA
FT                   MTFDLEHERGRQAVPPTSLELAFAAPVRDEAHFMRLLGERLARVELPAAVIAVRLKATR
FT                   VESVAPPADDLFPEPGGTKETRARLLELLVARLGAENVLCAAPVADHRPEAANRWLPLD
FT                   AQAGKPPGAPPAVPPRPVWLLPEPLPLLMRENRPVFHTPLRPMSSPERIEAGWFDGQTI
FT                   ARDYYVAQDEEGACYWIFRERMSSQADPHWFLHGLFG"
FT   gene            517951..521166
FT                   /locus_tag="Bmul_0477"
FT   CDS_pept        517951..521166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0477"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bam:Bamb_2886 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14172"
FT                   /protein_id="ABX14172.1"
FT                   /translation="MVAESLLLPAYAELFCRSNFSFLHGASHAEELVARAVKLGYRGIA
FT                   ITDECSLAGAPRMHVAARAAGLPLIIGSYFEVTPDEAPPGHDPGPGAFGLVLLAQNREG
FT                   YGNLSELISWRRMAAPKGTYQLTPRMLSRPPEEFAHLRGMPDCFAILVPVYPVRADVLD
FT                   AQVAWFRTTFGERARLGLVQLQRALDGPQRDEIRAAGARRGVRVVALGDVTMHKRSCKP
FT                   LQDVMTAIRLGMPVSECGYALAPNAEQHLRSRARIATLFSADEIAQTCAILDACHFELD
FT                   TLRYEYPDEIVPPGHTPTSYLEQETRAGAAERYPKGVPEKVEQQIRYELALIAKLSYEP
FT                   FFLTVYDIVKYARSQNILCQGRGSAANSAVCYCLGITEVDPEQSTLLFERFISENRGEP
FT                   PDIDVDFEHQRREEVIQHIYEKYGKHRAAIAAAVSTYRPRGVLRETGKALGVDPMLVDR
FT                   VAKGHRWFDGSRDLLQQFEMVGLDPATPLIRTWAELAARLLNFPRHLSQHSGGFVISRG
FT                   KLTRLVPVENAAMDGRRVIQWDKDDLEALGLLKVDVLALGMLSALHRAFDMITAWRGLQ
FT                   PDGKPFGFDHIPRHDDDTYDMICRADTVGVFQIESRAQMSMLPRLKPREYYDLVIQVSI
FT                   VRPGPIQGGAVHPYLKRRRIVAGEEEGEVTYPSDALKAVLERTLGVPIFQEQVMQIAIV
FT                   AAGFTPDEADALRRAMAAWKRKGDLGKYHDQIVNGMLERGYTREFAEQIFEQIKGFGEY
FT                   GFPESHAASFAKLAYASSWLKCHEPAIFVAALLNSQPMGFYAPAQLVQDARRHGVTVFP
FT                   VDVTKSNWETSLEALPGAAPPEGDPAVRLGLSLVRGFGEAAARRIEAARAAGPFENVDA
FT                   LARRARLERRDLEALAAANALATLAGHRRDALWQAVAAAPDRDLLAAASIDEAERPALG
FT                   APSEADEILADYDTTGLTLNRHPVALLRPVLRARRLSSAAELRDRPDGRLARACGIVIA
FT                   RQMPGTAKGVLFMTLEDETGCVNVIVRPELLARQRRETLDSRLLAASGVWQVVSDVRHL
FT                   VAQHFEDLTPLLGGLRTSTREFQ"
FT   gene            521486..522220
FT                   /locus_tag="Bmul_0478"
FT   CDS_pept        521486..522220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0478"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bam:Bamb_2885 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14173"
FT                   /protein_id="ABX14173.1"
FT                   /translation="METGWSELAPDPLSDTPLYLQLARKLAGAIHGGTWRAGEALPSER
FT                   ALSASVGVSRITARRALALLVEQGLIRRSRGAGSFITPRVADPLSRLVGFTAKMRQRGF
FT                   MPDSVWLERRLRAATRAELRHLGLAPGATVARLERLRRADGIVMAVEHSTLPAAVVPDP
FT                   LALGASLYEYLEARGMNVVRALQHFRAVNATREIAKWMAVKPGAALLVITRIGYGADQR
FT                   AIEVTETYCRDDYYDFVAELKR"
FT   gene            522271..523407
FT                   /locus_tag="Bmul_0479"
FT   CDS_pept        522271..523407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0479"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: bur:Bcep18194_A6154
FT                   N-acetylglucosamine-6-phosphate deacetylase; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14174"
FT                   /protein_id="ABX14174.1"
FT                   /translation="MPASPDPQENVMLTGNILTPDGWIHGSLDSENGRITTLDGTPADP
FT                   AKNDAPYILPGFIDLHVHGGGGADVMEGGDAIETIARTHAQFGTTSLLATTMTAPRDEL
FT                   MDVVANLGTAARTRTPGGARVLGVHLEGPYINPGKLGAQPDAAVSAVLDEVLKYLSIAP
FT                   IRVVTLAPEIAGHIEIIGEMAARGVRVQLGHSLATYDDAVAALKHGACGFTHLFNAMSP
FT                   LHHRNPGLVGAALAHAEYAEIIPDLLHVHPGAIRAALRAIPRLYVVTDSTSATGMPDGE
FT                   YRLGSQHVTKCLGGVRLADGTLAGSTLTMDQALRNLVSLGLPIADVSNRMSRYAADYLG
FT                   LADRGRLERGAWADLVVFDRDLNLTATYVEGESIVEYA"
FT   gene            523400..524407
FT                   /locus_tag="Bmul_0480"
FT   CDS_pept        523400..524407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0480"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: bam:Bamb_2883
FT                   glutamine--fructose-6-phosphate transaminase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14175"
FT                   /protein_id="ABX14175.1"
FT                   /translation="MLNEARESARVVAAQLADTTRVEALAGQLMDHPPAVALTVARGSS
FT                   DHAASYFASLTMSRLGVPVASLPMSVATLQQAPLKVQDQLAIAFSQSGKSPDLVNTMTA
FT                   LREAGARTVAAVNVLPSPLADACEHQLPLLAGPELSVAATKSYIAMLSLSAQIVAFWQR
FT                   DAALMTALRGLPDVLARAGTLDWSAAVAALAGVERMIVIGRGLGLAIAQEAALKLKETS
FT                   GIQAEAFSSAEVRHGPMELIDRDYPLLVFAPPGPEQAGLLQLADDMRARGAAVLVAAPA
FT                   GTPGATLPLASSAHPALDPIAAILSFYVMAAELAVARGRNPDTPRHLNKVTETH"
FT   gene            524423..527005
FT                   /locus_tag="Bmul_0481"
FT   CDS_pept        524423..527005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0481"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: PTS system, glucose subfamily, IIA subunit;
FT                   phosphoenolpyruvate-protein phosphotransferase; PFAM:
FT                   phosphocarrier HPr protein; PEP-utilizing protein;
FT                   sugar-specific permease EIIA 1 domain; PEP-utilising
FT                   protein mobile region; PEP-utilising protein domain
FT                   protein; KEGG: bur:Bcep18194_A6152 phosphoryl transfer
FT                   system, HPr/phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14176"
FT                   /protein_id="ABX14176.1"
FT                   /translation="MRRAEESQLKSSTHDQIVLLAPLTGPIVALADVPDPVFSGGMFGD
FT                   GIGIDPLAGKLVAPCAGIVSHLARTGHAVTITTPHGAEVLLHIGIDTVELNGQGFTARV
FT                   EAGARVEAGDLLIEFDQDAVARAAQSLVSVIAIANSDAFDVIERASGFATAGETPLLTL
FT                   RGKGEAAAQAAQAGAAAMNEVRRELVLTQPGGLHARPAARAREAARGHDAHVEVHFDGR
FT                   KAPIESVVGLLGLGAGERATVVLVGRGAHAQQAVDAVAAELLREAHGEAEEKPARLTSP
FT                   APQPVANRSGAPLAPNTLAGVCAAPGIAVGTLVRLDDADIVPPEQAAGTPAAESRRLDQ
FT                   ALKTVDAELDGTVRSASARGAVGEAGIFAVHRVLLEDPTLIDAARDLISLGKSAGFAWR
FT                   ATIRTQIDTLSKLDDALLAERAADLRDIEKRVLRALGHTSGAVRALPDEAVLAAEEFTP
FT                   SDLSSLDRARVTALVMARGGATSHAAIIARQLGIPALVAVGDALYAIPDGTQVVVDASA
FT                   GRLEHAPTALDVERARHERERLAGVREANRRMAGAAAATADGRAIEVAANIATLDDANT
FT                   AVDNGADAVGLLRTELMFIHRQAAPTMLEHQQSYQAIVDALQGRTAIIRTLDVGADKEV
FT                   DYLTLPPEPNPALGLRGIRLAQVRPDLLDDQLQGLLAVKPFGAVRILLPMVTDAGELVR
FT                   LRKRIDEFARAQGRTEPIEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAMDR
FT                   CQPDLAGQADGLHPAVLRLIDLAVRGAEKHGKWVGVCGALGGDPLAVPILVGLGVTELS
FT                   VDPVSVPGIKARVRRLDYALCRQRAQDLLTLDSAHAVRAASREIWPLD"
FT   gene            527085..528875
FT                   /locus_tag="Bmul_0482"
FT   CDS_pept        527085..528875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0482"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: bch:Bcen2424_2821 PTS
FT                   system, N-acetylglucosamine-specific IIBC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14177"
FT                   /protein_id="ABX14177.1"
FT                   /translation="MDGNPFLKIQSLGRALMLPIAVLPVAGILLRLGQPDVFNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIETAIMKDIDPKLNMGVLSGI
FT                   IAGVVAGLLYNRYKDIKLPDYLAFFGGKRFVPIITGLVCVVLGIVFGYVWQPIQHAIDA
FT                   AGQWLTTAGAIGAFVFGFLNRLLLVTGLHHIINSLAWFVFGNFTPPAGGEIVHGDLHRF
FT                   FAGDPTAGTFMAGFFPIMMFGLPAACLAMLHEAPKERRAMVGGLLFSMALTSFLTGVTE
FT                   PIEFSFMFLAPVLYVIHAVLTGLSLAICQILGVKLGFTFSAGAIDYVLNYGLSTKGWIA
FT                   IPLGIAYGIAYYALFRFFIRTFNMATPGREPASADAASESYASGGFVAPAAGAAGTATA
FT                   AAAAPRAQRYIAALGGAGNLSVVDACTTRLRLTVVDPAKVSEPELKSIGARGVLKRGGN
FT                   SVQVIIGPEADIIADEMRAAIGGGAAGAAVNATTPAGAVAEPAAGAAAGPLDPEPARWL
FT                   AVFGGATNVVSLDAIATTRLRVVVRDPSAVDRERLGTLDVAWVSSDTLHIVCGNAAARY
FT                   AQQLGARLPSAGDGAAAQPA"
FT   gene            complement(529207..530343)
FT                   /locus_tag="Bmul_0483"
FT   CDS_pept        complement(529207..530343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0483"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bch:Bcen2424_2818 cytochrome d ubiquinol
FT                   oxidase, subunit II; TIGRFAM: cytochrome d ubiquinol
FT                   oxidase, subunit II; PFAM: cytochrome bd ubiquinol oxidase
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14178"
FT                   /protein_id="ABX14178.1"
FT                   /translation="MDYATLKLIWWLLVGVLLIGFAVTDGFDMGATALLPFLGKTDDER
FT                   RIIVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFALFFRPVGFD
FT                   YRSKRPDPRWRAGWDWGLFIGGFVPALVFGVAFGNLLQGVPFRFDTDLRVSYHGSFWAL
FT                   LNPFALLCGLVSLTMLVAHGAAFIKLKTDGVIARRASVALRVSSFVAVVLFALAGVLVA
FT                   AHVDGFHITRAAPADTVANPLLKEVASGAGLWLANYRDYPWMIAAPVVGIAGGLLATLL
FT                   AGSRREKTAFFCTGLMIVGVILTAGFSMFPFIMPSSLDPTSSLTVWDSTSSEKTLLVML
FT                   FAVIVFLPIILVYTSWVYRVMRGKVTRQVLDENTHSMY"
FT   gene            complement(530375..531955)
FT                   /locus_tag="Bmul_0484"
FT   CDS_pept        complement(530375..531955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0484"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bmn:BMA10247_2868 cytochrome d ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14179"
FT                   /protein_id="ABX14179.1"
FT                   /translation="MISSEVVDLSRLQFGITALYHFLFVPLTLGLSWLLVIMESVYVMT
FT                   GKQVYKDMTQFWGKLFGINFAMGVTTGITLEFQFGTNWSYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWNRLSKVQHLIVTFLVALGSNLSALWILVANGWMNNPVGAEFNY
FT                   QTMRMELTSLFDVLFNPVAQVKFVHTVSAGYVTAAMFVLGVSSWYLLKKRDVDFALRSF
FT                   AVAAGFGLASTLCVIVLGDESGYTTGEVQKMKLAAIESEWETQPAPASFTLIGIPNQEA
FT                   QRTDYAVKIPYALGLIATRSIDEPVIGLRELAKRSEAHIQSGMIAYGALQKIKAGDTSA
FT                   ETRALFDAHKQYLGYGLMLKQFTPNVTDATPAQIEAAAKKTIPPVAPVFFSFRIMVFLG
FT                   FLFLATFIAAFWFCARRELLQDNRRWFLRYAVWAIPLPWLAAEFGWVVAELGRQPWTIA
FT                   GVLPTHLSASSLTPTDLYLSLAGFIVFYTALFVIEITLMFKYARLGPSSLHTGRYHHEQ
FT                   AAAREHAAA"
FT   gene            complement(531945..532202)
FT                   /locus_tag="Bmul_0485"
FT   CDS_pept        complement(531945..532202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14180"
FT                   /protein_id="ABX14180.1"
FT                   /translation="MISINQEPARPRGWRARVVAWAHGPTLARDITLVLILKLILLMSL
FT                   KYAFFNHPQAEHMSLPPAAVAEKLLSVPAPASTEGDHHDK"
FT   gene            complement(532510..533445)
FT                   /locus_tag="Bmul_0486"
FT   CDS_pept        complement(532510..533445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0486"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; KEGG: bch:Bcen2424_2815 RNA
FT                   polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14181"
FT                   /protein_id="ABX14181.1"
FT                   /translation="MSNALTLPNTLSPTPAKAESAGSLALATHSMLPGQLGNIDAYIQA
FT                   VNRIPLLTAEEERQYATEYRENNNLEAARRLVLSHLRLVVSIARNYLGYGLPHGDLIQE
FT                   GNIGLMKAVKRFDPAQNVRLVSYAIHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKKGMQAMTPEEIDGLAQELNVKREDVTEMETRLSGGDIALEGQVEDGEESYAPIAYL
FT                   ADSHNEPTAVLAARQRDMLQTDGIAQALDALDARSRRIIEARWLHVDDDGSGGSTLHDL
FT                   AAEFGVSAERIRQIEASAMKKMRTALAEYA"
FT   sig_peptide     complement(533389..533445)
FT                   /locus_tag="Bmul_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.745 at
FT                   residue 19"
FT   gene            533803..534372
FT                   /locus_tag="Bmul_0487"
FT   CDS_pept        533803..534372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14182"
FT                   /protein_id="ABX14182.1"
FT                   /translation="MNKKKNRRPRSRIALHAAVAASLLAGSGLAFADRWGIQAGGGFSD
FT                   RHGIDKADLAVVWDPGWNWWEIGGWHFAFVLEGHVGYWHTGGNIHSNIGEFGATPMFRF
FT                   IKSAGQVRPFIEAGAGVRLLTHPTISDNFSMSTAFQFADVVGVGAQFGERQQYQVGYRF
FT                   QHVSNAGIKEPNPGVNFHQFYVQYNF"
FT   sig_peptide     533803..533901
FT                   /locus_tag="Bmul_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 33"
FT   gene            534418..534801
FT                   /locus_tag="Bmul_0488"
FT   CDS_pept        534418..534801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14183"
FT                   /protein_id="ABX14183.1"
FT                   /translation="MTKVVDAIRALERDRFRAMVDGDGEALDALLSEKVFYVHTNGKRE
FT                   TKQQFIDAIAAGRRRYRQIEIQSQDVLPVGDGTCLVTGRALIEMETNNGGLVFPIAYTA
FT                   VQAQEQGRWRLLAWQATRCATDT"
FT   gene            complement(534937..536583)
FT                   /locus_tag="Bmul_0489"
FT   CDS_pept        complement(534937..536583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0489"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: bam:Bamb_2872 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14184"
FT                   /protein_id="ABX14184.1"
FT                   /translation="MKRNPQEKYRAFEPVRLNGRKWPTRTIERAPVWMSTDLRDGNQSL
FT                   IEPMSIEQKLEFFEMLVAIGFKEIEVGFPSASQTDFDFVRKLIDEKRIPDDVTIEVLVQ
FT                   SREDLIARTFEALEGVPRAIVHLYNAICPSFRRIVFGMSKDDVKALAVEGTRLIKAYAA
FT                   ARPDTQWTYQYSPETFSMTELTFAREVCDAVAQMWRPTRDHKMIVNLPATVEAAMPNVF
FT                   ADQIEWMDRNLAYRDSIVLSVHPHNDRGTAVAAAELALLAGADRIEGCLFGNGERTGNV
FT                   DLVTLALNLYTQGIDPGLDFSDIDAVRRVVERCNQIPVHPRHPYAGDLVFTAFSGSHQD
FT                   AIRKGFAQQRADALWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGATYLLERGMGFTPT
FT                   RRVQIEFSHAVQTLADASGAEVTGDAICALFAREFLETDGPAARHGNGARWQNREIAGA
FT                   FAADAAPEAAVQRAAAAFAAAAGATIDVASCEHVRTADGRIAVSVGCRVGDAPLRHGVG
FT                   VHADASCAALDAVVSAINRSAWQHADRRAAA"
FT   gene            complement(536976..538085)
FT                   /locus_tag="Bmul_0490"
FT   CDS_pept        complement(536976..538085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0490"
FT                   /product="glycosyl transferase family 3"
FT                   /note="PFAM: glycosyl transferase family 3; KEGG:
FT                   bch:Bcen2424_2811 glycosyl transferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14185"
FT                   /protein_id="ABX14185.1"
FT                   /translation="MRRRAAGEPECSAVRSQCVRERARAILGASVTEFRAPRCRPRAPR
FT                   PMTAAHDSAAPFPCARFIKEIGRGPHGARALSAADTFELYRAMLDARVSDVELGAILIA
FT                   YRLKGETADELAAMLAAAQASFEPVHVRDAAFRPVSIPSYNGARKQPNLVPLLALLLAR
FT                   EGVPVLVHGVAQDPGRVTSAEIFAALSIAPSTSHDAIEDTLAERRVAFAPIDTLAPRIA
FT                   RLLSMRAVLGVRNSTHTLVKLLQPFAPAGLRLVNYTHPPYRDSLVELFAAHPDAALGGA
FT                   LLARGTEGEAVADTRRQVQVDWLHDGVCDTLIEPERSSADAPPVALPESRDAQTTAAWT
FT                   DAVLRGEIPVPDTVARQVATIVRIARTAG"
FT   gene            538121..538765
FT                   /locus_tag="Bmul_0491"
FT   CDS_pept        538121..538765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0491"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: bur:Bcep18194_A6140
FT                   maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14186"
FT                   /protein_id="ABX14186.1"
FT                   /translation="MKLYSYFRSSASYRVRIALNLKRLPYDYVPVHMLRDGGQQLKDEY
FT                   RALNPDALVPTLVDGDATLQQSLAIIEYLDETHPEPALLPKAPVDRAYVRAIALQIACE
FT                   IHPLDNLRVLKYLKHTLKVSEDDKNAWYRHWIESGFASLETRLANDPRTGKLCFGDTPT
FT                   LADICLVPQVFNANRFSIDTTRYPTIQRIADYASTLDAFKAAEPGVQPDAE"
FT   gene            complement(538836..539978)
FT                   /locus_tag="Bmul_0492"
FT   CDS_pept        complement(538836..539978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0492"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: bch:Bcen2424_2809 signal recognition
FT                   particle-docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14187"
FT                   /protein_id="ABX14187.1"
FT                   /translation="MFSFFKRFKKTQEPGSAESQPADAPQPDAPSDAHDADVPPAPAPA
FT                   EPAAPAVVMTVTPSDNGRDEVVETVEIVPPPVQDASAKKSWLARLKTGLAKTGSSITGV
FT                   FVNTKIDDALYEELETALLMSDAGVDATEYLLGALREKVRVGRLTDPQQVKSALRDLLV
FT                   ELLTPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAA
FT                   AREQLTVWGERNNVTVVQQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLME
FT                   ELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKG
FT                   GILAAIARQRPVPVYFIGVGEKVEDLQPFSAEEFADALLG"
FT   gene            540192..540806
FT                   /locus_tag="Bmul_0493"
FT   CDS_pept        540192..540806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0493"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: bch:Bcen2424_2808 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14188"
FT                   /protein_id="ABX14188.1"
FT                   /translation="MSRSSSGRSAASSARGKPHTIRIIGGDWKRTPLAVLDLDGLRPTP
FT                   DRVRETLFNWLGQDLEGRRCLDLFAGTGALGFEAASRGAANVVMVERHPRAAQQLRAIK
FT                   DKLGARTVEIAEADALRLAAGLAPRSFDVVFLDPPFGDAAALARAIALTAPLVADGGAL
FT                   YVESGVELDLSAHDALAGWQVAKHGKAGAVHYHLLRRENDE"
FT   gene            540918..541415
FT                   /locus_tag="Bmul_0494"
FT   CDS_pept        540918..541415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0494"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: bam:Bamb_2867 pantetheine-phosphate
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14189"
FT                   /db_xref="GOA:A9AEW9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEW9"
FT                   /protein_id="ABX14189.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFF
FT                   SLEERLKIANEVLGHYPNVKVMGFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMGGP
FT                   AA"
FT   gene            541878..542864
FT                   /locus_tag="Bmul_0495"
FT   CDS_pept        541878..542864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0495"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: pna:Pnap_3921
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14190"
FT                   /protein_id="ABX14190.1"
FT                   /translation="MATFSQRNGRWQVKINRKGFPTQYRSFATKAEGQVWARSVETAMD
FT                   DGTWVDPAGTTDVTFGKLLERYRESITPTKRSRRSEEYRIGKMLRHKIAEYSMRNLTAS
FT                   LVADYRDQRLKVATNSCVCRELATISAVITHAQREWGLSITNPAKLVKKPRLPPGRNRI
FT                   LKPAELDRLLHELHAERHELRSRWLLPLAKLALETAMRQGELLSLEWRHVDFDQRTAYL
FT                   PMTKNGKDRHVPLSSAAIAILESLERIDERVIPITQNVVLCAWPRACKRAAIENFHFHD
FT                   LRHMATTNLAKKLPNVIELASVTGHSNVQMLSRYYHTSAGELARKLG"
FT   gene            543321..544460
FT                   /locus_tag="Bmul_0496"
FT   CDS_pept        543321..544460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14191"
FT                   /protein_id="ABX14191.1"
FT                   /translation="MDEELANDVQGIAADSEKDPGPADADREAKRAAARLKAKESLIAS
FT                   LAGGDFSNQQTRVAHILNLHPAARNSDVALALKYWETFQPEIYNPGGIKPADFFKLDRV
FT                   PFLVRARAKIQNEYELFQAEEKVRRRRKGREDEMREAVLNDEAPRQMLQVFSDETGKGE
FT                   DHVIIGSVWVLNGRAVYDVSKAIRDWQAVSKFARREIHFSAFGKGDVDAVTDYLNVVAA
FT                   NREFLSFKLIAVNKRNSRRPIDEVVQRLHEFMLVRGLRHEIESGRVGVPRHVAVTMDEE
FT                   QSIDRIALTEIRNRVSEGIERANLDGVTLDERFNTVSSKDSALVQLADVVAGAANRQLN
FT                   FKGERNYKDEIADRVMDVLELKLEEDEAPGVDAAVLFRI"
FT   gene            545297..546208
FT                   /locus_tag="Bmul_0497"
FT   CDS_pept        545297..546208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14192"
FT                   /protein_id="ABX14192.1"
FT                   /translation="MRLLGEVIDLLSANDGSLTGALLKTKVLMHRIGHKELAGWVNDEL
FT                   NGYKDENLIPTYRVVRARIVGNVMLPGGARYRSQTLPTAHLPEDIRQSYTEWPMPQSIS
FT                   VLETLAAQTQSLSNAIAPEIYGTFGSGYEAAHVTSAWRQIEPGQVQNIVVEVRSRLLDF
FT                   VLNLQDQIGDVPESDMKEAAKTVDASGMFNNAMFGDNVTVVIGHGNVTTSINTVQKRDF
FT                   DSLSAALKKAGVDDEDVEALRTAISDDDSAGAVVEKDRFGPKVQNWFGSMIRKAASGGW
FT                   TIGLSAAGAVLAAAINAHYGFK"
FT   gene            546292..547023
FT                   /locus_tag="Bmul_0498"
FT   CDS_pept        546292..547023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14193"
FT                   /protein_id="ABX14193.1"
FT                   /translation="MVRMATSEERLTRAKLLVAAAEEEMLLAIMFHETWKPTAYDGDLR
FT                   ARIGGSYAAHTFEIIRLALRREVVMALMRLWDDHRQALKLNSIVDVLQSAECFDGLMRE
FT                   RIAAIGVPEEEADALRDTHRKLRDDMVALVRKHTHSNDPSPLLDRLRTIRHERLAHRQA
FT                   EQPTDPAGLLATDEEVEDLYQDSRRIINYMALLLLGRSFYLALGSGRPYRESAGYFWES
FT                   VRGEGAEGHPRVERAQRRRPL"
FT   gene            complement(547145..547591)
FT                   /locus_tag="Bmul_0499"
FT   CDS_pept        complement(547145..547591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_2061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14194"
FT                   /protein_id="ABX14194.1"
FT                   /translation="MSAIANLKIVAAKRPGALPQIVQRRNRLIAQIWEQTELAKAQQAG
FT                   TSFTPTKFRSVKDAETGERRNLEVQKRVRAWWWTAENGRVHMHVKYGAKTLELAKGKTA
FT                   IEIGTLADLIPTLDTLKAAVVAGELDAQIEAISGQMRSGFVGKK"
FT   gene            548844..549410
FT                   /locus_tag="Bmul_0500"
FT   CDS_pept        548844..549410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0500"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: pnu:Pnuc_1839
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14195"
FT                   /protein_id="ABX14195.1"
FT                   /translation="MKQAKTFTEKELKQVLTYVSLRRHALRNRAMVLLTHWAGMRVGEV
FT                   AALLVGDVLDTDGSIKSEIRLAPEQTKGRHARTVFLGQKLRRELAAYVASLNNPTLDGP
FT                   LFYTQKRAGFTANTLCQYFHWLYKEAGIHGASSHSGRRSFITNLASKGVGVRVLMSLAG
FT                   HRDISTTQRYIDVNDDMQRKAVDLV"
FT   gene            complement(549906..550253)
FT                   /locus_tag="Bmul_0501"
FT   CDS_pept        complement(549906..550253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14196"
FT                   /protein_id="ABX14196.1"
FT                   /translation="MTRPADIYLRFLQLAEALRGLPSLPALDPLEEKILELVARLAQAN
FT                   ERLSVREMMARSELGSPVTLHARLKSMREKGWLTLGDTDDTRRKQIELTPAALKHFDKL
FT                   AEAFAKAAKGT"
FT   gene            550355..550897
FT                   /locus_tag="Bmul_0502"
FT   CDS_pept        550355..550897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14197"
FT                   /protein_id="ABX14197.1"
FT                   /translation="MGNWRLRLASIIGTVVVFVLSLWINQEVFMHSEFVRGVNWIYLPS
FT                   GVRLLATLLLGADGAIGLLVASWLVDFLYFFPNDPIRSIAGGVIATVAPYAVYRIARER
FT                   YGLRASLTNLTPKRLLVLALAFSVANPLLTNIWLALNGNTTNIGERFFAMFVGDLSGAL
FT                   IVLYAMRSLLRFLTARK"
FT   gene            complement(551626..553101)
FT                   /locus_tag="Bmul_0503"
FT   CDS_pept        complement(551626..553101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:504039.180 mucin-associated surface
FT                   protein (MASP) Pfam: Mucin PROSITE: ALA_RICH GLU_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14198"
FT                   /protein_id="ABX14198.1"
FT                   /translation="MFKSLAKILFLIFIIGSILRYCLSNIFGITGACALAAAVLWIFFT
FT                   SWKRDEDAGYFEQMTDAITSGKGEWYALGTRLQRTFTRTSKWQIAMFCAGAISLTIGII
FT                   QEQIRIERNQKQEDARYTALYDHNNKVKAIVRSRCGEEPYVDPKLSEIAHVVQNYNNSV
FT                   GLANNSADNLDDAIAEQKQKYSTCRDEVEKQNPFIYGVQTTSSEENSVVQAAKDAADVA
FT                   KEQSEAAVDAAAKAVEVQHEADNQHAATQQVLDQETDQANTAQVSNHVDTSQPVAQTMT
FT                   NQQAASAYQIYKAASENAQPQANAAACTTAADCAKAMLGFAKSENLAGAMQAASTIDSL
FT                   TKPQRGDRATARKLDQDGLAALKASNANDAVQLFAQAHDADPGDEEIISNLAYAYSADE
FT                   QLAKSEDTAVLALSLNPRRTSVWAPLAVTLAKEGRQDQAVEAMWLAFQFSGDKQKTLSF
FT                   IDTRLAAESDPAVRKMYTDSKAWLTENKKPEFN"
FT   sig_peptide     complement(552991..553101)
FT                   /locus_tag="Bmul_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.531 at
FT                   residue 37"
FT   gene            complement(553198..555201)
FT                   /locus_tag="Bmul_0504"
FT   CDS_pept        complement(553198..555201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0504"
FT                   /product="cell wall surface anchor family protein,
FT                   putative"
FT                   /note="KEGG: bpm:BURPS1710b_3662 cell wall surface anchor
FT                   family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14199"
FT                   /protein_id="ABX14199.1"
FT                   /translation="MKITQFASSAALIALLAACGGGGSANSSGSGPATSGTGSQQSAAT
FT                   SLGGTVAVGTALVGATVTVVDGSGHTATATSDSNGNYSVGIQGLTAPFVVEAVDSSGAS
FT                   SLLYSVVANADTTGNAPLIANVTPLTTAVAALLTQSGNPGDLIRNVSAITSGNISTAET
FT                   VLGQALAPILKANGVAANVDPIATSFTANQTGLDAVIDAVSVDPSAKGTGLQLSSLTDP
FT                   NTAIQLNSATTTATALAAPAQPANYLSSLQAAMSQCMIDVQGGASITSDSACATAIATG
FT                   YLNQSFTTMKARHGAMFTSGAKLTGIRTQAFLPSGTLPNTSGPVSLVYFLFTDATGKPN
FT                   FATDFVEQTSNGWQVIGNQEQYNLYIASFVGRLQYTDAANSANNRYESGLRIQIPATQN
FT                   VPDNNTDTSYTQLGSAVVTGPGLPSGGVGLYLTGSGSQASSASNGFSPYLTFPSVASTA
FT                   PFYCPGGSIPTPCSMSDGTSLEYKWAWMPISGSSVTVPTSSDYAPQSTNTSGIQQYGAY
FT                   TVTLYDVSGAQVGTPQVVVNIASVQAPQAGQQVAWQTLGGDTINSFLTPTGSASSAGIT
FT                   SLSLNWTESALNPLTPSQIMTGEKTQPQNAAAAMGYDSYASPSITESGTSYAAIDTSFA
FT                   TQTALSADAHRLISLLEQVNGDYYINTWQYGQ"
FT   sig_peptide     complement(555118..555201)
FT                   /locus_tag="Bmul_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.500 at
FT                   residue 28"
FT   gene            complement(555391..555750)
FT                   /locus_tag="Bmul_0505"
FT   CDS_pept        complement(555391..555750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14200"
FT                   /protein_id="ABX14200.1"
FT                   /translation="MFAAKALDIALSTGEISLDKLHLLLGCSRGQAVGAAFDLQEQGLA
FT                   RVIGSTRGQSGEYFLVPIDVRCEAARLYRVKLERLGRDMDLSDALERTLPALQTIFIEA
FT                   LSALEAQRRGGSRHA"
FT   gene            complement(556015..556701)
FT                   /locus_tag="Bmul_0506"
FT   CDS_pept        complement(556015..556701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0506"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pnu:Pnuc_1685 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14201"
FT                   /protein_id="ABX14201.1"
FT                   /translation="MLKLNNMTYPSQVTHDQIQMVLSPTYRFPADGKNGLILYGPYGTG
FT                   KTTVAELLPAAIEAKHSAETPNVRAEACRPSHNGVDLIASISEQIIHFPMSGTHHYIIL
FT                   DEVDNLTPAAMQQLKSAMNRPYGSQNHDAVFIMTTNHVEKIDQGVIGRSRLVSFEPMSM
FT                   TVWIPLARQALFKNGISNINLVTDGFIRRRIITKGNNPRAILDNCQEMAYLLNSNSELW
FT                   TLAQQP"
FT   gene            complement(556757..557506)
FT                   /locus_tag="Bmul_0507"
FT   CDS_pept        complement(556757..557506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14202"
FT                   /protein_id="ABX14202.1"
FT                   /translation="MLYHDHPLTAAAEDTETSYPKFEISEATFLDKITGLEAEHVRSKT
FT                   ALWDMLARVLGLYHVEIKNASVEIRFSNVQALKERCTQQEIRYTASTAPLTMMLKLIVS
FT                   DNRQLAAGYALVLNAADLQGQTKDTFVSWLKEAGGIEKVRKTYDASGTLRPIKTLAVPA
FT                   QHAACGRERLRTNILFSVDALSLVDAELETVTADTMRTAIVMLHADGSLSVRAIVKDQS
FT                   ALDRAYVAYANESAPDSTSTASDSTTN"
FT   gene            complement(557616..558398)
FT                   /locus_tag="Bmul_0508"
FT   CDS_pept        complement(557616..558398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14203"
FT                   /protein_id="ABX14203.1"
FT                   /translation="MRSRKLKRSARTPLNRLGGKAVNFDNVKDRRIPATQTEMNQTNNS
FT                   RETASDVPVCIEMAMQIFGQLSEMYEALEDGKTAEDFRNDIARPMLADGVDPNEIEDAF
FT                   EADPADISNLDMIRLSCAYATGAIASYDAGNHENAWIGIGHAQYWMGFAYGLGFSKGAY
FT                   QRGRSLPGQRGAQAHHGKLDPVREYAIELAVKGGYANASIAAFEIKDEVWKFYESYRNE
FT                   FSENNPKEYKLPTLYKHGIQERVRKWLSGLALGSKSQS"
FT   gene            558753..559016
FT                   /locus_tag="Bmul_0509"
FT   CDS_pept        558753..559016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0509"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bam:Bamb_2866 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14204"
FT                   /protein_id="ABX14204.1"
FT                   /translation="MALMITDECINCDVCEPECPNGAISMGPDIYVIDPNKCTECVGHF
FT                   DEPQCQQVCPVECIPRDPQHDESHAQLMAKYHALIAATGDAQ"
FT   gene            complement(559085..560152)
FT                   /locus_tag="Bmul_0510"
FT   CDS_pept        complement(559085..560152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0510"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG:
FT                   bch:Bcen2424_2805 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14205"
FT                   /protein_id="ABX14205.1"
FT                   /translation="MSRYWSDVVQQLVPYVPGEQPALAHPVKLNTNENPYPPSPRVVAA
FT                   IARELGANGDTLRRYPDPLARALRETVAAHHRLRPEQVFVGNGSDEVLAHTFQALLKHD
FT                   RPLRFPDITYSFYPTYARLYGVDTRTVPLADDFSIRVDDYLDDGGGVLFPNPNAPTGRA
FT                   LPLADIERIAAANPSSVVVIDEAYVDFGAQSAIALIDRYPNLLVVHTTSKARSLAGMRV
FT                   GFAFGDAALIEALNRVKDSFNSYPLDRLAQVAAQAAYEDDAYFVSTCARVVDSRTRLTQ
FT                   ALDALGFDVVPSAANFVFARHPAHDAGTLAAKLKEREIFVRHFRLPRIDQHLRITVGTD
FT                   AECEALVAALRELLG"
FT   gene            complement(560288..560887)
FT                   /locus_tag="Bmul_0511"
FT   CDS_pept        complement(560288..560887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0511"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: bam:Bamb_2864
FT                   aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14206"
FT                   /db_xref="GOA:A9AEY6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEY6"
FT                   /protein_id="ABX14206.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLIDQLAREAGATLRDERRFH
FT                   GFYAKARLYGEEVHLLEPQTYMNRSGQSVVALAHFFKILPDQILVAHDELDLPPGTVKL
FT                   KLGGGSGGHNGLKDISAHLSSQQYWRLRIGIGHPRDLIPESARAGAKPDVANFVLKPPR
FT                   REEQDVIDAAIERALAVMPMVVKGELDRATMQLHRN"
FT   gene            complement(560996..561601)
FT                   /locus_tag="Bmul_0512"
FT   CDS_pept        complement(560996..561601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0512"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   bch:Bcen2424_2803 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14207"
FT                   /db_xref="GOA:A9AEY7"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEY7"
FT                   /protein_id="ABX14207.1"
FT                   /translation="MKVVAFERKEQGTGASRRLRNAGKTTGIVYGGEAAPQMIELDHNA
FT                   LWHALKKEAFHSSILDLEVAGQSQQVLLRDVQYHPFKQLVLHVDFQRVDAKKKLHTKVP
FT                   LHFLNAEVSPAVKLSSAIVSHVATEIEVECLPAALPEFLEVDLSKIEAGQSIHAKDIAL
FT                   PKGVALTAHVDAENPVIASATIPAGAVSDAAEGETPAA"
FT   gene            complement(561763..562719)
FT                   /locus_tag="Bmul_0513"
FT   CDS_pept        complement(561763..562719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0513"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bpd:BURPS668_0569 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14208"
FT                   /protein_id="ABX14208.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVNILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQN
FT                   YPDLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVSEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAAERIAASALDELVVTDTIPLSA
FT                   ESLACSKIRSLTSASLLAETFSRIRRGDSVMSLFAES"
FT   sig_peptide     complement(562660..562719)
FT                   /locus_tag="Bmul_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.657 at
FT                   residue 20"
FT   gene            complement(562764..562840)
FT                   /locus_tag="Bmul_R0014"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(562764..562840)
FT                   /locus_tag="Bmul_R0014"
FT                   /product="tRNA-Gln"
FT   gene            complement(562893..563774)
FT                   /locus_tag="Bmul_0514"
FT   CDS_pept        complement(562893..563774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0514"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: bam:Bamb_2861
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14209"
FT                   /db_xref="GOA:A9AEY9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEY9"
FT                   /protein_id="ABX14209.1"
FT                   /translation="MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGD
FT                   TLHFTLRDDGKVARATDVPGVPEQSDLVVRAANLLKAHTGTAAGVDIEIDKCLPMGAGL
FT                   GGGSSDAATTLLALNRLWQLDLPRAELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEV
FT                   ELPTRWFLVVTPRVHVPTAEIFSDELLTRDSKPVTITDFLAQQSSDARWPDSFGRNDMQ
FT                   QVVTSKYAEVAQVVKWLYNVAPARMTGSGASVFAAFQSKQQAEAAKAQLPAGWNGAVAE
FT                   SLNEHPLFAFAS"
FT   gene            complement(563801..564421)
FT                   /locus_tag="Bmul_0515"
FT   CDS_pept        complement(563801..564421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0515"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="PFAM: outer membrane lipoprotein LolB; KEGG:
FT                   bam:Bamb_2860 outer membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14210"
FT                   /protein_id="ABX14210.1"
FT                   /translation="MQMFPMFSLSSRACRALVAAGAALALAGCASTPPSAQAPAGGTLQ
FT                   TAATHAYHGRFAVQYYDRLGKQQNVYGNFDWQEHGNDVSLELRSPLGQTLAIVKSTPRA
FT                   ASLELPNRQPQYAADVGELMQNTLGFSLPLAGLRYWLLPTPAPATPAETERDPADGTRL
FT                   KQIRQDGWTIDYLAYADAPATGVRRVNLVRATPPLDIKLVLDQ"
FT   sig_peptide     complement(564311..564421)
FT                   /locus_tag="Bmul_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 37"
FT   gene            complement(564421..566244)
FT                   /locus_tag="Bmul_0516"
FT   CDS_pept        complement(564421..566244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0516"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bvi:Bcep1808_2904
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14211"
FT                   /protein_id="ABX14211.1"
FT                   /translation="MTLPSKLLLKRPAAAGGTRAFPVRRALGAALLAVWTLTAFPAHAQ
FT                   DPASDDAESQGAFDHVMPDEKKDLPAVPLTSQIVYQVLAAEVALQRNQPAPAYQTYLAL
FT                   ARDTRDPRMAQRATEIALGAQSPADALSAANLWRQYAPDSNRASQVDAALLVLAGKPAD
FT                   AQPMLARELARATGDTRGPAILALQALLARGADRVGGLAVLKDMLKNDMNRPEAHLAIA
FT                   RQQLAVDDKDGAAQSLRRALQIRPDYLPAALMLSQMGPAERAAGIASFEKYVQQNPKSR
FT                   DARLALSQLYLADDRLDDAQKQFETMRKLDSKDPTPLMALALIKIQQKKLDDATAYLKQ
FT                   YVQLGAKQPDLDVGQGYIYLAQIAIEQGNDAQASQWLDKVDQTSQHYLPAQITRAQLLQ
FT                   KQGKTDEARKVLDDLPVTDPRDAAVIARTDASILFTAKRYAEAEARLSRAVDDFPDDPD
FT                   LRYDYAMAAEKTGHYAAMEKQLRELIRTQPDNPQAYNALGYSLADRNQRLPEANKLIEK
FT                   ALSLAPNDAYIMDSLGWVKYRMGDTAGAAKILRRAYDLQPNAEIGAHLGEVLWKSGAQD
FT                   DARSAWRAAQKLEPDNETLVQTLKRFQINGL"
FT   sig_peptide     complement(566110..566244)
FT                   /locus_tag="Bmul_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 45"
FT   gene            566333..567160
FT                   /locus_tag="Bmul_0517"
FT   CDS_pept        566333..567160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0517"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: bch:Bcen2424_2798 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14212"
FT                   /db_xref="GOA:A9AEZ2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEZ2"
FT                   /protein_id="ABX14212.1"
FT                   /translation="MPELPEVEVTRRGIAPFVAGRRVERVDVRTAMLRWPVPAGLAEQL
FT                   RAREVLAVERRGKYLLFEVDAGWFIVHLGMTGTLRVLPAGGVPVAAKHDHIDWIFDEFV
FT                   LRFRDPRRFGAVLWHSREAGDVHAHPLLASLGVEPFSPAFDGALLHRRTRGRTVSVKQA
FT                   LLAGDIVVGVGNIYASESLFRAGIRPTTAAGKVSLPRYERLAEAVRATLADAIDRGGST
FT                   LRDFVGSNGESGYFQLDCFVYDRAGEPCRVCGTPIRQIVQGQRSTYFCPTCQR"
FT   gene            567186..568298
FT                   /locus_tag="Bmul_0518"
FT   CDS_pept        567186..568298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0518"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   bch:Bcen2424_2797 A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14213"
FT                   /protein_id="ABX14213.1"
FT                   /translation="MKPPRIAPAPFPVTPLHRTFAPRLIAWQRQHGRHDLPWQNTRDPY
FT                   RIWLSEIMLQQTQVSTVVPYYTRFLERYPDVAALAAAPIDDVMALWAGLGYYSRARNLH
FT                   RCAQVVVAEHGGAFPATPDALADLPGIGRSTAAAIASFAYGARATILDGNVKRVLARVF
FT                   GIEGFPGEKRVENDMWALAESLLPDAAHPDDVSAYTQGLMDLGATLCVRGKPDCARCPF
FT                   AGDCVAQATGRQRELPAARPKKAVPTRKTWMLVLRDGDAVLLERRPPAGIWGGLWSLPQ
FT                   ADGDAELADLARRFGGGGPVPLAPLTHTFTHFRLEIEPRLSDVASEAAAVPFAQAQDAD
FT                   TAWVPLSALDTYGVPAPVRKLLDALSGPLL"
FT   gene            complement(568329..568964)
FT                   /locus_tag="Bmul_0519"
FT   CDS_pept        complement(568329..568964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0519"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   bam:Bamb_2856 peptidase S16, lon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14214"
FT                   /protein_id="ABX14214.1"
FT                   /translation="MSSLSTTLIDLPLFPLHTVLFPGGLLPLKVFEARYLDMARTCLRD
FT                   DAPFGVCLLKSGPEVAQDGAVSVPETIGCMARITECDTGEFGMLYLQAIGTQRFELLSY
FT                   RVESNGLLVGIAEPLPDDIPLEGEQALAQFGSCAEVLERIISALQKSEPGRLPFAEPFR
FT                   LDDPSWVSNRLAELLPLDLRARQKLMEFPDVGARIDAVHHVLDRHGWL"
FT   gene            complement(568992..569900)
FT                   /locus_tag="Bmul_0520"
FT   CDS_pept        complement(568992..569900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bam:Bamb_2855 uncharacterised P-loop ATPase protein
FT                   UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14215"
FT                   /db_xref="GOA:A9AEZ5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEZ5"
FT                   /protein_id="ABX14215.1"
FT                   /translation="MRIVLITGISGSGKSVALNALEDAGYYCVDNLPPHVLPELARYLD
FT                   EAGQRRLAVAIDARSSASLDEMPGLIRSLSREHDLRVLFLNASTQALIQRFSETRRRHP
FT                   LSGSPSHDANVGLLSSLEEAIERERELVAPLAEFGHQIDTSTLRANVLRTWVKRFIEQN
FT                   SNDLMLMFESFGFKRGVPLDADLMFDVRALPNPYYDHELRPLTGLDQPVIAFLDALPIV
FT                   HQMIDDIHAFLMKWLPHFREDNRSYLTVAIGCTGGQHRSVFIAETLAARFASAANVIVR
FT                   HRDAPVDVDASSRLVTEVDRP"
FT   gene            complement(569979..570947)
FT                   /locus_tag="Bmul_0521"
FT   CDS_pept        complement(569979..570947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0521"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   bam:Bamb_2854 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14216"
FT                   /db_xref="GOA:A9AEZ6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AEZ6"
FT                   /protein_id="ABX14216.1"
FT                   /translation="MDTSSINAQSIFDDNAATLKLSWLTGHEGWERGFSADTVANATSS
FT                   ADLVGHLNLIHPNRIQVLGEAEIDYYQRQTDEDRSRHMAELIALEPPFLVVAGGAAAPP
FT                   ELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPESQFPGKLV"
FT   gene            complement(571076..571672)
FT                   /locus_tag="Bmul_0522"
FT   CDS_pept        complement(571076..571672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0522"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bur:Bcep18194_A6123
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14217"
FT                   /protein_id="ABX14217.1"
FT                   /translation="MLRLSPGGVDPVAARCTLPMPNALISSNMDHQSAAARRPQAVQSP
FT                   ANMNRLAKILPIENVVIDLSVTSKKRVFEQAGLIFENQNGIARSTVTDNLFARERLGST
FT                   GLGEGVAIPHGRIKGLKHPLAAFVRLADAIPFEAPDGQPVSLLIFLLVPEQATQQHLEI
FT                   LSEIAQLLSDRDARERLHNETDPAELHRLLTQWQP"
FT   gene            complement(571784..572143)
FT                   /locus_tag="Bmul_0523"
FT   CDS_pept        complement(571784..572143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0523"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   bvi:Bcep1808_2897 sigma 54 modulation protein/ribosomal
FT                   protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14218"
FT                   /protein_id="ABX14218.1"
FT                   /translation="MNLKISGHHLEVTPAIREYVITKLDRVLRHSDQVIDGTVILSVDN
FT                   HKEKDKQQRAEINLHLKGKDIFVESSNGNLYAAIDLLIDKLDRQVVKHMERLQTHAHDP
FT                   IKLQPAVDQIELPPQ"
FT   gene            complement(572302..573807)
FT                   /locus_tag="Bmul_0524"
FT   CDS_pept        complement(572302..573807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0524"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG:
FT                   bur:Bcep18194_A6121 sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14219"
FT                   /protein_id="ABX14219.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVAMAVAQNP
FT                   LLENDDEWIASPLRVAADGSLIAQTPPVSNGEPAIANGNGQSSDRAERDEPAGADEYDG
FT                   YAAGDASDGPQWNLDEFGRASGASDDDDLPPLQVQEAATSLRDHLSAQLRVTQASPRDR
FT                   ALVMFLIESLDDDGYLTASLDEVLADLPPELEVDCDELNAALALLHSFDPAGVGARSAS
FT                   ECLKLQLLRLDPSPTRTLALEIVSQHLELLAARDFTRLRKHLKATDDALRDAHALIRSL
FT                   EPFPGAAYGKAEADYVVPDIIVKKVGQGWQAELNPEVVPKLRINNLYANILRNSRGDPS
FT                   AGSLKQQLQEARWLIKNIQQRFDTILRVAQAIVERQKNFFAHGEIAMRPLVLREIADTL
FT                   GLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIGAEDP
FT                   KSPLSDSRIAELLAEQGFVVARRTVAKYREALRIPAVNLRKSL"
FT   gene            complement(573960..574736)
FT                   /locus_tag="Bmul_0525"
FT   CDS_pept        complement(573960..574736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0525"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_2790 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14220"
FT                   /protein_id="ABX14220.1"
FT                   /translation="MNALPNRQPAGTTSSLVVRNLKKRYGSRTVVKDVSLDVKSGEVVG
FT                   LLGPNGAGKTTSFYMIVGLVPLDAGEISLNGSSISLLPIHKRASLGLSYLPQEASVFRK
FT                   LTVEENIRAVLELQHGDDGKRLSKDAIASRTEALLDELQIGHLRENPALSLSGGERRRV
FT                   EIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGICD
FT                   HAYIISDGSVLAAGAPNEIIENESVRRVYLGEHFRM"
FT   gene            complement(574733..575398)
FT                   /locus_tag="Bmul_0526"
FT   CDS_pept        complement(574733..575398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0526"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG:
FT                   bvi:Bcep1808_2894 OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14221"
FT                   /protein_id="ABX14221.1"
FT                   /translation="MNEPFPRQNSGGAARAVRAALAATLVALPLVGLAPLAHAEKADQN
FT                   KPINVEADNLTYDDLKQVTVATGNVVITKGTIKITGDRVEVRQDPEGYQYATSFGSGKK
FT                   HATFRQKREGLDEYIDGDAERIDYDGKQDLTTLTTAATVRRLQGTSTIADTVHGSVITY
FT                   DGQHDFYTAKGGKDVAAPGNPNGRVRAMLSPKNGGPGPMNGAPAKLSPSTTIQGAPGQ"
FT   sig_peptide     complement(575279..575398)
FT                   /locus_tag="Bmul_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.945 at
FT                   residue 40"
FT   gene            complement(575419..576033)
FT                   /locus_tag="Bmul_0527"
FT   CDS_pept        complement(575419..576033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0527"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bch:Bcen2424_2788 protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14222"
FT                   /protein_id="ABX14222.1"
FT                   /translation="MNPHFRWTQLLPLVAVAALAGITWWLLQATLPPPGEGVTQPKRHT
FT                   PDYFADNFSVTELDQSGTTQYRLTAAKLVHYEDTESSDLTMPAMRAFQPGKPVVTTTAK
FT                   RGTVNGDVSIVDLYDDARILRAAGGGDPQMQADSQHFRIFVNDDVIQTEKPVKLQRGLS
FT                   LVNATDGMKYNNVTRVIELYGNVRGTIAASDASGGSKGQPK"
FT   sig_peptide     complement(575944..576033)
FT                   /locus_tag="Bmul_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.466 at
FT                   residue 30"
FT   gene            complement(576037..576573)
FT                   /locus_tag="Bmul_0528"
FT   CDS_pept        complement(576037..576573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0528"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; KEGG: bur:Bcep18194_A6117
FT                   phosphatase KdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14223"
FT                   /protein_id="ABX14223.1"
FT                   /translation="MSAALTAAERASRVKLMIFDVDGVLTDGGLLFTVAGDAMKSFNSL
FT                   DGHGVKLLGEAGIATAIITGRRSEIVAARAKEMKITHLFQGVENKLSVFTDLIASLGIA
FT                   PDACGYMGDDWPDLPVMLRCGFAAAPANAHPEVIARAHWVAEARGGEGAVREVCDTVLR
FT                   AQRRYDALLAAACGA"
FT   gene            complement(576573..577556)
FT                   /locus_tag="Bmul_0529"
FT   CDS_pept        complement(576573..577556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0529"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: bur:Bcep18194_A6116 sugar isomerase, KpsF/GutQ
FT                   family; TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14224"
FT                   /protein_id="ABX14224.1"
FT                   /translation="MIAKINDDRALALARDVLDIEADAVRALRDQLDGSFAHAVALLLG
FT                   CRGRVVVSGIGKSGHIARKIAATLASTGTPAFFVHPAEASHGDLGMVTADDVFIGISYS
FT                   GESEELVAILPLVKRIGAKLIAITGRAESSLGTLADVNLNAAVSKEACPLNLAPTASTT
FT                   AALALGDALAVAVLDARGFGSEDFARSHPGGALGRRLLTYVRDVMRTGDDVPYVGLDAT
FT                   LSDALFQITAKRMGMTAVVDTNRKVAGIFTDGDLRRVLARDGDFRRLPIADVMTREPRT
FT                   IGADHLAVEAVELMERHRINQMLVVDADGVLIGALNMHDLFSKKVI"
FT   gene            577653..579689
FT                   /locus_tag="Bmul_0530"
FT   CDS_pept        577653..579689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0530"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: bch:Bcen2424_2785
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14225"
FT                   /protein_id="ABX14225.1"
FT                   /translation="MAPTNEDAPPVISPLEMTLLLLLASVVGVVVFRSLNLPPMLGYLA
FT                   VGILVGPHAFGVAGDLERAEHLAEFGVVFLMFSIGLEFSLAKLRAMQRLVFGLGLMQVV
FT                   ATLALAVVLGMLFRRWVDITWQGSVALGGALAMSSTAIVSKMLAERLEIETEHGRNIFG
FT                   VLLFQDLAVVPLLIVIAAFGAESSKDLALTLGFAAVKIVIALSLLLVIGQRFMTRWLNV
FT                   VARRRSQELFVLNLLLVTLGAAFITDRFGLSLALGAFIAGMLIAETPFRHQVEEDIKPF
FT                   RDVLLGLFFVTTGMLLDPRVIWEHPLLVGGFFVGQILFKATMIAGLARLFGATPGVAMR
FT                   TGIGLAQAGEFGFVLLNLILDRHLVDATLLQAILASMLLSMLAAPFLIQNADRIVMRLS
FT                   STEWMQQSLQMTRIATQSLKQRGHVIICGYGRAGQNLARMLEQEGISYVALDLDPDRVS
FT                   AAATAGESVVFGDAARRESLLAAGIHRAAAVAITYANTPSALRVLHHVHELEPTLPAIV
FT                   RTVDDADLEKLLAAGATEVIPEIVEGSLMLASHTLVLVGVPMRKVVRRVEEMRDERYSL
FT                   LRGYFHGADDADDDDHEQVRLQSVPVDARADAVGRSLEELGLYALGLEVTAIRRHGIRG
FT                   VEPDPQTKLRASDIVVLRGLPEALALAEERLSRHRRDPPAVAA"
FT   gene            579767..580333
FT                   /locus_tag="Bmul_0531"
FT   CDS_pept        579767..580333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0531"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: bur:Bcep18194_A6114 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14226"
FT                   /db_xref="GOA:A9AF06"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AF06"
FT                   /protein_id="ABX14226.1"
FT                   /translation="MSHSSSGAPLDPVAFIHSQIRTVPDWPQPGVMFRDITTLLQSPKA
FT                   LRILVDLFVERYVDAKLDYVAGLDARGFIIAPIVAYELSVGFVPIRKVGKLPYKTRSES
FT                   YELEYGSATVEIHEDACKPGDRVIIMDDLIATGGTMMAGRNLLERLGAVVVEGAAIIDL
FT                   PDLGGSALLRNAGLPVYTVTEFAGH"
FT   gene            580360..580974
FT                   /locus_tag="Bmul_0532"
FT   CDS_pept        580360..580974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0532"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bvi:Bcep1808_2888 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14227"
FT                   /protein_id="ABX14227.1"
FT                   /translation="MPNFMLFLATSIAITFAPGPDNLQVLARGISQGRAAGFVAALGFT
FT                   AGILFHTTLAALGVAAVLRSSPLAFQILKLAGAAYLVWIGIKALRSHGLANAHARPPQP
FT                   LGAIFRQSVIGNLMNPKVTLFFVVFLPQFVDPHGAQSVTLQMFELGALFMLQTAAIFSL
FT                   FGVGAGAIGAWLKRRPKAGVWLDRLAGATFIAIGIRVALKD"
FT   sig_peptide     580360..580431
FT                   /locus_tag="Bmul_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.720) with cleavage site probability 0.668 at
FT                   residue 24"
FT   gene            580980..581837
FT                   /locus_tag="Bmul_0533"
FT   CDS_pept        580980..581837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0533"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bam:Bamb_2842 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14228"
FT                   /protein_id="ABX14228.1"
FT                   /translation="MTFPCIAAARRFDPSAHVRFEIAGAAVGWIRRRDVARLARWPDVF
FT                   ELSDARVVLSDRYDTVDARSMALASAIGALAAEGAIPGWRDEIYAIRNRFDDPPLAYIE
FT                   RAASRFFGTQTYAVHLNGIVEYAVSPGAARTPQLWLGRRSATKATDPGMLDNVVAGGIG
FT                   WGFGVRETLVKECWEEAGIPAELAARAIAGRAVQVLCSLPEGTQSELIFVYDLSLPHDF
FT                   APHNQDGEVAEHLLAGVPEVIGWLRDGRATMDASLATLDTLLRHGWLPAADAAGLDALF
FT                   APAA"
FT   gene            581902..582786
FT                   /locus_tag="Bmul_0534"
FT   CDS_pept        581902..582786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0534"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: bam:Bamb_2841 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14229"
FT                   /protein_id="ABX14229.1"
FT                   /translation="MSTDHSFILKLSCPDRHGIVHAVSGFLFERNSNILDSAQFGDSRT
FT                   GEFFMRVHFEQDGAGRDAASALDTLRDDFAPLAEQFAMRWELHDASVKPRVVIMVSKIG
FT                   HCLNDLLFRYRTGQLPIEIPAIVSNHKDFYQLAASYDIPFHHFPLVGGSSDAAKAAQEA
FT                   RVLDVIDEHQADLVVLARYMQILSPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRG
FT                   VKLIGATAHYVTTDLDEGPIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEH
FT                   RIVLNGTKTVVFR"
FT   gene            complement(582876..583967)
FT                   /locus_tag="Bmul_0535"
FT   CDS_pept        complement(582876..583967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0535"
FT                   /product="putative transporter"
FT                   /note="KEGG: bch:Bcen2424_2780 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14230"
FT                   /protein_id="ABX14230.1"
FT                   /translation="MTMEKQQEPARDAQSREPHLRSVRLTSDFSLPKLSAIEIGSYVFA
FT                   LAAMWLVLDLKLLGGLLAGLLVYQLIHTIAPVIERHTTSMRARWVAVVLLAIAIVGALT
FT                   GLSIAVVEHFEHTVPNLQALLGQLMQIVEQTRARTPAWIANVLPVDVEQMKAKAAVLMT
FT                   AHMDQLQQSGKNVARGFGHVLFGMIIGAMIAIGVEHGKVRRPLSTALVTRVSRFADAFR
FT                   RIVFAQIKISAINAAFTGLYLLVALPIFHERLPLSKTLVLLTFIVGLLPVIGNLVSNTL
FT                   IVAVSLSVSMGTAIASLAFLVIIHKLEYFLNAKIIGGQIESRAWELLLAMLIMEAAFGL
FT                   PGIIAAPIFYAYIKRELQMLRMI"
FT   gene            complement(584222..587107)
FT                   /locus_tag="Bmul_0536"
FT   CDS_pept        complement(584222..587107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0536"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: bch:Bcen2424_2779 excinuclease
FT                   ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14231"
FT                   /protein_id="ABX14231.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARVGTPYCPDHDIPLEAQSVSQMVDAALALPEETKLMILAPVVANRKGEHA
FT                   ELFEDMQAQGFVRFRVRSGGGTANEGVAKIYDVDSLPKLKKNDKHTIDVVVDRLKVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDREHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYEFDI
FT                   DTAFEDLPEKIRKVLLFGSGKQTIPFSYINERGRTTVREHVFEGIIPNLERRYRETDSV
FT                   AVREELSKYQNNQPCPSCDGTRLRREARFVRIGTGDHARAIYEISGWPLRDALGYFDGL
FT                   TLEGAKREIADKVIKEIVARLTFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIATLKHLRDLGNSVIVVEHDEDMIRTADYVVDMGPGA
FT                   GEHGGVVVAEGTPKQVQANPQSLTGQYLVGARTIDYPDERIAPDPERMLRIVDAHGNNL
FT                   KHVNLDLPVGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSSAEPAAHEAIEGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGVFTPIRELFAGVPTAKERGYDPGRFSFNVKGGRCEA
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDVQYKGKNISEVLDMTVEHAYEFFS
FT                   AVPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIIAQG
FT                   TPEQVAKTKASFTGKYLAPLLKRPTRKVAAG"
FT   gene            587400..588587
FT                   /locus_tag="Bmul_0537"
FT   CDS_pept        587400..588587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0537"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_2838 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14232"
FT                   /protein_id="ABX14232.1"
FT                   /translation="MSNPSATSSRMSAPELRATTSLAAIFALRMLGLFMIMPVFSVYAK
FT                   TIPGGDNVVLVGIALGAYGVTQSLLYIFYGWASDRFGRKPVIATGLLIFALGSFVAAFA
FT                   HDITWIIVGRVIQGMGAVSSAVLAFIADLTSEQNRTKAMAMVGGSIGVSFAIAIVGAPI
FT                   VFHWVGMSGLFAIVGVLSILAIGVVLWVVPDAAKPVHVPAPFAEVLHNVELLRLNFGVL
FT                   VLHATQTALFLVVPRLLVDGGLPVASHWKVYLPVMALAFVMMVPAIIVAEKRGKMKPVL
FT                   LGGILAILIGQLLLGSAPHTILIVAAILFVYFLGFNILEASQPSLVSKLAPGSRKGAAT
FT                   GVYNTTQSVGLALGGIAGGWLLKHGGADTVFYACSGLVAAWLIIAASMKAPPRKA"
FT   sig_peptide     587400..587534
FT                   /locus_tag="Bmul_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.990 at
FT                   residue 45"
FT   gene            588690..589238
FT                   /locus_tag="Bmul_0538"
FT   CDS_pept        588690..589238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0538"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: bur:Bcep18194_A6107 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14233"
FT                   /protein_id="ABX14233.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EFKEMTEWHRVAFFGRLAEIVSEYLKKGSSVYIEGRIRTRKWQGQDGQDRYSTEIVADQ
FT                   MQMLGGRGGSGGGGGGDEGGYGGGYGGGGGGGRGEQMERGGGGGRASGAARGGSGGGQS
FT                   RPSAPAGGGFDEMDDDIPF"
FT   gene            589874..590155
FT                   /locus_tag="Bmul_0539"
FT   CDS_pept        589874..590155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14234"
FT                   /protein_id="ABX14234.1"
FT                   /translation="MRTRHSQKPLVNFLMYGVYPDRFSKEYGDGWFAILLGAFGRTLPM
FT                   SVGIAALSCVVAPGALTTGGLAFTTAILFAYNAFLEWHLIRRSRREAQ"
FT   gene            590408..591184
FT                   /locus_tag="Bmul_0540"
FT   CDS_pept        590408..591184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0540"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase; PFAM:
FT                   methylpurine-DNA glycosylase (MPG); KEGG:
FT                   bur:Bcep18194_A6105 3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14235"
FT                   /protein_id="ABX14235.1"
FT                   /translation="MTRNRRTPGWPGMLLPRAFFDRAAPAVAPLLLNKILASADGRAGR
FT                   IVEVEAYAGAIDPAAHTYRGKTPRNATMFGPPGHMYVYFTYGMHWCCNCVCGPDGAGTG
FT                   VLIRALEPLSGIERMRAARPPQTRDRDLCRGPARLTQAMGITGAQDGADLVRACDGFAI
FT                   VDDGTAPPARAKGGPRIGIRVGTDLPWRWSVPGNPYVSGPRARAVGGTRRACRAHRRCD
FT                   SHAARTYSIGNCRQHDRRRAHRPHRAHQPHPHHRLH"
FT   gene            591292..592056
FT                   /locus_tag="Bmul_0541"
FT   CDS_pept        591292..592056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0541"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bam:Bamb_2826 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14236"
FT                   /protein_id="ABX14236.1"
FT                   /translation="MRRVVFNQKGGVGKSTIVCNLAAVSASEGLRTLVVDLDAQANSTR
FT                   YLLGERATDVHPGVADFFDTALTFSFRPVDVASFIHPTPFAQLDVMPAHADLDTLHGKL
FT                   ESRYKIYKLRDALNELHAYDAVYIDTPPALNFYTRSALIAVERCLIPFDCDDFSRRALY
FT                   TLLENVKEIRQDHNAALEVEGIVINQFQPRASLPQRLVDELVEEGLPVLASRLSSSVKI
FT                   RESHQQSTPVIHLEPTHKLAHEFRALHRELVG"
FT   gene            592513..593094
FT                   /locus_tag="Bmul_0542"
FT   CDS_pept        592513..593094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0542"
FT                   /product="phasin family protein"
FT                   /note="TIGRFAM: phasin family protein; PFAM: Phasin family
FT                   protein; KEGG: bam:Bamb_2825 phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14237"
FT                   /protein_id="ABX14237.1"
FT                   /translation="MSVFAPEKLVADYQSGVAAWFAIARPAIRGFEAVVELNLQATKTA
FT                   LAEYEDKLKDALNTTNPIAGFAQRVAAPQEAAGKAVAYGRHLFDIAVSTQVEWTKVAHE
FT                   QYEQADLRMKDVIGELTKHAPAGSAPVVAVLNSALSAASAAAESVRAAAGQAMEAAQSS
FT                   FETAGETAARTGKQVAATARKEASGRETAA"
FT   gene            593367..594548
FT                   /locus_tag="Bmul_0543"
FT   CDS_pept        593367..594548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0543"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bur:Bcep18194_A6102 acetyl-CoA
FT                   acetyltransferase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14238"
FT                   /protein_id="ABX14238.1"
FT                   /translation="MTDVVIVSAARTAVGKFGGSLAKVAAPELGATVIRAALERAGVKP
FT                   DQVSEVIMGQVLTAGSGQNPARQSLIKAGLPSAVPGMTINKVCGSGLKAVMLAANAIVA
FT                   GDAEIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAEN
FT                   VAKEYGITREEQDAFAALSQNKAEAAQKAGRFNDEIVPVSIPQRKGEPLQFATDEFVRH
FT                   GVTAESLAGLKPAFAKDGTVTAANASGINDGAAAVLVMSAQKAQALGLTPLARIKAYAN
FT                   AGVDPRVMGMGPVPASRRCLERAGWTPGDLDLMEINEAFAAQALAVHKQMGWDTSKVNV
FT                   NGGAIAIGHPIGASGCRILVTLLHEMVKRDAKRGLASLCIGGGMGVALAVERD"
FT   gene            594766..595509
FT                   /locus_tag="Bmul_0544"
FT   CDS_pept        594766..595509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0544"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="TIGRFAM: acetoacetyl-CoA reductase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   bch:Bcen2424_2771 acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14239"
FT                   /protein_id="ABX14239.1"
FT                   /translation="MTKRIAVVTGGMGGLGEAISIRLHEAGHRVVVTYSPNNTGADRWL
FT                   TEMQAAGRQFDAYPVDVADHDSCQQCVEKIVRDVGPIDILVNNAGITRDMTLRKLDKVN
FT                   WDAVIRTNLDSVFNMTKPICEGMIERGWGRIVNISSVNGSKGSVGQTNYAAAKAGMHGF
FT                   TKSLALEVARKGVTVNTVSPGYLATKMVMAIPQDILDTKVLPQIPAGRLGKPEEVAALV
FT                   AYLCSEEAGFVTGSNIAINGGQHMH"
FT   gene            595616..595867
FT                   /locus_tag="Bmul_0545"
FT   CDS_pept        595616..595867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14240"
FT                   /protein_id="ABX14240.1"
FT                   /translation="MGLAIGGSALTVALTVAIALHWLERRRARRLRDFDHHDCWLVAYG
FT                   KSIVRRPATRARRVRAPAAIARLKTRSSPIAPFVSRDR"
FT   gene            595958..596719
FT                   /locus_tag="Bmul_0546"
FT   CDS_pept        595958..596719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0546"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bvi:Bcep1808_2860
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14241"
FT                   /protein_id="ABX14241.1"
FT                   /translation="MQLNKAVAACGVAFLLSACGGVQNLDANGLTSAGTNLFKAATLSD
FT                   ADIAALSNDACKASDAESKIAAPNSAYAKRLTKVMKGFGDMTLNGRKVDYKVYLTKDVN
FT                   AWAMGNGCVRVYSGLMDMMNDDELRGVIGHEMGHVALGHSKKAMQTAYAVSAARSAAGA
FT                   ASPGVAALTSSQLGDITEKFINAQFSQSQESAADDYSFDLLKQKGMSQKGLVTAFQKLA
FT                   QLDGGKSSMLSSHPSSASRAQHIEQRIAKGN"
FT   sig_peptide     595958..596032
FT                   /locus_tag="Bmul_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.581 at
FT                   residue 25"
FT   gene            597119..598768
FT                   /locus_tag="Bmul_0547"
FT   CDS_pept        597119..598768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0547"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bch:Bcen2424_2752 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14242"
FT                   /protein_id="ABX14242.1"
FT                   /translation="MLISLIRRAPAAGSPVGASPAVRCVRTRIARLLTVFALLPLVAAC
FT                   ATHPPATALERSVSHALPQSTATPLRDALAAPQAAHPGQSGFRLLADGAEALQMRIALA
FT                   RAATKTLDMQYYIATEDTTGKLLLGAALYAADRGVRVRMLVDDLNFHDIDRVMAALNTH
FT                   ENIEIRVFNPFGASRQGVMQRTTDFLTRIDSFTRRMHNKAMIADNQIAIVGGRNLGDEY
FT                   FSASATLQFRDLDVLAAGPVTDDISHSFDTYWASASSYPLRVLNHQTFKPKELDAMRDE
FT                   LREHWRKNADPYNAKPLNATPLSQQIARDELGLVWAPAEFKVDAPDKIARPNDQYVSPP
FT                   MQRLVELTRAAQQEFLAFSPYFVPHDAGVKILGDTAARGVRVAILTNSLAATDAVAVQA
FT                   GYAPYRVPLLQRGIELYEFKAQPDQPRARLFGSRSRASLHAKAYVIDRKILVIGSLNLD
FT                   PRSAHLNTELALVIHSPALAQQTAALFARATQPDESYRVTLVKAPGGGPPSLEWTGVDN
FT                   GQPSTYHVDPHAGLLRNVMTGIFTLLPVDDQL"
FT   gene            598922..599695
FT                   /locus_tag="Bmul_0548"
FT   CDS_pept        598922..599695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0548"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bam:Bamb_2800 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14243"
FT                   /protein_id="ABX14243.1"
FT                   /translation="MQRVPNQPFTRPARFSEAEWQARVQLAAAYRIFDHLGWTELIYNH
FT                   ISLRVPGEDGHFLINPFGLHYSEVCASNLVKIDIDGNVIGHSDWPINPAGFTFHAAIHA
FT                   ALPDAHCVMHVHTTPTMAVCCSRDGLSFSNFYSAQLYGKIAYHDFEGITVRLDEGRRIV
FT                   ESAGGRPVLLLRNHGPVTIGATLAQTFSLMWLLNRACEVQIATHAIGDALPIAPPVLEA
FT                   CVRDSLNFDPRHGAGQDAFDALQRIVDRIDPGYRA"
FT   gene            complement(599717..600718)
FT                   /locus_tag="Bmul_0549"
FT   CDS_pept        complement(599717..600718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14244"
FT                   /protein_id="ABX14244.1"
FT                   /translation="MSLPHRSVRVRPMLAGLCSVAALYGAPADAQEFSLFAGSLWGAGN
FT                   RSYAWAFDYQEGLSPHTALGFTWYNEGHIPDHHRDGQAIQFWGRVPLEDRRFVLSAGVG
FT                   PYRYFDTVPAAAGRGYSNSHGWGVLMSVRAAYYTSHRWIAQLQLNRAQVFSGPDTTSVM
FT                   FGVGYQLDAPDTPGPRDTALPRTRKVTNNEITAMLGETILNSRSSPSSLGGSLEYRRGL
FT                   TRSVDWTATWMYEGAKQAVRRNGIASQLWLTRAFLNDKVTLAAGAGAYFTVNQRNRDGQ
FT                   PGPGDGRLSGIVSISASYRLSDRWLTRLTWNRVVTRYNRDTDVIQAGLGYRF"
FT   sig_peptide     complement(600626..600718)
FT                   /locus_tag="Bmul_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            600803..601072
FT                   /locus_tag="Bmul_0550"
FT   CDS_pept        600803..601072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14245"
FT                   /protein_id="ABX14245.1"
FT                   /translation="MHNSLLPIVTTVVCKRAGNVSFRSSVRRPCMRRARCDSAYVSEHM
FT                   KRLAGPLRRRPRGDATTKKNAAGRPREYSQTPSDEGNKQLWDEV"
FT   gene            601240..601674
FT                   /locus_tag="Bmul_0551"
FT   CDS_pept        601240..601674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0551"
FT                   /product="CHRD domain containing protein"
FT                   /note="PFAM: CHRD domain containing protein; KEGG:
FT                   bam:Bamb_2798 CHRD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14246"
FT                   /protein_id="ABX14246.1"
FT                   /translation="MPKLRLLQVALLAGAFVAGGAAAETVRLSANLQPSSEVPPTTSHG
FT                   SGTVDARYDTVSHTLRWTVTYANLTGPATAAHFHGPAPVGQNAGVQVPIPKDALASPIK
FT                   GSAELTDAQVTDLMGGKWYFNVHTSAHPSGEIRGQVLPAN"
FT   sig_peptide     601240..601311
FT                   /locus_tag="Bmul_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            601764..602732
FT                   /locus_tag="Bmul_0552"
FT   CDS_pept        601764..602732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0552"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bur:Bcep18194_A6075 lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14247"
FT                   /protein_id="ABX14247.1"
FT                   /translation="MSWQSRVACWLLRWQFRPETLRPVLDPARARRFTDLRMRTIVPRR
FT                   APSGYRLRQCYGAGDAPLRGEWLERTDVPAGGATGPTLLYFHGGGYYFCSTKTHRALVF
FT                   GLTKRARVRSFSLDYRLAPENRFPAALDDALAAYRRLIALGTRPESIVLGGDSAGGGLA
FT                   LATLVALRDAGEPLPAGAILFSPWTDLAGSGDTLRTHDGIDPMFAGAALPKAAKLYLGD
FT                   TPATHPYASPLYADFSGLPPLYIQVGSTEVLLDDSRRVADKARAAGVPVEIEIWPGMPH
FT                   VWQLYTPMLPESRDALDRAAAFLRRVAVERAVQRVGEPSIA"
FT   gene            complement(602702..603547)
FT                   /locus_tag="Bmul_0553"
FT   CDS_pept        complement(602702..603547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14248"
FT                   /protein_id="ABX14248.1"
FT                   /translation="MEPISITPDAAPLSPQDRDALRRAKQVLESPSLTMKLTGVLGAPV
FT                   EKMIAKLPDFATGKINDATQLALRKCLNIALRTLGKPPAPDAEPDKPSNLLHKLAVATT
FT                   GAAGGAFGFLALPVELPVTTTLIFRSVCDIARSEGEDLTSVDTQLQCLAVLGMGGNPDK
FT                   DAEDADLGYFVLRGALAQAISKASQDIATKGLAAHSSAAVFKLVQAVASRFSVQVTEQM
FT                   AAKSVPAIGAVLGATVNTLFIDHFQQMAHGHFTVRRLERKYGTEAVQTAYQAIDGSPTR
FT                   "
FT   gene            603655..605250
FT                   /locus_tag="Bmul_0554"
FT   CDS_pept        603655..605250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0554"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_2745 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14249"
FT                   /protein_id="ABX14249.1"
FT                   /translation="MAVHTAAHHSSGQVLPFRESLLAMLGISFVTMLVALDQTVVGTAL
FT                   PTIVAELRGFDLYAWVATSYLLSSVITVPIFGRLGDYYGRKPFVIASIVVFSGASVLCG
FT                   MANDMLYLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRLRWQVLMSSAFGIANAVGP
FT                   SLGGVLTQTFGWRSVFYVNLPVGLLSLVFVCRYLPHLRQVEHESKMRLDWPGALLIAAS
FT                   LGALQLFVEWLPKYGIASWATLLLVVAVAAGAGLWHWEKRCAQPILPFDMFANRALSAL
FT                   FVLAILAGFAMFSLLFYAPLLFQGGFGMSPKEAGLVITPLVVFITIGSIMNGRVVTRIR
FT                   QPNAMLHVGFVLFAIACAGIVVSTHTTPTWALMALMVAGGIGLGFVLPNLTVFAQQTAG
FT                   RQHLGIATALLQSLRMVGGMIGTALTGTLVNQMYSSGVHDALAADHALQWHARLADPQI
FT                   LIDRAAQGGLVAELTRAGHNGALLLEAARESLVGAIHLGVAMAAVVAVYSVWQCRRVPP
FT                   IALRRKIEPHVAAD"
FT   gene            605278..605724
FT                   /locus_tag="Bmul_0555"
FT   CDS_pept        605278..605724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0555"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_A6072 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14250"
FT                   /protein_id="ABX14250.1"
FT                   /translation="MEEQDRVAILQQFGRTYRAFMTAFETHVGQPMPRWRIMVALHTMG
FT                   GHSSQKRLVEVLRIDPGALTRQLKSLDALGWIEREADARDNRVTNVTLTEAGRAAFDAC
FT                   LPRRKAFLERTMAQLPDDVLNALSGALAMLESRIADVGSTVVER"
FT   gene            complement(605783..606364)
FT                   /locus_tag="Bmul_0556"
FT   CDS_pept        complement(605783..606364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0556"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bch:Bcen2424_2743
FT                   intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14251"
FT                   /protein_id="ABX14251.1"
FT                   /translation="MAAKKILFLTGDFAEDYETMVPFQALQAVGHHVDAVCPGKRAGDK
FT                   VKTAIHDFEGDQTYTEKPGHQFTLNATFDDVDASRYDALAIAGGRAPEYLRLDPNVIAL
FT                   VRAFAEAGKPIAAICHAAQLLAAADVIRGKRISAYPACAPEVKLAGGEYADIPVDAAVT
FT                   DAPFVTAPAWPAHPAWLSQFLALLGTRIEL"
FT   gene            complement(606551..607831)
FT                   /locus_tag="Bmul_0557"
FT   CDS_pept        complement(606551..607831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0557"
FT                   /product="amino acid aldolase or racemase-like protein"
FT                   /note="KEGG: bam:Bamb_2792 amino acid aldolase or
FT                   racemase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14252"
FT                   /protein_id="ABX14252.1"
FT                   /translation="MKVTNYQEPTIDPFGKGLGNLPGASVPLDEAGRLEWNLLAEDISL
FT                   PAAVLYEERIEHNLNWMQAFVQQYGVQFAPHGKTTMAPQLFRRQLAAGAWGITLATAHQ
FT                   TQAAYHGGVRRVLLANQLVGRQNMTIIAALLSDPDFEFFCCVDSADNVDQLGRFFGAAN
FT                   KSLNVLLELGVPGGRNGVRNPAQRKAVLDALARYPDTLKLAGIELYEGVLKEEGEIRAF
FT                   LQDAVALTRELAAAGRFARTPAILSGAGSAWYDVVAEEFAKASDAGFAEVVLRPGCYLT
FT                   HDVGIYKKAQTDVFARNPIARRMGEGLLPALQLWAYVQSVPEPDRAIVALGKRDAAFDA
FT                   GLPEPARHFRPGRDSAPREVAASEGWAVTGMMDQHAYLKIPPGADVKVGDMVAFDISHP
FT                   CLTFDKWRQLLVLDPQFRVTGVIETFF"
FT   gene            607951..608892
FT                   /locus_tag="Bmul_0558"
FT   CDS_pept        607951..608892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0558"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bam:Bamb_2791 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14253"
FT                   /protein_id="ABX14253.1"
FT                   /translation="MNMRAVRSASRAATPESASVAQPVLDIVARIAECAPELRDAERKV
FT                   AEFILADLARAAHASIGALARDTGVSVATVTRFAKAVGCRDVRELKLLVAQAAAVGRRF
FT                   LVPAEQVPAEEDANPATVVYDEIRVALAHNHQLLRNASFDAAADRLVGAKMIYVYGQGG
FT                   GSTALADELRFRLVRFGRPVATYQDSLLQRMVSATLSRDAVVVALSVSGRVPELLENCR
FT                   LAKRYGASLIAITAPASPLAKLADHLIPVVAFETDFIYKPSTSRYAMMMAIDVLVTGVA
FT                   LRLGDAGRESLRRIKHALDAHRGGGDRQPVGD"
FT   gene            608895..610376
FT                   /locus_tag="Bmul_0559"
FT   CDS_pept        608895..610376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0559"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3; KEGG: bam:Bamb_2790 N-acyl-D-amino-acid
FT                   deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14254"
FT                   /protein_id="ABX14254.1"
FT                   /translation="MHSHPEAADTLIVGAQLYDGTGAPPVTRDVAIRNGMIAAIGNLSN
FT                   WLAETVVDANGRALAPGFVDVHTHDDTHVIRAPEMLPKISQGVTTVIVGNCGISASPVT
FT                   LAGDPPDPMNLLGDRDAFRYPTFADYVAAVNDARPAVNVAALIGHTALRNNQMDRLDRA
FT                   ATDSEIAAMRTQLEEALANGALGLSSGLAYGSAFAAPTEEVMALAEPLANAGALYTTHM
FT                   RTEFDAILDAMDEAYRVGRHARVPVVISHLKCAGPSNWGRSTEVLASLEGARRYQPVGC
FT                   DCYPYSRSSSTLDLKQVTGDIDITITWSEPHPEVAGKLLKAIAADWGVTEQEAAQRIRP
FT                   AGAVYHNMSEDDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGHYVRDTNLLPL
FT                   EEAIRKMTSLSARRFGLARRGEVHVGYHADLVLFDPARVIDAATFDQPQQPAHGIDAVW
FT                   VNGVLTYENGRPTGERAGGFVARGERAQASADAAF"
FT   gene            610463..610849
FT                   /locus_tag="Bmul_0560"
FT   CDS_pept        610463..610849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0560"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bte:BTH_I0547
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14255"
FT                   /protein_id="ABX14255.1"
FT                   /translation="MKRYGVGEAKGTGGQVMPFARAVEADGWLYVSGQTPMVNGEVVEG
FT                   GIVTQSKQAIENMIAILKEAGYGLEHVVRCGVWLDDARDFASFNKVFISYFGEHPPARA
FT                   CVQSSMVIDCKVEVDCIAYKAPAK"
FT   gene            complement(610946..611770)
FT                   /locus_tag="Bmul_0561"
FT   CDS_pept        complement(610946..611770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0561"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I; KEGG: bam:Bamb_2788 GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14256"
FT                   /db_xref="GOA:A9AFB4"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFB4"
FT                   /protein_id="ABX14256.1"
FT                   /translation="MNPEHSPLGKATVYASQYDASLLFPIPRAGAREQIGITSALPFFG
FT                   TDIWNAYELSWLNARGKPQVAVATFYVPAESPNIVESKSFKLYLGSFAQSKFDSVDAVR
FT                   DVLKRDVSAACGASVSVQLVSPHDFGKLEMDELDGLSLDRLDLDADVYEPDPSLLSAAE
FT                   DEAPVEETLVSDLLKSNCPVTGQPDWGSVQIHYVGPQIDHAGLLRYIISFRNHTGFHEQ
FT                   CVERIFLDILHRCKPVKLAVYARYTRRGGLDINPFRTNYNQPMPDNARTARQ"
FT   gene            complement(611781..613304)
FT                   /locus_tag="Bmul_0562"
FT   CDS_pept        complement(611781..613304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0562"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: bur:Bcep18194_A6064 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14257"
FT                   /db_xref="GOA:P53607"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53607"
FT                   /protein_id="ABX14257.1"
FT                   /translation="MASHDYLKKILTARVYDVAFETELEPARNLSARLRNPVYLKREDN
FT                   QPVFSFKLRGAYNKMAHIPADALARGVITASAGNHAQGVAFSAARMGVKAVIVVPVTTP
FT                   QVKVDAVRAHGGPGVEVIQAGESYSDAYAHALKVQEERGLTFVHPFDDPYVIAGQGTIA
FT                   MEILRQHQGPIHAIFVPIGGGGLAAGVAAYVKAVRPEIKVIGVQAEDSCAMAQSLQAGK
FT                   RVELAEVGLFADGTAVKLVGEETFRLCKEYLDGVVTVDTDALCAAIKDVFQDTRSVLEP
FT                   SGALAVAGAKLYAEREGIENQTLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFKRFCSLVGDRNVTEFNYRIADAQSAHIFVGVQIRRRGESADIAANFESHGFKT
FT                   ADLTHDELSKEHIRYMVGGRSPLALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHY
FT                   RNQGADYSSILVGLQVPQADHAEFERFLAALGYPYVEESANPAYRLFLS"
FT   gene            complement(613442..613873)
FT                   /locus_tag="Bmul_0563"
FT   CDS_pept        complement(613442..613873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14258"
FT                   /protein_id="ABX14258.1"
FT                   /translation="MGAILGKSVLLPGARRSRCGPERVGTRRPGPAPCVGPVPAPMRGA
FT                   GSTGPGGTRSHQHDRARRACRSAAGLAARGVGFNGAIRGCLCIFRSLIQNGILTHDRAT
FT                   RGTPDSAWGYRGNPRRTWLAAISHAHSPPGRSVTARLNR"
FT   gene            613925..617959
FT                   /locus_tag="Bmul_0564"
FT   CDS_pept        613925..617959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0564"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; FAD linked oxidase
FT                   domain protein; KEGG: bvi:Bcep1808_2841 FAD linked oxidase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14259"
FT                   /protein_id="ABX14259.1"
FT                   /translation="MNAPQVFDPHGAAAAVAADPAPRLREIPYNYTSFSDREIVIRLLG
FT                   EEAWAVLDELRAERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRALLIEALNH
FT                   RLTEIGKRRRADLTEHHDEAGRERAARVEMLEAAAQRAVDEFADEFDKMADLRRRATKA
FT                   LGRCTQKDNIRFDGLSRVSHVTDATDWRVEYPFVVLTPDTEAEIAGLVKACFELGLTVI
FT                   PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGAVELTELPGVPHKVPTIFSGAGVVTRRV
FT                   TEAAEAAGYVFAVDPTSLDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWL
FT                   EVTRLEHNQGKIHDIAVARFELKWFDGAYAPGEKLLRTEMLEIEGRRFRKEGLGKDVTD
FT                   KFLAGLPGVQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQAREAIPSIVEIKDYLFE
FT                   TSKQGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDADAVAQATSEVI
FT                   RMANGKSGEGFVAVSAEARKRFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGI
FT                   ERINIELSLKNKLQLVDALEAFFRGGNLPLGKTDDANEIPSAELLEDRVQQALELLKRV
FT                   RARWEFVRDRLDQPLREAQHYLVQLGYEALAEKFADRADEQPGATLFHVTQDRTVRISW
FT                   KQEIRAELRAIFNGGAFKPILDEAQAIHKRVLRGRVFVALHMHAGDGNVHTNIPVNSDN
FT                   YEMLQDAHAAVARIMTLARSLDGVISGEHGIGITKLEFLTDDEIAEFRAYKQRVDPNGR
FT                   FNKGKLLDGADLRNAYTPSFGLMGYESLIMQQSDIGAIADSVKDCLRCGKCKPVCATHV
FT                   PRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDEFNDVADHCTVCHKCATPCP
FT                   VKIDFGDVTMNMRNLLRKMGKKKFNPGQAAGMFFLNATNPQTINAARTVMMGVGYKVQR
FT                   FANDMLKKVVTKQTQHPPATTGKPPAVEQVIHFVNKKMPGNLPKKTARALLDIEDNKIV
FT                   PIIRNPKTTTVDSEAVFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQ
FT                   RGAGQYDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCR
FT                   IIDIHEFLLEKGMKLDGVTGTRYMYHDPCHTPIKTMDPVKLVNELMGSEKDGYKIEKND
FT                   RCCGESGTLAVTRPDVSTQVRFRKEEEIRKGAAKLRSIPVVASAAEPAAAAVAAPANGP
FT                   DVKILTSCPSCLQGLSRYSEDANLEADYIVVEIARQVLGENWMVDYVARANNGGIERVL
FT                   V"
FT   gene            618045..618488
FT                   /locus_tag="Bmul_0565"
FT   CDS_pept        618045..618488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0565"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bam:Bamb_2785 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14260"
FT                   /protein_id="ABX14260.1"
FT                   /translation="MECVFCREDGGEVLWQDDRLRVVLATGEHDYPGFCRVIWGAHVAE
FT                   FSDLGDDERAHLMRVVYAVERAVRRVMQPNKVNLASLGNMVPHVHWHVIPRFSNDAHFP
FT                   QPVWAPRQRSVSEALLRTRAAQASLLHNAVREEIQRTNDPRQP"
FT   gene            618485..618898
FT                   /locus_tag="Bmul_0566"
FT   CDS_pept        618485..618898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0566"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   bch:Bcen2424_2733 protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14261"
FT                   /protein_id="ABX14261.1"
FT                   /translation="MSGLTSTTPIPSGVVVHAVSRVLELQYPNGESYRIPFELMRVYSP
FT                   SAEVRGHGPGQETLQTGKREVTITALEGVGNYALQPTFSDGHSTGIYSWDLLYELATQQ
FT                   DALWRDYFDKLKAAGVDRDAPMPAASAPHGHCH"
FT   gene            618951..619682
FT                   /locus_tag="Bmul_0567"
FT   CDS_pept        618951..619682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0567"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bam:Bamb_2783 ubiquinone/menaquinone biosynthesis
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14262"
FT                   /db_xref="GOA:A9AFC0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFC0"
FT                   /protein_id="ABX14262.1"
FT                   /translation="MSKTHFGFETVEETDKAKKVAGVFHSVANNYDLMNDLMSAGMHRA
FT                   WKAFTIAQANVRPGYKVLDIAAGTGDLTKAFAKAAGPTGEVWHTDINESMLRVGRDRLL
FT                   DKGIVTPSLLCDAEKIPFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVAKPGGRVMVLE
FT                   FSKVWEPLKKAYDLYSFKVLPWLGDKFAKDADSYRYLAESIRMHPDQDTLKTMMEQAGL
FT                   DAVKYYNLSGGVVALHLGTKY"
FT   gene            619724..620746
FT                   /locus_tag="Bmul_0568"
FT   CDS_pept        619724..620746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0568"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bch:Bcen2424_2731 import inner membrane
FT                   translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14263"
FT                   /protein_id="ABX14263.1"
FT                   /translation="MSESRSLFNRSKPSKPWARRVGTLLMVGLLTAGTFASLDAEAKRM
FT                   GGGRSFGRQNSTVTQRQATPPAQQPMQQAAPAQAQRANPAAPAPAAQPNRSRWLGPIAG
FT                   LAAGLGIAALLSHFGLGEAFAGMMSNLIVIALLAMIGIWLVRKFMNRRRPQEPAYSVGS
FT                   APSSSGGYAQSPSFQPGSTSQYSGSGSNYANEAQRVFNGGAPAAGAAAAAPVQVPAGFD
FT                   TDAFLRSAKVSFVRLQAAWDQGNLADIREFTTPEMFAEIKIDLDSRGNEPNQTDVVQLD
FT                   AELVALEDRGIEQSASVRFHGLIRESANAAAEPFDEVWNLSKSGGQGWLLAGIQQLNAH
FT                   "
FT   sig_peptide     619724..619834
FT                   /locus_tag="Bmul_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.653 at
FT                   residue 37"
FT   gene            620879..621505
FT                   /locus_tag="Bmul_0569"
FT   CDS_pept        620879..621505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0569"
FT                   /product="protein of unknown function DUF1243"
FT                   /note="KEGG: bam:Bamb_2781 protein of unknown function
FT                   DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14264"
FT                   /protein_id="ABX14264.1"
FT                   /translation="MTFAAKPFAAAVNHLLARESWARDRLIPYAGKTARLDVPPVTLVL
FT                   LVQPDGYLSAVDEHDARQVDVSIALAGDTVAAFLQGGQPAVMKHVKIDGDAEFATQIAK
FT                   LAEHLRWEPEEDLAKLVGDAAAHRIATIVRDAGARARRTGRNVLDSIAEYWLDENPQVV
FT                   RRASLGGFDAELARARDALARVEKRVERLEQKIGARTGSGPRGAH"
FT   gene            621518..623095
FT                   /locus_tag="Bmul_0570"
FT   CDS_pept        621518..623095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0570"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: bch:Bcen2424_2729
FT                   2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14265"
FT                   /protein_id="ABX14265.1"
FT                   /translation="MRIFRFIKIVYTVIRFGLDEVMLSRIDDRRVKLLLRITTIGRRYS
FT                   DPPAVRLRHALESLGPIFVKFGQVLSTRRDLLSVDFANELAKLQDQVPPFDSSVAIAII
FT                   EKSLGAPVDELFDEFEREPVASASIAQVHFAKLKQGVHAGKAVAVKVLRPNMLPVIDSD
FT                   LALMRDIATWTERMWADGRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMFWDFSTSHVLVMERMSGVPISQVETLRAAGVDIKKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPNTFGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPETRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTM
FT                   PQLPRLIHHALAARHDAPRAASEDLMRQILIEQKRTNRLLQALLIFGLAVGVGALVARV
FT                   LLALAYGA"
FT   gene            623113..623739
FT                   /locus_tag="Bmul_0571"
FT   CDS_pept        623113..623739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0571"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 12; KEGG: bam:Bamb_2779 thiopurine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14266"
FT                   /protein_id="ABX14266.1"
FT                   /translation="MSDPKHAAAPAAASFETRDPGDASFWDERFARGMTPWEFGGVPAG
FT                   FRAFASARPPCAVLIPGCGSAREAGWLAQAGWPVRAIDFSAQAVAAAKAQLGAHADVVE
FT                   QADFFAYRPPFDVQWIYERAFLCALPPARRADYAATMAALLPAQGLLAGYFFVADKQKG
FT                   PPFGITRGELDALLGAHFELIDDAPVSDSLPVFEGHERWLAWRRR"
FT   gene            623835..624158
FT                   /locus_tag="Bmul_0572"
FT   CDS_pept        623835..624158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0572"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: bur:Bcep18194_A6054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14267"
FT                   /protein_id="ABX14267.1"
FT                   /translation="MPIYAYRCEACGFAKDVLQKMSDAPLSQCPECGKDAFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGSGGASAPATAASSGDAAPAAPAAAAPAAESTTTSAAAPAAAPA
FT                   AGS"
FT   gene            624220..624870
FT                   /locus_tag="Bmul_0573"
FT   CDS_pept        624220..624870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0573"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   bvi:Bcep1808_2832 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14268"
FT                   /protein_id="ABX14268.1"
FT                   /translation="MMKKTTLKSVFLTGLLVLVPLAITLWVLGLIIGTMDQTLLLLPES
FT                   WQPERMLGFHLPGIGAVLTLAFVFVVGLATQNFIGQKLVTWWNAVVRHIPVVGPIYTSV
FT                   KQVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGTPGGDVVNHLTEEYVSVYVPTTP
FT                   NPTSGFFLMLPKSEVIELDMSVDAALKYIVSMGVVAPPAPVPVPARRPVEPPL"
FT   sig_peptide     624220..624288
FT                   /locus_tag="Bmul_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.475 at
FT                   residue 23"
FT   gene            624938..626740
FT                   /locus_tag="Bmul_0574"
FT   CDS_pept        624938..626740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0574"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); GAD domain protein; tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bvi:Bcep1808_2831
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14269"
FT                   /db_xref="GOA:A9AFC7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFC7"
FT                   /protein_id="ABX14269.1"
FT                   /translation="MSMRTEYCGLVTEHLLGQTVSLCGWVQRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFATAEGVRNEFCVQVKGLVRNRPEGTVNAGLKSGKIEVLCHELNVL
FT                   NPSITPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEARKYLDEQGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLGEQEIRDLFEDMIRHIFKTTINVELDAKFPVMPYSEAMA
FT                   RFGSDKPDLRVKLEFTELTDAMKDVDFKVFSTPANAKDGRVAALRVPKGAELSRGDIDG
FT                   YTEFVRIYGAKGLAWIKVNEKAKGRDGLQSPIVKNLHDASIAAILERTGAEDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVEAGWKPLWVVDFPMFEYDDEDARYVAAHH
FT                   PFTSPKDEHLEYLESDPGRCLAKAYDMVLNGWEIGGGSVRIHREDVQSKVFRALKIGAE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQA
FT                   PSPVDERQLRELHIRLRQPEQPAS"
FT   gene            626906..627400
FT                   /locus_tag="Bmul_0575"
FT   CDS_pept        626906..627400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0575"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bam:Bamb_2775 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14270"
FT                   /protein_id="ABX14270.1"
FT                   /translation="MTKPPKIPESVLVVIYTPELDVLVIKRADQPDFWQSVTGSKDTLD
FT                   EPLAVTAAREVAEETGIVIGTADVPAAALVDWQHRIEYTIYPQYLHRYAPGVTRNTEHW
FT                   FGLCVPRRVDVTLSPREHVDYAWLPYRDAAARCFSPSNADAILQLPVRASLVHLPHGSS
FT                   A"
FT   gene            627397..628671
FT                   /locus_tag="Bmul_0576"
FT   CDS_pept        627397..628671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0576"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bur:Bcep18194_A6050 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14271"
FT                   /protein_id="ABX14271.1"
FT                   /translation="MNAETRKRFAQLRQMFLQERGSASRLAFTTGNTVRLCEGGGEFFR
FT                   ALIDRIDAAREQVMLETYIFCDDAAGRPVSDALIRAALRGVRVRVITDGVGTARLPLFD
FT                   AWTEAGIEHCIYNRYLFGRFGFSRTHRKLAVIDRSAAFCGGINIVDDYEQNGAPLQYPR
FT                   WDFALELAGPAVADVRAAFELQWHRIQFGHKPYAQYAAGLHGGEPFPEMFRRWIRSHRW
FT                   IKAGALRVVTEPSVAFVARDNVVNRRTIEKAYLAAIGRARHQIRLANPYFMPGRKLRRA
FT                   LTGAARRGVDVRILVGRKEFAALDTAVPFLYRALLRAGVRVAEYDKTILHGKVAVIDDN
FT                   WATVGSSNLDALSLMLNNEANVVLVRYDAVTNELRDAIEAAFADGREIDPAWYAARPLG
FT                   ERLLSWLAYTTYRIVMKALTVGGYD"
FT   gene            628925..629524
FT                   /locus_tag="Bmul_0577"
FT   CDS_pept        628925..629524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0577"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bvi:Bcep1808_2828 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14272"
FT                   /protein_id="ABX14272.1"
FT                   /translation="MRKGEQTRAAILEAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSREDLQVEVVREYHHRFENEVFFPSLREPRGLPRLRAMLARWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRPDSPVREQLIASVTAWRAALLRAISQAKEEGHLRADSDPDLMLFELYSF
FT                   TLGLHHDARFLHLPDAVRLTWAALEKTIVSYQSESR"
FT   gene            629582..631369
FT                   /locus_tag="Bmul_0578"
FT   CDS_pept        629582..631369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0578"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bvi:Bcep1808_2827 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14273"
FT                   /protein_id="ABX14273.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAELKQMPKHADLDADTINQVLEE
FT                   AGKFCAEVLFPLNQVGDREGCKYVGDGVVTTPTGFKEAYRQYVEAGWPALGCDPEYGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGSPELQKAYLPKLVSGEWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNGDGSYSITGTKIFISSGEHDMASNIVHLVLARLPDAP
FT                   QGTKGISLFIVPKFIPDASGEPGERNGIKCGSIEHKMGIHGNATCVMNLDNAKGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGMQGLGLTEVAYQNSLAYAKERLQMRSLTGPKAPDKPADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFTYWSALQIDKELSHADEAVRKEAADLVALLTPIIK
FT                   AFLTDNAFESTNHAMQIYGGHGFISEWGMEQYVRDARINMIYEGTNSIQSLDLLGRKVL
FT                   GDMGAKLKKFGKIVSDFVEAEGVKPEMAEFVNPLADIGEKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDNEASGDPFYKSKLATARFYFARLLPETAAT
FT                   IRAARAGSKTLMEVDESLF"
FT   gene            631482..633917
FT                   /locus_tag="Bmul_0579"
FT   CDS_pept        631482..633917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0579"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bcn:Bcen_2108 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14274"
FT                   /protein_id="ABX14274.1"
FT                   /translation="MSNFLIRKVAVLGAGVMGAQIAAHLVNARVPVLLFDLPAKEGPKN
FT                   AIALKAIENLKKLSPAPFGVKDDAKYLEAANYDDDIAKLAECDVVIEAIAERMDWKHDL
FT                   YKKVAPHIGPNAIFATNTSGLSITKLSEGFSDELKARFCGVHFFNPPRYMHLVELIPTA
FT                   HTRPEILDQLETFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVITEAAKFGLRFDEVD
FT                   DLTGSRLGRAKSATFRTADVVGLDTMAHVIKTMQDNLADDPFFPVYQTPAVLAELVKQG
FT                   ALGQKTGAGFYKKEGKAIKVLDAKTGSYVDSGAKADETVARILKRPPAERLKLLRETNH
FT                   PHAQFLWSIFRDVFHYIGVHLESIADNARDVDLAIRWGFGWNEGPFEGWQAAGWKQVAE
FT                   WVQDDIAAGKALANVPLPAWVLEGPVAEKGGVHTAEGSWAPASKRFVPRSDLPVYRKQV
FT                   FRAPLLGEAGADPKTYGKTLFETDSVRAWVDDRTGEDDVVIVSFKSKMNTIGPGVIDGL
FT                   VQAIELAEKDYKGVVIWQPTSLKLGTPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKF
FT                   QEGMLRVKYANVPVVAAVSGIALGGGCELMLHSAKRVVHVESYIGLVEVGVGLVPAGGG
FT                   LKEAALRAADAAAAANATTDLLKFVTKSFENAAMAKVSSSAHDARAMGYVKPSDTIVFN
FT                   VFELLDTAKKEARALADTGYRAPLRAKDVPVAGRSAIATIKAQLVNMRDGRFISDHDFL
FT                   IASRIAEAVCGGDVEAGSLVDEEWLLALERRAFVELLGTQKTQERIMGMLQTGKPVRN"
FT   sig_peptide     631482..631568
FT                   /locus_tag="Bmul_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.643 at
FT                   residue 29"
FT   gene            633944..635143
FT                   /locus_tag="Bmul_0580"
FT   CDS_pept        633944..635143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0580"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: bam:Bamb_2771 acetyl-CoA
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14275"
FT                   /protein_id="ABX14275.1"
FT                   /translation="MSKQLQDAYIVAASRTPIGKAPRGVFKNTRPDELLVHAIKSTVAQ
FT                   VPGFDTKLIEDAIIGCAIPEAEQGLNVARMGALLAGLPQTVGGVTVNRFCASGITALAM
FT                   AADRIRVGESDALLAGGCESMSMVPMMGNKPSMSPHIFDRNEDIGIAYGMGLTAERVAD
FT                   QWKVSREDQDAFSVESHRKALAAQQAGEFADEIAPYTITERFPNLASGEIDVKTREIKL
FT                   DEGPRADTSLEGLAKLRAVFANKGSVTAGNSSQTSDGAGALLVVSEKVLKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDLDWIELNEAFAAQSLAVIRDLGLD
FT                   PSKVNPLGGAIALGHPLGATGAIRAATVVHGLRRRNLKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            635232..636002
FT                   /locus_tag="Bmul_0581"
FT   CDS_pept        635232..636002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0581"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bam:Bamb_2770 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14276"
FT                   /protein_id="ABX14276.1"
FT                   /translation="MVADIQVERADGVLTITIARPAKKNALTAAMYQAMADALADAQED
FT                   SAVRAILLRGSDGNFSAGNDLEDFLKAPPKDENAPVFQFLARISGASKPIVAAVPGIAV
FT                   GVGVTMLLHCDLVYAADTATFSLPFVQLGLCPEAASSMLLPRLTGHQIAAEKLLLGEPF
FT                   DALEAHRIGIVNRVLPAAELDAFAAKQAAKLAALPASSLRVTKALLKDTGGVTVAARMA
FT                   EEAGHFSAMLRAPEAREAMTAFFEKRKPDFRQFD"
FT   gene            complement(636057..636881)
FT                   /locus_tag="Bmul_0582"
FT   CDS_pept        complement(636057..636881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0582"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: bam:Bamb_2769 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14277"
FT                   /protein_id="ABX14277.1"
FT                   /translation="MNPTETAEPRGAIELSVRRMRGGVAETAQDYVGQEWPVALVFNGI
FT                   SHAVMMCTPRDLEAFAVGFAMSEGIVARGSDIKDIDVILHADAPLPHAEVHLDVVQQAF
FT                   AALKDRRRALAGRTGCGVCGIESIDLLDLAPERVPDTGFLARLAPDALTRAAHALPAHQ
FT                   TLTQLTGGLHAAAWCDATGAIRMAFEDVGRHNALDKLIGSLVLSRAEPTDGFVFLSSRA
FT                   SYELVRKAARVGIPMVATISAPSSLAIEIAKAAGLRLVSFCRETGYVDYGTA"
FT   gene            637002..637484
FT                   /locus_tag="Bmul_0583"
FT   CDS_pept        637002..637484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bam:Bamb_2768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14278"
FT                   /protein_id="ABX14278.1"
FT                   /translation="MGLSDAPLLFNFEHESSENLTYIPMIVRFNLDRFGLRISLEQWQL
FT                   LPLEDRRLLARFPADDDTAIEPNFDHALFEMLRTHANLEPSWFQPEEQPAWRTTDAVPD
FT                   ALAQQCALAGLPVPAVAQWQQLAPFQRYVLMKLSRKPTLNHDFVPAMREFGLTATH"
FT   gene            complement(637523..638023)
FT                   /locus_tag="Bmul_0584"
FT   CDS_pept        complement(637523..638023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0584"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bvi:Bcep1808_2816 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14279"
FT                   /protein_id="ABX14279.1"
FT                   /translation="MRTSYCRRSRFAPLPAASQAGCARAAYFLQDESPAMTEPTLELPQ
FT                   KQPALRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPV
FT                   FVGDLLSFYATITRTGNTSVTVDVEVYAQRMRLMGEVVKVTEATLTYVATGPDRKPRPL
FT                   PAL"
FT   sig_peptide     complement(637946..638023)
FT                   /locus_tag="Bmul_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.802 at
FT                   residue 26"
FT   gene            638091..639962
FT                   /locus_tag="Bmul_0585"
FT   CDS_pept        638091..639962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0585"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   bvi:Bcep1808_2815 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14280"
FT                   /protein_id="ABX14280.1"
FT                   /translation="MRRYSASGEPAPAPTGPRNDWQTIRSLLPYLATYKLRVALALACL
FT                   IGAKVANLGVPIVMKRIVDHLASVQQLTALGRAEQSAGIVLAGGVGLLVVAYALVRLST
FT                   SLFTELREILFSKVTESAVRRLALQVFRHLHGLSLRFHLERQTGGMSRDIERGTRGIQQ
FT                   LISYSLYSILPTLVEVGLVLGFFVVKYDAYYAYVTFAALIAYIVFTVKVTNWRTHFRRT
FT                   MNELDSRANSRAIDSLINYETVKYFGNEEWEAQRYDENLKRYRQAAIRSQNSLSLLNFG
FT                   QQAIIGTGLVFILWRATQGVLAGKLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLT
FT                   DMDRMFGLLSAAKEVADRPDARPLAVAGAQVRFEHVNFAYEPARPILHDVTFTIEAGTT
FT                   TAVVGHSGSGKSTLSRLLFRFYDLDRASGGAIRIDGQDIRDVTQDSLRASIGIVPQDTV
FT                   LFNDSIYYNIAYGRPRATRDEVIAAARAAHIHDFIESLPNGYDTPVGERGLKLSGGEKQ
FT                   RVAIARTLLKNPPILLFDEATSALDSRSERAIQHELDQIARHRTTLVIAHRLSTVVHAQ
FT                   QILVMDHGRIVERGTHDELVRADGLYAQMWALQQQRAAAGDEAAEAA"
FT   gene            complement(640011..640733)
FT                   /locus_tag="Bmul_0586"
FT   CDS_pept        complement(640011..640733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0586"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG:
FT                   bur:Bcep18194_A6040 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14281"
FT                   /protein_id="ABX14281.1"
FT                   /translation="MSTSLTTAMIFAAGRGERMRPLTDTCPKPLLEAGGKPLIVWQIER
FT                   LAQAGIETIVINHAWLGAQIEQALGDGARWGVRLVYSAEGEALETAGGIAQALPLLERD
FT                   GRATVFVAVSGDVFCAFDYRTLAPRAARMAELDAPALHLVMVPNPPFHPAGDFALGDDG
FT                   RLTLDGAARLTFGNIGLYDTRMFRDLARGTRRALTPYYRAAIEAGRASGELYEGIWENV
FT                   GTPAQLHELDARLRAAGR"
FT   gene            complement(640759..641805)
FT                   /locus_tag="Bmul_0587"
FT   CDS_pept        complement(640759..641805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0587"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bch:Bcen2424_2712 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14282"
FT                   /protein_id="ABX14282.1"
FT                   /translation="MTPPSTAAHPDARLDALAAWLRPLADRYALDLSTLAPASSDASFR
FT                   RYFRVASAASAGGSLIAVDAPPPEKCREFVQVAQLLAAAGDHVPDVLAHDFDAGFMLVT
FT                   DLGRTSYISVLDPADPAAARPLMRDAFDALIRFQLTSKPDVLPPFDEAFLRREMELMPE
FT                   WFIGRHLGKPVTDAMRDTLERTFALLVASAHAQPQGFMLRDFMPRNLMVCEPNPGILDF
FT                   QDAVYGPLTYDVVSLLRDAFISWDEEFELDCFAYYWEKAKKAGLPVDPDFGEFYRQLEW
FT                   MGLQRHIKVLGLFARINYRDGKPHYLDDLPRFLGYARKVALRYRPLAPFAKLLDALEGR
FT                   TDDVAYTF"
FT   gene            642019..644379
FT                   /locus_tag="Bmul_0588"
FT   CDS_pept        642019..644379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0588"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; KEGG:
FT                   bch:Bcen2424_2711 organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14283"
FT                   /protein_id="ABX14283.1"
FT                   /translation="MPPKPLFPNVFPADGAPRKRRLALALLAVPGLVPAVSHAQLTGAA
FT                   AQPQPLDSPWDLRLAPQLEEHPLKDGAKPAAFVIADHMSGTAEQDMAAKGSAELRRGDA
FT                   VVKADAIHYDQDTDMADAYGQVRVINGGTSFAGPEAHLKIEASQGFMTAPKYHFNVTGG
FT                   SGSAERVDMLDSERSVFVNGTYTACACATHPAWYIKGSRFDFDTGADEGTARNGVLFFQ
FT                   GVPIFASPWMTFPLSGDRRSGLLPPTFSMNSNNGFELSLPYYFNIAPNRDLTITPRIIS
FT                   RRGVQTEATFRYLSPSYSGTFTANYLPDDRLAHRNRYAIYWQHQQNFGGGFGGYVYYNK
FT                   VSDNTYPEDLGSMNQFINGTQTLYQQEAGLTYNKGPWSVLARYQHWQTLPPSIAPYSRE
FT                   PQLNVKYTKYNVGGFDFGAEADYSRFRITTADSTQGDRIVFNPYIAYGVYGPGYFVVPK
FT                   VQYHFASYDLNYLSSSTPNSPKRFTESIPTVSFDTGLIFDRSVRLFGQDFIQTLEPRLY
FT                   YVYTPYRDQSNAPLFDTAESDFGLAEIYQPNTFVGNDRVADANRITAGLTSRFIDPRTG
FT                   DERARFVIAQQYYFADQRVTLNTGQSAAQARHSDLIVGAALKLGSGFMSETAFQYNQNN
FT                   NQLVKSSIGFGFSPGERKVINAAYRYTRASTTLDGQPINQFLVSAQWPLTRRLYAVGRF
FT                   NYDLAGDRLVDGLLGLQYDADCWALGVGVQRFANGVNSSGQRNSSTRFMMQLTLKGLST
FT                   VDNGLVAAFRAGVPGYTPLPSAPPPMSRFSNYE"
FT   sig_peptide     642019..642138
FT                   /locus_tag="Bmul_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.980 at
FT                   residue 40"
FT   gene            644428..645783
FT                   /locus_tag="Bmul_0589"
FT   CDS_pept        644428..645783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0589"
FT                   /product="SurA domain"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: bch:Bcen2424_2710 PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14284"
FT                   /protein_id="ABX14284.1"
FT                   /translation="MKKTLRFAAVVSSLAASAALLAAAPAAAQALGSQGAQLADEVVAV
FT                   VNNDVITGRELDQRVGLISRRLQQQNAPVPPIDQLRAQVLNQMVLERIQVQKAKDDGIR
FT                   VDDATVQATLQRLAQANGMTLDQYRSRLEAQGVPWSIFTADARTELMLSKLREREVDSK
FT                   ITVSDAEVASYIASQRGPNASQQQDLRFQHIFIKAPTNAPQTQIEAAQKKAEALLQQAT
FT                   SGADFEKLAKNNSEADDAKKGGDLGFKSPSALPADVVDAAAKLRPGQVNPTLIRVPDGF
FT                   EIIRLVDRRQSQGATAAAPKIVQTHVRHILLRVGEGKSEGQARQQLIDIRRQIEAGGDF
FT                   EKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNALQDGQISQPIRTEYGYHLIQVV
FT                   GRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSYVQYKIGGLPSN"
FT   sig_peptide     644428..644514
FT                   /locus_tag="Bmul_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.767 at
FT                   residue 29"
FT   gene            645791..646780
FT                   /locus_tag="Bmul_0590"
FT   CDS_pept        645791..646780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0590"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: bch:Bcen2424_2709
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14285"
FT                   /protein_id="ABX14285.1"
FT                   /translation="MSARALQIAITTGEPAGVGPELTVQALRDAGERWPDAQFTVLGDA
FT                   ALLEARAAAVGADWAALVGGSRVSVAHHALAAPAHAGRLDAANGRYVLALLDAAIDGAV
FT                   AGRYDAIVTAPLQKSTINDAGVPFTGHTEYLAERTHTARVVMMLAGTGATPLRVALATT
FT                   HLPLKDVSAALTIDGLVETLAIIDRDLRRDFGLARPRILVTGLNPHAGENGYLGREEID
FT                   VIAPALARAQAQQIDARGPYPADTLFQPRYLADADCVLAMFHDQGLPVLKYATFGEGIN
FT                   VTLGLPIIRTSVDHGTALDLAGTGRADPGSMIAALDTAVTMARHRRAA"
FT   gene            646876..647703
FT                   /locus_tag="Bmul_0591"
FT   CDS_pept        646876..647703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0591"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   bur:Bcep18194_A6035 16S rRNA dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14286"
FT                   /db_xref="GOA:A9AFE4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFE4"
FT                   /protein_id="ABX14286.1"
FT                   /translation="MSNSRQHQGHFARKRFGQNFLVDHGVIDSIVATIAPARGQRMVEI
FT                   GPGLGALTEPLIARLATPETPLHAVELDRDLIARLKQRFGALLELHAGDALAFDFRSLA
FT                   APGDAPSLRIVGNLPYNISSPLLFHLMTFADVVVDQHFMLQNEVVERMVAEPGTKAFSR
FT                   LSVMLQYRYVMDKLIDVPPESFQPPPKVDSAIVRMIPYAPHELPDVDPVLLGEIVTAAF
FT                   SQRRKMLRNTLGDYRETIDFDALGFDLARRAEDVSVAEYVGVAQALAATRNAQ"
FT   gene            complement(647796..648731)
FT                   /locus_tag="Bmul_0592"
FT   CDS_pept        complement(647796..648731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0592"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bur:Bcep18194_A6034 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14287"
FT                   /protein_id="ABX14287.1"
FT                   /translation="MNALAAAPARRALDARAVGLMLLLCAIWGFQQVAIKSTNAAIPPI
FT                   FQAGLRSVIAALLLWGWARSRGTPLFRADGTFGAGLAAGALFAGEFICVFFGLTLTSAS
FT                   HMAIFLYTAPCFTALGLHLFAPGERLQRVQWAGVGIAFAGIALAFADGFLKPRAPGASV
FT                   LAGLAGDALGILGGAMWAATTVVVRSTSLARASASKTLFYQLAVSAVVLVALAVLLGQA
FT                   SFAHVTPIAVASLAYQSVIVAFVSYLSWFWLLTRYSASRLSVFTFLSPLFGVAFGVLLL
FT                   GESVGWRFMSAAALVLTGIALVNAPTRRRV"
FT   gene            649134..649523
FT                   /locus_tag="Bmul_0593"
FT   CDS_pept        649134..649523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0593"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: bam:Bamb_2758 lactoylglutathione lyase;
FT                   TIGRFAM: lactoylglutathione lyase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14288"
FT                   /protein_id="ABX14288.1"
FT                   /translation="MRLLHTMLRVGDLDRSIKFYTELLGMKLLRREDYPEGKFTLAFVG
FT                   YEAESTGTVIELTHNWDTPSYDLGNGFGHLAIEVDDAYAACEKIKAQGGKVTREAGPMK
FT                   HGTTVIAFVEDPDGYKIEFIQKKTH"
FT   gene            complement(649621..650526)
FT                   /locus_tag="Bmul_0594"
FT   CDS_pept        complement(649621..650526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0594"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bur:Bcep18194_A6032 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14289"
FT                   /protein_id="ABX14289.1"
FT                   /translation="MKKRPRPRPAVVALDHRQLDLPLFDGPAAAPSAPVSPPAPPDAAP
FT                   ASPIAPLAPPDTAPAPDRARIRTLALDSRVLEYRLKRSARRTIGFTIDGSGLSITAPRW
FT                   VTLADIEAAIAEKQRWIFAKLAEWKTRTEQRALPQIDWRDGAQLPYLGKTITIALGAGA
FT                   VAFDALAQRLSLPLPAQADAQQIKDRVQGWLQGEAKRIFVERLAVYAEKLGVTYSMVAL
FT                   SSAATRWGSCSSDGKIRLNWRLIHFPMSIIDYVVAHELSHLREMNHSPAFWQTVESIFP
FT                   EFREARHTLKHHPPELLPSL"
FT   gene            complement(650573..651337)
FT                   /locus_tag="Bmul_0595"
FT   CDS_pept        complement(650573..651337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0595"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   bvi:Bcep1808_2805 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14290"
FT                   /protein_id="ABX14290.1"
FT                   /translation="MRFVRSLLLLIYFIVYTVPYATACFIAFPFLRPDARYWMAAGWCK
FT                   STLWVVRWLNGIRYRIEGFENLPDGPAVLLSKHQSAWETLAFPALMPKPLCYVFKRELL
FT                   YVPFFGWALGMLHMVHINRKEGKHAFDSVIRQGKKRLTEGAWVIMFPEGTRTPVGKQGK
FT                   YKTGGARFAIETGTAVVPIAHNAGHVWPRNSFTKYPGVVTVSIGKPIDVTGLTPDVLNS
FT                   RVEAWIEAEMRRIDPDAYRQAGNADTRDAARV"
FT   sig_peptide     complement(651266..651337)
FT                   /locus_tag="Bmul_0595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.570 at
FT                   residue 24"
FT   gene            complement(651381..651944)
FT                   /locus_tag="Bmul_0596"
FT   CDS_pept        complement(651381..651944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0596"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   bch:Bcen2424_2703 histidinol-phosphate phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14291"
FT                   /protein_id="ABX14291.1"
FT                   /translation="MPTSPNRKLVVLDRDGVINVDSDAFIKTPDEWIALPGAFEAIARL
FT                   NHAGYRVVVATNQSGIGRGLFDMAALNAMHLKMHRAAAAVGARIDAVFFCPHTSEDHCE
FT                   CRKPKPGMMQMIAERFEIDPDHTPVVGDTLRDLLAGVAVGFQPHLVLTGKGKKTLAAGG
FT                   LPPGTKVHDDLRAFALDFLSHDYE"
FT   gene            complement(651955..654054)
FT                   /locus_tag="Bmul_0597"
FT   CDS_pept        complement(651955..654054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0597"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: bam:Bamb_2754 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14292"
FT                   /protein_id="ABX14292.1"
FT                   /translation="MTHNHPAPLLVELLTEELPPKALARLGDAFAEGLAQRLAARDLVE
FT                   GELVFERYATPRRLAVVVQNVRAVAPDRQVREKVLPVSVALDAQGNPTAPLAKKLAALG
FT                   RPNLTIAELERAQDGKAEAFFINYSAAGATLADGLQAALDETLAKLPIPKVMTYQRPDG
FT                   SDVQFVRPVHRLTVLHDDRVVPVTAFGIDAGDTTLGHRFLSDGLVAIQHASAYAETLRD
FT                   KGRVIAHFGDRKETIRTQLNEHANGDTVVMPDALLDEVTSLVEWPVVYPCRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDIGGKLRSRFLIVSNIETKTPGEIVEGNERVVRPRLADAK
FT                   FFFEQDKKKPLAARVPLLANVVYHNKLGSALARVERLEALAGEIAPAIGADVAHAKRAA
FT                   RLAKADLLTDMVGEFPELQGTMGTYYARHDGEPDDVALACAEHYQPRFSGDTLPTTPVS
FT                   TAVALADKLETIVGIWGIGLAPTGEKDPFALRRHALGVLRLLIEKQLPLDLVSLLRTAY
FT                   ARFEGVPGVAESTDAIVAFFMDRLRGLLRERGYSAGEVDAVLSLNPTRLDDLVARLDAV
FT                   REFTRLAEAEALAAANKRISNILKKSEGGANGAVQPTLLVEAAEKALHEQLAAVTPHVQ
FT                   SQLEARAYTGALSALAALRAPVDTFFNDVMVNADDPALRANRLALLSALHQQMNCVADI
FT                   SKLAA"
FT   gene            complement(654077..655081)
FT                   /locus_tag="Bmul_0598"
FT   CDS_pept        complement(654077..655081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0598"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: bvi:Bcep1808_2802 glycine--tRNA ligase;
FT                   TIGRFAM: glycyl-tRNA synthetase, alpha subunit; PFAM:
FT                   glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14293"
FT                   /protein_id="ABX14293.1"
FT                   /translation="MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLIWTEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEYANVDLL
FT                   FTFFNSYEAEAKRMIEAQLALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALS
FT                   RLVAQAYYDSREKLGFPMLGNPPGVPGLTTDAQDAAQPAWAPPLKVERKIDQD"
FT   gene            655252..657033
FT                   /locus_tag="Bmul_0599"
FT   CDS_pept        655252..657033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0599"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bcn:Bcen_2088
FT                   tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14294"
FT                   /protein_id="ABX14294.1"
FT                   /translation="MRYGARRSRSYACVARQSRRRAARTLRCAYCGARIAHPTADSDCM
FT                   NDSNDLLIPLLPPLTALLERAADAHSRGEHDARALWLAAAAHLHPVDAAALSQLTSALV
FT                   ARQRIGDAIALAACAARVHADAAAHFNHGYALQMAGRHVDAVAPYRAALALDPDWPSLR
FT                   NNLAIAVRLSGGDRAEEVALLEAAVHAEPRDVQAWINLVVAQLAMRNLDRALVCAARLV
FT                   ELAPDNALAMNNVAMAMKEAQRWDDAERYAARASELAPDDPSYRFNLAIIQLVRGNYAA
FT                   GWRGHEARWDGAGELRGRRPALPGPRWQGEPLKDKTLLLWGEQGLGDVLQFCRFVAPLA
FT                   ERVHREGGRLVWNTFPPLGTLLQRSLGAHADEFGAGGDIAALPAFDYEVPLIGLPLMLG
FT                   MEEDTLASSVPYLRADARAIDAWRARLARERRLKVGLVWTGSAGHQRNPFRRVGIERYA
FT                   HAFRGIDGVAFYSLQPGADADVAAARASGFAIEDCTSELKSFDDTAAFIGALDLVITVC
FT                   TSVAHLAGALGARTWVLLDVNPHWPWLLERSDSPWYPTATLYRQRTFGDWQPVMDAVAG
FT                   DLQQLAATQRHASSPAR"
FT   gene            complement(657086..658747)
FT                   /locus_tag="Bmul_0600"
FT   CDS_pept        complement(657086..658747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0600"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bch:Bcen2424_2699 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14295"
FT                   /protein_id="ABX14295.1"
FT                   /translation="MDDPIPSRPAGGIPASAPGRALPRWHYPAALLAGAANTLCFAPTP
FT                   HGGWLQLVVFVWFFAQLTRTASWRSAALTGGAFGFGNFISGIWWLYISMHVYGEMAAPL
FT                   AGGALVLFSLYLSLYPAFSAGLWSFCAGHAWHRREPDPRPFSPSWHGAFAFAGAWALGE
FT                   WLRGTVFTGFPWLASGYPQVDGPFAGFAPVVGVYGIGWVLALFAALIVQALAAARPAQS
FT                   PAASAAPRARARVVAPAAVAVVLVAVGVALSQATWTIPANAPLTVRLLQGNVKQDIKFE
FT                   QAGIDAAIKMYQQMITEKPADLIVTPETAIAVMIQELPEPFAVAIRKFSDTTGSAVLFG
FT                   AVGASVTEDGRYVDYTNSLYGVTPNSRDIYHYDKHHLVPFGEFIPWGFRWFVDLMKMPL
FT                   GDFARGAPVQKPFLVRNQPVMADICYEDIFGEEIAATIRDNPQPPGVLVNVTNLAWFGD
FT                   TIALDQHLQIARMRALETGRPMLRATNTGMTAAIDARGRVLGQLKPFTIGSLDVRIEGT
FT                   SGFTPYVTSGNVTVLVVSLVLLAFGFTFGPGLRRRK"
FT   gene            complement(658806..659693)
FT                   /locus_tag="Bmul_0601"
FT   CDS_pept        complement(658806..659693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0601"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: bch:Bcen2424_2698 CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14296"
FT                   /protein_id="ABX14296.1"
FT                   /translation="MNDSYPSRKPTDKPQEKRSLLERLTDFISPEPESRGELLEILQDA
FT                   HERNLIDADSLSMIEGVFQVSDLCARDIMVPRAQMDAINIADKPEDFIPFVLEKAHSRY
FT                   PVYEENRDNVIGVLLAKDLLRFYAEEEFDVRGMLRPAVFIPESKRLNVLLHDFRVNRNH
FT                   LAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDEEAGNIISGPDGRYRVRALTEIEQ
FT                   FNEVFGTDFSDEEVDTIGGLITHHFGRVPHRGEKLQLGNLVFEIQRGDARQIHVLLVRR
FT                   NPLASRRAETSHED"
FT   gene            complement(660297..660929)
FT                   /locus_tag="Bmul_0602"
FT   CDS_pept        complement(660297..660929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0602"
FT                   /product="ChaC family protein"
FT                   /note="PFAM: ChaC family protein; AIG2 family protein;
FT                   KEGG: bch:Bcen2424_2696 ChaC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14297"
FT                   /protein_id="ABX14297.1"
FT                   /translation="MQNAATLPPAYPPSIGEGRLLTEEELAASLAHTMRDWDGRQDLWL
FT                   FGYGSLIWNPGLPTVAAVRAKVHGYHRGLYLWSRVNRGTPERPGLVLALDRGGSCAGIA
FT                   FRLAGATAQPHLETLWKREMPMGSYRPAWLPCSLETGERVTALAFVMRRDAPTYTGKLS
FT                   DAVVKEVFGCAAGRYGTTLDYVSRTVEALRASGIPDRALESLLARCR"
FT   gene            complement(660942..661655)
FT                   /locus_tag="Bmul_0603"
FT   CDS_pept        complement(660942..661655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0603"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   bur:Bcep18194_A6023 protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14298"
FT                   /protein_id="ABX14298.1"
FT                   /translation="MSLFDAKGKARTVKAQGLRIDFPDGRSLMFDLSGSSGDAAVAIVA
FT                   QHNDPAMRAKLALQPEHYDSLTLHVGAEPAPRDEDDDGEQREQELDLSVQYGDEITSEV
FT                   RKTLPKRKLIAEWLEPALFANAQITVRFVGETEGRTLNAGYRHKDYPTNVLTFAYDPAP
FT                   DGTVIGDLVLCCPVVEKEAREQDKPLAAHYAHLLVHGALHAQGYDHETSDEDAAEMEAL
FT                   EVDILAKLGFPNPYR"
FT   gene            complement(661874..662920)
FT                   /locus_tag="Bmul_0604"
FT   CDS_pept        complement(661874..662920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0604"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: bam:Bamb_2747 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14299"
FT                   /protein_id="ABX14299.1"
FT                   /translation="MKPAQALEFTAPRDDNARLANLCGPLDENLRQIEQALDVTLARRG
FT                   HRIAIRGRGAKLALAALENFYNRARDPLSVDDIQLALVEVRHTSGNGRQDTLDVRFRGD
FT                   PDHPFDEPTVQLDDDEALEEPAPKLYTRRADLRGRTPAQREYLKQILSHDVTFGIGPAG
FT                   TGKTYLAVACAVDALERDQVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALY
FT                   DLLGFDKTAKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGS
FT                   KAVVTGDTSQVDLPRGHKSGLVEAQQVLGGVRGIALTRFTSADVVRHPLVARIVEAYDD
FT                   FHAQHKDA"
FT   gene            complement(662990..664363)
FT                   /locus_tag="Bmul_0605"
FT   CDS_pept        complement(662990..664363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0605"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bur:Bcep18194_A6021 tRNA-i(6)A37 modification
FT                   enzyme MiaB; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14300"
FT                   /db_xref="GOA:A9AFF8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFF8"
FT                   /protein_id="ABX14300.1"
FT                   /translation="MTKKVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDSPEDADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRELKEAKPDLLIGVGGCVASQEGASIVSRAPYVDLVFG
FT                   PQTLHRLPQMIDARRTSGRAQVDITFPEIEKFDHLPPARVEGPTAFVSIMEGCSKYCSY
FT                   CVVPYTRGDEVSRPLDDVLTEVAGLADQGVREVTLLGQNVNAYRGALTAGSSEVADFAT
FT                   LIEYVADIPGIERIRYTTSHPKEFTQRLIDTYAKVPKLVNHLHLPVQHGSDRILMAMKR
FT                   GYTVLEYKSVIRKLRAIRPDLSLSTDLIVGFPGETEEDFDKMMALVHDMRYDTSFSFIY
FT                   SPRPGTPAANLHDDTPRDVKLKRLQLVQATIEENVARISQSMVGKVERILVEGPSRKDP
FT                   NELAGRTENNRVVNFPAPLAAHPRLIGQMIDVKINHAYPHSLRGELVLVSDDASAATH"
FT   gene            complement(664587..665519)
FT                   /locus_tag="Bmul_0606"
FT   CDS_pept        complement(664587..665519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0606"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_2745 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14301"
FT                   /protein_id="ABX14301.1"
FT                   /translation="MDRLGDIRLFVEAAELGSLSAAGRKLNLTPAAASARLAKLEAKIA
FT                   TRLFERSTRQLRLTDEGRLYLNCCRQALQALDDADAMLQEGRNVVGGKVRLSSTSDFGR
FT                   NQLLDWLDEFTARHPDVTFSLTASDSSSNLWQDEIDLAIRFAAPPDGALIARRLAANRR
FT                   VLCAAPSFIERYGTPVDPNDLARFPCNVITIASGPMNTWRFTRGDEVQTYTVPMSNAFE
FT                   TNDGGLTREWTLRGHGIALKSLWDIADDVRAGRLRVLLPEWRHQDAPLHAIYHSKRYMA
FT                   PRVRVLLDFLAERFAREEAALEDLLNACR"
FT   gene            665662..666837
FT                   /locus_tag="Bmul_0607"
FT   CDS_pept        665662..666837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0607"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_2691 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14302"
FT                   /protein_id="ABX14302.1"
FT                   /translation="MPIPLLALAISAFAIGTTEFIIMGLLPEVAHDLAVSLPSAGLLVT
FT                   GYALGVAVGAPLLAVLTSRMPRKAALQLLMAIFIVGNVLCATASGYAMLMVARVVTSFA
FT                   HGSFFGIGAVVAASLVPADKRASAIALMFTGLTLSNVLGVPFGTFVGQLLGWRASFWIV
FT                   AALGVLSLAGIAALVPNRHDSGPVGLGHEVRVLKEPQVWLALLMTVLGFGGVFVVFTYI
FT                   APILESVSGYSPRAVALILVLFGAGLTVGNTLGGRLADRALMPSLIAILVALMAVMAVF
FT                   AKTSHLPVAAAVTVFVWGIAAFATVPPLQARVVEKAASAPHLASTLNIGAFNVGNAGGA
FT                   WLGGLALDHGLALDALPWVAVAVTFSALVVTWLAMRLDARGPARDCAATAQ"
FT   sig_peptide     665662..665754
FT                   /locus_tag="Bmul_0607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.282 at
FT                   residue 31"
FT   gene            667108..667791
FT                   /locus_tag="Bmul_0608"
FT   CDS_pept        667108..667791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0608"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: bch:Bcen2424_2690
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14303"
FT                   /protein_id="ABX14303.1"
FT                   /translation="MSSPLALVRDVSSFESGAAADAQTSASFDALERIVGVNLARLRAE
FT                   RQLSLDALARLSGVSRAMLAQIESARSVPSIKVLCKVAAALKVSVAAFLRRHAVNGFEH
FT                   LPAERASRVVSSNGRFSARALYPEGEPVAAEFHELRIAPLHTEPGVRRAPGTTVNLVVS
FT                   EGTLEVVVHDRRQLLATGDAIVFDADQPYSLRNPGDSDARAFRVTVSPEVPPRWLVPDT
FT                   AHAAV"
FT   misc_binding    667957..668105
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 101.14"
FT   gene            668224..668934
FT                   /locus_tag="Bmul_0609"
FT   CDS_pept        668224..668934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0609"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: bam:Bamb_2742 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14304"
FT                   /protein_id="ABX14304.1"
FT                   /translation="MSLMSLSSAPADAFADLPLLDAEPVPPRIAAALDALRAGRAVVLQ
FT                   DDHDRENEADLIVAAERITPETMALLIRECSGIVCLCLTDDKVRALELPPMVQTNESRN
FT                   GTAFTVSIEAREGVHTGVSAADRVTTIRAAIADDAKPHDIVRPGHVFPLRAQPGGVLAR
FT                   RGHTEGTVDLAILAGLKPAGVLCELMNPDGTMTRGDDVERFARQHGLPMLTIAELVEFR
FT                   SALAAARERCCEPA"
FT   gene            complement(669032..669814)
FT                   /locus_tag="Bmul_0610"
FT   CDS_pept        complement(669032..669814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0610"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bch:Bcen2424_2687 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14305"
FT                   /protein_id="ABX14305.1"
FT                   /translation="MCSAGNRSRRVGESTYHVRDDRRRRLPRFFTIMLDHLICDCDGVL
FT                   VDSEVIADRVLLDTLSATFPHLDFEAAAKTAFGQQTSRFLAGLEARFAIRMPENFLETI
FT                   EHNIEVSLAQSLAPIAGVRDALLKVTLPAAVVSNSRLARVRNSLKRASLTEIFGDRVFS
FT                   SEQVARPKPYPDVYLYAAQTLGVAPERCIVVEDSVSGLNAARAAGMKTIAFVGASHIPD
FT                   NYADVLRGMGMTRIMRDMRELPALVEAGMRGEFGDVQS"
FT   gene            complement(669816..670802)
FT                   /locus_tag="Bmul_0611"
FT   CDS_pept        complement(669816..670802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0611"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bch:Bcen2424_2686 inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14306"
FT                   /protein_id="ABX14306.1"
FT                   /translation="MIEFALFGAGRIGKIHAANLARHPGAMLKYVVDRHAPSADALARA
FT                   HGAQVADVERALGDASVGAVVIASSTDTHADMIVAAAHAGKAVFCEKPVDLGVERAREC
FT                   AHRVRQSGITCMIGFQRRFDPTFAALKARVERGEIGDPEMLIVTSRDPGAPPADYIRSS
FT                   GGIFKDMLIHDFDVFRWMLGDEAQTLHATGSCLTDPAVRDAGDIDSTAVTIRTRRGLLC
FT                   QINTSRRAAYGYDQRFELLGSRGMLQAGNVRPTEVSAWSAQGIATDVPEPFFLERYRHA
FT                   YAAELAHFVDALRDGTPVRTTIDDGLAALELAEAATTSWRTGRAIDL"
FT   gene            complement(670854..671681)
FT                   /locus_tag="Bmul_0612"
FT   CDS_pept        complement(670854..671681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0612"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bch:Bcen2424_2685 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14307"
FT                   /protein_id="ABX14307.1"
FT                   /translation="MTQAFHFSLNRICAPHIPFDRYVALCRQLGIDAIEIRNDLDGAEL
FT                   ADGTPAAAIRATAEAAGVTILTINALQRFDRWDAARADEATLLADYAAQCGARALVLCP
FT                   TNSRDDARDAETRHADLVNALRALKPILEARGLLGFIEPLGFEECALRRKSDAVKAIYA
FT                   AAGEAVFRLVHDTFHHHLAGEAIFFPNLTGLVHLSGVEDDDLPVERMRDGHRVLVGGAD
FT                   RLGNVRQVRELLARDYRGALSFEPFAAEIAQADDIDARLRASIDYVQGELERR"
FT   gene            complement(671678..672895)
FT                   /locus_tag="Bmul_0613"
FT   CDS_pept        complement(671678..672895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14308"
FT                   /protein_id="ABX14308.1"
FT                   /translation="MPRAEKSTAALAIFRQRSSCNARRAAVQLAAIQFNTVRHRLNDGR
FT                   QTMADTILIGVNLDGVLEHDGLPPPTPAERFRMIADARVFDYVEKNPVRGEDLTPYFAL
FT                   VERHGLPIRVIGGIWRAGRDDAHVAEIVDAGARFGSTVLNCQLHAHHADGHPLSDREVA
FT                   DFYLRTYERGERVGCLPCLEVHVDMWSERFMRIARVARHVEQAGVPFRLTLDHSHLLFK
FT                   IGNRAELDASGLHGTAERMRERLDPASPSAVYTEWIARGWVRHAHARSVIPNNPDNRSM
FT                   RRPDGRPGRGIQYPFVAPAPGTYHDAWHADALDTWKAALRALLQSQVHARPAQVEQISC
FT                   EFIPFPDYGGGARYSIFDNNVACAQWLRDTWHALAATPADTHGDAAAHDVIRFAHDSVR
FT                   HQRTAR"
FT   gene            complement(672917..673978)
FT                   /locus_tag="Bmul_0614"
FT   CDS_pept        complement(672917..673978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0614"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; KEGG: bam:Bamb_2736
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14309"
FT                   /protein_id="ABX14309.1"
FT                   /translation="MADPSGPRWRKRTARFDEIAALAGVSTTTVDRVLNERGSVSARAR
FT                   ERVVAAARQLGVPRQLPDTRHGLVHVDVLLPDTDAPFFHRLQQALQRSLQMLDRRVVVH
FT                   RTIVAAADDARAAALIERPAYRRAALIVTAHDTPRVRDALTAAIARGEHVVTMVTDIGG
FT                   IARVHYAGIDNYRAGRTAGYYIGRLAARPGRVLLLGGRMAYRAHAQRMAGCMDQLGEAF
FT                   GALRCDAPIETLDDDDRCYRAVTNALRAGDEVAAIYNSGAGSAGIEAALRNAGAAGRVV
FT                   WIGHEMLDQHRAYIEAGSMDIAIDQDPDGQAISALQHVLHACGIVEQRPPGDPVEFRVF
FT                   CAANVRTSAYLQA"
FT   gene            674101..675237
FT                   /locus_tag="Bmul_0615"
FT   CDS_pept        674101..675237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0615"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bch:Bcen2424_2682
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14310"
FT                   /protein_id="ABX14310.1"
FT                   /translation="MPVRKVRMPANENRETRVTHTDDDLHRRPAAARRHAYRMIGGAGE
FT                   RARAAGLVNAEWYRCAVPRPLMKQLMQRSDARAIRDTLIWYASIVASGVLAWFAWRAHS
FT                   AWAIPAFFLYGTLYCSPADSRWHECGHGTAFRTRWMNDVLYQVASFQVFRRATVWRWSH
FT                   ARHHTDTLVVGRDPEIAAPKPTDWLALTLNVLALKHVASELRKMIAAAFTGRLDAEEQT
FT                   YVPESEWPKVVREARIHLAIHALAIGAALYARTILPLLYVGLPSLYGAWLYLYFGLTQH
FT                   AGMPENVLDHRRNCRTVMMNPVFRFLYWNMNYHVEHHMFPMVPFHALPKLHDAVKADMP
FT                   PPYPSTLAAYAEIVPALIRQTRDPSHHVVRPVPDAARA"
FT   gene            675273..675581
FT                   /locus_tag="Bmul_0616"
FT   CDS_pept        675273..675581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0616"
FT                   /product="Rieske (2Fe-2S) domain protein, MocE subfamily"
FT                   /note="TIGRFAM: Rieske [2Fe-2S] domain protein, MocE
FT                   subfamily; PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bam:Bamb_2734 Rieske (2Fe-2S) domain protein, MocE
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14311"
FT                   /protein_id="ABX14311.1"
FT                   /translation="MTQWIDAVGFDDIDDEDVVRFDHDGRTYAIYRIDGHVYASDGMCT
FT                   HERVHLADGLVIDHVIECPKHNGRFDVRDGRALSAPACERLRTYRARIEDGRVLIEV"
FT   gene            675586..676821
FT                   /locus_tag="Bmul_0617"
FT   CDS_pept        675586..676821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0617"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_A6008 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14312"
FT                   /protein_id="ABX14312.1"
FT                   /translation="MTNDRVMAIVGAGHAGGRAAQVLREYGWRGRIVLIGAEPHLPYER
FT                   PPLSKGVLTGERSAAQCALRDRDAWRADAIEPIVATVERIDPAAREIRVSDGRAFAYDA
FT                   LLLATGGRARRLAIPGADLDGVLALRTLDDAAALGARLVRDARIVLIGGGFIGLEVAAS
FT                   ARRRGCRVTVLDAASRVLGRAVPDTIAARVHALHVRHGVAIRLNRAPVAIERTAGGALA
FT                   VVLDDGDTLIADTVVVGIGIEPADELARDAGLAVDRGIVVDERLETSARGIYAAGDVAV
FT                   FPGGSSARRVRQETWHGAETQARVAARNMLGADEPYRDVRWFWSDQYDAQLQVVGEPAL
FT                   GERTVARVLDDDAEIRFHFDAQARLVAASGFGCAPTWVKEMRVARMLVERAADVTPADV
FT                   ADTGVKLKSLLR"
FT   gene            complement(676931..677647)
FT                   /locus_tag="Bmul_0618"
FT   CDS_pept        complement(676931..677647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0618"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: bur:Bcep18194_A6007 aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14313"
FT                   /protein_id="ABX14313.1"
FT                   /translation="MSPYIAEFIGTAILVLLGNGAVANVLLAKTKGKGADLIVIVMGWA
FT                   MAVFVAVYVTASFSGAHLNPIVTISLALAGKFPWAKVGGYVLAQMLGGMAGALLVWLAY
FT                   RQHFAKEADADLKLAVFCTAPAIRSVTHNVLTEAICTFVLILGVLYLASPQVGLGALDA
FT                   LPVGLLVLGIGISLGGPTGYAMSPARDLSPRIMHALLPIPGKRDSDWRYAWVPVIGPLL
FT                   GGAAAAALYLHLHTTV"
FT   gene            complement(677729..679231)
FT                   /locus_tag="Bmul_0619"
FT   CDS_pept        complement(677729..679231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0619"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bvi:Bcep1808_2790 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14314"
FT                   /db_xref="GOA:A9AFH2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFH2"
FT                   /protein_id="ABX14314.1"
FT                   /translation="MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWV
FT                   EHDPQEIWSTQAGVAAEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQ
FT                   DRRTADFCDSLKKQGLEAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFG
FT                   TVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTRQWDDELLELLDIPRSMLPEVKASSE
FT                   IYGHTKTTVFASKIPLAGIAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIES
FT                   KNNLVTTIAWQIGDDVQYALEGSIFIAGAVVQWLRDGLGIIKTAAEIEALAASVPHSDG
FT                   VYLVPAFAGLGAPHWNARARGSLFGVTRGTRDAHLARAALDAIAYQSLDVLAAMEADSG
FT                   LSIGELRVDGGASANNLLMQFQADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDE
FT                   VRSQWQLDRRFAPSMPKQQVERCMAGWQRAVRAAKAWADDAQ"
FT   gene            complement(679330..680853)
FT                   /locus_tag="Bmul_0620"
FT   CDS_pept        complement(679330..680853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0620"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bam:Bamb_2730 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14315"
FT                   /protein_id="ABX14315.1"
FT                   /translation="MNQPNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTS
FT                   SASTKLIHGGLRYLEYKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLI
FT                   RIGLFLYDHLAKRELLPGSRGIDMRRHAAGAPLVDSIRRGFVYSDGWVDDARLVVLNAL
FT                   DAKERGAEILTRTKLVSAERRSDEWEARLQQPDGAIRVVRARAIANAAGPWVGDVLHGA
FT                   LGRGAHHSVRLVKGSHIVTRRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYT
FT                   SDPARVAIDRDETQYLCDSINRYFKRKISPADVHWTYSGVRPLLEDENAANASAVTRDY
FT                   RLEMDDGEGAPLLSVFGGKITTFRKLAEEAGDMLCRALGRDAPAWTAGAPLPGGDIANA
FT                   KFDAFADAFAKRHRWLPAPLARRYARAYGTRAARVVGNAQSLADLGAEIVPGLFEAELR
FT                   YLRDTEWATSAQDVLWRRSKLGLHVAPGTLDAASAALDAWFAAAHAPHA"
FT   gene            681016..681384
FT                   /locus_tag="Bmul_0621"
FT   CDS_pept        681016..681384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14316"
FT                   /protein_id="ABX14316.1"
FT                   /translation="MRIGMGIGACAVVLAACSVGTPPLAGNWRAPSFVDLQTACGGTAR
FT                   DWGADAQPVYSALYDAYVAKRYRGLSQVNYCAFVNELSAHYAAPDAPGRAGWIAYLNGA
FT                   RAQAVSWRAAVDPTLRGG"
FT   sig_peptide     681016..681093
FT                   /locus_tag="Bmul_0621"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.760 at
FT                   residue 26"
FT   gene            complement(681475..681672)
FT                   /locus_tag="Bmul_0622"
FT   CDS_pept        complement(681475..681672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14317"
FT                   /protein_id="ABX14317.1"
FT                   /translation="MLSPHEFATLLLVKDAPDQTSMDREELDALLEQQLVRLEGLGSGR
FT                   KYCVTETGDATLRSIKYRYS"
FT   gene            complement(681974..682858)
FT                   /locus_tag="Bmul_0623"
FT   CDS_pept        complement(681974..682858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0623"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bch:Bcen2424_2674 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14318"
FT                   /protein_id="ABX14318.1"
FT                   /translation="MNPCAFRMNRVYPRAGGATDTLTISASFSRPRPSNMSRDPRLTLN
FT                   ARQQELLEWVQRDGFVTVDDLAAHFAVTPQTIRRDVNWLADLNLLRRYHGGASLPTSSE
FT                   NVSYTARQRMFHDEKRRIAALAASHIPDQASLFINLGTTTEEVARALNRHHGLRVITNN
FT                   LNVASMMSGYPDCEVLITGGIVRPWDKGIVGELAIDFIRQFKVDYAIIGTSAIEADGTL
FT                   RDFDTREVRVAEAIIEHARTVYLVADHSKIGRPALVRQGHLSQVHALFTDKPLPADMAD
FT                   TIAAAGTQVYVAE"
FT   gene            682956..684596
FT                   /locus_tag="Bmul_0624"
FT   CDS_pept        682956..684596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0624"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bam:Bamb_2726 gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14319"
FT                   /protein_id="ABX14319.1"
FT                   /translation="MTDFNWHNPYPTPRIPVFARNVVSTSHPLAAQAGLRMLWKGGNAV
FT                   DAALAAAAAITVVEPVSCGLGGDAFALVWDGGKLHGLNASGVAPAAWSVDYFRRRHGED
FT                   AHGIARKPTRGWDTVTVPGVIAGWEALHAKFGSLPFADLLEPAIDIAERGYSVSPIVAH
FT                   KWAAAVPELQRLPGFAETFMPRGRAPLVGERMCLPGHAKTLRTLANEGARAFYEGALAA
FT                   QLVAFAREGGGALSAEDLRAYRPEWVEPIGKRFGRHTIHEIPPNGQGIAALIALGIAEH
FT                   AGVTDWPVDSADSQHLQIEAMKLAFADVYRYVADPRAMEVTPEQMLDDAYLAARAKQID
FT                   RTRATQFEAGRPHSGGTIYLSAADERGMMVSFIQSNYMGFGSGLVVPGAGIALQNRGHG
FT                   FSMDPASPNVVAGGKRPFHTIIPAFVTEEAGGRTEAVMSFGVMGGDMQPQGHLQTIVRM
FT                   LGYGQQPQAACCAPRWKVNRDFTLDVEATMDRATVEALAARGHTIKSIDDPYMDFGSGQ
FT                   FVWRLDPDDPDRGYVAASDSRRDGLAAGF"
FT   gene            684887..685714
FT                   /locus_tag="Bmul_0625"
FT   CDS_pept        684887..685714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14320"
FT                   /protein_id="ABX14320.1"
FT                   /translation="MHTETTHVMPWRIEDIDLNRIDRQRAAANEDLLLLLCAASFIESG
FT                   SDLYTSNLSEFFNDDPEVSAWLNNAWEHEELQHGRALKAYIAHVWPEFDWDTAFANFFD
FT                   EYSKTCSVEAFEKTRALEMVARCVVETGTATLYRAINECSDEPVLKEITDNIRTDEVRH
FT                   YKHFFKFFKKYNQLEGNGRLAVLGALMRRVMEIKNEDSEIALRHVFAVRYPDRVGDSEY
FT                   SRARVARINSLVRRNLSADMCVKMLLKPLDLPAKIQPGVHYPLTKITQHVFFR"
FT   gene            685740..686288
FT                   /locus_tag="Bmul_0626"
FT   CDS_pept        685740..686288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14321"
FT                   /protein_id="ABX14321.1"
FT                   /translation="MLRFRRLPPAGFATMTESHRHALEQWTFDAWPPAVVSLFDGTALE
FT                   RHADFAASLLVATDDGQLRTTLLSVGEIYARDPRTLLLALWPQSRAARALAQRRAAALT
FT                   LVADGAFYQAQLDVTPLEGTFGGLAGFAATIAHGDAQRVGYARLATGVTFALEGERTAV
FT                   LARWQRQVEHLRRAAARLQ"
FT   gene            complement(686282..687724)
FT                   /locus_tag="Bmul_0627"
FT   CDS_pept        complement(686282..687724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0627"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   bvi:Bcep1808_2782 DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14322"
FT                   /protein_id="ABX14322.1"
FT                   /translation="MSFESLGLAEPLVKAVNELGYTSPTPIQQQAIPAVLGGGDLLAGA
FT                   QTGTGKTAGFTLPILQRLHTFYTEHRSAKRAVRALILTPTRELAAQVEESVRAYSKYLK
FT                   LRSTVMFGGVSINPQIDALKRGVDIVVATPGRLLDHMQQKTIDLSDLDILVLDEADRML
FT                   DMGFIHDIKRVLAKLPPRRQNLLFSATFSDEIKALADSLLDSPALIEVARRNTTAETVA
FT                   QKIHPVDRDRKRELLTHLIREHNWFQVLVFTRTKHGANRLAEQLTKDGISAMAIHGNKS
FT                   QSARTRALAEFKNNTLQVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGRTGRA
FT                   GATGEAVSLVCVDEKQLLRDIERLIKREIPREVIAGFEPDPNAKPEPIQQRRGQQPRGG
FT                   GGNGGGGGGNRAPRAGGAAQQPGAKRDGQAPKPKAAAKPRPQGGGNGNGARPSGGNGAR
FT                   AANGNAAHPNRNRSSRSGQRGH"
FT   gene            complement(687856..689154)
FT                   /locus_tag="Bmul_0628"
FT   CDS_pept        complement(687856..689154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0628"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bvi:Bcep1808_2781
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14323"
FT                   /protein_id="ABX14323.1"
FT                   /translation="MKRKSLFALSAVAIVAAAALVPVLWSGNDTLHGASAVAATPADQA
FT                   ALIKKGEYLARVGDCIACHTVRGGKPFAGGLPMATPFGTMYTPNITPDDQNGIGKWTSD
FT                   DFYRAMHTGRSKDGSLLYPGFPFASYTKVTRADSDAIYAYLRSVAPVSVPSRPHELKFP
FT                   FNNRNLLIGWRTLFFKEGEYKPDPTKSVEWNRGAYLVEGLGHCSMCHTSINMMGGPVNS
FT                   AAFAGGLIPLQNWYAPSLTNDKELGLGDWHVQELSDLLQAGVSNKGAVFGPMADVVHNS
FT                   LQYMTDEDTRAMSTYLKSIPQKAEAPKNMQYEPSKQFGNALFEQGKKIYADNCATCHAE
FT                   NGAGKPPAYPPLAGNHSIVMESAVNPIRMVLNGGYPPSTFKNPRPYGMPPFAQSLSNQE
FT                   VAAVVTYIRMSWGNNGTPISPQQVSDLRSAPLD"
FT   sig_peptide     complement(689074..689154)
FT                   /locus_tag="Bmul_0628"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.382 at
FT                   residue 27"
FT   gene            complement(689174..689884)
FT                   /locus_tag="Bmul_0629"
FT   CDS_pept        complement(689174..689884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0629"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: bvi:Bcep1808_2780 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14324"
FT                   /protein_id="ABX14324.1"
FT                   /translation="MIGGAGLTSAAQAQTKPTEQAHAQQAPLKAPDTMAERVRGCTACH
FT                   GVHGQGTDNDYFPRLAGKPAEYLYNQLVNFRDGRRKYPPMNYLLTYLSDDYLREIAEHF
FT                   SAERPPYPTPAKPTLPAATLARGKQLVTQGDPSRKLPACVACHGAALTGMQPAIPGLVG
FT                   LHADYLSAQLGAWRSGNRHAKAPDCMHDIASKLSDEDVTAVTAWLAAQPAPANPVPAPA
FT                   RSMKTPLACGSEPQ"
FT   gene            690326..691258
FT                   /locus_tag="Bmul_0630"
FT   CDS_pept        690326..691258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0630"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bur:Bcep18194_A5995 copper resistance D"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14325"
FT                   /protein_id="ABX14325.1"
FT                   /translation="MRIDSLWIGQVALAALMDAAFAMAVGSALLKGWLGRDGARPVVAP
FT                   SHPAWVRAQHSLVAAALALVLADLGWLVYEAASMSGAGLGGAFAAMPTVLAQTHAGFAW
FT                   SVAFGGAVVLAIVALLKPDGTVAHALLWLAVIVIAAGKASLGHAADVGALSAAVGVQTV
FT                   HLLATAVWGGVVLAGGLAVLPMLGSSVARGALIRIGQQMSRTSVIAVVFVLGTGVLNAL
FT                   RGLGGSLAPLDGSTWGRVLLLKLLLVALALVLGGLNRFSALPRLRRTASTEDAHTFRNI
FT                   LHLEALTMIGVFVAAAVLSFSVPGFAALG"
FT   sig_peptide     690326..690400
FT                   /locus_tag="Bmul_0630"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.762 at
FT                   residue 25"
FT   gene            complement(691375..692523)
FT                   /locus_tag="Bmul_0631"
FT   CDS_pept        complement(691375..692523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0631"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bch:Bcen2424_2666 mandelate
FT                   racemase/muconate lactonizing enzyme, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14326"
FT                   /protein_id="ABX14326.1"
FT                   /translation="MKITRLETFIVPPRWLFLKIETDEGIVGWGEPVVEGRAHTVEAAV
FT                   HELADYLVGKDPRLIEDHWQVMYRAGFYRGGPIMMSAIAGVDQALWDIKGKHHGVPVHA
FT                   LLGGQVRERIKVYSWIGGDRPSDVANNARAVVERGFKAVKMNGSEELQIVDTYDKVEQV
FT                   IANVAAVRDAVGPHVGIGVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENAEALRD
FT                   IVNQTNTPIALGERLYSRWDFKHILAGGYVDIIQPDASHAGGITECRKIATLAESYDVA
FT                   LALHCPLGPIALAACLQLDAVSYNAFIQEQSLGIHYNQGNDLLDYLRNPEVFRYDDGFV
FT                   AIPQGPGLGIDVNEEKVREMAKTGHRWRNPVWRHADGSVAEW"
FT   gene            692684..693352
FT                   /locus_tag="Bmul_0632"
FT   CDS_pept        692684..693352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0632"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bam:Bamb_2718 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14327"
FT                   /protein_id="ABX14327.1"
FT                   /translation="MHGQTAFRLATAILRGDYPPDSLLPREPDLMAMFGVSRTVLREAL
FT                   RTLTSKGLVESRPKVGTRVRPRRAWNLLDADLLDWYARVAPALSFALKLQEMREMIEPH
FT                   AAAMAARVRAADAIAAIDEALGAMAAARNVDEWVRADLRFHLGVLEAGGNELLVPLGAL
FT                   IDRTLEAQLHLNARRAHVYNASLAEHAAVGDAIRAGDADGARRAMAALLAVTRARIEQS
FT                   "
FT   gene            complement(693397..693642)
FT                   /locus_tag="Bmul_0633"
FT   CDS_pept        complement(693397..693642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0633"
FT                   /product="protein of unknown function DUF1272"
FT                   /note="PFAM: protein of unknown function DUF1272; KEGG:
FT                   bur:Bcep18194_A5992 protein of unknown function DUF1272"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14328"
FT                   /protein_id="ABX14328.1"
FT                   /translation="MLELRPGCECCDKDLPPDSADARICTFECTFCATCADTVLKGRCP
FT                   NCGGELVARPRRPAALLEKYPASTQRVLKQGGCANA"
FT   gene            complement(693751..695136)
FT                   /locus_tag="Bmul_0634"
FT   CDS_pept        complement(693751..695136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0634"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bja:bll5462
FT                   hypothetical metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14329"
FT                   /protein_id="ABX14329.1"
FT                   /translation="MTARAAREPQPGHQPKKAAASGWIGSALEYYDFFIYATAAALIFP
FT                   QIFFPKGDPTTAIVASLATYGVGYVARPIGAFVLGHLGDTHGRKTVLLSCMFLMGFATI
FT                   GVGLLPTYDQIGLLAPVLLVILRLIQGFAVAGEISGASSMILEHAPFGRRGFFSSFTLQ
FT                   GVQAGQVLAAAVFLPLAHYMPTEQFNSWGWRIPFLLSVVVIFAGWVIRRNVTETPAFTG
FT                   EEARQTRARSPVVEAFRFHWADMLRVVCMSLMNVIPVVATIFGAAYAVQPAYGIGFAKD
FT                   VYLWIPVAGNIVAVLVIPYVGSLSDRIGRKPPIVFGALLSGLLAFAYLYAISIQSVPLA
FT                   FAMSLLMWGVVYQGYNAVFPSFYPELFPTRTRVSAMAIAQNVGTAITAMLPALFTAVAP
FT                   PGATHIWLTVGAIAFGITVIAALAALSARETYRIAMSELGRADARPVDKTEYDRRRAQA
FT                   PVA"
FT   gene            695445..695792
FT                   /locus_tag="Bmul_0635"
FT   CDS_pept        695445..695792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0635"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: bam:Bamb_2716 glutathione-dependent
FT                   formaldehyde-activating, GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14330"
FT                   /protein_id="ABX14330.1"
FT                   /translation="MLYHGSCHCGDVKFDVEGDLQGVMACNCSICRRKGALMWFVPRDR
FT                   MTLVTPDEHLGTYTFNKHVIRHRFCKRCGIHPFGEGVHPNGTAMAAINVRCLDDVDLDA
FT                   LPVTHFDGRSH"
FT   gene            complement(695817..698924)
FT                   /locus_tag="Bmul_0636"
FT   CDS_pept        complement(695817..698924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0636"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; KEGG:
FT                   bch:Bcen2424_2662 glycosyl transferase, family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14331"
FT                   /protein_id="ABX14331.1"
FT                   /translation="MNRPLNRILPRVTGTASVWTWVKWSLLAALLIAVAIIARVVQTEI
FT                   ETSRLQAHYLSELTRDIGYTVEAGASDHIRFPANGPYDRRLGYALIPEFQQRLLARGFV
FT                   VGKQAHDSARMISLAEHGLFLPYAEKDQTGLMLFDSTGSPLFASVSPQRVYADFDTVPR
FT                   VVVDSLLFIEDRYLLDANEPNRNPAIDWGRFSRALADQALHVVNHHQARPGGSTLATQI
FT                   EKFRHSPDGRTSTPPEKLRQIASASIRAYLNGPQTMLARRTIVVRYLNSVPLAARPHIG
FT                   EITGIGDGLAAWYGRDFNDVNRILAAPTTGDNIDERGETFRQVLSLIIAQRAPSYFLNR
FT                   GYPALQRLTDSYLRLLANGGVISPALRDAALAAHIELSAPPAAARVQSFVSRKAITSAR
FT                   ASLLAALGISDLYQLDQLDLEATSTLDNGVQRAVAERLAQASTRDGAQAAGLYGFEMLA
FT                   PKDDPSHLTYSFTLYEHRNGANLLRVQTDSVNQPFDVNRGGRINLGSTAKLRTLITYLQ
FT                   IVADLHARYGHLSNAELARVKPDPIDGLSRWALDYLSHTRDRSLQAMLDAAVERKYSAS
FT                   PDVFYTGGGAQVFSNFEKSDNGRIMTLHTAFEHSVNLVFVRLMRDIVHYEMVQTAGPSS
FT                   SWLGDPEQRKQYLQQFVDGESKVYVKRYYTRYAGKSPDDALALMLQDVRKSPPKIATVL
FT                   RSVAPNESLAWFDAQMRKQLKGTPAASLSDDDLAALYAKYAIDRFNLNDRGYIASVHPL
FT                   ALWTLNYLRAHPDAPLDDVLRDSRDARFYTYSWLYKTRYHATQDRRIRRMVELRAYGAI
FT                   TKAWRALGYPFAEVTPSYAAAIGASGDQPDALAKLIGLIANGGDKAPTETITRLDFAKG
FT                   TPYETRFVRAPAQPQPMLSPEIVNVARTLLRDVVLNGTARRLAGGLTLPDGKTLPVYGK
FT                   TGTGDQRFNVYARGARLIESRKVNRSGTFVFVIGDRFFGVLTATAHEPYAARYDFTSAM
FT                   AVQLLKSMAPALAPLIERPANAGVRTAGPAPQAELPAQNGRATQPS"
FT   sig_peptide     complement(698793..698924)
FT                   /locus_tag="Bmul_0636"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.917 at
FT                   residue 44"
FT   gene            complement(699013..699339)
FT                   /locus_tag="Bmul_0637"
FT   CDS_pept        complement(699013..699339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14332"
FT                   /protein_id="ABX14332.1"
FT                   /translation="MKGTHASPEYDECSPRVRQRSRCAGPRAARPPGARGCNRYLPAGL
FT                   ARRVARVQFVRAARSRHCLSKSLPRTPTSAADPARIPLQRPYIARRRATRRSRGNARCV
FT                   GASP"
FT   gene            complement(699367..699678)
FT                   /locus_tag="Bmul_0638"
FT   CDS_pept        complement(699367..699678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0638"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bur:Bcep18194_A5987 cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14333"
FT                   /protein_id="ABX14333.1"
FT                   /translation="MQIIRSKAFTADRAWGALDIANLDGITVRLHWTDEPYRWHVNDGE
FT                   EVFAVLDGRVEMRYREAGIERTAILEAGDVFHASAGTEHVAHPLGEARILVIEKEGSV"
FT   gene            complement(699758..700441)
FT                   /locus_tag="Bmul_0639"
FT   CDS_pept        complement(699758..700441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0639"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bam:Bamb_2705
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14334"
FT                   /protein_id="ABX14334.1"
FT                   /translation="MTLHIGFLVFPGVQQLDLTGPHDVLASLPDAAVHLVWKSREPVAS
FT                   SSGLALTPTHTFADCPPLDVICIPGGSGINALLLDAETIAFVQQRAADARYVTSVCTGA
FT                   LLLGVAGLLRDRRATTHWRFHTLLERLGAVPVRERVVRDGNLITGGGVTAGIDFALTIA
FT                   AELVGDEEAQAIQLQLEYAPAPPFDAGSPDTAPASVVARVNARTAAGFDNRAQTIDRAL
FT                   AAVAR"
FT   gene            700555..701523
FT                   /locus_tag="Bmul_0640"
FT   CDS_pept        700555..701523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0640"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_A5985 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14335"
FT                   /protein_id="ABX14335.1"
FT                   /translation="MSSPRPILILAFPRAQLLDVSGPLQVFASVNELALERGQPAPYAP
FT                   RIVAADAGPVETSSGVAVVADSLRSTARGIDTLIVAGGKGVHAASRDARLVRWVRRQAD
FT                   RARRVASVCTGAFLLAEAGLLDGRRAVTHWTRCDELAARYPNVRVEADPIFIREGALWT
FT                   SAGVTAGIDLALALVEEDLGRAVALDVARELVVFLKRPGGQAQFSAMLSMQRTDDRFGE
FT                   LHAWIAEHLGADLSVPALAERARMSERSFVRHYRASTGRTPARAVEQIRVEAAQRLLGE
FT                   TGWPVKRIAARCGFGSEETLRRSFVRVLGVSPQEYRERFVR"
FT   gene            701674..702642
FT                   /locus_tag="Bmul_0641"
FT   CDS_pept        701674..702642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0641"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_2703 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14336"
FT                   /protein_id="ABX14336.1"
FT                   /translation="MDRIQAMEVFTRVVDANSFTRAAETLAMPRASVTTIIQNLEALLG
FT                   VRLMHRTTRRLSLTPEGAAYYEHCVKILSEIAEADASFQKGKPTGVLRVHMPSSLGRRL
FT                   VIPSLSLFRQRYPDITLDLGLSDRPVDPVEEGIDCMIRVGPLEDSSMVARRIGMLRRVT
FT                   CAAPDYLARHGEPREIADLAGHYAVNFRATQGGRAVPWVFLIDGKPVEVRMNASVTVND
FT                   SDAYVNCGLEGFGMIQPTLFMVVSNLLDGSLVEVLPDCNPKPKPISIMYPHNRHLSAKV
FT                   RVFADWIAEVFESTPALEGGENWRRNVRAKVEGEAAGSVVA"
FT   gene            complement(702752..703867)
FT                   /locus_tag="Bmul_0642"
FT   CDS_pept        complement(702752..703867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0642"
FT                   /product="GP31"
FT                   /note="KEGG: bpl:BURPS1106A_3672 GP31"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14337"
FT                   /protein_id="ABX14337.1"
FT                   /translation="MTKDELAAWANDPKRRDTLPYGLFEPPYQKGIVGAAFVVRGVLYF
FT                   RNGYTDAKRKALVRCYDRYLDAITKYEVALAKAEGRDEPKSGPMRWFYAEGEAPVAFDK
FT                   SPGFPDLAKRLPSNAALVSTTTSADHKLATGFYDFSVFCLEDWEAKFGRSLDVMSFTVP
FT                   RSFLQLAPGAFERLFAEFADGLRPVHGHGGYAVNLPPMGRDPNEASEYFWARQYGAGLD
FT                   VGSPRRTCVRDLTDKLKTVDWLTAIDSDLVRAVGGADALMLPPDWYRKTPFGDGGLIIQ
FT                   AGTEPQTGVAMGAGQPPALPAAYVLLNKALHAIVADTIDSLQDGTVSSTAPLLSTTVAS
FT                   EAWLRRFNVPDDELPGYWIELHKTAKLPAVQ"
FT   gene            complement(703873..704640)
FT                   /locus_tag="Bmul_0643"
FT   CDS_pept        complement(703873..704640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0643"
FT                   /product="VRR-NUC domain protein"
FT                   /note="PFAM: VRR-NUC domain protein; KEGG: bps:BPSS1058
FT                   bacteriophage GP30 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14338"
FT                   /protein_id="ABX14338.1"
FT                   /translation="MTDYSSSSAAGASKGDGNTTVVGLDGRLSGKDKEVLCGVMCPCAR
FT                   IGVATREDKRGRSRTLRQACVAQRLDAMNADARRKYGAPTEYLPEVSYDMSPTPPAPPV
FT                   PIMDEASPLRPDSLVDWIRDNWPGSMKGYRDGKKAGLDQTRRPDVVIVRDPALPPEQSN
FT                   IKTVVEMKFEDSYGDRQKEAYVRIAGSNKKVATLRPADCGCRDDEPDEKPVQSTQTQSE
FT                   IESIFGVGPAGPNRMLPAPIPHLPPGVPGFALP"
FT   gene            complement(704637..705158)
FT                   /locus_tag="Bmul_0644"
FT   CDS_pept        complement(704637..705158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0644"
FT                   /product="bacteriophage GP29 protein"
FT                   /note="KEGG: bps:BPSS1057 bacteriophage GP29 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14339"
FT                   /protein_id="ABX14339.1"
FT                   /translation="MGFAFIREGDTTSHGGRVLACDSTNTVDGKPLALLGDMVSCPRCG
FT                   GVYPIVKVKAELHMTFNGRPVASDGDTTACGATLIASQGAATASPTSGAGAPLGDCKSV
FT                   LAQNNGPNRGRFKVVDDNTRLPIANHPYTITSADGRTVHGTTDADGYTDWLNTQQAASL
FT                   SFRQPGTSAA"
FT   gene            complement(706716..707813)
FT                   /locus_tag="Bmul_0645"
FT   CDS_pept        complement(706716..707813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0645"
FT                   /product="plasmid recombination protein"
FT                   /note="PFAM: plasmid recombination protein; KEGG:
FT                   bvi:Bcep1808_2768 plasmid recombination enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14340"
FT                   /protein_id="ABX14340.1"
FT                   /translation="MPNYNILRAKKVKTRSQITQAAEHNFRLRHQRNIDKNRTHLNRTL
FT                   VNTLNIDTNNASSLQEGVTAYYKNLGVKEKEGNVLMMEFVISASPDFFKNKSKKQIDEW
FT                   ASHQVGFMRKEFGEQLKIAILHMDEKTPHFHFMVSTEVKSFKKYKNQKGEFHKETWSLN
FT                   AKRYDPNFLRGLHDRHAEWNKNFGLVRGVRGSLRKHHDPKEFYKMIDEALSTKFDKTIE
FT                   KTISDMETGWFSGKVSIAEIREKFKPMMNTLLKSNEVLRKKFLFDIKQWAENLYKQKKE
FT                   QEAKKLELEKQEKDLTARRELYAEALNSKNNDVSLLSSLMDRNEVLQQEIERLKAKNEV
FT                   LDAQATPMPTSGSTNSLKSPKTLKK"
FT   gene            complement(708088..709458)
FT                   /locus_tag="Bmul_0646"
FT   CDS_pept        complement(708088..709458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0646"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bvi:Bcep1808_2767 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14341"
FT                   /protein_id="ABX14341.1"
FT                   /translation="MNKLPRLYQSRHGVYYLRIIRNKKKYRWSLGTKDFHRARIHALDL
FT                   NMKLAMNDFDLSKIKKLDVEVAPNGAVSFRDVKPADVDIVSQIIEKLGLTPTQFSQLSP
FT                   AELASKLAGNPQPPNLGASLGNVPNGLPQGPRATQKSELFSTVVTLYLTEKKIDNVAKT
FT                   LYDKERVYDEFKSFFGDLDVNQYSPDQAVAYKNRLLALGGSASAINAKTSFLRSLFEYA
FT                   INNNLFFTANPFERVKISTKAKLKKQVRSYKPFEDDDLKIIFEELKYRAFLKKPDYHWL
FT                   PFLSLYTGARVEELASLRLDQITKVDGVLVFDIQHDAAKNSNSVRKIPLPDVILKSKFL
FT                   DYVEQVKATKATHLFPHLKDGKNGFSKNMSRRFGEYLDKLEIKDDRKVFHSFRTTFINS
FT                   MTNLNVHPAILMAIVGHYEQGKVDFSSPHFTNYQQDKPMKILKEAMDKLTYPIKIFH"
FT   gene            complement(709536..709612)
FT                   /locus_tag="Bmul_R0015"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(709536..709612)
FT                   /locus_tag="Bmul_R0015"
FT                   /product="tRNA-Met"
FT   gene            complement(709769..711427)
FT                   /locus_tag="Bmul_0647"
FT   CDS_pept        complement(709769..711427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0647"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_A5982
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14342"
FT                   /protein_id="ABX14342.1"
FT                   /translation="MATLGGQIAHSPMTAEEKKVIFASSLGTVFEWYDFYLAGSLAAYI
FT                   SKSFFSGVNPTAAFIFTLLGFAAGFAVRPFGALVFGRLGDLVGRKHTFLVTIVIMGVST
FT                   FVVGFLPGYASIGIAAPVIFIAMRLLQGLALGGEYGGAATYVAEHAPANRRGFYTAWIQ
FT                   TTATLGLFLSLLVILGVRTFIGEEAFGAWGWRVPFVASILLLAVSVWIRMQLNESPVFL
FT                   RIKSEGKTSKAPLTEAFGQWKNLKIVILALVGLTAGQAVVWYTGQFYALFFLTQTLKVD
FT                   GASANILIAIALLIGTPFFLFFGSLSDKIGRKPIILAGCLIAALTYFPLFKALTHYANP
FT                   QLEIATQKAPISVVADPATCSFQFNPVGTSKFTNSCDIAKSALAKAGLNYENVAAPAGT
FT                   TAQIKVGDTVIPAYDGKAADAKAQGAAFDKTLASTLKAAGYPAKADPAQLNWPMTIVIL
FT                   TILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPATAFAIVAAKGD
FT                   IYSGLWYPIVIALVTFVIGLLFVKETKDSNIYAQD"
FT   gene            complement(711654..713201)
FT                   /locus_tag="Bmul_0648"
FT   CDS_pept        complement(711654..713201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0648"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: bur:Bcep18194_A5981 periplasmic sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14343"
FT                   /protein_id="ABX14343.1"
FT                   /translation="MATPAPSRHPTGEPSSAADAARDARYANPFAPPDETDAPEAARPR
FT                   SLFGEILDWMLAPLLLLWPMSIAVTYLVAKTIANGPFDRSLETNAYVLARQIHPVNGVA
FT                   ELTLPQQTRDFLRADNIDSVYFQVLGTRGELVAGEADMPLPRDEDRPPPGVVVFRDDLL
FT                   RGNDVRVAYTTVSLPQTSGSQLVLVQVGETLDKRNALANDIIKGVILPQFVILPLAILL
FT                   VWFGLSRGLAPLNALQAHIRARRPDDLSPVEAQRAPPEIEPLVTSFNDLLARLEQNMAL
FT                   QKRFIADAAHQMKTPLAGLRTQAEFALRHPVPPDVQRSLEQIATSSEQAARLVTQLLAL
FT                   ARAENRASGLTFEPVEIASLARRAVRDWVQAALAKQMDLGYEGPPDDAPIDVDGNPVML
FT                   REMLGNLIDNAIRYTPEGGRITVRVHADRTARLAHLEVEDTGPGIPAAERGRVVERFYR
FT                   ILGREGDGSGLGLAIVREIATQHGGTLTIDDHVYQTAPRLAGTLVRVSLPLSVAAPD"
FT   gene            complement(713220..713978)
FT                   /locus_tag="Bmul_0649"
FT   CDS_pept        complement(713220..713978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0649"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bch:Bcen2424_2653 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14344"
FT                   /protein_id="ABX14344.1"
FT                   /translation="MRILIAEDDSILADGLTRSLRQSGYAVDHVKSGVEADTALSMQTF
FT                   DLLILDLGLPKMSGLDVLKRLRARNSNLPVLILTAADSVDERVKGLDLGADDYMAKPFA
FT                   LNELEARVRALTRRGAGGGPTVVRHGSLAFDQVGRIAYANDRVLDLSARELGLLEVLLQ
FT                   RIGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEPSGVRIATVRGLGYCLEKVV
FT                   PAAPADAPAPPPAAADPASAKPATAGTPLR"
FT   gene            714167..715240
FT                   /locus_tag="Bmul_0650"
FT   CDS_pept        714167..715240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0650"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: bam:Bamb_2699 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14345"
FT                   /db_xref="GOA:A9AFT0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFT0"
FT                   /protein_id="ABX14345.1"
FT                   /translation="MEESKKGSGMTAEKSKALAAALAQIEKQFGKGSIMRMGDGEAAED
FT                   IQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVIAELQKLGGTAAFIDA
FT                   EHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRSGSIDMIVIDSVAALVPKAE
FT                   IEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGNPETTTGGN
FT                   ALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIFDILYGEGISRQG
FT                   EIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREIENRIRESLGVAA
FT                   MPDGAGHDEAEAMDEEE"
FT   gene            715240..716097
FT                   /locus_tag="Bmul_0651"
FT   CDS_pept        715240..716097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0651"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG:
FT                   bur:Bcep18194_A5978 regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14346"
FT                   /protein_id="ABX14346.1"
FT                   /translation="MVGRRGKPAEPDERDTPEAARAGRPAESSGAGRRLPGSHAAASRT
FT                   ATRASDDALVSFEIAAPEDPFDDDESFDAHDRSRRRVSGLGLPRDRAADGSASAAEDVY
FT                   TRSSQHPRRTRRAGGAASGDAAGSGERKSSKPPRSLKGRALGYLSRREYSRAELARKLA
FT                   PYAAEDESVEPVLDALEKDGWLSDARFAESLVHRRASRVGVARIVSELKRHAIGDALVD
FT                   ELNTQLRETEWARAQAVWRKKFGALPQTPAERAKQARFLAARGFSSATIVKLLKVGDDF
FT                   PIDD"
FT   gene            716172..716843
FT                   /locus_tag="Bmul_0652"
FT   CDS_pept        716172..716843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14347"
FT                   /protein_id="ABX14347.1"
FT                   /translation="MRRPVSNTQYAKIHGFSSSASTSSMPLSEPVPRQLRHRRAIRADA
FT                   YERGDGLWDIEACLTDHKPRDVALASGIRPQGLPIHELWLRVTIDRDLNVVDAEASSEW
FT                   VPYPGHCQSAPPAYRALIGLNLFRNFRRDANRLLSGTAGCSHLTELCAVLPTAAIQAFA
FT                   GDVWNVREAGGEGPEHDDAHDEPPFQLGRCRALRFDGEVVRQYYPRWYGASRPESGGTK
FT                   E"
FT   gene            716912..718078
FT                   /locus_tag="Bmul_0653"
FT   CDS_pept        716912..718078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0653"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: bam:Bamb_2696 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14348"
FT                   /db_xref="GOA:A9AFT3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFT3"
FT                   /protein_id="ABX14348.1"
FT                   /translation="MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADI
FT                   KQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDSQADDL
FT                   ATKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVVALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVN
FT                   LNVPLVVRMKGTNEDLGKKMLADSGLPIISADSMEEAAQKVVAAAAGK"
FT   gene            718226..719107
FT                   /locus_tag="Bmul_0654"
FT   CDS_pept        718226..719107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0654"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: bte:BTH_I0647 succinyl-CoA
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14349"
FT                   /protein_id="ABX14349.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPK
FT                   KAGEDFEGIPIYASVKEAKEETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIP
FT                   VRDMIEVKDRMRREGRKTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLT
FT                   YEAVAQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPDTDAVVMIGEIGGPDEAN
FT                   AAQWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAEAKLEIMEACGIKVTRN
FT                   PSEMGRLLKAAL"
FT   gene            719264..719968
FT                   /locus_tag="Bmul_0655"
FT   CDS_pept        719264..719968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0655"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bur:Bcep18194_A5974 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14350"
FT                   /protein_id="ABX14350.1"
FT                   /translation="MVEFLTSLHWGAVLQIVIIDILLGGDNAVVIALACRNLPDDQRLR
FT                   GVVWGTAGAILLRVALIVFAVVLLDVPFLKLGGGLLLLWIGIKLMAPAPDAHDDIKPAS
FT                   RLWDAVKTIVIADAVMSLDNVIAIAGAAEQADPSHRIALVIFGLVVSVPIIVWGSTLVL
FT                   KLLDRFPIVVAFGAALLGWIAGGLIVHDPVGDRWPVLDTPAAVYGASIAGALLVVAAGY
FT                   ALRRRRSVTRAH"
FT   gene            720070..720669
FT                   /locus_tag="Bmul_0656"
FT   CDS_pept        720070..720669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0656"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: bvi:Bcep1808_2757 general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14351"
FT                   /protein_id="ABX14351.1"
FT                   /translation="MFEAFSVSLFRRMAADLRRARRPAPLRAWRAGFTLIELMIVLAIV
FT                   GVVAAYAIPAYQDYLARSRVGEGLALASSARLAVADNAASGTALDGGYSAPAATRNVEA
FT                   IRIDAETGQITVAYTARVAAAGANTLVLVPSAPDKPDTPTARVPLKKGEMQAGAIAWEC
FT                   FAAGKDASSLPAPGAGPLPGTAATLPAKYAPAECRA"
FT   gene            720793..722574
FT                   /locus_tag="Bmul_0657"
FT   CDS_pept        720793..722574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0657"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bch:Bcen2424_2645
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14352"
FT                   /protein_id="ABX14352.1"
FT                   /translation="MPSTFTRSLPLIALAVALIVPYAITTHTYPIPTFYSEFSALVLYL
FT                   LLGLSVVLLVRTQRAAEPFAAPAAFVAPIGFALVLIAQLALLPLKVPSMNGLALGYLAA
FT                   ALVAMQAGYALARDGLGDAVARMMAGALLIGGVFAVACQVVQLFHLESAVSPFVVMYNI
FT                   AVDRRPYGNMAQANHLATYIAFAMAGALYLVQTRRLAVWAWLALSIVLSAGLALTVSRG
FT                   PWLQVAVMVVAGFWMAWVESRRTRGAARAWLLPVVLVVAFVAVNVAVRWANVHYQLNLA
FT                   ESAAERMRDAGQIAPRLALWKYGLAMFREHPLLGVGWGEFPSHQFALARALGGVEIANN
FT                   SHDIFIDLLAKSGLVGLGVLAVTLVMWFVRAVRAPQSSSRVFGFALIGILLMHALVEYP
FT                   QQYMFFLLPAMFVIGLLDVKPLRVLPARAAFALFAVLSFAGLLATIPVLRDYQRAEVLY
FT                   YGSSPAAQYRDAPSLLFHAWGDYGAATLLTISPDDLPAKLAAHERAIALLPGETVLRRY
FT                   AVLQALDGREADALDTVARLQVFAKELKDWPAQLALLYKLCDEHPSLKAFKAAVVAKYG
FT                   EVPSDADDESDDEDDTE"
FT   sig_peptide     720793..720879
FT                   /locus_tag="Bmul_0657"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.383 at
FT                   residue 29"
FT   gene            complement(722620..722898)
FT                   /locus_tag="Bmul_0658"
FT   CDS_pept        complement(722620..722898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14353"
FT                   /protein_id="ABX14353.1"
FT                   /translation="MTMVDANRARSGATPCDPGSNRRAARNRVCRAVARSPLYRPYRAA
FT                   RIPLIRHRAASLSPCRRVRLRAMRKATAARLGNRARAVQSRDHRRIA"
FT   gene            722931..723518
FT                   /locus_tag="Bmul_0659"
FT   CDS_pept        722931..723518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0659"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG:
FT                   bur:Bcep18194_A5971 TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14354"
FT                   /protein_id="ABX14354.1"
FT                   /translation="MRESLPMRARACRRNVSGSRALDVASAGYAAGSRPIIREAARPSR
FT                   GAGPTAAAQPSACGERCRRHAAFVRNRPEQRYSTMAIRSTYLILPAVAMLFSGCAMLSS
FT                   SQESKLTCHIPRAVYPDTAKPLTRPATVLVRALMTASGEAQNVTVTTSSRNAAADRAAV
FT                   EAMARATCTQTGAAANPFLLTQPFVFEPQRGQ"
FT   gene            complement(723634..724113)
FT                   /locus_tag="Bmul_0660"
FT   CDS_pept        complement(723634..724113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0660"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: bam:Bamb_2685 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14355"
FT                   /db_xref="GOA:A9AFU0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFU0"
FT                   /protein_id="ABX14355.1"
FT                   /translation="MSGLTHFDAAGHAHMVDVGGKQETQRIAVARGTIRMLPATFELIR
FT                   DGKAKKGDVLGVARIAAIQGAKRTADLIPLCHPLALTRVAVDFELDDALPGVHCIAQVE
FT                   TFGRTGVEMEALTAVQVGLLTVYDMCKAVDRGMVIGDVSVTEKRGGKSGDWKAQA"
FT   gene            724364..726145
FT                   /locus_tag="Bmul_0661"
FT   CDS_pept        724364..726145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0661"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bch:Bcen2424_2637
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14356"
FT                   /protein_id="ABX14356.1"
FT                   /translation="MATIFRSDQTPRCAPGARAASLHPAMRVKQLLAVSLSAALALPAN
FT                   SFAQRTTPAPLESANAASPSISTVPPGIATGVFGTYGGAESRFSGATGIADDASAPAAS
FT                   LRAPLRAFELPDLGDGSGGALTPQAERKLGERVMRDVRRDPDYLDDWLVRDYLNAVAKR
FT                   LAAAASARYIGGYAPDFDLFAVRDPQINAFSMPGGFIGINSGLVVATQTESELASVIGH
FT                   EMGHVLQRHIARMIGANEKTGYTALATMLLGVLAGVLARSGDLGSAIAMGGQAFAVDNQ
FT                   LRFSRTAEREADRVGFQLLAGAGYDPYGMPGFFERLERASMGDAGVPAYARTHPLTVER
FT                   IADMDDRARRAPYRQPRQSPEYGFVRARLRVLQNRAPNDIAAEARRMQLEIDDRTAPNV
FT                   AANAYGIALANALLGQYDAADRALATARAAFDARERRDGDPAAGSPSLDVLAADIARRA
FT                   GRTDDAVRLAALAQRRWPASHAAIVVHLQTLIAARRFAEAQTLARVQASADPDQPDWWD
FT                   YLAKASDGKGDVLARRRALAEKLALDGAWPSAIRQLKEARDAKDVSFYDQSIIGARLLE
FT                   FEARYKEEREDDKNGRG"
FT   sig_peptide     724364..724510
FT                   /locus_tag="Bmul_0661"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.828 at
FT                   residue 49"
FT   gene            complement(726222..726818)
FT                   /locus_tag="Bmul_0662"
FT   CDS_pept        complement(726222..726818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14357"
FT                   /protein_id="ABX14357.1"
FT                   /translation="MDDIVKQALAKWPNVPHCTGWLLLDRRGTWRLRDEAAQAAGELGS
FT                   PIRHAALIAFIGRNYECDAHGQWFFQNGPQRVYVELAYTPWIVRLTERDGQLSLTDHTG
FT                   APFEPDAAWLDDAGGVLFVEAGTRPRVAALHDHDLALFADHADLDATPPVLRWRDARLL
FT                   PLGQIAGTDVPARFGFVTSPARRASEAGKAGEAGR"
FT   gene            complement(726811..727851)
FT                   /locus_tag="Bmul_0663"
FT   CDS_pept        complement(726811..727851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0663"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bch:Bcen2424_2635 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14358"
FT                   /protein_id="ABX14358.1"
FT                   /translation="MSTASPPTSPLTGPQAPDDDNLLRYRAPRWLPNSHVQTIVPALFA
FT                   RRPVVAYRRERWETPDHDFIDLDWVAHLDSAAPPPDAPLFVLFHGLEGSSGSHYALAMM
FT                   AAARAKGWHGVVPHFRSCSGELNRQPRFYHLADSAEVDWILRRLAAQHRGPIVAAGVSL
FT                   GGNVLLRWLGEHRSDTSIVRAAAAISTPIDVHAGGRALSQGFAMVYTRSFLKTLKRKAL
FT                   MKLEQYPGLFDRDAMLRAVTMHDFDEVVTAPLHGFANANDYWTQATTRPLLPAIDVPTL
FT                   ILNARNDPFLPESALPGPADVSPAVELDQPAHGGHAGFMTGPFPGRLDWLSVRVFGYCS
FT                   KFVDHG"
FT   gene            complement(727879..728325)
FT                   /locus_tag="Bmul_0664"
FT   CDS_pept        complement(727879..728325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14359"
FT                   /protein_id="ABX14359.1"
FT                   /translation="MPRFARLFEAAADTLNAYYQAVADANLDALLALWIDEDFASCVWA
FT                   DGEHLHGLDQIRSGLGTRLATRPVTIEPLDIRVYDSLGTVVYTIAEAHQQADLTADPDM
FT                   VFATYVMIHERGEWRIAHIHASPIPEQAAGQFAAKIRHGQGPLH"
FT   gene            complement(728441..729478)
FT                   /locus_tag="Bmul_0665"
FT   CDS_pept        complement(728441..729478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0665"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG:
FT                   bvi:Bcep1808_2748 lipopolysaccharide heptosyltransferase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14360"
FT                   /protein_id="ABX14360.1"
FT                   /translation="MRRALVIAPNWIGDALMAQPLFALLKKLHPRIAIDAVAPTWVAPV
FT                   LERMPEIHDVYATDLAHGKLQLLRRWQLASDLRDVGYDAAYVLPNSLKSAVIPWLANIP
FT                   LRIGYTGEHRYGLLNVRHANPDKSAERPPMTTHYAALAYAPGAKLPESMKTLPPPRLDA
FT                   DLNETARVSARFNLDTRKPLVVFCPGAEYGPAKRWPPEHFATLATIVHQSFPYTQIVAL
FT                   GSQKDAAAAQAIADHAPNVRNLCGQTSLSEACALIARANAVVTNDSGLMHVAAALRRPL
FT                   VALYGSTDPRHTPPLSDLAKVQWLHLECSPCFERECPLGHLNCLRELGPEQVFGDLRGM
FT                   LVGQR"
FT   gene            complement(729618..729812)
FT                   /locus_tag="Bmul_0666"
FT   CDS_pept        complement(729618..729812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14361"
FT                   /protein_id="ABX14361.1"
FT                   /translation="MSEIKEMPLVELAAKDLPAYCPNPAMTRWNAHPRVFIDVSHGEAR
FT                   CPYCGTRYKLRDGEVVKGH"
FT   gene            complement(729863..730786)
FT                   /locus_tag="Bmul_0667"
FT   CDS_pept        complement(729863..730786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0667"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: bvi:Bcep1808_2746
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14362"
FT                   /protein_id="ABX14362.1"
FT                   /translation="MSMADRDGKIWMDGKLIDWRDATIHVLTHTLHYGMGVFEGVRAYK
FT                   TADGSTAIFRLPEHTKRLLNSAKIFQMDVPFDQETLEAAQREVVRENKLESCYLRPIIW
FT                   VGSEKLGVSAKGNTIHVAIAAWPWGAYLGEDGLAKGIRVKTSSFTRHHVNVSMVRAKAS
FT                   GWYVNSILANQEATADGYDEALLLDVDGYVSEGSGENFFLVNRGKLYTPDLSSCLDGIT
FT                   RDTIITLAKDAGIEVIEKRITRDEVYTADEAFFTGTAAEVTPIRELDNRTIGSGARGPV
FT                   TEKLQSAFFDIVSGKNAKYAHWLTKV"
FT   gene            730978..731733
FT                   /locus_tag="Bmul_0668"
FT   CDS_pept        730978..731733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0668"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: bur:Bcep18194_A5961
FT                   AzlC-like efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14363"
FT                   /protein_id="ABX14363.1"
FT                   /translation="MLARLSPTDRFALIQGARDYSPTLMAILSWGLVTGIAMSQSVMTL
FT                   GQASAMSLLVYAGSSQLAVLPLLAAKLPIWTVLLTAAMVNMRFVIFSAGLAPHFSYLPL
FT                   WRRLAIGYFNGDVIYLLFQKQGFANGHVPGKEAYFWGMALASWVSWQVSSLAGILLASF
FT                   FPASWGLELAGTLALIPIMVSAVANRSTLAAVAVAGIVSLVAFDLPYRLALPIAVLAAL
FT                   AAGCTADWFVERADWRRIRTETVRNEEVE"
FT   gene            731730..732053
FT                   /locus_tag="Bmul_0669"
FT   CDS_pept        731730..732053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0669"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   bch:Bcen2424_2629 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14364"
FT                   /protein_id="ABX14364.1"
FT                   /translation="MSAAEIWIVIVGMTIVTAVTRALFLIGGERTVLPERAQRALRYAP
FT                   AAALVAVVLPDVLETPAGLSFALSNHPFYAALAGLGWFLWRRSMLGTIVVGMVVFTVLR
FT                   LVV"
FT   gene            732332..733528
FT                   /locus_tag="Bmul_0670"
FT   CDS_pept        732332..733528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0670"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG:
FT                   bch:Bcen2424_2628 phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14365"
FT                   /protein_id="ABX14365.1"
FT                   /translation="MSQVKRLTDLIAAGQLAGKRVFIRADLNVPQDDHGNITEDTRVRA
FT                   SVPAIKAALEAGAAVMVTSHLGRPTEGEFKPEDSLAPVAKRLSELLGRDVPLVANWVEN
FT                   GVNVAPGEVVLLENCRVNKGEKKNSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAK
FT                   YAPVACAGPLLAAELDALGKALGNPARPLVAIVAGSKVSTKLTILKSLAEKVDQLIVGG
FT                   GIANTFMLAAGLSIGKSLAEPDLVDEAKAIIDEARKRGASVPIPTDVVTAKEFSPTAAA
FT                   TVKPVADIEADDMILDIGPDTAKALASQLEKAGTIVWNGPVGVFEFDQFGNGTKTLAEA
FT                   IAKSSAFSIAGGGDTLAAIAKYGIHDQVSYISTGGGAFLEFLEGKKLPAVEVLETRAA"
FT   gene            733813..735249
FT                   /locus_tag="Bmul_0671"
FT   CDS_pept        733813..735249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0671"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: bch:Bcen2424_2627 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14366"
FT                   /protein_id="ABX14366.1"
FT                   /translation="MQRATKIVATIGPASSSPEILLQMMQAGLDVVRLNFSHGTADDHR
FT                   QRAEMVREAARKVGREIAIMADLQGPKIRVGKFENGKTTLTPGQPFILDAACELGNDDR
FT                   VGLDYKELPRDLKPGDLLLLNDGLIVLTVERVLGDEIHTIVKVGGELSNNKGINRQGGG
FT                   LSAPALTAKDMEDIRTAMSLGADLVAVSFPKNATDMEMARQLANIAGAPYGIKPKMIAK
FT                   IERAEAIPALQSILDASDGIMVARGDLAVEVGNAAVPALQKRMIRMARESNKLVITATQ
FT                   MMESMIHAPVPTRAEVSDVANAVLDGTDAVMLSAETAAGKYPVQTIEAMAAVCVEAEKS
FT                   EQIELDKDFLDRTFTRIDQSIAMGALFTAYHLGAKAIVALTESGATALWMSRHYTHVPI
FT                   FALTPRVGSERAMALFRNVTPLHVDFNSDRDSALQAALETIVKRGYVAHGDMVVLTVGE
FT                   PMGQAGGTNTLKIVRVGEHY"
FT   gene            735548..736612
FT                   /locus_tag="Bmul_0672"
FT   CDS_pept        735548..736612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0672"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: bvi:Bcep1808_2741 fructose-bisphosphate
FT                   aldolase, class II, Calvin cycle subtype; TIGRFAM:
FT                   ketose-bisphosphate aldolase; fructose-bisphosphate
FT                   aldolase, class II, Calvin cycle subtype; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14367"
FT                   /protein_id="ABX14367.1"
FT                   /translation="MPLVSMRQLLDHAAEHGYGLPAFNVNNLEQVQAIMAAADQVGAPV
FT                   IMQASAGARKYAGEPFLRHLIEAAVESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMM
FT                   DGSLEADGKTVASYEYNVDVSRKVVEMAHSIGVTVEAELGVLGSLETMKGDKEDGHGAE
FT                   GTMTREQLLTDPEQAADFVKLTQCDALAIAIGTSHGAYKFTKKPTGDILSIQRIKEIHA
FT                   RIPNTHLVMHGSSSVPQELLAEIREFGGDMKETYGVPVEEIQEGIKHGVRKVNIDTDLR
FT                   LAITGAIRRYMFENPSKFDPRDYLKPAREAAKKVCVDRYLAFGCEGQAAKIKPVPLEKI
FT                   AEKYKSGELAQVVR"
FT   gene            736831..737721
FT                   /locus_tag="Bmul_0673"
FT   CDS_pept        736831..737721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0673"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: bch:Bcen2424_2625
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14368"
FT                   /protein_id="ABX14368.1"
FT                   /translation="MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVI
FT                   MGEPIPNKGRVLNQMANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLE
FT                   PILIEAVVRGYLAGSGWKEYQATGAVCGVQLPAGLQNAQKLPEPIFTPAAKAEMGEHDE
FT                   NITFEETERRIGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLM
FT                   DEVLTADSSRFWPADQYQVGTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAA
FT                   KYQEALERITGQPLA"
FT   gene            737729..738259
FT                   /locus_tag="Bmul_0674"
FT   CDS_pept        737729..738259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0674"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bur:Bcep18194_A5955
FT                   phosphoribosylaminoimidazole carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14369"
FT                   /protein_id="ABX14369.1"
FT                   /translation="MHEMNEVQTAHTHSAPLVGVLMGSSSDWDVMKHAVAILQEFGVPY
FT                   EAKVVSAHRMPDEMFDYAEKARERGLRAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASK
FT                   YLKGVDSLHSIVQMPKGVPVATFAIGEAGAANAALFAVSILSGTSVDYANRLAAFRVRQ
FT                   NEAAHAMVLPPLE"
FT   gene            738345..739541
FT                   /locus_tag="Bmul_0675"
FT   CDS_pept        738345..739541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0675"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; KEGG: bch:Bcen2424_2623
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14370"
FT                   /protein_id="ABX14370.1"
FT                   /translation="MTATPDSVSPILPGAWLGMVGGGQLGRMFCFAAQSMGYRVAVLDP
FT                   DPASPAGAVADRHLRAAYDDEAALTELAALCDAVSTEFENVPAASLDFLARTTFVAPAG
FT                   RCVAIAQDRIAEKRFIEASGVPVAPHVAIESADALAALDDAALDAVLPGILKTARLGYD
FT                   GKGQVRVRTAQEAREAYASLGGVPCVLEKRLPLKYEVSALIARGADGRSAAFPLAQNAH
FT                   HNGILALTVVPAPAADDALVAQAQQAAVRIADTLGYVGVLCVEFFVLEDGSLVANEMAP
FT                   RPHNSGHYTVDACATSQFEQQVRAMTRMPLGNPRQHSPAAMLNILGDVWFPQGAESDAV
FT                   TPPWDAVAAMPTAHLHLYGKEEARVGRKMGHVNFTAATRDEAVAAAHACAQLLRVPLD"
FT   gene            739553..740581
FT                   /locus_tag="Bmul_0676"
FT   CDS_pept        739553..740581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0676"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   bur:Bcep18194_A5953 SUA5/YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14371"
FT                   /protein_id="ABX14371.1"
FT                   /translation="MSTDLPKSVTPAQIDAAAALLDAGQLVAFPTETVYGLGGDAASPD
FT                   AVARIYAAKGRPANHPVIVHLPPGGDPAYWAAELPADAQKLIDAFWPGPLTLILKRHPR
FT                   IPDAVSGGQDSVGLRCPSHPVAQALLAAFSARRGGHGGVAAPSANRFGHVSPTTAQHVR
FT                   DEFGDTVHVLDGGASEVGIESTILDLSRGFPALLRPGHVTPQQIADVLGRAPRLPDGSD
FT                   ATAPRASGTLKAHYAPRTPLALLPFDALEPLLAAAQADGERVALVARASRAGRWAQADG
FT                   VHFVAAPEDPQAYARDLYGMLRALDRAQVARILVEKLPETVEWIAVNDRLGRAAAAFEA
FT                   SD"
FT   gene            complement(740701..741828)
FT                   /locus_tag="Bmul_0677"
FT   CDS_pept        complement(740701..741828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0677"
FT                   /product="phospholipase/lecithinase/hemolysin-like protein"
FT                   /note="KEGG: bur:Bcep18194_A5952
FT                   phospholipase/lecithinase/hemolysin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14372"
FT                   /protein_id="ABX14372.1"
FT                   /translation="MQTQRNLPSRTRHRLLRSAQVAIAGAALALLAACGGGDDNGGSAS
FT                   NAPPSGVKMQVVSFGDSLSDVGTYSQIKLGFGGGRFTTNPGQVWTQNVAQYYGDTLQPA
FT                   NQGGFGVPLQATGGLGYAQGGSRVTQQPGIGHAAASVPNADYAQATTTPVAAQVQQYLQ
FT                   QHGSFNANQIVLLNGGANDIFYQVAALQAGAITPTQLQQNIGLAAQQLAGLVQQIVAAG
FT                   ATHVFVSNVPDIGGTPLALQGGTQTTLTQLSMLFNGTLAATLQALKVDTSKYVLLDTFK
FT                   WQDGILAAYQANGFTVSNTDTACNLKAMVAAATQYGVADPSAFGSSLFCSPQTYTAPNA
FT                   DQTYMFADTVHPTTRLHALFAQYVEQQIAASGVGK"
FT   sig_peptide     complement(741721..741828)
FT                   /locus_tag="Bmul_0677"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.426 at
FT                   residue 36"
FT   gene            complement(741916..742830)
FT                   /locus_tag="Bmul_0678"
FT   CDS_pept        complement(741916..742830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0678"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG:
FT                   bur:Bcep18194_A5951 sterol desaturase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14373"
FT                   /protein_id="ABX14373.1"
FT                   /translation="MRFDVEWLLLALAPVFLLCIGWEAWYLARTRPQDHVYAWRDTLCN
FT                   AALALMHQGADKLAWVFVIPVYAYCYDRYRLFTWHDGWLSFAVLFVAQDLLYYVFHRAS
FT                   HRVRWLWAAHVVHHSSERMNFSTAFRQSLMYPVAGMWVFWLPLALLGFPPQQIVGVVLI
FT                   NLAFQFFVHTQAIGKLGWLEYVFNTPSIHRAHHARNARYIDRNYAGVLVIWDRLFGSYV
FT                   DEAPDDPPQYGIVERLESNNPLVATFHEWRAMAADALRVEGWRNKLRAIVGPPEWASAY
FT                   HAQIGDTADRDPRRAPLAGVHNE"
FT   gene            complement(743035..744567)
FT                   /locus_tag="Bmul_0679"
FT   CDS_pept        complement(743035..744567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0679"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bam:Bamb_2666 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14374"
FT                   /protein_id="ABX14374.1"
FT                   /translation="MPISALSTRFAPRARVCLRAAAVVATCTALAFAPAAHARKKPHKD
FT                   ARRAPVVSAAARDAGLPASVLVALQRAKVPASAMSVVVERVGDPQPLIAWNANRPMLPA
FT                   STMKLVTTFAGLSILGPEFRWRTTAYADGPVDPDGTLQGNLYIKGTGDPKLVPEELIDL
FT                   VDKIRKAGIKRVAGGLVLDKSYFAASTRDLPSFDDDVSAPYNVGPDPLLYAFKAISFTV
FT                   TPGEDGKVAVDVLPPLANLSIDNQLYEGSGSCASAAAAARPTLNADGAMLTASFAGDYP
FT                   LRCGARTTNLAILDHTTFFARGFLALWQQDGGTIAGPVAEGKVPSAARPIAVHHGPVLG
FT                   SVVYDINKFSNNVMARNLFLTIGAVAGKPPATPEQSSRVIRAFLQKNGIAMPDLVLDNG
FT                   SGLSRDEHVSALSLAALLQAANASPVAQAFVDSLPIAGIDGTMKNRLTNAGVLGNAHIK
FT                   TGTLRDVRAIAGYVAGADGQSYVVVSFINDDHAEAARAAHDTLLEWIYAGAH"
FT   sig_peptide     complement(744451..744567)
FT                   /locus_tag="Bmul_0679"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 39"
FT   gene            744727..745404
FT                   /locus_tag="Bmul_0680"
FT   CDS_pept        744727..745404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0680"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_A5949 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14375"
FT                   /protein_id="ABX14375.1"
FT                   /translation="MDAIPMRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGESALTAL
FT                   GGESYDLLLLDLGLPKRDGIDVLRTLRARGLSLPVLIVTARDAIADRVKGLDAGADDYL
FT                   VKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALL
FT                   EALLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVV
FT                   KES"
FT   gene            745408..746754
FT                   /locus_tag="Bmul_0681"
FT   CDS_pept        745408..746754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0681"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bur:Bcep18194_A5948
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14376"
FT                   /protein_id="ABX14376.1"
FT                   /translation="MRSIRHQLLIWLLAIVVAGVSVAGWLIYRQALAEANELFDYQLQE
FT                   IAAALPSEPFSQVFGSRTNGDEGIVIQIWNRNGVLMYFSHPRAPIAPRAELGFSTERTD
FT                   RGEWRVYGAIVGDNVVQLAQPLSVRNRLAANVALRTLWPLIVLLPFLGAAVWMIVGRGL
FT                   APLGRVTRAVETRRPEALDPLPDARLPLEVQPLVRALNGLLARLSGALDTQKAFVADAA
FT                   HELRTPLAAVQIQAQLVARAKDDAARREALDDLQHGVTRATRLAEQLLALARAEPDAGA
FT                   VREPVDLQTLLAECVAAHAPLAQRRNIDLGFEETRAATVVADVGALRVMFGNLLDNAVK
FT                   YTPDGGRIDVSLTRDAAGRACVQIGDSGPGIPAEERERVFDRFYRDSSARARTDVSGSG
FT                   LGLAIVKRVAAQQGATVSLGDAAAGGLLVSVVFRDAEMPAQAPQQPASV"
FT   sig_peptide     745408..745479
FT                   /locus_tag="Bmul_0681"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.927 at
FT                   residue 24"
FT   gene            746853..748337
FT                   /locus_tag="Bmul_0682"
FT   CDS_pept        746853..748337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0682"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bur:Bcep18194_A5947 peptidase S1C, Do;
FT                   TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14377"
FT                   /protein_id="ABX14377.1"
FT                   /translation="MNTRFLARSAVVVAVAAALSAGYVAGTRRADPQIIAPAHAAAMMP
FT                   AEAAAKTGIPDFSGLVETYGPAVVNISAKHVVKQVARRVPQPQLPIDPSDPFYQFFKRF
FT                   YGQVPGMGGDAQPDDQPSASLGSGFIISPDGYILTNAHVIDGANVVTVKLTDKREYKAK
FT                   VVGSDKQSDVAVLKIDATGLPTVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKS
FT                   RALPDENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAIPINE
FT                   AIKVKDELVKTGHVSRGRLGVAVQGLNQTLASSFGLAKPDGALVSSVDPNGPAAKAGLQ
FT                   PGDVILSVNGTPVVDSTTLPSQIANLKPGSKADLQIWRDKAKQSVTVTLGAMTDAKLAS
FT                   NDGGPVEQGRLGVAVRPLTPQERSADNLSHGLIVQQAGGPAASAGIQPGDVILAVNGRP
FT                   VTSPEQLREAVKSAGNSLALLIQRDNAQIFVPVDLS"
FT   sig_peptide     746853..746945
FT                   /locus_tag="Bmul_0682"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.605 at
FT                   residue 31"
FT   gene            748441..748881
FT                   /locus_tag="Bmul_0683"
FT   CDS_pept        748441..748881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14378"
FT                   /protein_id="ABX14378.1"
FT                   /translation="MQYLRNVSRIAVAVALSAGLAAAATGAYAQSSDGLPEATQQGDIS
FT                   FVSGGIGKDQSTAFERNESAWPLALRFTGKGGEYLADVHVRIVDGKGTEVLKTDARGPY
FT                   MLVKLPPGRYTVHASYQGSDETRAVTVGAKGGAKAAFQWSAQ"
FT   sig_peptide     748441..748530
FT                   /locus_tag="Bmul_0683"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 30"
FT   gene            749009..749368
FT                   /locus_tag="Bmul_0684"
FT   CDS_pept        749009..749368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0684"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   bch:Bcen2424_2614 protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14379"
FT                   /protein_id="ABX14379.1"
FT                   /translation="MSDAAAPRLEIVLNRHRVRVIHRGITYADSHGALTVREAGQPDVH
FT                   YLPRGDVNMSRLVRSATTATCPVKGAAVYFNLQTEDGVIEDAAWSYESPEAAALALAQY
FT                   VAFDVARIDSLVETS"
FT   gene            749397..750104
FT                   /locus_tag="Bmul_0685"
FT   CDS_pept        749397..750104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0685"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   bur:Bcep18194_A5944 carbon monoxide dehydrogenase subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14380"
FT                   /protein_id="ABX14380.1"
FT                   /translation="MELNDTLCVALAPAVVRDALEDVALLRASVDHCESFVKLARDEFA
FT                   LTITVPHGTLRARYEVRVHVAAEHGDAEGRPRRMLGFHARAEGLGALRGQIDVVLTPDD
FT                   AGNATRIEYLVWATATGPLAELPARQIENALRDCIDDFFREFCAIVQAKHGLAPNRARP
FT                   AAPRRPHVFLRPAALTAAAKRPASPHLAGASGGRAAGALHHRHTGPVPLWAWVAMIVFV
FT                   ALLLYVARWFNGG"
FT   gene            complement(750141..751133)
FT                   /locus_tag="Bmul_0686"
FT   CDS_pept        complement(750141..751133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0686"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_A5943 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14381"
FT                   /protein_id="ABX14381.1"
FT                   /translation="MTTASSPAATVVAVVAYDGISPFHLSVPSVVFGKERDAADSPAFE
FT                   FRVCSADRGPLATTGGFTIVAPYALDGLLDADIVIVPSWRDENETPPDELLDAVRAAAA
FT                   RGAQLVGLCLGAYVLAAAGLLDGRPATTHWAWADDFARRFPRVKLDPDVLYVDDGNLMT
FT                   SAGTAAGLDCCLHVVRRRFGSDAANRIARRLVIPPHRQGGQAQYVPQPVAAHPRDTRLA
FT                   ALLDWVRANLDAAHSVDSLAARVLMSRRTFTRHFRQATGTTVTAWLQAERLARAQHLLE
FT                   TTGQSIDAIAQAAGYGSSVSLRQHFAGALGTSPSAYRKQFRGTGSDARP"
FT   gene            complement(751456..752241)
FT                   /locus_tag="Bmul_0687"
FT   CDS_pept        complement(751456..752241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0687"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   bch:Bcen2424_2610 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14382"
FT                   /protein_id="ABX14382.1"
FT                   /translation="MDVCKKTVRAVPSAKSYELLPVASIARSGARDEGPGPGLSLIESD
FT                   SGLHMVRRTKEEALETRNRILDAAEHVFFEKGVSHTSLADIAQHAGVTRGAIYWHFANK
FT                   SDLFDAMFDRVLLPIDELKRMPADAPGSNPLEKVRKILIWCLLGVQRDSQLRRVFSILF
FT                   MKCEYVADMEPLLLRNRAGMSEALHAIDADLAMAVRLELLPERLDTWRATLMLHTLVSG
FT                   FVRDMLMLPDEIDAEKHAEKLVDGCFDMLRCSPAMLKDD"
FT   gene            752494..753789
FT                   /locus_tag="Bmul_0688"
FT   CDS_pept        752494..753789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0688"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bch:Bcen2424_2609 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14383"
FT                   /protein_id="ABX14383.1"
FT                   /translation="MRVERVPYRLLTVATAAVFLAACGKKESAPPPQTPEVGVVTVQPQ
FT                   AVPVFTELPGRTSAFLVAQVRARVDGIVLRREFTEGSDVKAGQRLYKIDPAPYIAALNS
FT                   AKATLAKAQANLATQNALVARYKVLVAANAVSKQDYDNAVAAQGQAAADVAAGKASVET
FT                   AQINLGYTDVVSPITGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLEGLK
FT                   LRQDVQSGRLKTTGPGAAKVSLILEDGRTYSQPGKLQFSDVTVDQTTGSVTIRAVFPNP
FT                   GKVLLPGMFVRARIEEGVNDNAYLVPQIGVTHDQKGQAVAMVVNANNKVEPRTLTATRI
FT                   EGQNWVVESGLQPGDRVIVQGVDKVRPGATVKAVPAQLASAPNDASGAAAPAAAAPASA
FT                   AAASAAAASSAGASGAPASAAAGSSAAASGAQ"
FT   gene            753805..757005
FT                   /locus_tag="Bmul_0689"
FT   CDS_pept        753805..757005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0689"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bam:Bamb_2655 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14384"
FT                   /protein_id="ABX14384.1"
FT                   /translation="MAKFFIDRPIFAWVIAIILMLAGVAAIFTLPIAQYPTIAPPSIQI
FT                   SANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGTATITLTFAPGTNPDIAQ
FT                   VQVQNKLSLATPILPQVVQQLGLKVTKSSSSFLLVLAFNSEDGSMNRYDLANYVASHVQ
FT                   DPISRLNGVGTVTLFGSQYAMRVWLDPVKLTNYGLTPIDVTNAISAQNVQVAGGQIGGT
FT                   PAKPGTLLQATITEATLLRTPAEFGNILLKVNQDGSQVRLKDVAQIGLGAENYNFDTKY
FT                   NGQPSAALGIQLATNANALATAKAVRAKVDELSKYFPHGLVVKYPYDTTPFVKLSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMSLVGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLGPKEATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVSAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNR
FT                   TFNASRDKYHVGVHHVIKRSGRWLIIYLVVIVAVGLLFVRLPKSFLPDEDQGLMFVIVQ
FT                   TPSGSTQETTAKTLANITDYLLKDEKDIVESAFTVNGFSFAGRGQNSGLVFVRLKDYAQ
FT                   RQHADQKVQALIGRMFGRYSGYKDAIVIPFNPPSIPELGTAAGFDFELTDNAGLGHDAL
FT                   MAARNQLLGMAAKDPTLQGVRPNGLNDTPQYKVDIDREKANALGVTADAIDQTFSIAWA
FT                   SKYVNNFLDTDGRIKKVYVQSDAPFRMTPEDLNIWYVRNGSGGMVPFGAFATGHWTYGS
FT                   PKLERYNGISAMEIQGQAAPGKSTGQAMAAMEALATKLPTGIGYSWTGLSFQEIQSGSQ
FT                   APILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVIGALLAATLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQMTEKMGPIEAALEAARLRLRPILMTSLAFILGVLPLA
FT                   ISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVKIRAIFSGEKEDVDEALRLAQE
FT                   HSHHEEKPGNGDEGNKGQ"
FT   sig_peptide     753805..753882
FT                   /locus_tag="Bmul_0689"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.738 at
FT                   residue 26"
FT   gene            757005..758528
FT                   /locus_tag="Bmul_0690"
FT   CDS_pept        757005..758528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0690"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bam:Bamb_2654 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14385"
FT                   /protein_id="ABX14385.1"
FT                   /translation="MMQKHALTAIAVALLAAGCTLAPHYTRPDAPVAQAFPSGGVYATQ
FT                   PGAAGARSANGQAATAIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQIT
FT                   RAGLFPTLDGTGTGNIQRVPQGVSQTGAPYISRVYNVGLSASWELDLFGRVQSLKDQAL
FT                   AQYLSTAYARQAAEISLVSQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNG
FT                   TGSELELRQAQTVVEQALANQQAQARARAQALNALVLLIGEPLPDDLPPGLPLDAQNLL
FT                   ADVPAGLPSDLLTRRPDIMQAEQTLLAANANIGAARAAFFPRISLTGAFGTASPTLGGL
FT                   FKAGTAAWSFAPQITMPIFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVADGLAA
FT                   RGTYDQQIAALERNTHAQQRRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQALINARLA
FT                   RWTNLVDLYRALGGGWIERAGETPRAPDQTVDYDKASAPASASAAATNG"
FT   sig_peptide     757005..757061
FT                   /locus_tag="Bmul_0690"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.399 at
FT                   residue 19"
FT   gene            complement(758904..760280)
FT                   /locus_tag="Bmul_0691"
FT   CDS_pept        complement(758904..760280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0691"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bam:Bamb_2653 uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14386"
FT                   /protein_id="ABX14386.1"
FT                   /translation="MQSNTVHPCDEVLPTGKLVTLGLQHVLVMYAGAVAVPLIVGGALK
FT                   LPKDQIAFLISADLFSCGIATLIQTLGLWIFGIRLPVIMGCTFAAVGPMIAIGTNPGLG
FT                   ILDIFGSTIAAGIIGIVLAPMIGKLLRFFPPVVVGTVISVIGLSLMEVGINWAAGGVGN
FT                   PEYGSPVYLGLSLLVLTLILLINKYGRGFVANISVLLGIVAGFVIAFALGRVNTDGVSV
FT                   APWVGFVMPFHFGWPHFDPLSIATMVTVMFVTFIESTGMFLAVGDMVERPVDQDRLVRG
FT                   LRVDGLGTLIGGIFNSFPHTSFSQNVGLIGVTGVKSRFVCATGGVILVLLGLFPKMAQV
FT                   VASVPPFVLGGAGIVMFGMVAANGIKVLSKVDFVKNHHNLFIVAVSIGMGLVPVVSPHF
FT                   FSKLPPALAPILHSGILLASASAVILNLVFNGVKGEKDAKCEIRRAGHDFDGQAVDAHH
FT                   "
FT   gene            760703..762139
FT                   /locus_tag="Bmul_0692"
FT   CDS_pept        760703..762139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_0692"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   bch:Bcen2424_2605 carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABX14387"
FT                   /protein_id="ABX14387.1"
FT