(data stored in ACNUC7421 zone)

EMBL: CP000869

ID   CP000869; SV 1; circular; genomic DNA; STD; PRO; 2472928 BP.
XX
AC   CP000869; AAVB01000000-AAVB01000037;
XX
PR   Project:PRJNA17407;
XX
DT   16-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2472928
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   "Complete sequence of chromosome2 of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
RN   [2]
RP   1-2472928
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   ;
RL   Submitted (26-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0e260c0f4ac7bb55a80514cc017970d1.
DR   BioSample; SAMN00623032.
DR   EnsemblGenomes-Gn; Bmul_R0072.
DR   EnsemblGenomes-Gn; Bmul_R0073.
DR   EnsemblGenomes-Gn; Bmul_R0074.
DR   EnsemblGenomes-Gn; Bmul_R0075.
DR   EnsemblGenomes-Gn; Bmul_R0076.
DR   EnsemblGenomes-Gn; Bmul_R0077.
DR   EnsemblGenomes-Gn; Bmul_R0078.
DR   EnsemblGenomes-Gn; EBG00001111203.
DR   EnsemblGenomes-Gn; EBG00001111204.
DR   EnsemblGenomes-Gn; EBG00001111205.
DR   EnsemblGenomes-Gn; EBG00001111206.
DR   EnsemblGenomes-Gn; EBG00001111207.
DR   EnsemblGenomes-Gn; EBG00001111208.
DR   EnsemblGenomes-Gn; EBG00001111209.
DR   EnsemblGenomes-Gn; EBG00001111210.
DR   EnsemblGenomes-Gn; EBG00001111211.
DR   EnsemblGenomes-Gn; EBG00001111212.
DR   EnsemblGenomes-Gn; EBG00001111213.
DR   EnsemblGenomes-Tr; Bmul_R0072-1.
DR   EnsemblGenomes-Tr; Bmul_R0073-1.
DR   EnsemblGenomes-Tr; Bmul_R0074-1.
DR   EnsemblGenomes-Tr; Bmul_R0075-1.
DR   EnsemblGenomes-Tr; Bmul_R0076-1.
DR   EnsemblGenomes-Tr; Bmul_R0077-1.
DR   EnsemblGenomes-Tr; Bmul_R0078-1.
DR   EnsemblGenomes-Tr; EBT00001702700.
DR   EnsemblGenomes-Tr; EBT00001702702.
DR   EnsemblGenomes-Tr; EBT00001702703.
DR   EnsemblGenomes-Tr; EBT00001702704.
DR   EnsemblGenomes-Tr; EBT00001702705.
DR   EnsemblGenomes-Tr; EBT00001702706.
DR   EnsemblGenomes-Tr; EBT00001702707.
DR   EnsemblGenomes-Tr; EBT00001702708.
DR   EnsemblGenomes-Tr; EBT00001702709.
DR   EnsemblGenomes-Tr; EBT00001702710.
DR   EnsemblGenomes-Tr; EBT00001702711.
DR   EuropePMC; PMC6315756; 30545132.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000869.
DR   SILVA-SSU; CP000869.
DR   StrainInfo; 39670; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002733
CC   Source DNA available from James Tiedje (tiedjej@msu.edu)
CC   Bacteria available from ATCC: ATCC 17616
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2472928
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="2"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   gene            40..1053
FT                   /locus_tag="Bmul_3158"
FT   CDS_pept        40..1053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3158"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bam:Bamb_4969
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16842"
FT                   /protein_id="ABX16842.1"
FT                   /translation="MSLPTPAAPPARAEEKDLFDRGASDWIVSPEAAFDAWLAMQDYRR
FT                   SSADVYRAQWGAFLTWLRARQKNLATVDTASIAEFVGELPIRKTQRLRYLRLIERVLDH
FT                   IRRTEFASTNPARFIAQDGEADWRKARDNEPTSFLTPAERAKLLAYLFSPIGVSGAAYW
FT                   KERRDRALVAAFLGAGIKTGEARVLTISCVNTSGTSLRIPSTHPDFARDAHLASFAIAL
FT                   FDAWLAERSRQQIPGDLVFPASHTGRPMHKATMLRAIDAIVESAGLTSSRTARTSPQTL
FT                   RNTYAAELFEHDVPPERVGKWLGFVQPISANRLHRAWKTWRAELVEGDAAGSGETH"
FT   gene            complement(1194..2375)
FT                   /locus_tag="Bmul_3159"
FT   CDS_pept        complement(1194..2375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16843"
FT                   /protein_id="ABX16843.1"
FT                   /translation="MTVDEMRQSIREELESMRAAGARRQELSLHACKRLFFDLGIRPSA
FT                   ANVRDLTQTGSASDIPKDIDHFWERIRSASKVRLEGAAIPKSVEEKAGALIGALYEEAL
FT                   KAARDGLDVDRQQVRAEMAAAEQRLRDATVRQETLEAALARSEARNEQLQARVTELEVQ
FT                   LASQTTHGSANEVTLRATVARLETELAAAHGRVNTEQTLNATLRDRIDELQAELQHRTE
FT                   HYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSAAKARA
FT                   DRLEEQLRTQSDELERATRDVNALRANRTMSPEIATLIRRLADAGHLDADAFAAIGTAL
FT                   DHDVPVPSQCPHCDGEPELSHTDDGFEVSCPECEHASGSWPSRLEAVTRFARR"
FT   gene            4198..5562
FT                   /locus_tag="Bmul_3160"
FT   CDS_pept        4198..5562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16844"
FT                   /protein_id="ABX16844.1"
FT                   /translation="MATKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLF
FT                   NVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQ
FT                   KPGRKWGISTLIADAEILEDPATRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRS
FT                   SAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRP
FT                   AIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKL
FT                   GIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAAALFKDALKKGYAPPVDA
FT                   VDALPAAAPSAKGTAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGELEREVARESFEAE
FT                   ALPTLGTHLRDDWRKRGLESKLAETAFFDWLAQKTWGEPTDGDLLAFTLNQSRAA"
FT   gene            complement(5641..6702)
FT                   /locus_tag="Bmul_3161"
FT   CDS_pept        complement(5641..6702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3161"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bch:Bcen2424_5694 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16845"
FT                   /protein_id="ABX16845.1"
FT                   /translation="MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSDAPAPTTA
FT                   KSAKKDSAAPHVPDLAIDLSTDESPQYRAWRLENRYAPGQVIELPLKAIKHSPFNPRHF
FT                   YLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIVI
FT                   DVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELAEHLGLDESTVAV
FT                   ALSIGKLPEAVMQEMVARPDRFGSNMAYQVGRYHAARGTEATLRLINKIVSDDLSTRQV
FT                   SDIVKGRVAAQDAPKPASRQRYAQRLEIKLGGKSVGDLKSYGDDRIELRLRGLPKDKRD
FT                   AILEQLERMLLAD"
FT   gene            complement(6726..7388)
FT                   /locus_tag="Bmul_3162"
FT   CDS_pept        complement(6726..7388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3162"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bam:Bamb_4965 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16846"
FT                   /protein_id="ABX16846.1"
FT                   /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADGQNT
FT                   LVHWSSASGDGDNGIPFPVVNLAEAGGQIHREIKKFINDYDIIVVDCPPSITEKVSGVV
FT                   LLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKR
FT                   ALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGAKLAAAEIRACADEIVAMLP"
FT   gene            8535..8894
FT                   /locus_tag="Bmul_3163"
FT   CDS_pept        8535..8894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3163"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: bur:Bcep18194_B0006 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16847"
FT                   /protein_id="ABX16847.1"
FT                   /translation="MMITIYHNPRCSKSRETLALIETLNTTGAPVNVVEYLKTPPTVEE
FT                   LETLHHQLGRPMRDMLRDGEEPYKTLDLGRAELTDAEAYAAIAAHPILLQRPIVVYRGK
FT                   AAIGRPPEAVRALFE"
FT   gene            8968..9135
FT                   /locus_tag="Bmul_3164"
FT   CDS_pept        8968..9135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_2001 protein of unknown function
FT                   DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16848"
FT                   /protein_id="ABX16848.1"
FT                   /translation="MRHARRQWRSGSVGFVAGGLLQLAGFVRYVQFGAVAAIALVTITA
FT                   LRCSGLERKR"
FT   gene            complement(9304..9771)
FT                   /locus_tag="Bmul_3165"
FT   CDS_pept        complement(9304..9771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16849"
FT                   /protein_id="ABX16849.1"
FT                   /translation="MSEESNRLIPGRRQRSVYRQASPRAARPGHPADFPQGFPQKLWIT
FT                   LGGASGEWGSVRRGKLCATQGLGKHSAARRFGAGKRDGRGWVGGVGGVGGVGGVGGVGG
FT                   VGGVGGVGGVGGVGGVGGWRRCRCSRSDATGRRAKKHAEVAVPRKSSGGAR"
FT   gene            9787..10338
FT                   /locus_tag="Bmul_3166"
FT   CDS_pept        9787..10338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3166"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bur:Bcep18194_B0009 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16850"
FT                   /protein_id="ABX16850.1"
FT                   /translation="MAYRVAVVVGSLRRGSWNRALAHAVISLAPSDLSFEFVEIGELPL
FT                   YSQDYDADFPEVAKRFKQSIEAADALLFVTPEYNRSIPGVLKNALDWGSRPWGSNSWAG
FT                   KPGAVLGTSPGATGTALAQQHLRNVLSYLDVKLLGQPEMFIKHDPTRIDDEGKIVNEDT
FT                   RKFLQGFVDRYADWVRLLKK"
FT   gene            complement(10396..12672)
FT                   /locus_tag="Bmul_3167"
FT   CDS_pept        complement(10396..12672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3167"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bur:Bcep18194_B0010 periplasmic sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16851"
FT                   /protein_id="ABX16851.1"
FT                   /translation="MMAGTSATPSYRMTSDRPAESRTPVTAPADDWQDDGNYASGAPEH
FT                   DFAVRRITLIVLLVAAIVLPCIYVVVMAYNDLKAREAAASDVTMRTVRVAEEHALKVFD
FT                   LTETLDARIVDLVQDMKDATVRNQEADIHDALNTIGGGYPQVAAVSIFGASGMLLANSL
FT                   YYPAPYASIENREDFIGIRDGRVIEHISKLMMGPLKLENIPVFNTGIARRNSDGSFAGM
FT                   VSIALKSSYFNAFYRDLLGGAKTPMTMALARSDGAVLASYPQLPSAVHTDREATFGNAH
FT                   NNPRAGVVRVHHGGSDSEIVAYRQVGSYPVYVVCTYRASAIWREWYEHLSVLFLSMFAP
FT                   SVALWCVIWLSLKRLKAEERAWERWQAEASMRRSIESAYRQSRKMQALGNLVGSVAHDF
FT                   NNLLMIISSNVQIMRRRNAEHLDKELGAIERALKNGQSLTRQLLGVARKQPLHSETIDV
FT                   GQWLGSCRELLKTSLGSKSSLVVAIDPGVWPIRVDVAELELAVINLAVNARDAMPTGGR
FT                   FTVGARNVTLRREDGFPLTGDFAQLSFDDTGSGMAPDVLSRAFEPLFTTKAHGMGTGLG
FT                   LPQVFAFCERSGGLATIDSAVGAGTSVRLYLPRARAEDITTRPPAAAHVAPHTGLHVLL
FT                   VEDNSEVAAGTEALLSLLGHRVTYAATGDDALRLIESATDDNAFDLVISDIHMPGRLNG
FT                   IDLAEAIDKRPEKLPVILVTGYAEELDRTRSVNVRVLSKPFDIALLDAILLEIRDGRDE
FT                   QHPRP"
FT   gene            13104..13472
FT                   /locus_tag="Bmul_3168"
FT   CDS_pept        13104..13472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3168"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bam:Bamb_4958 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16852"
FT                   /protein_id="ABX16852.1"
FT                   /translation="MSLPIVIADDSLLARKLLAKALPGDWDVDVAYAANGREALALYRD
FT                   GKASVMFLDLTMPDMNGYQVLETLRHEDMNTFVIVVSADIQPQAQARVRELGAIAFVAK
FT                   PVTSEALLPILKEYGLYA"
FT   gene            13477..14091
FT                   /locus_tag="Bmul_3169"
FT   CDS_pept        13477..14091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3169"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: bam:Bamb_4957 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16853"
FT                   /protein_id="ABX16853.1"
FT                   /translation="MFTAEQRDALQEIANLAMGRAAARLAVLLGRFIELSVPRVRVVRA
FT                   AEAGRALREMTGIDDNVTAVRQGFRSDIKGEAIVLCRSAGVGRLMSLVERTFGGGAHGG
FT                   MATQDELVFDVANVLMGACVASILDELGRKPVFFPPGLLGTNVSFEDVFQPTVLAWSVA
FT                   LLLEVNFGLEDHAFRAHFVMLMAEDSIRLMGDALDALLSAL"
FT   gene            14088..15026
FT                   /locus_tag="Bmul_3170"
FT   CDS_pept        14088..15026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3170"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: bur:Bcep18194_B0014 diguanylate cyclase (GGDEF
FT                   domain); TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16854"
FT                   /protein_id="ABX16854.1"
FT                   /translation="MTAERASLSDLVIERVGFGLFVLDRRMTVLMWNRFMQDHSGVPAA
FT                   DVIGRNLFDCFPDLPRAWLTRKLESVFQLGSFAFSSWEQRPYLFRFEHDRPITGGVDYM
FT                   QQDCTFMPLTRGRDVEAVCVTISDVTHVSVMQREREEAVAKLREHANRDGLTGIANRRY
FT                   FETRLGEEFARWQRYGGDLSMLLFDLDHFKAINDRFGHAVGDAVLRETARRVAAIVRAQ
FT                   DTFGRFGGEEFALLLPCTNLEEALQVADKVRDAIGRTPVDAEGVSVAVTASVGAACAKL
FT                   GQPACDALVNDADAALYRAKRLGRDRSVGYA"
FT   gene            complement(15060..15944)
FT                   /locus_tag="Bmul_3171"
FT   CDS_pept        complement(15060..15944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3171"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="KEGG: bch:Bcen2424_5683 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16855"
FT                   /protein_id="ABX16855.1"
FT                   /translation="METNVTAPSQSDHPVFVLVHGAWHGAWCFAHVAAALAARGHLSIA
FT                   RDLPAHGLHARFPVSYHVRPLDKDAFGAEPSPVANTTLDDYATQVMQAVDDAYALGRGK
FT                   VILVGHSMGGLAITAAAERAPDKIAKLVYLAAFMPAAGVPGLDYVRAPENRGELLGPLM
FT                   LASPRVAGALRIDPRSGDADYRAATRRALCDDVPQADFDAVANLMSCDVPAAPFATAIP
FT                   TTAARWGAIDRHYIKCLQDRVLLPALQQRFIDEADAFAPGNPTHVHQLDSSHSPFMSQP
FT                   AVLAGVLADIAKH"
FT   gene            16157..16489
FT                   /locus_tag="Bmul_3172"
FT   CDS_pept        16157..16489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16856"
FT                   /protein_id="ABX16856.1"
FT                   /translation="MNVDYLFYRKPDKPGPYSLDDLGDVAPPIGASDAVRAGIARVFEE
FT                   IDWAESPDVPGAWFGTGGAVFQFTAEPDGRVTSFMGSRLERRAMLQLTREMGLIALDLQ
FT                   RDIVYG"
FT   gene            16779..17627
FT                   /locus_tag="Bmul_3173"
FT   CDS_pept        16779..17627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3173"
FT                   /product="squalene synthase HpnD"
FT                   /note="TIGRFAM: squalene synthase HpnD; PFAM:
FT                   Squalene/phytoene synthase; KEGG: bam:Bamb_4953
FT                   squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16857"
FT                   /protein_id="ABX16857.1"
FT                   /translation="MAVSNLVVDEQETDAAAVTSGSSFYLAMRILPAVQRDAMFQVYAF
FT                   CRAVDDIADSDLPRAERAAGLERWRADIDACFAGHPPRHLVALEREIRAFDLQRDDFHA
FT                   MIDGMAMDAAEDICAPDEPTLDLYCDRVASAAGRLSVRIFGMPEAEGIKLSHHLGRALQ
FT                   LTNILRDIDDDAAINRCYLPRELLQREGIAISDPATIARDPALPRVCATLVERALEHFR
FT                   QADAVMDTCARAQVKAPRIMSGAYRCILEAAVARGFAAPRAPLRKPKARMLMIAARYAL
FT                   F"
FT   gene            17632..18885
FT                   /locus_tag="Bmul_3174"
FT   CDS_pept        17632..18885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3174"
FT                   /product="squalene-associated FAD-dependent desaturase"
FT                   /note="TIGRFAM: squalene-associated FAD-dependent
FT                   desaturase; PFAM: amine oxidase; FAD dependent
FT                   oxidoreductase; KEGG: bur:Bcep18194_B0018 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16858"
FT                   /protein_id="ABX16858.1"
FT                   /translation="MPRTVHVIGAGLAGLSAAVELQRRGRRIVLHDAHAHAGGRCRSWF
FT                   DSTLGTTVDSGLHRVFAGQAATQRYLRTIGAADQLTGPPSSEFPVVDLASQQRWTLRFG
FT                   NRRWPSWLFDATARAPGTTPLDYASLASLAFARTGRSLAQTMRCDGVLWERWLRPHFLR
FT                   VLNVEPRHATAELARAALCGTLAAGGPGCRPLVARHGLGSAFVEPALRMLQHGGAQIRL
FT                   RSRLDALEFGARGNAVDALAAGGQRIDLAPGDAVVLAVPPDVAQPLVPDLAAPDAFGAV
FT                   ATAYFAAEPPPGAPLDTTVINGVADAVRTGEGQLAATVHDAGRWLDLPREALARRLWED
FT                   VARVTGANAAVVPPWQLVVEPRAGFAAVPSQEMKRPAVRTRWTNLVLAGDWIATGLPAT
FT                   IEGAIRSGQQAADALQTQ"
FT   gene            18897..20870
FT                   /locus_tag="Bmul_3175"
FT   CDS_pept        18897..20870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3175"
FT                   /product="squalene-hopene cyclase"
FT                   /EC_number="5.4.99.17"
FT                   /note="KEGG: bur:Bcep18194_B0019 terpene synthase/squalene
FT                   cyclase; TIGRFAM: squalene/oxidosqualene cyclase;
FT                   squalene-hopene cyclase; PFAM: Prenyltransferase/squalene
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16859"
FT                   /protein_id="ABX16859.1"
FT                   /translation="MNDLTDMATLSAGTVPAELDAAVARATDALLAAQNADGHWVYELE
FT                   ADSTIPAEYVLLVHYLGETPNLELEQKIGRYLRRIQQADGGWPLFTDGAPNISASVKAY
FT                   FALKVIGDDENAEHMQRARRAIHAMGGAEMSNVFTRIQLALYGAIPWRAVPMMPVEIML
FT                   LPQWFPFHLSKVSYWARTVIVPLLVLNAKRPLAKNPRGVRIDELFIDPPVNAGLLPRQG
FT                   HQSAGWFAFFRAVDHVLRAVDGLFPAYTRERAIRQAVAFVDERLNGEDGLGAIYPAMAN
FT                   AVMMYDVLGYAEDHPNRAIARKSIEKLLVVHEDEAYCQPCLSPVWDTSLAAHALLETRD
FT                   PRAEQAAVRGLDWLRPLQILDVRGDWISRRPHVRPGGWAFQYANPHYPDVDDTAVVAMA
FT                   MDRAQKLNQSDTYRESIARAREWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLD
FT                   PPTADVSGRCLSMLSQLGETALNSDAARRALDYMLKEQEPDGSWYGRWGMNYVYGTWTA
FT                   LCALNAAGLGPDDARVKRAAQWLLSIQNKDGGWGEDGDSYKLNYRGYEPAPSTASQTAW
FT                   ALLGLMAAGEVNNPAVKRGIDYLIAEQKEHGLWDEARFTATGFPRVFYLRYHGYRKFFP
FT                   LWALARYRNLKRDNTTRVTVGI"
FT   gene            20876..21580
FT                   /locus_tag="Bmul_3176"
FT   CDS_pept        20876..21580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16860"
FT                   /protein_id="ABX16860.1"
FT                   /translation="MASQQSGGLPVIAVTGMAFEARIARGDGVEAVFAARADRLERALT
FT                   EATARGCAGIVSFGTAGGLAPDLKPGALVVADAVDGPFGRVQTDADWSARLVVALHDTP
FT                   VWTRVSRGAIAAVTAPVVTEQEKASLHRAKGALAVDMESHIAAAFAAARGVPFAVCRAI
FT                   VDPAWRTLPRAATAGLRDDGSTAILPILRELLKQPSQLGPLLQVASDARAARTTLIQAR
FT                   HAFGREGALRIV"
FT   gene            21845..23809
FT                   /locus_tag="Bmul_3177"
FT   CDS_pept        21845..23809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3177"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   bur:Bcep18194_B1828 protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16861"
FT                   /protein_id="ABX16861.1"
FT                   /translation="MRWSLRLAFDTLPTAMPSNAWRGTRIARAMNPHLLDAYNRELLYF
FT                   KELVEEFAQAHPKIARRLGLHAGEIADPFVERLVQAASFTTARLQLKLDAAFPLLSSRL
FT                   LETVYPNYVAPTPSIAVARLYPDEQEGNLLEGFRVPRGTTFTSRVPDGERTPCTFRSGL
FT                   DVTLYPLEIVSARLTGVPPDIPSVERYGAADRPIRGALRLRLRTTGEARFDELRGLDRL
FT                   PVYLAGDERVASRLFELIHAGAVASVIGMPNRFADSNRSFGVVRDRAVEHTGLAADEGL
FT                   LPLVGTKFHGQNLLHEYATCPARFWFFTLTGLNAGLRYVTDREAEIVVLLDRFDGSLVE
FT                   HVDASRFALFCTPVINLFRRTSDPAEMPGTGAEVLVQPDRQNGSDYEVFAVEALHGFVS
FT                   KGAASLEFRPLYRPLLNNEADHGRYFTIRREHGTAKTSYRRYGARTPYVSTDVFVSLVD
FT                   ENERSYPQAMKYLSVDAWLTNGDLPSLLEPEGATDLTVEISAPVRRTELVRAPSAARAP
FT                   LAQGDAAWRLIGQLNLDYGRLETQDGSALRDILILFAAADDVRLRRQIDSLIRVETRPV
FT                   TKKLPGQGPLRFGRGIECVLTVDEAGFDGASPFLFGVILEHYVARHVSTHSFTQSVLRS
FT                   PQRGELMRWPVRMGTRSAA"
FT   gene            23880..29825
FT                   /locus_tag="Bmul_3178"
FT   CDS_pept        23880..29825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3178"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: YD repeat protein; type VI secretion system
FT                   Vgr family protein; PFAM: RHS protein; YD repeat-containing
FT                   protein; Rhs element Vgr protein; KEGG: bur:Bcep18194_B1826
FT                   rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16862"
FT                   /protein_id="ABX16862.1"
FT                   /translation="MVNFKTNRTFSVSGPALPDLEGIGAMLHLSAMRGTEQLSTPYTYE
FT                   LWLTTPADPRLPAEMLANLDLKAMLGKELTVTIQLDGMGSFVAGMAGQAGAGNLGAGTR
FT                   EISGIVTAASYVDQLNRQCRYRVVLEPWLALARERTDYRIFQRKSVLDILREVFGSYWY
FT                   SFEMRVGRTYRTLRYQVQYGESDFAFAQRLMEEHGIAWFFEHSQGVHRLVLVDGPGAYR
FT                   SVESVAYQTLEYYPPGRKIDREHVDRFEATERLQSGVWTTDDFDFEKPGATLTAQNSLP
FT                   RETAHNQLERYEWPGDYTETEDGHAFAQVRMEEIHAQGARAQGEGNLRNVVCGTTFVLA
FT                   GHPMASANREYLVIASELDVKETGETTGFSAYAIRSRFTVQPSDVVFRPPRTIRKPRTR
FT                   GPQTAIVTGPPDAEIWTNKNGEVTLKFHWDRSDVKDQNSSCWVRVSYPWAGSNFGGIHV
FT                   PRVGTEVIVDFENGDPDRPIVTGRVYNAMTMPPWRLPAHATQSGILTRSTKGGGYGNAN
FT                   AIRFEDKKGAEQVWIQAERNLDAVIEADETHTVGHDRTKRIGHDETDQIGRHWTLSTGG
FT                   YKFETVTLASVKSVGMGAMFNVGMAYNVNVGGLYLRNVGLQMASTVGRSRTDRVVQDWT
FT                   ADVGHTYTLTVRGKAVGDAVAADRANPIEPSPDFAPQLPAPVSSSNANQLRIADTGESS
FT                   LSGAKQTQLIGPGGTVTIDESGIHLKGTAIYLQAPTISMTNGNAGGLAPVTEADCAECA
FT                   KKSVSANPVDLATGQKVLSHTDFTLPGRVSIDWSRSYRSADQRRGSLGVAWKLPYATEV
FT                   RTSATGLIYFDADGRQLQFPALNPGEAHFHPIEKFTLMRGDDNASGATYALRFGNGVEE
FT                   HYGRHPVDETRWQLQRIATRDGQCLTLGYTAQGWLETVRNNVHTVRCALDDAGRITSVL
FT                   LDQGVGNQPLHLTSYVYDEHGDLVEATDRENLTWRYGYDNHLLTTYRTPAGATHVSEWS
FT                   DDTPNAYCLRTYAYTEGADGQRVVTREMRFDYLPSLRATRVTDGLGHTTEYHYNGLWAV
FT                   EKIVHPDGSVEQTHFDETGSVAGYTDALGRTTRIVNDARGNPTSIIDPAGNVTRISYGE
FT                   HNLPEQITDPAGQIWQRGYDAHGHLTSETDPLGNVTRYAYENGLPVARTDALGNVTKMQ
FT                   WDDAGQLVARTDCSGHTTTYDYDPFGQLTETTDALGQVSHHSGSVSARVTAVQPAGMGW
FT                   WKVEYDEAGRAIAHTDPLERVTRVDWDGYGQRTQIVDPAGGTQQFRYDAIGRLTKLTNA
FT                   NQETTTFRYDSRNRLIEQTGFDGRRQSYRYNAAGELVERIDHGQDGQIATHVTYDVLGR
FT                   PVERRSSDGSQASYRYDERGLLTQAQAIVPGRAPVHVTYEYDAAGRRTAEVQAHHGRVW
FT                   RLTHGVDAIGNRDWTHVPDIGSLVWQRYGSGHVHGILLDEHPLASFERDALHREIRRTQ
FT                   GPASHHFGYGANGLLAVHRWQNLDERGRSLEHPRPWRAWAYDDAGQLTTLDDAWRDQKA
FT                   YRYDALSRLTQVMAASGPEAFHYDPAGNLLAAAPSRDNMQAWKASGDRLLRFAPQTRPD
FT                   RPVDFTYDGHGNRIARTVPLPPKPALTEAEKRSQRGTDNLLRVMEVLTGTPKYEEPSEV
FT                   PEVTRYRYDGSHQLIAIEHADGARSEYEYDALGRRVAKHHTPAGGAQQTTLFMWDGDWM
FT                   MQEVRTGRTSHEDRAVTYVPHPDHEGPLTRLADGQAWHYVTDHLGTPQELYDEQREVLW
FT                   AADLSAYGRTARWLTRVVDNPIRFPGQYRDEESGLHYNRFRYYDPMVGRYINQDPIAFD
FT                   GGINFYSYADSAPNIAYDPKGLFVPLIAVASFLGRGALGGAVEIAMQGAKQVFRQAKNN
FT                   WVDGRPLTDIDWDCVKIDWTDVGVSVAVGGVAPSLGATRKSVTRSIKAIRNLSNQSANT
FT                   ANRAAKLKVRVDIKKDSIKRDLIVQGAWQGIKQGAKCAFGEEKKCEEE"
FT   gene            32441..32737
FT                   /locus_tag="Bmul_3179"
FT   CDS_pept        32441..32737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16863"
FT                   /protein_id="ABX16863.1"
FT                   /translation="MGFMLPRAFAFFLPVFMKISIIDYERADVIPDAVVYRLCDMAKDR
FT                   ADDNLSAVLSSYTHEQLEMVLNFLLEMSRTEWRHHNPDLAFEAATLLREKFLI"
FT   gene            34280..34534
FT                   /locus_tag="Bmul_3180"
FT   CDS_pept        34280..34534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16864"
FT                   /protein_id="ABX16864.1"
FT                   /translation="MPARVATLGTLTTHGGAVTSASAGVAINGRPAACVGDAVSCPLHG
FT                   AGVITNGGVGTINGRQIAHHGSGTSCGATLVVSDDGPTV"
FT   sig_peptide     34280..34351
FT                   /locus_tag="Bmul_3180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.779 at
FT                   residue 24"
FT   gene            34545..35486
FT                   /locus_tag="Bmul_3181"
FT   CDS_pept        34545..35486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16865"
FT                   /protein_id="ABX16865.1"
FT                   /translation="MKGISSATQSDSAPKIVSAKRTSAPPRQPNGTFLSNRDPRQQPGP
FT                   RRNRPFGPLAPPEDEPTRLAAVLGHRNALLEAGRVLLRALVDMSALIDTGHDARLRDLL
FT                   LEEVRVFERLCVRANIRVDHRIGARYCLCTALDEAAMRELAARGDASGSAAWASDALTQ
FT                   RIGEDNQGGSKVYALTLRLLDDAADHWPLLELIYRIFSLGFEGRYPHGRTFSAHDRVRE
FT                   RIYNAIAAHLPTVPNALSPHAATIESARPRACFEMPVWLSAAVLSAALCALYVYCRIES
FT                   GAQADDVQRQLSNIARTAPYSAIDPPQGDPAR"
FT   gene            35515..39468
FT                   /locus_tag="Bmul_3182"
FT   CDS_pept        35515..39468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3182"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   bur:Bcep18194_B1823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16866"
FT                   /protein_id="ABX16866.1"
FT                   /translation="MKKILSFPSWRHLWAVVMVIAAVVVIWFAGPLLTFGGLSPLASIG
FT                   IRLTLIALVLAAWALWLIDWTMSIVIVVLLCLAIWHAFPLVTLSGKPLFASVTARILAM
FT                   IGVVFVYAGVMSVRWWRQMRRHPGRLRRWLRLGKRGPRPLAASRLAEIEDMARATIAQL
FT                   KAGRAVHGRLARLFRGAAHLYDVPWYVVLGPKGSGKTSMLLNSGLAFPLDARLQHSLAP
FT                   DDARALPGWRLTNEAVLIDTAGHYVQHGTSRYSLPVASSDGPNGGKRKKQPPDMAAVRR
FT                   QSDSAEWHGFLRLLRRIRPRLPLNGVLLTIDVAALAHADPAAHTTESRALRARLEEMQA
FT                   EFGTGFPVWLVVTKMDRLPGFTDYFAALGQAERAQILGVTLGSGQQARMNDAIRTELNL
FT                   LATRLADGVTSLLRNEADMDRRRRLAVLPESVAALVNPLADLIEHVFARDDNGGPTQPR
FT                   AMFRGVYLTSAIQGDHAIAAERRTLLRRMIDASGTTRRAPRPARGETGYFLRDLWLAVV
FT                   FREGHLASPNWNREHRVRLQRWLGHSLVWLIAAAMCVNLWNGFVTERTSLATLGQNARS
FT                   LAALLARNDLSADPERVPMVLNRAKELLHDATRLATDADGTFRFATARLETIASDSRHA
FT                   YEALSDQAVLPHIVRRMEGAISSAVAIGDAQAAYDALRVYLMLHDRERFNANDVRMWVL
FT                   DDWWRHDSAATFGGRAAMMGHVERLFSEGHVVRSPLSRNDALIRQARVFLDGSDLIERL
FT                   YRRAKATMWKDAPDDFSLLRMVGTQAGMVFTCVSGAPLSGGVPGIFTREGYQAVFSKRL
FT                   PEFLRAASDDDAWVMGRRASGDPRRHSAGTLNAPNQDDDALLAAITRRYLLEYAQQWDA
FT                   FLGDIRIVSGTSLAFNLKILRTLAAPDSPLTRLARAAVIETTLTQPMAKSDGALLAKAT
FT                   DAIHQKAETVLGPRASEQLEREWVDRHFAALREVVTGHADTRSDTQPVETSAGRTGLDG
FT                   IADLLNDYYAALAIADNALLNNSMPPASEHAAKLKMMADTMPAPLRAVLHQLAVEGSRG
FT                   VNQGIGRLLSRQVQAAIGDVCRTTIEGNYPFSPDSSRDVGIDDFTRMFAHGGVIDDFFT
FT                   RTLAPFVDTAAKPWRYRTLPGATEAVQGPDLAPFEHAKAIRDIFFNEVDRTRPSWKVDI
FT                   RIPELDPTIMSLSLDIDGQTTRYRHGPVEPFTVTWPGPRGGAHAWLVASPSIGPNTWTI
FT                   AADGPWALMRLLRKGHVIETATLGRTRVVFSFDGREAALDIASAGSAGNPLTSDVLATF
FT                   RCPGTMAMFNLPDSGPPPGLPHGRLPAMPDSGL"
FT   sig_peptide     35515..35619
FT                   /locus_tag="Bmul_3182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.446 at
FT                   residue 35"
FT   gene            complement(39498..40511)
FT                   /locus_tag="Bmul_3183"
FT   CDS_pept        complement(39498..40511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3183"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: bam:Bamb_4949
FT                   VacJ family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16867"
FT                   /protein_id="ABX16867.1"
FT                   /translation="MNNMRIIAVTVAASAMLSGCATGPNRNPNDPLEPMNRAMYKFNDT
FT                   VDEHIAVPIAKGYQKITPTPLRTAISNFFSNLGDLGNMANNLLQLRITDATQDLMRVAM
FT                   NSVFGMAGLIDIATPAGLPKHHQDFGLTLARWGVPSGPYLVLPVFGPSTFRDGVGRAVD
FT                   VRFNLLNYIEPAARNPMYVMQFISARSDLLGATDLLKQAALDPYSFVRDAYLQQRKSLT
FT                   YRGQSSAGVPSYNEPGEAGAVPGAVPAATPAAPGLPNYEDPGESGGTGGGAPNNAPAAP
FT                   GLPQYDDPGSDTATPASAPAAASATAPAGSTTAPAASGAPIAPAMPTVPASSPAAQ"
FT   sig_peptide     complement(40446..40511)
FT                   /locus_tag="Bmul_3183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.906 at
FT                   residue 22"
FT   gene            complement(40504..43137)
FT                   /locus_tag="Bmul_3184"
FT   CDS_pept        complement(40504..43137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3184"
FT                   /product="hopanoid biosynthesis associated RND transporter
FT                   like protein HpnN"
FT                   /note="TIGRFAM: hopanoid biosynthesis associated RND
FT                   transporter like protein HpnN; KEGG: bch:Bcen2424_5676
FT                   efflux pump, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16868"
FT                   /protein_id="ABX16868.1"
FT                   /translation="MVTSLIVRLVAWSVRRPVWVVVLSLLIAAFSGVYVARHFKINTDI
FT                   SKLVDAEPQWAALSQAVDRAFPQRNGTILAVVEAPAPEFATAAAHALTESLQKQAAAGR
FT                   IGPVAEPGGGPFFEHNGLLFLSPQQVADTTSQLASARPLVNELAKNPSLTGLATTLSTT
FT                   LGQPLLTGQVKLPSMAKLLSRSAATVDDVLAGKPAAFSWRALVDNDAARQPARAFVTVQ
FT                   PVVNYGALKAGAQTSDVIRETARALDLEKRYGAVVRLTGEQPLADDEFSSVEDGAALNG
FT                   VVTLLVVFVILWLALRSKRMIASVLVTLFVGLVVTAALGLAMVGSLNMISVAFMVLFVG
FT                   LGVDFSIQYGVKYREERFRDERIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRG
FT                   VSELGLIAGVGMFVALLTTLTLLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPIL
FT                   IGTLAVVIGALPLLAFLHFDFNPLHLKDPHSESMSTLLALKDSPEAAVNDVTLLAPSLA
FT                   DADAAAKRLDALPEVGRTTTLSTFIPADQPEKRAAIATAASTLLPALTQPPAPPATDAQ
FT                   RVAALKRASDLLGYAAEDHPGPGAAAAQHLSQSLAKLAAADSATRDRAERAFADTLRIA
FT                   LNQLAALLQPQEITRDTLPPPLVRDWVAPDGKALVQISPKVPKGVDPNDDTMLRHFATA
FT                   VKAAEPGAIGGPISILHSANTIISAFLHAALWSIISITILLWITLRRFGDVLRTLVPLL
FT                   VSGIVTLEMCVVLGMSLNFANIIALPLMLGVGVAFKVYFVMAWRAGQTGLLHSSLTHAV
FT                   LFSAATTATAFGSLWLSHHPGTSSMGKLLALALTCTLIGAVVFQPVLMGKPRVKRAKNQ
FT                   SQGINE"
FT   gene            43456..44052
FT                   /locus_tag="Bmul_3185"
FT   CDS_pept        43456..44052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3185"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   bur:Bcep18194_B0023 toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16869"
FT                   /protein_id="ABX16869.1"
FT                   /translation="MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAA
FT                   RGGDMAKITQVVEQRFLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAA
FT                   SLAQLGNQDAKFSFKAGGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSG
FT                   AWLIQVYQGQFKSQLASGGIDGLIAYLQKHNSRTN"
FT   sig_peptide     43456..43518
FT                   /locus_tag="Bmul_3185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 21"
FT   gene            complement(44225..44869)
FT                   /locus_tag="Bmul_3186"
FT   CDS_pept        complement(44225..44869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3186"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bvi:Bcep1808_3814
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16870"
FT                   /protein_id="ABX16870.1"
FT                   /translation="MSAPDTARPAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNAD
FT                   EALALAAELEPDLALMDVGMNGMNGIALAGVFHERFPAIRVLMLSMHDNVEYVTQAVRA
FT                   GASGYLLKDSPASEIVRAIGAVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILD
FT                   ALAEGLSSKQIAQQTGLSVRTVETHRLNLKRKLDIEGQAELIKFAVEHRRR"
FT   gene            complement(44897..46276)
FT                   /locus_tag="Bmul_3187"
FT   CDS_pept        complement(44897..46276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3187"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   Cache type 2 domain protein; KEGG: bam:Bamb_4945
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16871"
FT                   /protein_id="ABX16871.1"
FT                   /translation="MKLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAY
FT                   LSSKEVELKHYVELATSAIMPLYDAAGRNGRDDAMLRTQALAMLQKMDFGPDGYFFVYD
FT                   LHGNALMHPREPERVGHNFWTMRDPQGALTIQQLIGAASRGGGFVRYVWQRPSTGKPAP
FT                   KLGYVVALERWGWMVGTGIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAAIAV
FT                   CALVLNVSESRSADAKLKQLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALA
FT                   RFERGTVRVPEAERALASGVVRLGDTLREVRRISHALRPAMLDDLGLAAALDQLIREFG
FT                   AQSGIDIGYTQVAHSGARPLPAAVNTALFRIAQEALSNIVHHAHASRAAVTLDVGAQSV
FT                   TLTIADNGCGFDAVRSQADERRGIGLRNMRERLDALGGTLTITSQVGHTVVAARVPLRD
FT                   A"
FT   sig_peptide     complement(46184..46276)
FT                   /locus_tag="Bmul_3187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.319 at
FT                   residue 31"
FT   gene            complement(46394..47983)
FT                   /locus_tag="Bmul_3188"
FT   CDS_pept        complement(46394..47983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3188"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bur:Bcep18194_B0028 diguanylate
FT                   cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16872"
FT                   /protein_id="ABX16872.1"
FT                   /translation="MPDDPRIMAETDYAMPRESGLTSRVATHLRRLLLPHLIFYSGLLI
FT                   ALLLMLLCAIVLYEGRIDARERARTTLQNLVLMASWDIERNIEIYSLSLQAVVEGENDP
FT                   AIVALPMPLRRQVLFDRATTARYLGGIYVLDSRGNIAVDGKSDVPRNANFADAPYFSVH
FT                   RDRPDVGLYVSDPYRSRLRGGSPSIALSRRITRADGSFGGIAVMSIRLEYFRDLFSRLA
FT                   LGDRGAMSLIGTNGVMVMREPYDPKIVGRNISQASTFRQFMRAREGSFFDRASIDGVRR
FT                   LYAFRHLDNLPLIMMVAESESEIYAAWYDRAIPIGSAMALLALGFVGLSLLLDVQLRKR
FT                   HRAETELQALARTDGLTGLDNRRMLDVTLAREWRRAARSQHALSLLFVDVDHFKRYNDS
FT                   QGHQAGDDALAAVGRCIAGCLRRPADYAARYGGEEFVVILPDIGSDGAVAIAETIRTSI
FT                   LELGIRHDGSAFGCLTASIGVATCRPDRDDDMHAALKLADDALYRAKETGRNRVVVLTA
FT                   AHAGRHYAPRTA"
FT   gene            complement(48445..50619)
FT                   /locus_tag="Bmul_3189"
FT   CDS_pept        complement(48445..50619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3189"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: bch:Bcen2424_5669 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16873"
FT                   /protein_id="ABX16873.1"
FT                   /translation="MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAP
FT                   RNRELLAERDRLQSELDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDS
FT                   EIATQAGPQLVVPLSNARYALNAANARWGSLYDALYGTDALPEDNGAERTATYNPTRGQ
FT                   RVIDYARNVLDNAAPLAGASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAAD
FT                   APSAILLKHNGLHLEIQIDGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDK
FT                   VQLYRNWLGLMQGTLVEEVSKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGH
FT                   LMTIGAVLDRDGNEIPEGILDGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAF
FT                   ADTLFARIEDLYGLPRNTLKMGIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDE
FT                   MHSAMEAGPMIRKGDMKSSAWIAAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAML
FT                   EQKIAHPRAGANTAWVPSPTAATLHALHYHLVDVQAVQQELERTPYASERDALLDGLLT
FT                   VPVVERAAWSDEEILREVENNAQGILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRI
FT                   SSQHIANWLRHGVITEAFVLDVFKRMARVVDQQNAGDPNYRPMAPDYDRSVAFQAACAL
FT                   ALHGTSQPSGYTEPLLHRFRLAFKAQQAQA"
FT   gene            complement(50654..51058)
FT                   /locus_tag="Bmul_3190"
FT   CDS_pept        complement(50654..51058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3190"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   bch:Bcen2424_5668 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16874"
FT                   /protein_id="ABX16874.1"
FT                   /translation="MQMKPELELADADRILAAARAEAERNGWAVSIAVVDDGGHLLAFA
FT                   RLDGASPASAAIAQDKARAAALGRRDTKAYEDMINGGRTAFLSAPLSGLLEGGVPVTAG
FT                   GRVAGAIGVSGVKSVQDAQIARAGAQSVAD"
FT   gene            51641..53119
FT                   /locus_tag="Bmul_3191"
FT   CDS_pept        51641..53119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3191"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bam:Bamb_4936 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16875"
FT                   /protein_id="ABX16875.1"
FT                   /translation="MSNPVRGDGPDARAVPILHRPVCDLLGCTWPIVLAGMGGVARSAL
FT                   ASAVSAAGGFGFLGMVREPVELIRREVQQVRAATDRPFGINLIPAATPPELLDAQLDAC
FT                   IELRVPVVALFWDVMPAIVRRLRDAGIRVVHQVGSVDDAQAAEAAGADALIVQGHEAGG
FT                   HVRGDRPLLALLPDVIGAVQVPVLAAGGIVDGAGVAAAMALGAQGAAIGTAFLATHESF
FT                   AHAYHKQRIVDAHDGDTLLTDIFHINWPRGAKVRVLPSSVTRGERGDPFGDARVVIGDE
FT                   EGRPIYLFSTDSPLRTMTGDFEAMALYAGTGAGRIRAVEPAADVLRRIVREAAAILESR
FT                   AAAPSGHDADAQRTALLAALDELLEAERAGARVASETAAELTDDDALHRLIAHIRQDEA
FT                   HWCSVLVDAIRTLGATPTRATGAFYEKAMAIDDLAERMAFLNRGQRWVVRKLQALLPTL
FT                   ADRDLHEALTQMLVAHEKNIGAVDVRLRDGGVHG"
FT   gene            complement(53135..54139)
FT                   /locus_tag="Bmul_3192"
FT   CDS_pept        complement(53135..54139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3192"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; KEGG: reu:Reut_A0607 CheB
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16876"
FT                   /protein_id="ABX16876.1"
FT                   /translation="MDHRDVVVVASSRGGLPVLRTLVTNLPEGFPVPICIVQHIGRNRS
FT                   ILPELLTRWGRLDATHALHGERPHPGRIYVAPPDRHLVLRGGRLHLLDTAAENYARPAA
FT                   DPLFRSAAREYGPGAIGVVLSGDLDDGSAGLAAIRAHGGYGIVQRPDECEAPSMPRAAL
FT                   AAAGADAVATADELARTIHAAVYGARGEEGRTMTDLRTLDDESRIAEGRFVTPQLLDAI
FT                   GERSALTCPSCNGALWRMRDDRPLRYRCHTGHAFSALSLDDAEAQKAEDAIWVAIRAVN
FT                   ERMIFARERQEWARRTGNAEDEAIEQARIDENRQLAEVLRHALHVATHGRETG"
FT   gene            complement(54294..58436)
FT                   /locus_tag="Bmul_3193"
FT   CDS_pept        complement(54294..58436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3193"
FT                   /product="signal transduction histidine kinase with CheB
FT                   and CheR activity"
FT                   /note="KEGG: reu:Reut_B4915 protein-glutamate
FT                   methylesterase, two-component system, chemotaxis family,
FT                   response regulator CheB / chemotaxis protein
FT                   methyltransferase CheR; TIGRFAM: PAS sensor protein; PFAM:
FT                   CheB methylesterase; MCP methyltransferase CheR-type;
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16877"
FT                   /protein_id="ABX16877.1"
FT                   /translation="MARQEPTDRERLPASATLRSDLTFPIVGIGASAGGTTALQTFFEN
FT                   APTGMEMAFVVIVHLAPEQISHMDSVLQHTTGMPVRQVTSTVPIEKNHIYVIAPGMQLE
FT                   MADGCLRCSPREMSGGVALTIDHFFRTLADAHDSRAIGIVMSGTGSDGAAGLRRIKEVG
FT                   GITLAQTPDDAEHAEMPKQAIAVGGADIVLPAAEMPQRLLDLWANARRIEQQGLELAHA
FT                   HQNLDRPGANDPERALSDILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLLAYR
FT                   DFLRATPDEANALLADMLIGVTQFFRDRDAFDFLEREVIASMFSPDAGEEQVRVWVAGC
FT                   ATGEEAYSISLLLARARETAVSSQAIQVFATDIDEAAIVRARTGSYPLSIAADVPEPLL
FT                   QRYFTRDGAHFVIAKSVRERILFAAHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILE
FT                   LFHFALRPNGYLFLGTAESADAADDLFTVVDKKRRIYQARVVTHRAKTPTGCPPLLHVE
FT                   SGSADERPVPTPALRAPASPVQRNFSYAELHQRALEMYSPPSVIIDKESNVVHLSDNAG
FT                   RFLRHVGGELSSNIMTLVLPDLRLDLRTAIFRALQTGTSVEARRVKWTHDTQVSWINMT
FT                   VRPFHDKVANADFLLVVFDEVAGRMTDEDQAEATGQDPVLAQLEHELQHSREQLATIIE
FT                   QYETSVEELKASNEELQAINEELRSTSEELESSKEELQSVNEELTTANAEMQARIEDTA
FT                   KANDDLHNIIASSEIATVFVDKEIRIKRFTPNATAIFNLIDSDLGRSLFHITHSLRYPT
FT                   LADDVRQSFQSLRLIEREIESEAGRWYLIRLLPYRTADDHIDGAVITLIDVTDRHHAEE
FT                   AARAGEQRLRLVAQSTKDYAIIIQDGNGIIASWNAGAERIFGYTEDEMIGQDVELIYEP
FT                   NDRHARVPAHEREVAAREGRADDERWHRTKDGRRIFCSGVVTPIADTSFNGFAKIVRDL
FT                   TQRKLSEDANREALAREQAAREQALSSNQLKDEFIAVLSHELRHPLNLIGVRAEMLPRL
FT                   PETRDIPAVREAAELIRQAVRAQAQIIDDLLDLSRIRTGKLALELSRVDLTAVLRTIVD
FT                   TCEADAHARGLVLTAELPDEPAIALADPIRCEQIFWNLMSNALKFTHAGGRIVVRLTHE
FT                   ARMLRVDVIDDGQGIDRDTLPHVFDMFRQAPRDRTRGGLGIGLALVRQLVEMHDGRISA
FT                   ASEGPGRGTTMTVWLPAAADTRVAAADRRASEGRIAGLHVLLVEDDAETALSLTTLLKL
FT                   AGAEVRTAASGAAALEMLAQGPVDAIVSDIGLPDMDGYALLRRIKADPQWAQVKAIALT
FT                   GRNRQTDVGAATQAGFDTHLPKPLDFGLLLAALAEPR"
FT   gene            complement(58763..59614)
FT                   /locus_tag="Bmul_3194"
FT   CDS_pept        complement(58763..59614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3194"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3824
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16878"
FT                   /protein_id="ABX16878.1"
FT                   /translation="MFPTPVAQWKPVTRRLYKLSLPVALAIWLLPLIAVFVTSVRSTEE
FT                   LVEGHYWGWPRHFSMIENYRDALTTSPMLHYFWNSVQITVPSVLGSIALAAMAGFALAT
FT                   YRFRGNTALFGTFVAGNFVPVRVLMIPVRDLSLRLGVFNTVEALILFHVAFQTGFCTLF
FT                   LRNFIKQLPFELIEAARIEGAGEWTVFWRIVLPLIRPALAALAILVFTFVWNDYFWALC
FT                   LTQGDEAAPITAGVAALKGQWTTSWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGAT
FT                   KG"
FT   sig_peptide     complement(59486..59614)
FT                   /locus_tag="Bmul_3194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.460 at
FT                   residue 43"
FT   gene            complement(59631..60569)
FT                   /locus_tag="Bmul_3195"
FT   CDS_pept        complement(59631..60569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3195"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3825
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16879"
FT                   /protein_id="ABX16879.1"
FT                   /translation="MSSPLTSHSPAGAAASRDAAHALPARRPSPAARRQRRAAWLFLAP
FT                   ACAMVAVYVIWPILSTLWLSLCNWDGMTERTFVGLANYVELLHAPTFYTALRNNVIWLV
FT                   LFMLAPPLGLALALYLNQAVGGIRLVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLALI
FT                   AGHGIPVLGDARYATLGVVFAALWPQTAYCMILYLTGLTSLNPEQIEAARMEGARGFAL
FT                   LWHVVLPQLRPTTFMAIVVTVIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYR
FT                   LGYSASIAVVLFAIMLVYIAFQLRRMLRNEQ"
FT   gene            complement(60623..61882)
FT                   /locus_tag="Bmul_3196"
FT   CDS_pept        complement(60623..61882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3196"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bam:Bamb_4932 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16880"
FT                   /protein_id="ABX16880.1"
FT                   /translation="MTHRPVRAAARFATAAAVALASLAATAPADAGTLSINIAFKGASQ
FT                   RAVWQSTLDAFHRAHPDIDVKATFVDEEAYKVQLPAWLTTVAPDVVNWHAGERMAYYAK
FT                   RGLFEDLSGDWAKNGWDAMYASTRSASSYNGKQYAAPTVYYSWGLFYRKDLFRKVGIAN
FT                   EPKTWDQFLDACRKLKAAGITPIAVGGRDAWTLAGWFDYLDLRLNGNAFHQQLMAGDVP
FT                   YTDARVKKVYTTWKSLIDAGYFIDNALSYDLDGAQPFLFQGKAAMMLMGTFIAAGFPAN
FT                   VKPEMGYYRFPIIDANVPTAEDGPVESLHIPTKAKNKADAHTFLAFVETPEIGAKLAEG
FT                   LGSLSANSKSPEPAEPISRIGFRILADTKGGVAQFYDRDMTKEMADEGMKGMQQFVANP
FT                   AQLDAVLAQLEQTRKRIYKK"
FT   sig_peptide     complement(61787..61882)
FT                   /locus_tag="Bmul_3196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.732 at
FT                   residue 32"
FT   gene            complement(61956..63941)
FT                   /locus_tag="Bmul_3197"
FT   CDS_pept        complement(61956..63941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3197"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: bam:Bamb_4931
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16881"
FT                   /protein_id="ABX16881.1"
FT                   /translation="MRVGVCYYPEHWPESMWADDARRMKALGIAQVRIAEFAWSRIEPS
FT                   PGEYDWGWLDRAVDVLAAAGLDIVMCTPTATPPKWLIDRHPEILAIGADGRPRTFGSRR
FT                   HYDFSSPVYYDASRQICTAVAERYGRHPAVRFWQTDNEMGCHQTVVSYSPAALARFREW
FT                   LKARYGTIDALNRAWGTVFWSMEYRDFDEIDAPVGTVTEAHPTHRLDYRRFASDEVVRY
FT                   HRMQVDVIRAHSPGRPVAHNFMQLFTDFDHYAVARDLDVATWDSYPLGALEEHWFAPDV
FT                   KARWLRTGHPDFASFNHDLYRGMSKLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEA
FT                   FAHGAGCVSYFRWRQAPFAQEQMHAGLHTPDDRLDEGGREAERVAHEIAVVHGADAHAD
FT                   AAVHARVALVFDYEAKWLLDVQPQGADFQYARIAFEYYSALRALGLDVDVISAQAPLDG
FT                   YRLVVVPPLPIVPDDFAARLAASGAHAVFGPRTGSKTVDLQIPPTLPPGALASILPLRV
FT                   WRVESLRPNVTERVDGALVDGTPFAGHARHWRDLVELRDAQRTVVRARFADDHPAWLSH
FT                   GTLHYWAALFDDATTAQLFASVAAEAGLAPTPLADGVRISRRGGLTYVFNYGDTVHTID
FT                   AVPPAAFVVGSADVEPRGVAVYRSPV"
FT   gene            complement(63951..65099)
FT                   /locus_tag="Bmul_3198"
FT   CDS_pept        complement(63951..65099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3198"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5656 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16882"
FT                   /protein_id="ABX16882.1"
FT                   /translation="MASISMRRVQKAYGDHAPVIRDVDLEIGEHEFCVFLGPSGCGKST
FT                   LLRMIAGLEDLSAGELSIGGRRVDDVPAAERGVAMVFQSYALFPHMTVYENMAFGLKLA
FT                   RTPKAEIDRKVRDAARILQLDALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLS
FT                   NLDAALRGQTRIEIARLHRQFERASVVYVTHDQTEAMTLADKIVLLHAGADTAQHGSIA
FT                   QVGAPLELYHRPASRFVAGFIGSPRMNFLPAVVAAADAQRTTVTLVPSGETFTLARDGA
FT                   ALRAGDAVTLGIRPEHLTLGAAHDSTMLVRDVALVERLGEQTCVHLEQPGGTPLIAKVP
FT                   GDASVRPGERLPVHAPAAACHLFTEDGRALPASATLSVHHYA"
FT   gene            65287..66303
FT                   /locus_tag="Bmul_3199"
FT   CDS_pept        65287..66303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3199"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bvi:Bcep1808_3829 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16883"
FT                   /protein_id="ABX16883.1"
FT                   /translation="MATLDEVARRAGVTAATVSNVLRGRGRVGDATRARVLEAVQTLGY
FT                   RPHLAARALAEGRAPTVALMVSSIANPFYPEFALAVERAVRRNGQFLIVCNTNDDPAQG
FT                   RAYLDQIAGTVSEGILVTNASHLPDLLEVTRRGVPVVLCMWERPDAPPDGLPCVAVDFR
FT                   EAGRIATRHLLELGHERIGAIVGGCAGGVQAARYDGFADVMREAGLDASIVEAEPDSIE
FT                   GGLRAAARLLDAHPELTALLATNDLPAIGALHAAADRGLRVPDDLSIVGITDIQLARDT
FT                   RPTLTTVAIPTAEAAALAVDLLNALREAGGRVDDAARVRTASAPRLVVRGTTGVARR"
FT   gene            complement(66364..68469)
FT                   /locus_tag="Bmul_3200"
FT   CDS_pept        complement(66364..68469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3200"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bam:Bamb_4928 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16884"
FT                   /protein_id="ABX16884.1"
FT                   /translation="MSRKNWAAAPMAIVVGTAGLSSAEAQELSLPAIEVSGQRTTAPFR
FT                   APESTSATRTETDVMEIPFAVSSVDTKLIRTVAATRGDDLYDWVAGVARQNNFGGLWDN
FT                   YAVRGFAGDGGTSGTDYLVNGFSWNRGMSVPRDTATLERMEVLKGPASALYGRGDPGGL
FT                   ISYTTKQPQFAPSNTIGVSAGSYGALRQTLDSTGPVTKSLAYRFIAMNEDNGSFRDTVS
FT                   SKRYLFAPSFTWDIGDDTTLHYEFETARQRAPLDRGVVAVNGQLGAVPASRFMGEPRDG
FT                   DYDVRNSGHQLTLEHRFNADWSINAGFAQRDTDLSGRSSEAFALQPDGRTLWRRYRQVA
FT                   FHSNDLQGRVEVAGKARTGAIGHMFVMGVDAYRFNYDQFVARSTPTAAAPYAIDIFNPV
FT                   YGQPAPVPRTATNLLERDDGQGLYAQDTLAFGPHWKVLAGLRWDRFHQSVENRLKGVTT
FT                   SQLQTAVSPRLGIVYEASPSLSLYANTAYSFRPNNGADVNGRAFDPEKGHGYEAGVKWA
FT                   GTRWLATVAAFYVNKRNVLTADPANAGFSRAAGEVRSRGVEFEWNGELGHGLRGIVNLA
FT                   YVDAQVTRDSVLTPGARLVDIPRLSGSALLMYETALPLVDKAGAGAGVIYVGRRAGNTA
FT                   NTQDGFDLPAYATVQLNGYVQVNKHLRASVVLNNLFNRTYYVSSYNSLWVTPGAPRSLF
FT                   ASLSYTF"
FT   sig_peptide     complement(68392..68469)
FT                   /locus_tag="Bmul_3200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 26"
FT   gene            complement(68941..69891)
FT                   /locus_tag="Bmul_3201"
FT   CDS_pept        complement(68941..69891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3201"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4926 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16885"
FT                   /protein_id="ABX16885.1"
FT                   /translation="MPDASPWGNRSRLKTRQLLLVVALADEGSIHRAAAALNMTQPAAS
FT                   KLLRELEESIGAVLFERLPRGMRPTLYGDALIRHARAALGSLDQAREELAALKSGHLGH
FT                   VAVGAITSPGLRIVPAAVADVKASHANIRISVEIDTSLALLEHLAQEKLDIVLGRLSAE
FT                   HDKLHLRYEPLTGEPVAAVVRTGHPLLADAPLALADVQRAAWIVPPAGSVLRHRFELVF
FT                   QRASLAPPANVVETAALLFITQLLEQSDMIAVVAEDVAHYYARHGIVSVLPLEMDCRMD
FT                   DFGIITRTDRLPSPAVEVMTDAIRAAARQVYGVGV"
FT   gene            70006..71757
FT                   /locus_tag="Bmul_3202"
FT   CDS_pept        70006..71757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3202"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bur:Bcep18194_B0041 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16886"
FT                   /protein_id="ABX16886.1"
FT                   /translation="MSATKPRLRSAQWFGTNDKNGFMYRSWMKNQGIPDHEFDGRPIIG
FT                   ICNTWSELTPCNAHFRKLAEHVKRGIFEAGGFPVEFPVFSNGESNLRPSAMLTRNLASM
FT                   DVEEAIRGNPIDAVVLLAGCDKTTPALLMGAASCDVPAIVVSGGPMLNGKLEGKNIGSG
FT                   TAVWQLHEALKAGEIDLHHFLSAEAGMSRSAGTCNTMGTASTMACMAEALGVALPHNAA
FT                   IPAVDSRRYVLAHMSGIRIVEMALEGLVLSKVLTRAAFENAIRVNAAIGGSTNAVIHLK
FT                   AIAGRIGVPLELEDWMRIGRDTPTIVDLMPSGRFLMEEFYYAGGLPAVLRRLGEGGLLP
FT                   HPDALTVNGKTLWDNVREAPNYDDEVIRPLDRPLIADGGIRILRGNLAPRGAVLKPSAA
FT                   SPELLKHRGRAVVFENFDHYKATINDESLDVDANSVLVLKNCGPRGYPGMAEVGNMGLP
FT                   PKLLRQGVKDMVRISDARMSGTAYGTVVLHVAPEAAAGGPLAAVRNGDWIELDCEAGTL
FT                   HLDIPDDELQRRLSDVDPAAAPGVAGQAGKGGYARLYLDHVLQADEGCDLDFLVGTRGA
FT                   EVPSHSH"
FT   gene            71872..73248
FT                   /locus_tag="Bmul_3203"
FT   CDS_pept        71872..73248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3203"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_3833 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16887"
FT                   /protein_id="ABX16887.1"
FT                   /translation="MTTTQHTSAASAAAPSGPAAAVDERQLMGLLTRRLVPFLALIYVV
FT                   AYVDRTVVGFAKLHMNAAVGLSDAAYGLGAGLFFIGYFLCEVPSNLALGRFGARVWFAR
FT                   ILATWGVITMAMALVRGPTSFYVLRFLLGAAEAGLYPGILYFLTQWFPMRDRARVIGLL
FT                   VLAQPVAGIVTGPLAGWLLSTHGLFGLSNWQTLFVASGLPAVLLVWPTLRVLPESPERA
FT                   RWLDDAQRRWIARELAADRDTYRPDAHRNPLAALRDRRVLLLAALFLPFPLCIYGLSLW
FT                   LPTIIKAFGTGDAATGLLSAVPYLFAVVGLLVVPRHSDRTRERYAHIVVVSAAAALTMA
FT                   ASASVRQPALQFLFICLTAFSLYSIQAVVWALPGEFLTGTSAAVGIAAINSLANLGGYV
FT                   GPYGIGLIKQATGSLAAGLYFLAATLLFAVLITFAVRAALRAPQRAGDALARESRPLSG
FT                   "
FT   sig_peptide     71872..71937
FT                   /locus_tag="Bmul_3203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            73279..74208
FT                   /locus_tag="Bmul_3204"
FT   CDS_pept        73279..74208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3204"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bur:Bcep18194_B0042 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16888"
FT                   /protein_id="ABX16888.1"
FT                   /translation="MTSSRTPRYRGIFPVVPTTFTETGELDLASQKRAVDFMIDAGSDG
FT                   LCILANFSEQFALADDERDVLTRTILEHVAGRVPVIVTTSHYSTQTCIARSVRAQQLGA
FT                   AMVMVMPPYHGATFRVPEAQIHAFYARLSDALSIPIMIQDAPASGTVLSAPFLAQLARE
FT                   IEHVAYFKIETPGAATKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGAYP
FT                   DGIRPILEAHREGRHDDAFARYQTWLPLINHENRQSGILTAKALMREGGVIACEAPRHP
FT                   MPTLHPDTRAELIAIARRLDPLVLRWAR"
FT   gene            74231..75160
FT                   /locus_tag="Bmul_3205"
FT   CDS_pept        74231..75160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3205"
FT                   /product="Galactose 1-dehydrogenase"
FT                   /EC_number="1.1.1.48"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bch:Bcen2424_5642 galactose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16889"
FT                   /protein_id="ABX16889.1"
FT                   /translation="MSQVVSLGVVGIGKIARDQHLPAIAAEPGFALTACASRHAEVTGV
FT                   RNYPDLGALLAGEPELAAVSLCAPPQVRYAQARAALNAGKHVMLEKPPGATLGEVAALE
FT                   ALAQSRGLTLFATWHSRCASAVEPARAWLATREIRAVQVRWKEDVRRWHPGQQWIWEPG
FT                   GLGVFDPGINALSIVTRILPRELVLREATLVVPSDTQTPIAAELECADTDGVPVHAEFD
FT                   WRHGPVEQWEIAVDTADGVLAISAGGAKLSIAGEPVEVGPAREYPALYAQFHALIARRE
FT                   SDVDVRPLRLVADAFLFGRRVDTEAFGR"
FT   gene            75229..76233
FT                   /locus_tag="Bmul_3206"
FT   CDS_pept        75229..76233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3206"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bvi:Bcep1808_3836
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16890"
FT                   /protein_id="ABX16890.1"
FT                   /translation="MFRTNRRTLLRALLAALCIAPLGMQGTARADAPLKIGFLVKMPEQ
FT                   AWFINEQNAAAALGQKENFSVVKIGTPDGEKVLAAIDNLGSQGAQGFVICAPDVRLGPA
FT                   IAARAKRYNMKFVTVDDQLVDSTGKPLANVPHLGMSATKIGNQVGQAIADEMKRRGWKP
FT                   EEVGALRITNYELPTAKLRTDGATQALLANGFRKENIFDAPQKTTDDEGGFSAAAPVLA
FT                   RHPNVKKWVIYALNEETVLGAVRATEQLHIPAADVIGVGINGAGEAFAEFQKKEPTGFF
FT                   GTIAVSSTNHGKESTQNLVDWIRNGKMPPADTQTSGKLMTRSNWQAVRAELGI"
FT   sig_peptide     75229..75321
FT                   /locus_tag="Bmul_3206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            76254..77801
FT                   /locus_tag="Bmul_3207"
FT   CDS_pept        76254..77801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3207"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B0046 ABC sugar transporter, fused
FT                   ATPase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16891"
FT                   /protein_id="ABX16891.1"
FT                   /translation="MTTQTMTAAASPAAAAAPVQRDALLALDGITVSFPGVRALDGVSL
FT                   SVRAGEVHGLMGENGAGKSTLLKVLSGVNQPQAGTLTLNGEVQRFASTRAALEAGIAII
FT                   YQELHLVPELTVAENLMLGQLPSRLGVVDERTLAARALDALERLGERIDPHVPVKYLSI
FT                   GQRQMIEIGKALMRDARVIAFDEPTSSLSARETAQLFRIIRALRADGRAIIYVTHRMEE
FT                   VDALCDRVTVFRDGRKIETFESVADLDRDRLIGCMVGRSIQDVYGYRPRTAGDVLLEAK
FT                   GLMGPGLAEPVSFAARRGEIVGFFGLVGAGRSELMKLLYGAARPSAGHVELNGRRVAFA
FT                   SPRDAVRAGIALCPEDRKQEGIVAIASVADNLNISARRHFSPARMLLDARRERELAQRY
FT                   IERLAIKTRDGDTPIGALSGGNQQKVVLARWLAERIDVFLMDEPTRGIDVGARAEIYNL
FT                   FYELAEAGRTVILVSSDLAEVIGVSDRIVVMKEGRIAGQVAKAQATPDTLIKLALPR"
FT   sig_peptide     76254..76304
FT                   /locus_tag="Bmul_3207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.969 at
FT                   residue 17"
FT   gene            77839..78858
FT                   /locus_tag="Bmul_3208"
FT   CDS_pept        77839..78858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3208"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0047 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16892"
FT                   /protein_id="ABX16892.1"
FT                   /translation="MSQAMQPQQTSPSPDAAAVPVRPRGGVWQLINRSGIVMVFAVLFA
FT                   TLSLTVPDFLTPRNIQGLLLSVTLIGSIAVTMMFVLALGEVDLSVASIVAFSGVVASTL
FT                   ITATHSVVLGIAAGVLAGGAVGLVNGVLIARWRINSLIVTLAMMEVVRGLAFITSNGDA
FT                   VMISEERFFDLGGGSFLGISYPIWSNIVGFVVFGFLLRKTVFGKNVLAVGGNGEAALLA
FT                   GLPVMRIKITVFVLQGLVTGFAGVMLASRMSLGDPKTSVGLELGVISACVLGGVSLTGG
FT                   VATISGVLVGVLIMGSVQDAMSLLNVPTFYQYLIRGGILLLAVLFDQYRRNQRRAMKI"
FT   gene            78898..79803
FT                   /locus_tag="Bmul_3209"
FT   CDS_pept        78898..79803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3209"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bvi:Bcep1808_3839 SMP-30/gluconolaconase/LRE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16893"
FT                   /protein_id="ABX16893.1"
FT                   /translation="MQQNRPAAAASLLADCRNALGEGATWCDATNTLYWTDIEGARLWR
FT                   CRADGSALAQWPMPERLACFALTDDPDVLLVGLATHLAFFDLRSGAFTRIVDVEPELPT
FT                   RLNDGRCDPFGAFVFGMKDEGGEPPRAVGGFYRLGPDRVLERLALPPAAIANSIAFSPD
FT                   GTKMYFCDSMVREIFVGDYSRAGVSGVRSFARLTDPDGDPDGATVDRDGGLWSAQWGGR
FT                   RVVRYGPDGIETERVDVPTAQPSCPALDGEGRLYVTSARVGLADDALADDPHAGGVFVA
FT                   ATRHAGLPTARFALKRGVGT"
FT   sig_peptide     78898..78963
FT                   /locus_tag="Bmul_3209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.911 at
FT                   residue 22"
FT   gene            80217..81044
FT                   /locus_tag="Bmul_3210"
FT   CDS_pept        80217..81044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3210"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bvi:Bcep1808_3841 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16894"
FT                   /protein_id="ABX16894.1"
FT                   /translation="MSYEGRWKTVKVAVEGGIAWVTLNRPEKRNAMSPTLNAEMIDVLE
FT                   AIELDPEAQVLVLTGEGDAWTAGMDLKEYFREVDAGPEILQEKIRRDASRWQWQLLRMY
FT                   AKPTIAMVNGWCFGGGFSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGH
FT                   RQALYYIMTGDTFTGQQAAQMGLVNKSVPRAQLRDEVRALAAKLLDKNPVVIRNAKHGF
FT                   KRCRELTWEQNEDYLYAKLDQANYRDPEGGREQGLKQFLDEKSIKPGLQAYKR"
FT   gene            81097..82548
FT                   /locus_tag="Bmul_3211"
FT   CDS_pept        81097..82548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3211"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bvi:Bcep1808_3842 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16895"
FT                   /protein_id="ABX16895.1"
FT                   /translation="MHEVSLLIDGVSRGASDGATFDRIDPATGQVASRAAAATLDDADA
FT                   AVAAAARAFPGWAALAPTERRRRLLAAADAMDARTGEFIEIGRAETGAMANWYGFNVML
FT                   AANMLREAAAMTTQIDGAVIPSDVPGSLAMAVRQPCGVVLGIAPWNAPVILATRALAMP
FT                   LACGNTVVLKASEGCPGVHRLIGSVLHDAGLGDGVVNVITHAPQDAPAIVERLIANPAV
FT                   RRVNFTGSTRVGRIVATLAAQHLKPALLELGGKAPVLVLDDADLDAAVDAVAFGAFFNQ
FT                   GQICMSTERVIVDRKVADAFVDKLVAKARTLKAGNPAAPGVVLGTLESVAAAQRIAALV
FT                   ADAHAHGAALPLGCEVDGAVMQPTIVDGVTRDMKLYADESFGPVVTVQRVDDDEAALAA
FT                   ANDSEYGLSAAVFSRDIARAMQLAKRIESGICHINGPTVHDEAQMPFGGVKASGYGRFG
FT                   SKASIAEFTDLRWITVQTAPRHYPI"
FT   gene            82649..84571
FT                   /locus_tag="Bmul_3212"
FT   CDS_pept        82649..84571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3212"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bvi:Bcep1808_3843 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16896"
FT                   /protein_id="ABX16896.1"
FT                   /translation="MEADPTQSRGDAAAQTVPAGYRPVAIGTAPPEIVQRDGCWYLRAA
FT                   TPLGAYPRRLTDRLVSGAQAHPDRWLVARRGADGAWIGITYAQMLERARAIGQALLDRG
FT                   LSVERPIAILSGNDLEHLQIAFGAMWAGIPYAPLSPAYSLVSSDYGKLRHALALLTPGL
FT                   VFASDGDAYRAALDAAVPADVERVIVSARDGMPGATRFASLLDTVPRDVDAAHDAVTGD
FT                   RIAKFLFTSGSTRLPKAVPTTHRMLCSNQQMLLETFPQFGIEPPVLVDWLPWNHTFGGS
FT                   HNVGIALYNGGTLYIDDGKPVAGKFDETLRNLREIAPTVYFNVPKGWEELTAALETDAA
FT                   LRRTFFSRVKLYFFAGAGLSQAAWDRLERVTLAHCGERIRIMAGLGMTEAAPSCMFTTG
FT                   PFSAAGYIGLPAPGCDAKLVPVDGKLEARFRGPNVMAGYWRANEADARDVFDDEGYYRS
FT                   GDAVRFVDPQRPEIGLMFDGRIAEDFKLSSGTFVSVGPMRARIISNGAPYVQDAVVTGM
FT                   NRDDVGVMIFPRIDDCRRLAGAAPDADLRAVLRAPAVRAFFAELLARLNRDATGSATLI
FT                   TRLRILDEPPSLDLGEVTDKGSINQRAVLAHRAALVEAMYAADARDDAEAGLIFADVER
FT                   IARHG"
FT   gene            complement(84716..85750)
FT                   /locus_tag="Bmul_3213"
FT   CDS_pept        complement(84716..85750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3213"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: rso:RSp0223 probable vanillate O-demethylase
FT                   (vanillate degradation ferredoxin-like) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16897"
FT                   /protein_id="ABX16897.1"
FT                   /translation="MKVTLLRKLPVATDICMFELGPADGAALPPFTAGAHIDIHLGGLV
FT                   RQYSLCNSPSEAGVYRLGVLRERESRGGSVAMHACEPGTTLEIGEPRNHFPLDPHAAHS
FT                   VLLAGGIGITPLLSMALHLAETARSFELHYCAREPARAAFVDRLDTPPLNVRTRLWFDD
FT                   APAGQRIDFAQVLGKPDAHTHLYVCGPAGFIAAALGAAAQAGWDPANVHREYFGAAGLG
FT                   AAGVGAAGLGAAGVGATGAGAAGESETSTAATADGPFQVSLAQSGRVVDVPAGTTIVEA
FT                   LRGCGIEVPVSCEQGVCGTCLTRVLSGTPDHRDVYLTDDERAANDQMLPCCSRARTPML
FT                   VLDL"
FT   gene            complement(85806..86849)
FT                   /locus_tag="Bmul_3214"
FT   CDS_pept        complement(85806..86849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3214"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   rso:RSp0222 probable vanillate O-demethylase oxygenase
FT                   subunit oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16898"
FT                   /protein_id="ABX16898.1"
FT                   /translation="MFLKNAWYVACTPDEFASKPLGRQICGERMVFFRDGEGTVAALED
FT                   FCPHRGAPLSLGTVRDGHLVCGYHGLTMGADGKCTSMPCQRVRGIPAIRRYPAVERYGF
FT                   VWVWPGDPAQADSATIHPLHWADDPGWAYGGGLYHIDCDYRLMIDNLMDLTHETYVHAS
FT                   SIGQPEIEEAPPTTKVDGDTVTTSRFMEGIVPPPFWAAALRGNGLADDVRCDRWQICHF
FT                   TPPSHVMIEVGVAHAGKGGYHADPRDKVSSIVVDFITPETETSIWYFWGMARSFAVDDR
FT                   ALTDTIRKGQGAIFAEDLDMLEAQQRNLLRWPDRPLLKLNIDAGGVQSRRVLDRLIEQE
FT                   RAAALSC"
FT   gene            complement(86938..87708)
FT                   /locus_tag="Bmul_3215"
FT   CDS_pept        complement(86938..87708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3215"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: pol:Bpro_3386 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16899"
FT                   /protein_id="ABX16899.1"
FT                   /translation="MTTVDTPASDTRPAASPSQTVRALLGLRELIVGGELGPGERISEL
FT                   WVVERLGVSRTPVRAALIRLQEEGLIEPIATGGFAVRAFSAREIGDAIELRGTLEGLAA
FT                   RFAAERGVPASTLRSLHACADEIDGLLAGPLTDDTFSRYVDANARFHRLLAGAAGSDVV
FT                   ARQIDKVATLPFASASAFVVVQSLDPRARETLVVAQAQHRAVLDAIARRQGARAEALMR
FT                   EHAQIAHDNLRRVLDNQRAMTKLAGGNLIRRDAG"
FT   gene            87957..88481
FT                   /locus_tag="Bmul_3216"
FT   CDS_pept        87957..88481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3216"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bvi:Bcep1808_3845 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16900"
FT                   /protein_id="ABX16900.1"
FT                   /translation="MARDIDSDTFMSSTPAKPAGAKRAARVTEARPRVRTQQRLTYLIG
FT                   NLDRLLRRQMSDALAPLGVTLAQYTALSVLEARGALSNAQLAVRSFITPQSANEVMSAM
FT                   AARGFVTREADPSHGRVILLRLTDEGSAILRECEQVLRPLERRMLGDDLTADDVAQVQR
FT                   TLELFVRNLRD"
FT   gene            88759..89964
FT                   /locus_tag="Bmul_3217"
FT   CDS_pept        88759..89964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3217"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bvi:Bcep1808_3846
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16901"
FT                   /protein_id="ABX16901.1"
FT                   /translation="MDTSVAERPAVATTLGLCFAIALLEGLDLQSVGVAAPRMAHEFGL
FT                   TVSQMGIAFSAGTFGLLPGAMLGGWLADRIGRKQVLIASVCLFGLLSIATAQVSSFAML
FT                   VVVRALTGLGLGGAMPNLIALSSEAVGARSRSSAVAVMYCGIPFGGVIASLIGVLLAGD
FT                   TEWRHIFYVGGVGPLLLAPLLIALLPESRAFLDVSASGAARAGVRDTLFGGGRTGSTLA
FT                   LWISYFCTLIVLYFLLNWLPSLMAAKGLARGQAGIVQIFFNIGSGLGVLGIGMSMDRMR
FT                   PARVVGGMYAGIVLSLAALAIAPGLMWLSVAAFAAGMFVVGGQSVLYALAAIYYPTAMR
FT                   GTGVGSAVAVGRLGSVVGPLAAAELLAMGRSASVVIGASIPVTLVAAIAALLLIRRPHA
FT                   HD"
FT   gene            90048..91169
FT                   /locus_tag="Bmul_3218"
FT   CDS_pept        90048..91169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3218"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_B0054 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16902"
FT                   /protein_id="ABX16902.1"
FT                   /translation="MLAAGACVLAATGAHAQSSVALYGIVDTGVEFVTHANAAGDHVVR
FT                   MPAVTGEMPSRWGIRGNEDLGGGYQAVFVLESGFNVRGGDLGQGGRLFGRQAFVGLKGG
FT                   FGTLAFGRQYTMTYLALQGADIIGPDIYGLGSLDAYVPNGRADNAVTYIGTYRGVTLGA
FT                   AYSFGRDGAGTGNSPGQGTCAGQVPGHAVECRNWSAMLKYDSAYFGAAASYEEQRGGTG
FT                   AAANFFDGVAPVAFTSSAGKDARVHLSAYAQAGGARVGAGWIGRRVSTGSPAAAGAHSD
FT                   LFFVGASYTVKPYLIVDGEGYRIVNSAHDTRATMATLRTTYLLTKRTSVYAQTSYLWNS
FT                   AHARYAVSGGGPGTTPGEGMGQLGAMVGVKHLF"
FT   sig_peptide     90048..90098
FT                   /locus_tag="Bmul_3218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.947 at
FT                   residue 17"
FT   gene            91193..92911
FT                   /locus_tag="Bmul_3219"
FT   CDS_pept        91193..92911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3219"
FT                   /product="Tannase and feruloyl esterase"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bam:Bamb_4911 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16903"
FT                   /protein_id="ABX16903.1"
FT                   /translation="MINRKLLCAAPLSAALLAACGGDDSVTSAPTHLSAATPAAMTQTC
FT                   DALAAKLAYANTSFTSVTTAAAGALTVAGKPVPEHCVIVGKMNERVSAVDGNTYAIGFE
FT                   MRLPKAWNGRFFYQANGGLDGNVVTATGEIGGGGPLTDALAMGFAVISSDSGHSAAQNP
FT                   LFGVDPQARIDYGYGAVDALTPMAKQVIRIAYGKAPDRSYFGGCSNGGRHAMVTAVRNA
FT                   ADYDGIIAGDPGFHLPKAAIGEMYGAQQFAKIASATGTNGLPDIRSGFNDAERRFVGAA
FT                   ILAKCDALDGAADGIVQDVAACQAHFSLDTDIPDCANGTRTGACLTPAQKTALANVFAG
FT                   ARNSAGAALYASFPYDPGVAGSGWAAWKQSNSIALDPAAMAFTFMTPPKPASTLANLAG
FT                   FALGFDMDNDAPAIFATSGAYTQSAWSFMTPPDETNLGALKQRGAKLLVYHGTGDPVFS
FT                   FNDTRDWYARLAQANGGDASDFARFYPVPAMNHCSGGPATDQFDMLTPLVAWVEQGQAP
FT                   GAIVAAARDAANPVPNAEVPASWGTGRSRPLCPYPQVARYKGSGDLNSAASFSCR"
FT   sig_peptide     91193..91258
FT                   /locus_tag="Bmul_3219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.716 at
FT                   residue 22"
FT   gene            complement(93012..94370)
FT                   /locus_tag="Bmul_3220"
FT   CDS_pept        complement(93012..94370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3220"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bur:Bcep18194_B0060 glutamate-1-semialdehyde
FT                   2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16904"
FT                   /protein_id="ABX16904.1"
FT                   /translation="MSSRHGVDLTRARALFDRERRAFTEAMPISRALSAEAAEHLLFGV
FT                   PLHWMQDWSTPFSLYVKEARGATFTDVDGHRYVDFCLGDTGAMFGHAPEPVARALAEQA
FT                   TRGYTTMLPSEDAAWVSRELARRFRLPFWQFALSASDANRFVLRWARAATGRNTIVVFN
FT                   GCYHGTVDDVFVDLVDGRAVQRDSLLGQSYDLLANTRVVEFNDLDALEAALKHDDVACV
FT                   IAEPAMTNIGMVLPEPGFWREARALTRRYGTLLVIDETHTISSGPGGYAVAHDLEPDVL
FT                   VVGKPIAGGVPCAVYGFSAEFAERAKQAKLNAPPGHSGIGTTLTANMLAMHAMRATLAE
FT                   VATDAAYAHMFELAARLAAGLEQTIAKHALPWCVTRIGARTEFQFAPTPPRNGTLAGAQ
FT                   LDSELEHIVHLYLLNRGVLITPFHNMMLVCPQTTADDVDRLVAAFDACLSELT"
FT   gene            94705..96702
FT                   /locus_tag="Bmul_3221"
FT   CDS_pept        94705..96702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3221"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; SMART: Parallel
FT                   beta-helix repeat; KEGG: bam:Bamb_4904 glycoside hydrolase,
FT                   family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16905"
FT                   /protein_id="ABX16905.1"
FT                   /translation="MAAVRRRPSSSVRSRSPKRLSRRAFLGWTGALAGGTVLGGPLAAT
FT                   RAWAGKLPASSAVDLIWGEHGAAARIAASLAHVSRLAFRARDFDVTHYGARPCATVPQT
FT                   SPYTNAAKSPVSPGADRTTAPGAFDSRPAFLAAIDACVREGGGRVVVPPGNWYCAGPIV
FT                   LQSNVNFHLSANCTIYFSPNPADYAKDGPVDCGANGRLYYSRWQANDCLNYGAPVYARN
FT                   AVNIALTGEGPTSVLNGQAMTPFAGSGNDSVCWWTYKGSSGAYGAASSVPSQAYPNPNN
FT                   LDLRIVAPGISDALYAMLTSPVTPWQQDQNYLPALSEAGVPVDKRIFGLGHYLRPCMVE
FT                   FIGCTNVLMENYQTQNTPFWQHHPTACRNVVIRGVTTNSIGPNNDGFDPDACTDVLCED
FT                   CTFNTGDDCIAIKSGKNRDTEYGPAKRHLVRNCTMNSGHGGITLGSEMGGGVEQIYATN
FT                   LSMLNANWQTNPLNIAIRVKTNMNRGGYVKDFHVKGVSLPNGVTLKGGGYGSALLAGSP
FT                   INASVPLGVVTPAAGNPSAAQGGIVTFDCDYQPANDAVRTRAPVVQNVTIADVTARNVT
FT                   LNGVTASCFQAIVAQGPVAFDYNGASPAPTVQPIAGVTISHCDFGTPVASGTPTVTSPG
FT                   PIYAFNVSGMTLRNVVIAGQTVNTTITDSR"
FT   sig_peptide     94705..94854
FT                   /locus_tag="Bmul_3221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.650 at
FT                   residue 50"
FT   gene            complement(96758..97264)
FT                   /locus_tag="Bmul_3222"
FT   CDS_pept        complement(96758..97264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3222"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bvi:Bcep1808_3852 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16906"
FT                   /protein_id="ABX16906.1"
FT                   /translation="MITIRLLDAADAAPFQSLRLAAIRTSPTSFLPTEDEVAAVPVETF
FT                   AAQITPTHTQAVFGAFDGETLIGSTGVRRDAHAKVAHKATIWGVYVDAAYRGRGIAQSL
FT                   LEHAIAHAEHAWQCAQLMLCVNEFNATAERLYASLGFERFGTEPRSLCVDGRFYDEHHM
FT                   VKRLA"
FT   gene            complement(97657..98475)
FT                   /locus_tag="Bmul_3223"
FT   CDS_pept        complement(97657..98475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3223"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG:
FT                   bur:Bcep18194_B0066 outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16907"
FT                   /protein_id="ABX16907.1"
FT                   /translation="MRPAQPAARAWSDAATDFTRCYPAAPDAHRAIPYTHAQFASVPES
FT                   VGEHVADSGNPMMRLPSKKTVLFASLVAVAVLPLTACVAPGYGPYGAQPGYPQQQQYAT
FT                   PGYAQPAYTQPGYVQPAYPNQPYDSQQQYGSQPYGNQYGNQYGNQYGGQYQNGYGTQYG
FT                   TVANIRPINSAVGPSGVAGTVVGALIGGVLGNQIGRGHGRDAATVIGALGGAVAGNQIG
FT                   QQMGAQQAPSGYRIDVQVSDGSMRSFDVQSPGDLRPGDRVQINGSQLSRY"
FT   gene            98651..99850
FT                   /locus_tag="Bmul_3224"
FT   CDS_pept        98651..99850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3224"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bur:Bcep18194_B0067 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16908"
FT                   /protein_id="ABX16908.1"
FT                   /translation="MTDRLFTHAVDADGQPLELLVRDGRFVAIGRDCGAASGTETIDLD
FT                   GRVVLPGFVDGHIHLDKSFVGGRWVPHEPVDSLRARLAVEKRQLAAAPPIAERAHALIA
FT                   QAAAFGTVAMRSHVDVDATTGLANLHAVMAARERWRGIVDIELVAFPQAGVVSCAGTAE
FT                   MLDAAVREGADVVGGIDPTTLDGDADGQLDIVFGIAEKRGVKIDIHLHEPGDTGIAQLL
FT                   RIAARTRAAGLGGRVNVSHAYALGQVGADVVARTAAALADAGVSIMTNAPGDCAFPPVL
FT                   ALRDAGVHVFAGNDNIRDAWWPYGNGDMLQRAMLIGYRSGFYTDDALRVALDMATHAGA
FT                   RAIGRTHYGLAVGCDATFVAVRAPNAAAAVAGVPAERWVVRRGESDRGAPYAPALDFAR
FT                   "
FT   gene            99942..101126
FT                   /locus_tag="Bmul_3225"
FT   CDS_pept        99942..101126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3225"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bur:Bcep18194_B0068 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16909"
FT                   /protein_id="ABX16909.1"
FT                   /translation="MTALLIRNVRTGADDALDILIEGDRIARTGPSLDAPPGCAIEEGA
FT                   GAIALPGLVEGHTHLDKTHWGMPWYRNAVGPRLVDRIENERHYRATSGHDAGAASLALA
FT                   RAFLAAGTTRIRTHVDVDTDAGLRHLHRVLDTRETLRGQVEIQIVAFPQSGVLKRPGTD
FT                   ALLADALAAGADLLGGLDPCAIEGDPVKAVDVLFGIAERYGRGLDLHLHERGSMGAYSL
FT                   DLILQRTAALGMQHKVTISHAFCLGDLAERERDALLARMAELGVAVVTTAPAAVPVPSV
FT                   LACRAAGVTVIGGNDGVRDTWTPYGSPDMLERAMLIAMRNDFRRDDALEVALECVTHGA
FT                   ARGCGFDAYGLQPGARADVVLVDAMTLAEAVVARPVRRLVVSSGKIVARNGALV"
FT   gene            complement(101200..102120)
FT                   /locus_tag="Bmul_3226"
FT   CDS_pept        complement(101200..102120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3226"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_3732 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16910"
FT                   /protein_id="ABX16910.1"
FT                   /translation="MLKVVPRIRKRNARPTRSAEMNRPLFDLDLLRALVMVADCGSFTA
FT                   ASARLHSTQSTVSQKVRRLEEIAGHRLLDRGTRDVRPTDAGVTVLSYARRMLALNDEML
FT                   EVLAGATVALTIRLGVPDDFAAGRTTHALAAFKRAHPQVKLEVTCGLSRDVSAAYDRGE
FT                   LDLVLIKQRRDSREAVARWPEKLRWIDSAKHPSIDLDPLPIVAFPPRGLYRDDMIQAIE
FT                   ARGRRWRIAFTTSSLSGIQAAVADGLGISVLPARAVTAEHVVLTATQGFAPIENMDVAI
FT                   LHRPTADPMVRELTKTLADMLEHEQ"
FT   gene            102518..103303
FT                   /locus_tag="Bmul_3227"
FT   CDS_pept        102518..103303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3227"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bch:Bcen2424_5618 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16911"
FT                   /protein_id="ABX16911.1"
FT                   /translation="MNRIAKLLATALACAPLVSFAQDTSTIRWGIDPTYPPFEAKQPDG
FT                   SLTGFDIDLRDAICAQLHAKCVWVEQNFDGMIPALRARKFDVIMSAMTATEERLKQIDF
FT                   SNKLYASPAALVAPAGSKLQSTAASLAGKRVGIIQGTTQDMYAKAEWAPKGVTIVTYQN
FT                   QDQVYQDLVNGRLDATFQDKTQAGYSFLKTERGKHFAFAGDDITDSRITGFGVAMGLRK
FT                   GDAALKARLNDAIAAIRANGTYQKIAAKYFDFDIYGAKQ"
FT   sig_peptide     102518..102583
FT                   /locus_tag="Bmul_3227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            103336..104187
FT                   /locus_tag="Bmul_3228"
FT   CDS_pept        103336..104187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3228"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: bam:Bamb_4896
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16912"
FT                   /protein_id="ABX16912.1"
FT                   /translation="MTTSISERVAQAVTPDLIEAFRAEGAVCIRGIFSPDEVAALRAGI
FT                   DENLAHPSARAKVASRPDDPGWFFEDFCNWQHNDAYRQFIVRSPAPSVAAALMGTATVR
FT                   LHHDHLLVKEPGTRQRTPWHQDQPYYNIEGDDNVSMWIPVDPVPLESTLEFVAGSHRGP
FT                   WLMPRTFMDKEAKWFPEGSLADLPDIEADRAAFPIRRWALEPGDMVCFRMLTLHASGGT
FT                   RNRRRAFSIRFVGDDIRHAPRRWKTSPDFPGLADELPDGAPLAHPLFPVVWSRDAGQAS
FT                   AI"
FT   gene            complement(104254..104991)
FT                   /locus_tag="Bmul_3229"
FT   CDS_pept        complement(104254..104991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3229"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: bam:Bamb_4895
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16913"
FT                   /protein_id="ABX16913.1"
FT                   /translation="MVMKTTAPFQQIKTLVRQKTEAGEWRPGDRIPSELDLAAQFGVAR
FT                   MTVNRALRELTEEGVLKRIAGVGTFVAESKPQSNLLMIAHIRDEIRARGHAYRCRVLSQ
FT                   SREPASFDVAAAFGLPVNTPVFHVVCVHEENGRPIQLEDRYVNPAAAPAFIDQDFRQEP
FT                   PSEYLYNNVSHDELEIEHVVDASLPTAEQARLLDMRADEPCLTLTRRTWTKGLPVTFVH
FT                   FLHPGNRYRLGSRFKPGAGRRQT"
FT   gene            complement(105034..105798)
FT                   /locus_tag="Bmul_3230"
FT   CDS_pept        complement(105034..105798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bam:Bamb_4890 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16914"
FT                   /protein_id="ABX16914.1"
FT                   /translation="MTSSAGAPNVRAIVTGHTRGLGAALATQLLDQGLAVLGVSRSRHP
FT                   SLAAASHAPFAEIELDLSDTAAVAAWLAGDTLRRFVDGASLVLLFNNAGIVDPIGPLDV
FT                   QDANTVARAVNLNVAAPLMLSAALAQAVSAPTECRIVHVSSGAARNAYAGWSVYCATKA
FT                   ALDHHARAVALDANRALRIGSVAPGVVDTGMQATIRATGDDRFPMRDKFEQLKASGALS
FT                   TPEAAARQLIRYALSDAFGATPTADVRELPPA"
FT   gene            106063..106770
FT                   /locus_tag="Bmul_3231"
FT   CDS_pept        106063..106770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3231"
FT                   /product="protein of unknown function DUF480"
FT                   /note="PFAM: protein of unknown function DUF480; KEGG:
FT                   bch:Bcen2424_5610 protein of unknown function DUF480"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16915"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AL79"
FT                   /protein_id="ABX16915.1"
FT                   /translation="MNTTPDTPTPRALRELTPLEARILGVLVEKQHTVPDTYPLSLNAL
FT                   TAGCNQKTARAPVMNVTDDEVTTALDALKHLSLVFEGSSSRVPRFEHNLNRVLGIPSQA
FT                   IALLTVLMLRGPQTAAELRLNSARLHGFADISSVEAFLDELATREPPLVVRLPRAPGAR
FT                   ENRWMHLLCGDVNVGEFAGADGGGAEAVAPSEFEALKAEQKRLADEVARLNALVRRMAS
FT                   ELGIDADAPGDAN"
FT   gene            106833..107963
FT                   /locus_tag="Bmul_3232"
FT   CDS_pept        106833..107963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3232"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: bch:Bcen2424_5607
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16916"
FT                   /protein_id="ABX16916.1"
FT                   /translation="MQKLDNPTHDREVGVADATLDTTRIDDVRIGAVRPLISPALLLDE
FT                   LPVPAATQTLVEDTRKAIGDILHGRDDRLLLVVGPCSIHDHDQALDYARRLKAAADALK
FT                   DDLLITMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRAARQLLLDINALGLPASTE
FT                   FLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVASDAIVA
FT                   ARASHAFMGMTKMGMAAIFETRGNDDAHVILRGGKNGPNYDAAHVDASCAVLRAAGLRE
FT                   QVMVDCSHANSNKSHERQIEVAQDLARQLSQGEHRIVGVMIESHLEAGRQDLKPGVPLK
FT                   YGVSITDACLSWAQTEPVLDVLAEAVRHRRVFARNA"
FT   gene            108207..108635
FT                   /locus_tag="Bmul_3233"
FT   CDS_pept        108207..108635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3233"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bur:Bcep18194_B0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16917"
FT                   /protein_id="ABX16917.1"
FT                   /translation="MAFYKTLVAVAVLASSVSAHAQIAGAQPLSVTVEQSQALLEGWSV
FT                   KKSVLGKAVYNDQNQKVGTVRDLIVAPDGSVSAAIVSAGGFLGVAAHDVAVPIASLDVR
FT                   NGNIYLPGATKDALKATPAFQYAKVPSPPKPKKVDDKH"
FT   sig_peptide     108207..108272
FT                   /locus_tag="Bmul_3233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            108664..109209
FT                   /locus_tag="Bmul_3234"
FT   CDS_pept        108664..109209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16918"
FT                   /protein_id="ABX16918.1"
FT                   /translation="MMRRVSRAGRRACGARLHARPATSRRSPCIEAAVVRHSLSSPPCR
FT                   LQRRKRRKRRDRVRDIAARTRRPSGMRAPSCCTFTDSIQAADDFIGSASHAIAVGPSAP
FT                   VPRFPLRKTLIAHRRARFLLPLRAIGPAPSGASPPRLPTCREPRSDAAPRSSDQSCEVW
FT                   KTRSFRCGAEYRIPDRYG"
FT   gene            109290..110426
FT                   /locus_tag="Bmul_3235"
FT   CDS_pept        109290..110426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3235"
FT                   /product="muconate and chloromuconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="KEGG: bur:Bcep18194_C7044 mandelate
FT                   racemase/muconate lactonizing enzyme; TIGRFAM: muconate and
FT                   chloromuconate cycloisomerase; PFAM: Mandelate
FT                   racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16919"
FT                   /protein_id="ABX16919.1"
FT                   /translation="MTPITIERIETRLVDLPTIRPHKLSVATMHGQTLMLVKVFCSDGV
FT                   TGIGEGTTIAGMAYGPESPEAMKLAIDTYFAPAMIGRDATRIQALMAHVGKLVKVNHFA
FT                   KSALEMALLDAHGKRLGVPVSELLGGRRRERLPVAWTLASGDTARDIDEAEHMLDVRRH
FT                   NVFKLKIGAKALDADIRHVAAIKKALGDRAAVRVDVNMAWSETQAARALPALADAGCEL
FT                   VEQPVASAAALARLMRRFPVALMADEILQGPDSAFDIAKQHGADVFAIKIEQSGGLFAA
FT                   QRVATIADAAGIELYGGTMLEGAVSTVASAHLFASFANLQWGTELFGPLLITEEILATP
FT                   LDYSDFELTVPSGPGLGIELDDEKVARFTRDGLTKVVR"
FT   gene            110461..110751
FT                   /locus_tag="Bmul_3236"
FT   CDS_pept        110461..110751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3236"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="KEGG: bam:Bamb_6586 muconolactone delta-isomerase;
FT                   TIGRFAM: muconolactone delta-isomerase; PFAM: Muconolactone
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16920"
FT                   /protein_id="ABX16920.1"
FT                   /translation="MLFHVRMDVNLPADMPAGVADEIKAREKAYSQTLQRSGKWRHIWR
FT                   VVGEYANYSIFDVADNAELHDILTQLPLFPYMKISVTPLCRHPSSVREDDV"
FT   gene            110817..111752
FT                   /locus_tag="Bmul_3237"
FT   CDS_pept        110817..111752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3237"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /note="TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase domain
FT                   protein; KEGG: bur:Bcep18194_C7045 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16921"
FT                   /protein_id="ABX16921.1"
FT                   /translation="MSVKVFDTKEVQDLLKAAANLNGDAGNARFRQIVHRLLSDLFKAI
FT                   DDLDITPDEVWAGVNYLNKLGQDGEAALLAAGIGLEKYLDIRMDAADRAAGLDGGTPRT
FT                   IEGPLYVAGAPVRDGVAKIDLDDDADAGPLVIRGTVTGTDGKPLAGALVECWHANSKGF
FT                   YSHFDPTGAQTAFNLRGAVRTDANGKYEFRTLMPVGYGCPPQGATQQLLNGLGRHGNRP
FT                   AHVHFFVSGDGHRKLTTQFNIEGDPLIWDDFAYATREELIPHVVDKTGGAALGMKSDAY
FT                   KEIEFDIVLTPLLDGRDNQVVHRPRASADA"
FT   gene            111846..113204
FT                   /locus_tag="Bmul_3238"
FT   CDS_pept        111846..113204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3238"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein;
FT                   Aromatic-ring-hydroxylating dioxygenase, alpha
FT                   subunit-like; KEGG: bch:Bcen2424_6524 Rieske (2Fe-2S)
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16922"
FT                   /protein_id="ABX16922.1"
FT                   /translation="MSANFDQANALDQLLASAVQDDKAAGLYRCRRDIFTNDALFELEM
FT                   KHIFERNWVYLAHESQIPNNNDYYTTWIGRQPIVITRDKNGELHAVINACAHKGAMLCR
FT                   RKHGNKGSFTCPFHGWTFSNSGKLLKVKDEKTTEYPVQFNTNGSHDLKKVARFENYRGF
FT                   LFGSLNADVLPLEDYLGEARVIIDQIVDQAPNGLEVLRGNSSYIYEGNWKMQMENGCDG
FT                   YHVSTVHWNYAATMGRRKEDGTKAVDANSWSRSVAGVYGFDHGHILLWTKTMNPEVRPV
FT                   YRHRDEIRARVGEVRADFIVNQTRNLCVYPNVFLMDQFSTQIRVVRPLAVDKTEVTIFC
FT                   FAPKGESAEDRALRIRQYEDFFNVSGMGTADDLEEFRACQAGYAGITSLWNDLSRGAPL
FT                   WIEGPDENATKMGLKPLISGERSEDEGLFVCQHEYWVRVMRDALKQEREEALS"
FT   gene            113201..113689
FT                   /locus_tag="Bmul_3239"
FT   CDS_pept        113201..113689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3239"
FT                   /product="benzoate 1,2-dioxygenase, small subunit"
FT                   /EC_number="1.14.12.13"
FT                   /note="KEGG: bur:Bcep18194_C7047 2-chlorobenzoate
FT                   1,2-dioxygenase; TIGRFAM: benzoate 1,2-dioxygenase, small
FT                   subunit; PFAM: aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16923"
FT                   /protein_id="ABX16923.1"
FT                   /translation="MSFDYHTICATLYREARLLDDRQWDEWLTCYTDDVTYWMPAWDDD
FT                   DRLTDDHESQISLMYYPDRGGLEDRVFRIKTERSGASTPEPRTSHSVTNVEVLAERGDE
FT                   VDVRYNFHTLNHRYRVTDHFFGTMFVTLRKVGDALLISYKKIVLKNDYIRQVLDVYHV"
FT   gene            113725..114753
FT                   /locus_tag="Bmul_3240"
FT   CDS_pept        113725..114753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3240"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bur:Bcep18194_C7048 ferredoxin/oxidoreductase
FT                   FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16924"
FT                   /protein_id="ABX16924.1"
FT                   /translation="MSSYKIALNFEDGVTRFIECKAGEKVLDAAFRARINLPMDCSDGV
FT                   CGTCKCRAESGRYDLGDDYIDDALTEDEKDEGLVLTCQMVPQSDCVIAVPTSSTACKTG
FT                   NSRFAATVAKIEPHNDAAIVLELDIDAAADAPVFLPGQYVNIDVPGSGQHRSYSFSSAP
FT                   GETKVSFLIKKIPGGVMSSWLEAAQPGDKLDLHGPLGSFYLRDVQRPLLFLAGGTGLAP
FT                   FLSMLEVLARAGSQQKIHLVYGVTRDLDLVQVDAIDAYVAKLPNFSYATVVADEASSHP
FT                   RKGWVTQHIPADALNDGDVDVYLCGPPPMVDAVRKHFDDTGVKPNSFHYEKFTPNVTAK
FT                   AA"
FT   gene            114750..115526
FT                   /locus_tag="Bmul_3241"
FT   CDS_pept        114750..115526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3241"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bch:Bcen2424_6527 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16925"
FT                   /protein_id="ABX16925.1"
FT                   /translation="MTMQRFAGKTLVVTGAAQGIGRGVALRAAAEGGQVLFVDRAEFVA
FT                   DVAAEAGTDRAAGFVADLETYEGARATMAFAASRFGAIDVLINGVGGAIRMRPFAEFEP
FT                   AQIDAEIRRSLMPTLYACHAVLPYLLERGRGTIVNVSSNATRGIRRVPYSAAKGGVNAL
FT                   TQALAMEYGEHNIRVVATAPGGTTAPPRRVPRNAAGDSAQEQAWMSEAVKQVTESTFFK
FT                   RYGTLDEQIAPILFLASDEASYITGTVLPVAGGDNG"
FT   gene            115618..116016
FT                   /locus_tag="Bmul_3242"
FT   CDS_pept        115618..116016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3242"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG:
FT                   bvi:Bcep1808_5829 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16926"
FT                   /protein_id="ABX16926.1"
FT                   /translation="MQQRKAIVPAGMEAVYEQIGYAPAIQVGDTIYVSGQIGRDRSMQL
FT                   VDGREAQIVQAFENLRYVLEAAGASLADVVDLTTFHTDMRDLPLFMQVRNRYFTADPLP
FT                   AWTAVGAHMLGGAPGYIVEIKAVAVLSR"
FT   gene            116096..117442
FT                   /locus_tag="Bmul_3243"
FT   CDS_pept        116096..117442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3243"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: xau:Xaut_4356 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16927"
FT                   /protein_id="ABX16927.1"
FT                   /translation="MTASATRSIPAWIDDAPLGAFQIRVLALCVLIALLDGFDTQAIAF
FT                   TGPAILASFALPAGALAPILTAGIVGMTIGAMTLGLVGDRIGRRPAIMIGLALFGAATL
FT                   ATAWASSPSQILVLRFIAGLGMGGCTPVLLALAAEYCPARLRGAVMTGVLLGLPAGAML
FT                   GGLLAARMLPAIGWQGIFVVGGGVPLAMLGAVALLLPESLCYLASRDDARAQQRVRATL
FT                   PKIATQPLPADAHFTVPDEASAKASVGALFRNGYARRTLGIWAIYLLNWIAWFMLLSWL
FT                   PTVLKAAGLTAQQAPVGTVIVNAVFIVCAIPLSIVLPRVNVRNLLCAMFAFGIAVALAL
FT                   GQAGTNWTLVFVLVGAAGFGVGGQQIALNYLIVGAYPTALRATATGWAIGMGRAGAIAG
FT                   SAIGGTFLAWGGAPGFFTALAVPLAGAALAAFGLRPGRTPGADLAAANR"
FT   gene            complement(117467..118417)
FT                   /locus_tag="Bmul_3244"
FT   CDS_pept        complement(117467..118417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3244"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2394
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16928"
FT                   /protein_id="ABX16928.1"
FT                   /translation="MELRHLRYFVAVAEERSFTRAAQRLHIAQPPLSRQIQQLEQLLDV
FT                   QLFERNSRPLKLTETGRFFYQHAAQLLAQTAELESMTRRVGKIERSLSVGFVGSTLYGM
FT                   LPKIIRRYRQQYAEVELSLHEMSTMDQIKALKEGRIDVGFGRIRLEDPSIRRVVLREER
FT                   LIAALPLGHPLCDAKPVLSLHDLLKETLIIFPKAPRPSYADQVLAAFHDRSLKPARVIE
FT                   TRELQIALGLVAAGEGVSIVPKSVYGLKRDDIAYKDLDDAKLVSPIIMSMRMLDQSEDI
FT                   ERMLQLIYDLYDEQGMEYMTPSEHEPTARRGPAPD"
FT   gene            118761..120839
FT                   /locus_tag="Bmul_3245"
FT   CDS_pept        118761..120839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3245"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   bam:Bamb_4884 carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16929"
FT                   /protein_id="ABX16929.1"
FT                   /translation="MNRASSTLIWIAVALLGAFAFGTIALAHGERVSALWIVIAAVCVY
FT                   LIAYRFYSRFIASKVMQLDGLRMTPAVKYNDGLDYVPTNKYVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYTPGMLWILAGVVFAGAVQDFIVLFISTRRDGRSLGDLVKMELGTVPGVIA
FT                   LFGAFLIMVIILAVLALIVVKALTNSPWGTFTVAATIPIALFMGVYTRFIRPGRIGEVS
FT                   IIGFVLLMASIAYGQHVHDSPTLAAWFTFSGTQLTWILIGYGFVASVLPVWLLLAPRDY
FT                   LSTFLKVGTIVGLAIGILIVAPELKMPALTKFVDGTGPVWSGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKLIDNETNARFIGYGAMLMESFVAIMALVAACVIEPGIYFAMNAPAAV
FT                   LGSTPEAVANTVTQWGFVLTPDMLTQTAKAVGETTIIARAGGAPTLAVGMAHILHQVIG
FT                   GEAMMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGTFHPALKRTESLPANLIAT
FT                   GLCVAAWGYFLYQGVVDPLGGINTLWPLFGISNQMLAAIALVLGTVVLFKMKRERYAWV
FT                   TIVPTAWLLICTLTAGWQKIFDANPKVSFLAHAAKLQAAVDEGKVLAPAKSIAQMKRII
FT                   FNDYVDAALAGLFILVVVSIAVYGLIAVLRARREAKPTVRETPYEAMPAAQALGSGR"
FT   sig_peptide     118761..118844
FT                   /locus_tag="Bmul_3245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 28"
FT   gene            120853..121059
FT                   /locus_tag="Bmul_3246"
FT   CDS_pept        120853..121059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3246"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   bur:Bcep18194_B0098 protein of unknown function DUF466"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16930"
FT                   /protein_id="ABX16930.1"
FT                   /translation="MFSDLGSDLRSAGRYLGQALRLMVGLPDYDTYVAHMRTTHPDREP
FT                   MTYEEFFRERQNARYGSGAGKCC"
FT   gene            121211..121831
FT                   /locus_tag="Bmul_3247"
FT   CDS_pept        121211..121831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3247"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: bps:BPSS0803 putative
FT                   hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16931"
FT                   /protein_id="ABX16931.1"
FT                   /translation="MHVGERFNSITHLVGALLSVAGLATLVTMGALDGDAYKVVSFSVY
FT                   GAMLCVLYAISTLYHSVRDPRLKAILQKCDHAAIYLLIAGSYTPFTLVTLRGPWGWSLF
FT                   GVSWGLAVFGIVQELTLGRRTRVLSMVLYVLMGWLALVAVRPLIHALPPVGTAWLVAGG
FT                   VIYSVGIYFFINDERIRHGHGIWHLFVLAGSLCQFVSVAMYVA"
FT   sig_peptide     121211..121303
FT                   /locus_tag="Bmul_3247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.782) with cleavage site probability 0.666 at
FT                   residue 31"
FT   gene            complement(121866..122303)
FT                   /locus_tag="Bmul_3248"
FT   CDS_pept        complement(121866..122303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16932"
FT                   /protein_id="ABX16932.1"
FT                   /translation="MTPSDADACARRIHDDWHAAVVARDLDALMALYADDAVLETPLIV
FT                   VTLPAHGSGVLHGKAAIGAFFAAGLRNPRNRLGRWYRTGLFFSNGRQLTWEYPRATPDG
FT                   DQVDLVEVMDLRDGLIAHHRVYWGWVGFQALTAAAAARDRG"
FT   gene            complement(122435..122788)
FT                   /locus_tag="Bmul_3249"
FT   CDS_pept        complement(122435..122788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3249"
FT                   /product="Dopa 45-dioxygenase"
FT                   /note="PFAM: Dopa 45-dioxygenase; KEGG: bch:Bcen2424_5557
FT                   aromatic ring-cleaving dioxygenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16933"
FT                   /protein_id="ABX16933.1"
FT                   /translation="MDFIDVNAIRNWHAHVYFDAASRDAAWTFRQTIEARFGAIIELGR
FT                   FHERPVGPHPAWSYQIAFGAAQFDEIVPWLVLNHGALDIFLHPNTGDDLRDHRDSAVWI
FT                   GKSYALNLDALAR"
FT   gene            123260..123637
FT                   /locus_tag="Bmul_3250"
FT   CDS_pept        123260..123637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16934"
FT                   /protein_id="ABX16934.1"
FT                   /translation="MRSLVSAAVLSGALVALPAVTFAQSAGTDWSPNATHLTWSAARAE
FT                   TDVQLMQMTRVGYRATSAGNQNYPLAMQRALERVRNPVPDRSAEEKAAMQARAARDAQT
FT                   GHPVRAFFVKTAYYLKGENTF"
FT   sig_peptide     123260..123331
FT                   /locus_tag="Bmul_3250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.761 at
FT                   residue 24"
FT   gene            123861..124349
FT                   /locus_tag="Bmul_3251"
FT   CDS_pept        123861..124349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16935"
FT                   /protein_id="ABX16935.1"
FT                   /translation="MKARKKTRRHAPLTREWLLPLPPAYARDISLKCHMALVALRGEHG
FT                   SEALLLRLRTSLYLVFLALDDVTGADASVDLCVDAERALDASTARAEQSGAWTLTDDEG
FT                   ALLERVLAANDACVDSLTRYRLAELWRHVCTFVASGQPKLIEHAAARMRAHRTEALAA"
FT   gene            complement(124540..125700)
FT                   /locus_tag="Bmul_3252"
FT   CDS_pept        complement(124540..125700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3252"
FT                   /product="hopanoid biosynthesis associated radical SAM
FT                   protein HpnH"
FT                   /note="TIGRFAM: hopanoid biosynthesis associated radical
FT                   SAM protein HpnH; PFAM: Radical SAM domain protein; KEGG:
FT                   bvi:Bcep1808_3717 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16936"
FT                   /protein_id="ABX16936.1"
FT                   /translation="MSIPLLQQVRVGAYIMRQHLSGNKRYPLALMLEPLFRCNLACNGC
FT                   GKIDYPDPILNQRLSVEECLQAVDECGAPVVSIAGGEPLLHNEMPEIVKGIMKRKKFVY
FT                   LCTNALLMEKKMDDYQPSPYFVWSVHLDGDKEMHDHSVSQDGVYDKAVAAIKEAKRRGF
FT                   RVNINCTLFNDAIPERVAKFFDTLKPIGVDGITVSPGYAYERAPDQQHFLNRDKTKNLF
FT                   REILKRGEGGKRWSFSQSSLFLDFLAGNQTYKCTPWGNPARTVFGWQKPCYLVGEGYVK
FT                   TFKELMETTDWDSYGVGNYEKCADCMVHCGFEATAVMDTIAHPLKAFAVSRKGVRTDGP
FT                   FAPDISIAKQRPAEYVFSRHVEIKLEEIQRAGKGKLQKPAKPATAA"
FT   gene            complement(125713..126654)
FT                   /locus_tag="Bmul_3253"
FT   CDS_pept        complement(125713..126654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3253"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: bvi:Bcep1808_3716 hydroxymethylbutenyl
FT                   pyrophosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16937"
FT                   /protein_id="ABX16937.1"
FT                   /translation="MRVILAQPRGFCAGVVRAIEIVDRALQQHGAPVYVRHEIVHNRHV
FT                   VENLRNKGARFVEELDEVPHGAVAIFSAHGVAQTVERDAQTRGLDVLDATCPLVTKVHV
FT                   QGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPVDTPVAYVTQ
FT                   TTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSGQVDVLLVVGATNS
FT                   SNSNRLREIGTESGVPSYLVADGSEVKAEWFAGVQTVGLTAGASAPEEMVEDVIGALRA
FT                   LGPVEVTTMAGREEKVEFKLPAKLMQAVAREV"
FT   gene            126813..127055
FT                   /locus_tag="Bmul_3254"
FT   CDS_pept        126813..127055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16938"
FT                   /protein_id="ABX16938.1"
FT                   /translation="MVPYLPCCNPGTGASAPARAEPSKLRGFAGCPSGRPASRSFQGLS
FT                   MTVDFSAYCPLARVVLSAIPTLIARSGARRQETCR"
FT   sig_peptide     126813..126875
FT                   /locus_tag="Bmul_3254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.611 at
FT                   residue 21"
FT   gene            127052..128239
FT                   /locus_tag="Bmul_3255"
FT   CDS_pept        127052..128239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3255"
FT                   /product="hopene-associated glycosyltransferase HpnB"
FT                   /note="TIGRFAM: hopene-associated glycosyltransferase HpnB;
FT                   PFAM: glycosyl transferase family 2; KEGG:
FT                   bch:Bcen2424_5551 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16939"
FT                   /protein_id="ABX16939.1"
FT                   /translation="MMPAIAFLLSGLSLVIWIVLLVARGGFWRAQPARPLPPEARGAAA
FT                   DAGWPAVVAVVPARNEADVIARAATSLLEQDYPGEFHLIIVDDHSDDGTADAARAAALA
FT                   ANRADRLTVLSAKPLPAGWSGKVWAQSQGIAAVRTLGLPADYLLLTDADIGHPPDAVAQ
FT                   LVTRAQAEQRDLVSLMVRLRCDSFWEKALIPAFVFFFAKLYPFSWINNPRNKTAGAAGG
FT                   CMLVKRTALEEAGGIESIRGALIDDCSLAAQIKHRGSGRHPIRLDLADRSVSLRPYDSW
FT                   RDIWNMIARTAFTQLHYSPWLLAGTLVGMTIIYLVPPVAALVYGARAWPAWLAWASMCA
FT                   AYAPMLRYYRRSPLWAPALPLVAAFYVGATFASAWRYWRGKGGQWKARVQAPVER"
FT   gene            complement(128338..129639)
FT                   /locus_tag="Bmul_3256"
FT   CDS_pept        complement(128338..129639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16940"
FT                   /protein_id="ABX16940.1"
FT                   /translation="MNLNDQIDALNTGVDQLLHDHHAAQQAARSAEAFARAAAAEAQAA
FT                   AQRHAAAEAEAQAAAQRHLDAAAEAEAAQQRHAEATAAAEAAARRHTDAEAASQRHAAA
FT                   IAEAEAAAQRHHAAAAEAEAAAQRHAAATAEAEAAAKRHAQATAEAEAATAEAEALAQR
FT                   HAQAIAEAEAAAQRHAQATAEAEALAKRHAEAIAEAEAAARRHADATAEAQAVAQRHTE
FT                   AIANAEAAAQRHDKAIADAEALVEAVMKDAMSTDASAAENGAEAAAPAPSADAVAHDVR
FT                   DAQEANDATPAAAEAQTEADAATETGTAVVSAAEADANAAPAPADKSTLHVSRPTQNEL
FT                   TLTINGESMTLHPEQLGQLIEELAHARASMQPEPPNGIPPGWRFVSTKNPMMAVQKQSN
FT                   GDRLLVMRHTGYGWVPFTFSPDVVIQMYMLLTQR"
FT   gene            complement(129748..130755)
FT                   /locus_tag="Bmul_3257"
FT   CDS_pept        complement(129748..130755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3257"
FT                   /product="hopanoid-associated sugar epimerase"
FT                   /note="TIGRFAM: hopanoid-associated sugar epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; NmrA family protein; Male sterility domain;
FT                   KEGG: bch:Bcen2424_5549 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16941"
FT                   /protein_id="ABX16941.1"
FT                   /translation="MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTN
FT                   VADLDAEIVTGDMRDETSMRAALRGVRYLLHVAADYRLWAPDPHEIERANLEGAVATMR
FT                   AARAEGVERIVYTSSVATLKVTSAGDPADENRPLTPEQAIGVYKRSKVLAERAVERMIA
FT                   DEGLPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFL
FT                   ALERGRIGERYILGGENLPLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKFT
FT                   KKEPFVTVDGLRMSKNKMYFTSAKAERELGYRARPYRDGLRDALDWFRGAGYLK"
FT   sig_peptide     complement(130684..130755)
FT                   /locus_tag="Bmul_3257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.905 at
FT                   residue 24"
FT   gene            130909..131205
FT                   /locus_tag="Bmul_3258"
FT   CDS_pept        130909..131205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3258"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: bch:Bcen2424_5548
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16942"
FT                   /protein_id="ABX16942.1"
FT                   /translation="MNRDELDERIETYYVRVRGVVQGVGFRHATVREAHALKLRGWVSN
FT                   LEDGSVEAMIQGPGAQIDRMLAWLRHGPPAARVTEVTFEERQTDKRFERFQQQ"
FT   gene            131212..132111
FT                   /locus_tag="Bmul_3259"
FT   CDS_pept        131212..132111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3259"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   KEGG: bam:Bamb_4871 RarD protein, DMT superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16943"
FT                   /protein_id="ABX16943.1"
FT                   /translation="MTGYPEAGRGVMLSVAASTLFALMSAYAKWLTPLTGLDIFAWRVL
FT                   WTAPGALALIALRGRWPALAALLSRSVRDWRLLVALPVTAALLGLQLWLFLWAPLHGRM
FT                   LEVSLGYFLLPLTMVLVGRFYYHERLDPLQWAAVACAALGVAHEVWATRAFAWPTLVVA
FT                   LGYPPYFVLRRRINADSLAAFAVEIVLLCPIAVAMVATSGTPVAPHPLLWSTLLPGLGV
FT                   LSTLALASYLKASRMLPMALFGILGYVEPVLLVAVSLLLLGETLTVAKLATYGPIWVAV
FT                   ALTAWHSAMLMRRLPTRT"
FT   sig_peptide     131212..131298
FT                   /locus_tag="Bmul_3259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.980 at
FT                   residue 29"
FT   gene            132488..133612
FT                   /locus_tag="Bmul_3260"
FT   CDS_pept        132488..133612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16944"
FT                   /protein_id="ABX16944.1"
FT                   /translation="MSMNAPPSATASWPRSGRLIEVDFFRGIVLLMIVVDHIGASVLSR
FT                   VTLHAFALCDAAEVFVFLGGFATASAYGAIAERQGARAAQRRFVRRAMQIYRAFLATST
FT                   LMLVVSAVLDHYGIDAPNLALDDVSVMLASPLTGLAELLTFQRQPYLASVLPMYVLFAL
FT                   ASPVLVPFARRHPWPLVVLSVASWLAAGWLGPELLDTDGFRWSFNPFAWQLMFVAGVLA
FT                   RCQPFYRRVALGRWGAAATGLACAVVLGCASYKLFSGLPVPEGVLKRDLALPRVVSFAA
FT                   VAWLMADWVRYGWIARVAQAVRPVVAVGQRGLICFVAGAAISLVIDSLLHPVAGSAELR
FT                   HIGVGLAADACALGLMMAVAGSGAWISRWRTAAA"
FT   gene            complement(134018..135538)
FT                   /locus_tag="Bmul_3261"
FT   CDS_pept        complement(134018..135538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3261"
FT                   /product="amino acid/peptide transporter"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bam:Bamb_4868 amino acid/peptide transporter;
FT                   TIGRFAM: amino acid/peptide transporter; PFAM: TGF-beta
FT                   receptor type I/II extracellular region; major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16945"
FT                   /protein_id="ABX16945.1"
FT                   /translation="MMHAPVSQTRSFTTVFLIEMWERFGYYGMAALLVLFMVDRLGFTD
FT                   SHANLTWGAFTALVYASPSIGGWIGDKVLGARRTMILGAAVLCAGYLMLSIPNDALAYM
FT                   YASLGVIVVGNGLFKANAANLVRRIYEGDDARIDSAFTIYYMAVNIGSTVSMLATPWIK
FT                   DHWGWHTAFAVCCGGMLLAILNFMLMHRTLAHIGSQPDDEPIRWKRLGAVAAGGVALAL
FT                   VTLYVLQHKQLAVASVWTAAVAILAIFAYMIAKSERSERAGLIAALVLIAQVILFFIFY
FT                   VQMSTSLTLFALRNVDPRFILFGTTLFTWSAAQFQALNPIWIMLLSPVLVWIYNAFSKG
FT                   GRDLPVAAKYALGFGAVAAGYLVFTISGRYAVDGRVSSWFMVGGYGLYSLGELLVSGLG
FT                   LAMIARYVPARMSGFMMGAYFVATGVSQYLGSVVANFAQMPSHDLPAVDSLPLYLSLFE
FT                   KLGWLAAIGMVLALLLLPMMNRLSRQHQRCAEERRDEALQAQNVAAVQ"
FT   gene            136039..136620
FT                   /locus_tag="Bmul_3262"
FT   CDS_pept        136039..136620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3262"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF861 cupin_3; Cupin 2 conserved barrel
FT                   domain protein; KEGG: bur:Bcep18194_B0114 transcriptional
FT                   regulator, XRE family with cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16946"
FT                   /protein_id="ABX16946.1"
FT                   /translation="MVPPTENSRSAVAAAALGSKIRALRQRLKRTLDETATAAGISKPF
FT                   LSQVERGLASPSLTSLAGIAQALGVTVQYFVDTPSEERSVCRGEQLRFFGFADSANLFA
FT                   RLTNLSEGRQLEAILVRMPPGQKRSEVTTHAGEEFLYVVEGEVSLTLEGKTFVLQAGDS
FT                   SHYQSTVPHSWANTAKIESVVVWVGTPRLF"
FT   gene            136799..138412
FT                   /locus_tag="Bmul_3263"
FT   CDS_pept        136799..138412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3263"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bam:Bamb_4866 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16947"
FT                   /protein_id="ABX16947.1"
FT                   /translation="MKSLHAMSAVLAALVLTTPAARAVTVPSNVTLAAQQDLTRQVPAE
FT                   VESLDPAHIESWTGNTIGLDLFEGLARIDAAGQVVPGVALSWERKTPQTWIFKLRHDAK
FT                   WSNGQPVTAADFVYSWQRLADPKTGSKYTILVEFVKNSKDIIAGKAAPSTLGVRAVDPY
FT                   TLEVTTDVPVAFFPELTAMAPLAPVNKDVVAKFGDAWTRPGNIVSNGAYQLVDWQPNNR
FT                   IVMTKDAKYWNAPKVVINKVTYLPVESDETAMRMYQAGQIDYSYSIPSGIFQQVSKQFG
FT                   AELRPGLQLATYYYYLNNSDPALKDKRVRQALSMVIDRDVLTSKLTQAGEKPMYGLMPN
FT                   GTKGVQPFTPEWASWPMAKRVETAKNLLKQAGYSDAKPLSFTLTYNTNDLHKKVALFAA
FT                   SEWRTKLGIDTKLENVEFKVLMKQRHDGKVQIARDGWFADYNDAMTFFDLIRCGSSQNT
FT                   VGYCNKQVDTLVDEGNQKLDDKARAALLTQAHDTAMKDTPMVPLFQYSADRLVKPYVGG
FT                   YSLKNVIDMRASQDMYLIKH"
FT   sig_peptide     136799..136870
FT                   /locus_tag="Bmul_3263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            138424..139362
FT                   /locus_tag="Bmul_3264"
FT   CDS_pept        138424..139362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3264"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bam:Bamb_4865
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16948"
FT                   /protein_id="ABX16948.1"
FT                   /translation="MLAYALRRTLWAVPTILAVVTVCYLLLHFTPGGPFDTEKQLSAAT
FT                   LANLNAKYHLDEPLWKQYLLYLGSLLRGDLGPSFRYVDWSVNDLVKKALPVSLGVGGLS
FT                   IPLSIVLGVLLGTVAAVRRDSVIDRFVMLIGNFGNVVPPFVLGPVLVWIFAILLKTSAG
FT                   NGWLPAGGWGDGGWQYRLLPIVLLTFINVSLLARVMRGSMIETLSSNYIRTARAKGLPG
FT                   STIVLRHALKPALMPVVSLFGTVCITSITAAVVTESVFALPGLGQLVVNGAINRDYTLV
FT                   LGLVVLTTVCAVLFNLLIDLAYAWLDPRIRY"
FT   gene            139376..140278
FT                   /locus_tag="Bmul_3265"
FT   CDS_pept        139376..140278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3265"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3704
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16949"
FT                   /protein_id="ABX16949.1"
FT                   /translation="MTPTTPAVGLPAQTDTPPRSRSPLALAFARFLHNRAAVFSLVLLA
FT                   LIVIACFVGPWLLAADPAASDWGAISLPPTLANQHWFGTDELGRDLLVRTLIGGRVSIE
FT                   VGLLGTLVSGLFGVAWGATAGFAGGRVDAVMMRIVDMMYAIPYLLIAILMMTLFGRSFL
FT                   LVVLTISAFSWIDMARVVRGQTLSLRNREFVDAARAIGVSPVSIVRRHIVPNLLGVVVV
FT                   YATVSVPNIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLESMPWLLLCPAVMLCVTL
FT                   YCVNFAGDGLRDALDPKDR"
FT   gene            140281..141273
FT                   /locus_tag="Bmul_3266"
FT   CDS_pept        140281..141273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3266"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bam:Bamb_4863 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16950"
FT                   /protein_id="ABX16950.1"
FT                   /translation="MAALLEVDNLGVRFTRKDAPPIDAVSGVSFSLEAGKTLGIVGESG
FT                   SGKSQTVMALLGLLAANGTTSGTARYRGEDLLAMDTRALNGVRGDRIAMIFQDPMTSLN
FT                   PFLTIERQMTETLQLHRGLSRKAATKRAIEALESVRIPDAARRIRMYPHEFSGGMRQRV
FT                   MIAMALLSEPEILIADEPTTALDVTVQAQIIDLLRELNRERGTAIVLITHDMGVVAGLA
FT                   DDVMVMYAGRTVEYARAESIFAAPSHPYTIGLLNALPRLTDADDAPLVAIPGNPPMPGT
FT                   APAGCAFAKRCTYAEDRCGTLRPALETYGAAGAVRACHRPLADLTGGLR"
FT   gene            141270..142289
FT                   /locus_tag="Bmul_3267"
FT   CDS_pept        141270..142289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3267"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B0119 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16951"
FT                   /protein_id="ABX16951.1"
FT                   /translation="MSVNERCEAGASGDTLLAVDGLKVHFRVPLGGYPWSPKGTLRAVD
FT                   GVSFDVKRGETVGLVGESGCGKSTLARALIGLVPMTAGTVSWRGEAVAPAQLRGTAMRR
FT                   EVQMIFQDPLASLDPRMTIEQVVAEPLVTHQPGLGRTEVRRRVIAMLERVGLNAHHLLR
FT                   YPHEFSGGQCQRVGIARALIGEPKLVICDEPVSALDVSIQAQIVNLLRDLQRDLSLSYL
FT                   FVAHDLAVVKAISQRVLVMYLGRVMEFGTRDDVYRVPQHPYTRALLDAAPTPDPARERA
FT                   RRPMLLAGEMPSPLNPPSGCAFRTRCPVAIDACAQDVPLPEVRHGSAARVACIRAGAA"
FT   gene            142485..143924
FT                   /locus_tag="Bmul_3268"
FT   CDS_pept        142485..143924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3268"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: bam:Bamb_4861
FT                   outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16952"
FT                   /protein_id="ABX16952.1"
FT                   /translation="MLLAWGLPALAGVSLTGVARADDAAPAPLTVAQAAPAAGASASVA
FT                   QATTPNAVVNAEASQAVTPSDEQPSAQSKSKGFIADSHLDFLFRNYADVLDSKGGPHRH
FT                   AWIQGVMANFESGYTTGLIGIGFDASLYAALKLDGGAGAGSMAHIAKGGGGSNQLAWAY
FT                   PGIYDVKARISNTVIKYGLQAVDNPFMEQHDNRALPPTFLGATIVSNEFKNVMLEAGSF
FT                   TKTDARGHTTLTNLTTQYGGTRVNRITYVGGTWDYSPNGEVALYANQADDVWHQYYASV
FT                   KHSIGSPQTIKWTGFGNVYSTHDTGDALQGKINNNAYSLSLAAQHGPHELLLAYQQILG
FT                   DQFFDYLNETNGIFLANSMDVDYNAPHEKSLQLRYTFYGKEAGLPGFKAMVWGVTGWGA
FT                   DGSAGAANDPSHSSIYWSNGAPVQGRHHEFGFIPSYTFQSGKLKDTKVTFIAMWHNGSA
FT                   HYSDATNREYRLVVNLPLHAF"
FT   sig_peptide     142485..142550
FT                   /locus_tag="Bmul_3268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            complement(143974..144969)
FT                   /locus_tag="Bmul_3269"
FT   CDS_pept        complement(143974..144969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3269"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   bch:Bcen2424_5536 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16953"
FT                   /protein_id="ABX16953.1"
FT                   /translation="MLRDLVAQYGPLLVFANVLAAAIGLPVPAMPTLVLFGAMAAMHPA
FT                   MIGSQLATVIALSVLGALLGDTVWYVAGRRYGGATLKTICRLSLSRDTCVKKTERFFGR
FT                   YGVRVLAVARFIPGLSLVSVPMAGALHTRYRTFVGYDALGAALWTIAGLVAGLVFYRQI
FT                   DWLFAGASRLGHAVLVVIIALLAVYAAIRWVRRRALIRQLAHARIGVDELDALLRDDAA
FT                   PVILDVRSPEHRKLDPFTIPGAQFADERQIADIVARYPLTQKFVVYCSCPNEVTAALMA
FT                   KRLLDAGFTDALALRGGLDAWRDTGRELASLATDLPPAANEPVAGLHKPA"
FT   gene            complement(145125..145394)
FT                   /locus_tag="Bmul_3270"
FT   CDS_pept        complement(145125..145394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16954"
FT                   /protein_id="ABX16954.1"
FT                   /translation="MRTTGSSGAMTLLTEHDPADGRELRSLRLEATGDGKSVLLIEIDE
FT                   RKPGIHREVRYEITPAELIAAIRSHGAELPGEHHGAASLARTPS"
FT   gene            complement(145664..147979)
FT                   /locus_tag="Bmul_3271"
FT   CDS_pept        complement(145664..147979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3271"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: bch:Bcen2424_5534 phospholipase C; TIGRFAM:
FT                   phospholipase C, phosphocholine-specific; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16955"
FT                   /protein_id="ABX16955.1"
FT                   /translation="MTSRRKFLQQTATAGLSAAALSAFPPSIRRALAIPAFHETGTIND
FT                   VKHVVLLMMENRAFDSYFGTFKGVRGYGDRFAVPSPNGRDVFYQTYTKTTPAVTVTPYY
FT                   LDASKGNAQRAGGTPHTWADAQAAWDHGRMNRWPDAKTTLSMGYYDAAEVPFQRALADA
FT                   FTLCDHYHCGMHTGTIANRLFYWSGTNGPNGISPVDGSRVKVAALNNQFNGGNDIGPST
FT                   QGWTWTTYADRLQQAGVSWKVYQSLIDNFGCNEMMGFRHWRAAIEQMPAARRPVYVAST
FT                   DITQPVTAAGPFYDPAIDDPLSPLAKGFGNTMPYGFLESFSDDIRNDRLPAVSWIIPPS
FT                   AYSEHPGPSSPAQGGWYVQAVLDALTANPEVWSKTVLLINYDENDGFFDHMPSPAAPSR
FT                   NADGTLAGGYTLLGADVAAEYHDFAPATSSQPVADGRPYGPGPRVPMWVVSPWSRGGWV
FT                   NSQVFDHTSTLRFLEKRFGVVEPQISGYRRAICGDLTSAFNFRSPNNEPLPTLAGRSTK
FT                   SQVDALSAAQQAAPKIAPPATPAPPAQTIGVRPSRALPYELHASAQADARSGMLRLKFA
FT                   NTGDAAAVFHVYDKLHLDRVPRRYAVEPGKTLHGDWAAMADDNGQYDLWVLGPNGYHRR
FT                   FTGDLTRIAAAGAPNPEIRVGYAGASGNLHLRLSNHGGGTVRFTIRSNQVYGPLAGHGA
FT                   TDTHGHGNGNGTGTTWTVTVRGGTQSELHWKLDSTGYWYDFIVTADHDARYARRIAGRV
FT                   ETGRHSVSDPAMGIADRF"
FT   sig_peptide     complement(147878..147979)
FT                   /locus_tag="Bmul_3271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.607 at
FT                   residue 34"
FT   gene            148521..149105
FT                   /locus_tag="Bmul_3272"
FT   CDS_pept        148521..149105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3272"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_4857 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16956"
FT                   /protein_id="ABX16956.1"
FT                   /translation="MKPAMLDGMRYAHRRMHLKERYLGRSPVMTDITIRHSDAHDVDAI
FT                   RTISAQPAVCKNTLQHPFPSFEKWQQRLERIREQGVSLVAEVDGAVVGHLALHTEPNPR
FT                   RRHAAGLGMMVDASHHGRGIGSRLLAAAIDLAENWLDVTRIELTVFVDNRAAIALYEKH
FT                   GFRIEGESAEYALRDGAYAAVYHMARLRTRP"
FT   gene            149119..150849
FT                   /locus_tag="Bmul_3273"
FT   CDS_pept        149119..150849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3273"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: bcn:Bcen_5329
FT                   thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16957"
FT                   /protein_id="ABX16957.1"
FT                   /translation="MPHIHSRIRSFSSGRLHRIVERFAERRDRRATRLPAIVFSTEPAS
FT                   MKTVIRTLTAACLFAASGAAFATAAPQEGVAASASSQRTHLPPGIAWQQGDVDDAFALA
FT                   KRSGKPLLLYWGAVWCPSCNQVKSTIFSQQAFKTRSSLFVPVYLDGDTESAQKLGERFK
FT                   VHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTAAHPVRQTLASALKDGASLTA
FT                   DEWRLLADYSWDTDGALPVPADRVAQTLQTLSQRARAAGAKAEAARFALKAAVVAASDD
FT                   PPQAGALDKSALADAWRTVLADRALSRADSDVLVTAPARVVAYLGSSDAQRAKLRGAYD
FT                   AALARLSADTTLSSIDRLMALHGRVLLARGEARSGAPLDAPALVDTVRRQIAASVQGAA
FT                   NPYERQALVSEGADTLTDAGLFDESDALLKAELPRSSTPYYFMSGLAANAKARGDKAAA
FT                   LDWYRKAYDTATGPATKLRWGATYFANAVQLAPEDSARIEGIAASVLAQAGKTRDAFYG
FT                   ANLRALTKVVAQLNRWRSGGAHDASVRTVVRQFDAVCGKLPAGDPQAAACAKLIQPVKT
FT                   "
FT   gene            complement(150874..151125)
FT                   /locus_tag="Bmul_3274"
FT   CDS_pept        complement(150874..151125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16958"
FT                   /protein_id="ABX16958.1"
FT                   /translation="MKRLIQAVALALAVSGPVIAHAQSNQPLTRAQVRAEVKALKQAGF
FT                   QPSDWFYPASIQSAEAKIAQQSGAGYGSARDASSESGR"
FT   sig_peptide     complement(151057..151125)
FT                   /locus_tag="Bmul_3274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 23"
FT   gene            complement(151490..152977)
FT                   /locus_tag="Bmul_3275"
FT   CDS_pept        complement(151490..152977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3275"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: bch:Bcen2424_5530
FT                   citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16959"
FT                   /protein_id="ABX16959.1"
FT                   /translation="MARNLHEPEPVRGAPSDRTTTKAIRRLPLSFVIVLAALAFLMFAA
FT                   YRGYSVILFAPIAALGAVLLTDPAAVAPVFSGIFMEKMVGFVKLYFPVFMLGAVFGKVI
FT                   ELSGFSESIVHAAIRYIGRSRANAVIVAVCALLTYGGVSLFVVVFAVYPFAAELYRQSN
FT                   IPKRLMPGAIALGAFSFTMDSLPGTPQIQNIIPTTFFKTTAWAAPALGTIGSLFIIVVG
FT                   LAYLEWRRRAAMAKGEGYGTSLVNEPERVEAQSLPNPALAILPLILVGVSNFAFTKLIP
FT                   QWYGAASYTVAPEVLPGVHAPVTTSIKTVVAIWSVEAALLLGIVLVVLTAFKRVSERFA
FT                   SGSKAAVGGALLAAMNTASEYGFGGVIAALPGFLVVGDALKSIPNPLVNAAVSVSSLAG
FT                   ITGSASGGMSIALAAMSDVFIKGAQAANIPMDVLHRVVAMASGGMDTLPHNGAVITLLA
FT                   VTGLTHRESYRDIFAVTVIKTLAVFFVIAVYYMTGLV"
FT   gene            153211..154707
FT                   /locus_tag="Bmul_3276"
FT   CDS_pept        153211..154707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3276"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase; KEGG: bch:Bcen2424_5529 sigma54
FT                   specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16960"
FT                   /protein_id="ABX16960.1"
FT                   /translation="MMNDWTRLPANYGDVLRRAAESLFRTFEDSSAGTVVVDRDARIVW
FT                   MNERYAARFGFADPQQAVGLDCEAVIPNSLLREVVSSGQPILLDIMETGREPLVVTRLP
FT                   LKNEAGETVGAIGFALFDQLKTLTPIFSRYAQLQQQLIATQRSLAQARRAKYTFASFVG
FT                   TSAASLETKRQARRAAQVDSPVLLLGETGTGKELLAHAIHAASARALQPLVTVNVAAIP
FT                   DTLLETEFFGAAPGAYTGADRKGRVGKFELADRGTLFLDEIGDMPLPLQGKLLRVLQDK
FT                   EFEPVGSNRIVRADVRIIAATSADLPALVAAGRFRADLYYRLNVLTIHAPPLRERASDI
FT                   AALVYVTLEELAAQHGRAAHCELTDDALRMLCAYPWPGNVRELRNTLERALMLSDRAII
FT                   DARALAPFLGPMRVHADAAPAVPTAAVTAGGGGVGSRSGSGDPHAGQHVSYADALAAWE
FT                   RQFFADALAACDGKVVEAAARIGIGRATLYKKLAALGIGR"
FT   gene            154741..155349
FT                   /locus_tag="Bmul_3277"
FT   CDS_pept        154741..155349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16961"
FT                   /protein_id="ABX16961.1"
FT                   /translation="MVRIGYGNDRETQAGRQARAHRPTGGDMKRIGIAGWVTLMLATSA
FT                   LAQTGDTDAPTARRNWYNDPFVALSRDIAECPLPLGPWTTKAEMEDDAHYRVERGTTCW
FT                   LAHRCTKPNSYLYDAPIADAAKAHFAGSERLRGTSLWITVQRRFVYVEGCANPGFDRQA
FT                   LQREFEALPDVEQVFIRITDDPARTLPYRTRGQPDRTPN"
FT   gene            155474..155695
FT                   /locus_tag="Bmul_3278"
FT   CDS_pept        155474..155695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16962"
FT                   /protein_id="ABX16962.1"
FT                   /translation="MALVAALGGCGGGAPLFTSDGRPTTQVQCTGDSWSNCTDNARAIC
FT                   NGEYDVLQQSTDNGTRSLLFACRKKSGY"
FT   gene            155796..156089
FT                   /locus_tag="Bmul_3279"
FT   CDS_pept        155796..156089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3279"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bch:Bcen2424_5527 histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16963"
FT                   /protein_id="ABX16963.1"
FT                   /translation="MATYRQLSVQLERLQQKIDKEREKAIADAIAEIKAKIDEFDITPE
FT                   ELGFRPLGAPSAKPKRTLPPKYRNPKTGETWSGRGRAPAWLGKNRTRFLIAD"
FT   gene            156505..159045
FT                   /locus_tag="Bmul_3280"
FT   CDS_pept        156505..159045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3280"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; CoA-binding
FT                   domain protein; KEGG: bch:Bcen2424_5525 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16964"
FT                   /protein_id="ABX16964.1"
FT                   /translation="MRGTRRVAGRCMMRGLTAVGQLAVRHIGSRGPFAYAWDSRIGVRR
FT                   GAVCRSGRVSSANGADVTVRHLDALFQPRSVAVVGASSRAGSIGAMVWSRVLDGAFDGP
FT                   VWPVNPKHRELDGHAVVPDVDRLPAPPSVAVICTRPATWAGIVRKLGELGTRVAIIVGD
FT                   ARSDADRAALDRALKAAKPFVLRIVGPGSLGVLSPARHAHFGAPAYTVRSGGVAWVSQS
FT                   NALTNAVLGWANARGLGFSHVVALGGEADVDAGDVLDYLASDPGTRAILLELDSVRAAR
FT                   KFMSAARAAARNKPVLALRTGRADPGDGLYTAAFQRAGMVRVDALDDLLDEIETLGVGR
FT                   VTARGAATLVTSDAGVAKLAVDAIDDVRVALAEWPAEVAAAMSAALPHLDTPGNPLTLG
FT                   DDARPEHFAAAIKALAPFPQTGTLFVVHSTSHSAPADAVARVLIDNRQHAHRGVLACFF
FT                   GAVDAATRDALHASGIPVHSTPQRLARAYARLVDYNLGRQLLMQTPEGTPSHPAACIAT
FT                   AQADARRMLDEGRHALTGDAALHWLSHFGLHGEAEEPAEAAIVDVAVDMYDDSNFGPVF
FT                   RYAVPPADGVSAPFVVYGLPPLNTVLARAVIARSPYARRAPIEPVLDALIALSQVVCDV
FT                   REVVAMSLTLRVSPSRVGVIAPRMTLAAGRSRLAIMPYPRALERTLDWRGETVTIRPIR
FT                   PEDEPAHSELLRAMTPEDLRMRFFGAVRSFDHSQIARMTQIDYDREMAFIAVVNDASGQ
FT                   AHTLAVARAVSDPDNETAEFAIAVRPDQKGKGLGRLLLTRIIDYARSRGTAWMIGEALR
FT                   ENAPMIALAKSCGFEVSATEEPGVVGFRMKLQPE"
FT   gene            complement(159678..160229)
FT                   /locus_tag="Bmul_3281"
FT   CDS_pept        complement(159678..160229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16965"
FT                   /protein_id="ABX16965.1"
FT                   /translation="MDVMAKLLNDQEFQRFSELQQKQASFTITPEEADELRDIVARAQK
FT                   KRDDRAAAMQAIESYIEQFDITPDELFSPEQIGDAARTYGLITATKKERVLPPSITFNG
FT                   KPYQWTKTLPDDVRSALFDAFTSGESVKRFIAMPKDAARCALTIARLERETGAVYADTH
FT                   LEELAISRAQVNDAAAKLAA"
FT   gene            complement(160475..161248)
FT                   /locus_tag="Bmul_3282"
FT   CDS_pept        complement(160475..161248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3282"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bur:Bcep18194_B0136 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16966"
FT                   /protein_id="ABX16966.1"
FT                   /translation="MRALDRYRAPALDKGLDILELLSEQKEGLTRTEITKELGRNASEI
FT                   YRMLERLVARRYVMRSPGGDRYTLSLKLFALAHRHPPMNRLIAEALPPMQRFADAAEQS
FT                   CHLSVYDRGSLLVIAQVDGPGSWGVSVRLGSRVGLADTASGSVMLAFQSAEHRAHMLAE
FT                   HRKVQGEAPLNEAELASACESIRQAGFLQQDSRQAYGVTDLSAPLLGPSGQAIAVLTCP
FT                   YMRRIDAHAAPPIDEVVERLRDTARNLSMYRTETC"
FT   gene            161961..162809
FT                   /locus_tag="Bmul_3283"
FT   CDS_pept        161961..162809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3283"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bur:Bcep18194_B0137 5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16967"
FT                   /db_xref="GOA:A9ALD1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ALD1"
FT                   /protein_id="ABX16967.1"
FT                   /translation="MKLLRYGPPGQEKPGILDADGRIRDLSAHVPDLAGDVLSDAGLAR
FT                   LRALDPATLPLVSGEPRIGACVGRVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSS
FT                   ICGPNDGIDIPKGSVKTDWEVELGVVIGAPCKDVDEARALDYVAGYCVVNDVSEREWQI
FT                   ERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQSLDLWLEVDGHRYQNGNTRTMVFTVAQ
FT                   LIAYLSSCMTLQPGDVITTGTPPGVGMGIKPAPVYLKAGQMVRLGIEGLGEQLQLTRAA
FT                   R"
FT   gene            complement(162953..163336)
FT                   /locus_tag="Bmul_3284"
FT   CDS_pept        complement(162953..163336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3284"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B0138
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16968"
FT                   /protein_id="ABX16968.1"
FT                   /translation="MIDHLSFGVAQIERSRTFYDNTLGALGYKRLHTAADSLGYGADEP
FT                   SLRLTRTPRPVVADPESGLHISFKAASPVEVDAFYRAALAHGGQDNGGPGKREQYGPGY
FT                   YAAFVVDPDGYRIEAHCELDNIV"
FT   gene            163436..164074
FT                   /locus_tag="Bmul_3285"
FT   CDS_pept        163436..164074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3285"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   bam:Bamb_4844 protein of unknown function DUF1470"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16969"
FT                   /protein_id="ABX16969.1"
FT                   /translation="MAVSTIADMNARRAPTGPDCLIPAPADTLSIDFANTLYWRGTEPP
FT                   TETLRTIDDLFAWCRDQAGVPACVVDACRARIDDEPAWLAHALALREALYRLFLAQAEQ
FT                   REPQAEDLKQVGAFLAEASPRVALARVDGRYAWRIEPPGATLAALLSPVLWSATDLLGG
FT                   LRLAKVKRCANDACQWLFVDDSKNGSRRWCSMSSCGNRAKAYRHYHKTD"
FT   gene            complement(164135..166117)
FT                   /locus_tag="Bmul_3286"
FT   CDS_pept        complement(164135..166117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3286"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /note="KEGG: bam:Bamb_4843 sigma54 specific transcriptional
FT                   regulator, fis family; TIGRFAM: propionate catabolism
FT                   operon regulatory protein PrpR; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; Propionate catabolism activator domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: PAS domain containing protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16970"
FT                   /protein_id="ABX16970.1"
FT                   /translation="MDLSSIKPAGAADRTVRPRIWAMGISRLRDLFREIAGEFDERADV
FT                   RIVTRAYEDALGAIAEAGTARPDVIVAAGSNGGFLKTRAQVPVVVVSPTGFDVMQALAR
FT                   ARRDATRIALVSAGDTPPEVRRFVAAYGLDVQFASYQTAQEAEACVHDLRDRGIETIVG
FT                   PGLVTDLAASAGMGAVFLYSHASVRRAVETALEVAYATHAEAFRRQRLDTLLQHLRDGV
FT                   VALDAQGRVEAINERLASALGVEPSAAVGRALVDLRPELRTLRGEDGDALATVRGVRYV
FT                   VHRGPLVDRGVTSGSVLTFQESRAVERLDRALRSQPNTQQFAARYSLDDVVGASAPMTR
FT                   VRELVRRYAKSDATVLVLGESGTGKEMIAQSLHALSARRSYPFVAVNCGAFPEALLESE
FT                   LFGYEEGAFTGARRGGKTGLFEAAHRGTLFLDEIGEMPPSLQSRLLRVLQEREVIRLGS
FT                   TEPIRIDVRVIAATHRPLLAAVEAGTFRADLYYRLNILNVGLPPLRERAADIPALAATL
FT                   LVQAARREPRLAERLRDADDAARVLGAVQPTLTRYRWPGNVRELQNVIERIAVELADAA
FT                   DEGDAAAPCAALAPDALQTIAPELFAAPPDGGDAEDAQTLQARRRRAEADEIRAVLDAC
FT                   GGDRDRACAMLGISKTTLWRKLSAK"
FT   gene            166289..167182
FT                   /locus_tag="Bmul_3287"
FT   CDS_pept        166289..167182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3287"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG:
FT                   bch:Bcen2424_5517 methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16971"
FT                   /protein_id="ABX16971.1"
FT                   /translation="MSNTHLQSAGAKFRAAVAAEQPLQVVGAITAYAAKMAQAVGFKAV
FT                   YLSGGGVAANSLGIPDLGISTMEDVLIDANRITNATDLPLLVDIDTGWGGAFNIARTIR
FT                   SFINAGVAAVHIEDQVGQKRCGHRPGKECVPTDEMVDRIKAAVDARTDDQFVIMARTDA
FT                   AAAEGIDSAIERAVAYVEAGADMIFPEAMKTLDDYRRFKAAVKVPILANLTEFGSTPLF
FT                   TVDELREANVDIALYCCGAYRAMNKAALNFYETVRRDGTQKAAVPTMQTRAELYDFLGY
FT                   HEYERKLDELFAQGKK"
FT   gene            167237..168409
FT                   /locus_tag="Bmul_3288"
FT   CDS_pept        167237..168409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3288"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.5"
FT                   /note="KEGG: bam:Bamb_4841 2-methylcitrate synthase/citrate
FT                   synthase II; TIGRFAM: 2-methylcitrate synthase/citrate
FT                   synthase II; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16972"
FT                   /protein_id="ABX16972.1"
FT                   /translation="MSETKDAAAPAAAGAFKPKKSVALSGVTAGNTALCTVGKTGNDLH
FT                   YRGYDILDVAESCEFEEIAHLLVHETLPNLTELAAYKAKLRALRGLPNALKAVLEQIPA
FT                   SAHPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADRLMASLGSMLLYWYHFSHNGKRIE
FT                   TETDDDSIGGHFLHLLHGKTPSKSWVDAMHTSLILYAEHEFNASTFTGRVIAGTGSDMY
FT                   SAITGAIGALRGPKHGGANEVAYEIQSRYRSPDEAEADIRRRVENKEVVIGFGHPVYTI
FT                   SDPRNKVIKGVAHKLSKEAGDLKLYDIAERLESVMWDAKKMFPNLDWFSAVSYHMMGVP
FT                   TAMFTPLFVISRTSGWAAHIIEQRVDNKIIRPSANYTGPDDLQFVPIEKR"
FT   gene            168487..171087
FT                   /locus_tag="Bmul_3289"
FT   CDS_pept        168487..171087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3289"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /EC_number="4.2.1.3"
FT                   /note="KEGG: bvi:Bcep1808_3678 2-methylisocitrate
FT                   dehydratase, Fe/S-dependent; TIGRFAM: 2-methylisocitrate
FT                   dehydratase, Fe/S-dependent; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16973"
FT                   /protein_id="ABX16973.1"
FT                   /translation="MMNTAYRKPLPGTSLDYFDTRAAVEAIAPGAYDTLPYTSRVLAEN
FT                   LVRRCDPAILADSLKQIIERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGG
FT                   DPAKVNPVVPVQLIVDHSLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIEWTKKAFENV
FT                   DVIPPGNGIMHQINLEKMSPVIQVQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEA
FT                   ENVMLGRASWMRLPDIVGVELTGKRQPGITATDIVLALTEFLRKEKVVGAYLEFRGEGA
FT                   ASLTLGDRATISNMAPEYGATAAMFFIDGQTLDYLRLTGRSDEQVKLVETYAKEAGLWA
FT                   DTLKHAQYERTLTFDLSSVVRNMAGPSNPHKRLPTSDLAARGIAGQWEEKPGQMPDGAV
FT                   IIAAITSCTNTSNPRNVIAAGLLARNANARGLVRKPWVKSSLAPGSKAVELYLKEANLL
FT                   PELEKLGFGIVAFACTTCNGMSGALDPKIQQEIVERDLYATAVLSGNRNFDGRIHPYAK
FT                   QAFLASPPLVVAYAIAGTIRFDIEQDVLGHDRDGKPVTLKDIWPTDEEIDAIVASSVKP
FT                   EQFRTVYEPMFARAADAGERAAPLYDWRPQSTYIRRPPYWEGALAGERTLKGMRPLAVL
FT                   GDNITTDHLSPSNAILPDSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTLV
FT                   NEMAVVDGAVKKGSLARVEPDGKVMRMWEAIETYMNRKQPLIVVAGADYGQGSSRDWAA
FT                   KGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTNRKTLGIDGTETFDVIGERTP
FT                   RADLTLVIHRRNGERVDVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESSQAAA"
FT   gene            171113..172303
FT                   /locus_tag="Bmul_3290"
FT   CDS_pept        171113..172303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3290"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: bch:Bcen2424_5514
FT                   putative AcnD-accessory protein PrpF"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16974"
FT                   /protein_id="ABX16974.1"
FT                   /translation="MAHIPQIRIPATYMRGGTSKGVFFRLQDLPDAAQAPGAARDALLL
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVIVSKSTRPGHDVDYLFGQVAIDRAFVDWTGNC
FT                   GNLSAAVGPFAIAGGLVDPARVPRDGVATVRIWQANIGKTIVAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFMDPAADEEGAGGAMFPTGNLVDDLTVPGVGTLKATMINAGIPTI
FT                   FVDAEAIGYKGTELQDAINGDAKALEKFETIRAHGALRMGLIDTLDEIATRQHTPKIAF
FT                   VAKPADYVASSGKRVNAGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAA
FT                   GGGERNAVRFGHPSGTLRVGAEAKFENGEWTVTKAIMSRSARVLMEGWVRVPGDAF"
FT   gene            172465..173514
FT                   /locus_tag="Bmul_3291"
FT   CDS_pept        172465..173514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3291"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bur:Bcep18194_B0153 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16975"
FT                   /protein_id="ABX16975.1"
FT                   /translation="MSLDAPLSGVHIVEFEGLGPGPLAGWMLAGMGARITLVARPAGRS
FT                   SAPDALRSRDGDLLREGKTIVELDLKSAAGREAALDLVAHADALIEGLRPGAMERVGLG
FT                   PDACARRNPKLVYARMTGWGQHGPLASAAGHDLNYVALTGMLSLSAPCDGRPGLPPTVV
FT                   GDAGGALGLAFGIVCALFDVRAGGPGRAVDGAIVDIVSMLGTLALWARANGQLDGAQPS
FT                   LFHDAPFYDVYRCADGECVTIGALEPPFYALLIERLGLTDVDPASQYDRTRWPALKARF
FT                   AEVFAQHPSPHWRALLEGTDACFAPVLSVADAADHPHNVARGLYRTDRDGNLRARVAPR
FT                   FMPLNDDSA"
FT   gene            complement(173652..174095)
FT                   /locus_tag="Bmul_3292"
FT   CDS_pept        complement(173652..174095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3292"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bur:Bcep18194_B0156 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16976"
FT                   /protein_id="ABX16976.1"
FT                   /translation="MTDIVDHARGALRAQPFSMLLGTELMHIGDNEVSLCLAVRDELRQ
FT                   QHGFVHGGVISYLADNALTFAGALALGPRVVTGEYKINYLRPAVNGTLVARAKLVYAGR
FT                   HQATCQCHVFVIDGDHERLVAIAQGTINRVGDGKNPGAPQETA"
FT   gene            174343..175962
FT                   /locus_tag="Bmul_3293"
FT   CDS_pept        174343..175962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3293"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: ligand binding Tar domain protein; histidine
FT                   kinase HAMP region domain protein; chemotaxis sensory
FT                   transducer; KEGG: bur:Bcep18194_B0157 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16977"
FT                   /protein_id="ABX16977.1"
FT                   /translation="MFGKIKLASGLLGVLTVFCVFLFAIEALGFWALASTRSGVDDLSN
FT                   VAIAQVDSANQATERLLDARVNLSRAGTRMVRGGPKPDDIIRHASDSLVEADKAFAVLT
FT                   SARPVDEANRARVAALVERYRALRGALGELVQFLDADNIQAFLDQPTQRFQDAYVAELR
FT                   RFADYGAASSRTALDTIDGGMQWFKWVGIVLLIAMLATSAAIYAAARRAVVAPLDEAGR
FT                   HFERIAQGRLDEAVRARGVFEIDRMLRGLAAMQASIADTVRTVRQASDAIHVGAGEIAG
FT                   GNADLSARTGTQAASLEETAASMEELTATVRQNTDSARAASALADAALEATSHGGGVVD
FT                   SVIERMRGIAQSSGRIAEIISVIDGIAFHTNILALNAAVEAARAGEQGRGFAVVAGEVR
FT                   SLAQRSAQSAKEIKALIEESVAQINGGAELVERAGDAMRTVSESITRVVQTMSEITAAS
FT                   VEQTSGIEQVNQAVTQMDQLTQQNAALVEEVAAAAASLNEQTAQLMRAVSVFELGDARG
FT                   AYAPRVATSAAEPRYAPVGSAA"
FT   sig_peptide     174343..174417
FT                   /locus_tag="Bmul_3293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.792 at
FT                   residue 25"
FT   gene            complement(175935..177119)
FT                   /locus_tag="Bmul_3294"
FT   CDS_pept        complement(175935..177119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3294"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   bch:Bcen2424_5499 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16978"
FT                   /protein_id="ABX16978.1"
FT                   /translation="MFYPWARSRRFGPRRHESIPAHNPAMSVSDSASAQAAQLRHHFAH
FT                   VVLPIWRGSGFDHTLRLPFEAVDPATHAPLPVTRYRAMACARQLFVFAQAGDAAHAAVL
FT                   FDTLRSRFRDAQHGGWFYSVDAHGAPLDTTKDLYTHAFVVFACAAWYAASGDGDARTVA
FT                   EETAALIQDRFAPQPGDALLDAARAADFSSSGSGALQNPLMHLTEAWLAAADAFGDTAF
FT                   DDALARTAAAVERTFVDPATGCVAELPLGAADNRFEPGHQFEWFYLVDAAGARLAQTTL
FT                   PEALTRAFAFAERHGVDPQTGGVCAALDAQGTCIDGTQRIWAQTEYLRALATHGGTPAS
FT                   APLATQIARFAARFLHPRGWFECKTADGQVSRADMPSTTPYHLATAYAALPTGA"
FT   gene            177157..177852
FT                   /locus_tag="Bmul_3295"
FT   CDS_pept        177157..177852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3295"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bvi:Bcep1808_3670
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16979"
FT                   /protein_id="ABX16979.1"
FT                   /translation="MLGNLELVMRLVLAAALGSVIGFERERLSWAAGLRTHMLVCVGSA
FT                   LIMIVSAFGFADVLGREHIELDPSRMAAQVVSGIGFLGAGSILLRGEIVRGLTTAASLW
FT                   SVAAVGLAVGGGLYVGAIAATIIILIILAGLKPLERRYFTVRQRRQLALTVLGGTLTFD
FT                   SLHAALGPDSARVKQFIVQRADETGEHDDVRIALARVSDLEFRAICDKLRALPGVTRFD
FT                   DGQGASGDE"
FT   gene            177936..179390
FT                   /locus_tag="Bmul_3296"
FT   CDS_pept        177936..179390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_5363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16980"
FT                   /protein_id="ABX16980.1"
FT                   /translation="MTESVTTPRSRSRSGRSSTRARERSAAAARSVSAAAAQPERAAAG
FT                   DAARDERTLDLFGDPVLAPHDDVSALGSSSRDDDVRASALTLERADDSEGDSARQATLD
FT                   GFEAEAAVSTVAGAGKAIAPTIAPRHDEDRDGMTADGQPTAVHFSDGVAPDETVAKTTE
FT                   PIPAAEAGANDAAANRDVDAPVAHASTRVLDDVAALDVAATRLADAAARNDENPSDAGN
FT                   AAPLGGVHESAQRNPASVVDDVPVAEAIAEAGVAAVSAAADTIPSTQRAEIAADATRAA
FT                   PAPRRRSEPSAPKARRAASVSARRAKDDVPEEPAATVAATAPADSQPASDKRSSAERPT
FT                   DGPATPASAATFVTKPSIDTSPAAPDARGLVSSDRLAALQADVTRLTQAADREKRRVNR
FT                   LLLALAIVVLATLVALIMQTCQIAHLNQDAAAQQLRIDRLAADLSTQQASVMTLQEHHE
FT                   ALLSQVDRLQRAVSRDAAVKRVRRAR"
FT   sig_peptide     177936..178064
FT                   /locus_tag="Bmul_3296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.415 at
FT                   residue 43"
FT   gene            179566..179718
FT                   /locus_tag="Bmul_3297"
FT   CDS_pept        179566..179718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16981"
FT                   /protein_id="ABX16981.1"
FT                   /translation="MSFIFALLQKIDDLFVSPHLPLDAEYSYVARRAEADRVRRSHAPL
FT                   CLYRR"
FT   gene            179758..180315
FT                   /locus_tag="Bmul_3298"
FT   CDS_pept        179758..180315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3298"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bvi:Bcep1808_3667 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16982"
FT                   /protein_id="ABX16982.1"
FT                   /translation="MPLPCAAPARCARYTGSSIPHTDERAMLQMRPMTAGEFRAYRARA
FT                   IEGYARDLVASGQNTTEDAAPRAQRCFDTLLPDGLSTPGQTLVSLVDSTSGETVGDLWY
FT                   AIVTEGPHRTLFIYDLDIVPSRRRQRWATRVLDALEAEARRYGVTEIGLSVFNHNVAAR
FT                   ALYRACGFVPITTTLIKPVVSS"
FT   gene            complement(180409..183957)
FT                   /locus_tag="Bmul_3299"
FT   CDS_pept        complement(180409..183957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3299"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper ion binding protein;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bch:Bcen2424_5494 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16983"
FT                   /protein_id="ABX16983.1"
FT                   /translation="MTESLASASLHTIELGVDGMHCGGCTGRVQRALAGVPGVVDATVD
FT                   LERQAATITARETVEPARLVDAVGAAGYRATVREAVAGSDAMAAQGKHEGSPGAAATVL
FT                   LDIDGMTCASCVSRVEKALVKVPGVTRASVNLATERATVEASADVSAAQLVEAVEQAGY
FT                   GATPIESAPAVVTSAPVDHKAAHSVELDIDGMTCASCVSRVEKALAKVPGVAHASVNLA
FT                   TERATVEASADVSAARLVEAVEQAGYRATSVESAPPAATSAPVDHKAAHSVELDIDGMT
FT                   CASCVSRVEKALEKVPGVTHASVNLATERATVEASADVSAARLVEEVEQAGYGATPIEP
FT                   ARAAVTSEPADHKAARSIDLDIDGMTCASCVSRVEKALAKVPGVTHASVNLATERATVE
FT                   ASADVSAAQLVEAVEQAGYQAMPVESAPSPARSASAEREATHSIDLDIGGMTCASCVSR
FT                   VEKALEKVPGVTHASVNLATERASVRAAGPLDVDALIAAVTTAGYRATLTPAPAADANA
FT                   AASSTRAAPDRDARKRQEALRERNLVIASAVLSAPLVAPMLAAPLGIDAMLPGWLQLVL
FT                   ASIVQFGFGARFYRAAWHAVKARAGNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFE
FT                   ASAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPDRARIVENGVERDVPLAQVRVGTI
FT                   VSVRPGERLPVDGRVVSGRSHVDESLITGESLPVPKDDGDAVTAGSINGEGALVVETTA
FT                   IGAETTLARIIRLVESAQAEKAPIQRLVDRVSAVFVPAILGIAVLTLVGWLLAGAGAET
FT                   AILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRATVIAFDKT
FT                   GTLTEGKPSVTAFDAVDLPRDDALALAAAVQRHSDHPLARAVVAAYDAQRNAQAAPVAT
FT                   DARAVAGRGVEARVDGRLLALGSTRWRDELGIVVPPALDARAAELERAGNTISWLMHAD
FT                   APRAAIALIAFGDTVKPGARDAIAALAARHVASVLVTGDNRGSAAAVAAALGIDEVHAQ
FT                   VLPDDKARVVASLKREHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLM
FT                   RGDPALVADAIDISKRTYRKIQQNLFWAFVYNLIGVPLAALGWLNPVIAGAAMAFSSVS
FT                   VVTNALLLRRWKGRAR"
FT   gene            184364..185791
FT                   /locus_tag="Bmul_3300"
FT   CDS_pept        184364..185791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3300"
FT                   /product="protein of unknown function DUF1214"
FT                   /note="PFAM: protein of unknown function DUF1214; protein
FT                   of unknown function DUF1254; KEGG: bam:Bamb_4826 protein of
FT                   unknown function DUF1214"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16984"
FT                   /protein_id="ABX16984.1"
FT                   /translation="MIEHLRESLSLRRACASLAMAALLAGCASQPDAIQRKTGWMRTEV
FT                   ADSYVYAYPLVLMDVAKDAATGGDGAQPGQAPLNTLRHAQALPPVGAVNPPLPGVDTLD
FT                   STGWLDVAAEPVIVTLPDTRGRYWDARALDMWTNVLWSASSAAVRGSRRSQTIAFVAKD
FT                   WQGTLPKGTVRVDVPTRHAWLEVRLQTSGGRDLTAVKKLQRAMRIVPLSVYTGDTRGAS
FT                   VAVHTGSAPADALTGGTPAEQVAALDPKAFFTRFARALQDNPAPDDDPHAQQLLDDIGV
FT                   SAGNPVQWTGDRLTAATAGVAEGRARLAAPPPNLLSANGWSWIGDTAGKYGQDYALRAY
FT                   AAYTQFGTATRDDETIAIVRVDSDGQPLNGANRYVLHFAPGALPPVRGFWTLTPYTPGG
FT                   ALPDVGAARRSLGDRDRLRRNHDGSVDIVVSAAPGAARAANWLPAPRADFALALRLYAP
FT                   KPQATDGSWMPPAVVRK"
FT   sig_peptide     184364..184450
FT                   /locus_tag="Bmul_3300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.419 at
FT                   residue 29"
FT   gene            185941..189735
FT                   /locus_tag="Bmul_3301"
FT   CDS_pept        185941..189735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3301"
FT                   /product="protein of unknown function DUF748"
FT                   /note="PFAM: protein of unknown function DUF748; KEGG:
FT                   bch:Bcen2424_5492 protein of unknown function DUF748"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16985"
FT                   /protein_id="ABX16985.1"
FT                   /translation="MASPDKEIPSTTLHALGGVARSRRTRRIGLGILIFLVLFGLLGFF
FT                   AAPPLIRHVAEQQLSEQLGRPATIRRIALNPYTLNLEADDIHVGERGGQGDFVDIGKLV
FT                   VRPSWSSLFRGAPIVNEVRLDSPRFRIVRYDAQRFNFTDLIEKFSTPPKPDSKPTLFSV
FT                   SNIQVNNGRIDFDDRLLNEKHVVDEWTLGVPYIATLPSKTDIFVEPKLRMRFDGSPIAI
FT                   DGKTKPFAQSRESEIALKFDKLDVPKLISYVPAKLPVAVTSGLLSSDLSVNFVMSGDTP
FT                   ALRVSGTVDLADAKVTGPASEPLFAARGVHVAAAGLEPLRNAMHFDEIRLDRPVIDLSR
FT                   DKQGVLNVEKLAGSPAAAPKPASAAGNGASRAAVAAASAPAASGAQAADTKTPPLDLTI
FT                   RHVAIDGGTVNLDDRVPATPTALSLTKLAATLDGFALQRKTPAKYTLSTSLSRGGDLKA
FT                   EGAVDVAAKQVDTKLVVDALALVPLQPYLGEATRARVLDGALGATINAKADWGKTPLDA
FT                   QVADSELSLKSLKLATPDAKSPAIVLPDARAKIAKVDVAARTAEIASVDAHGLALDVKR
FT                   LKNGNIDLAAFASPAQPAVPQRTVARKAQAAAPSWHYRIDALNVKEASANFTDLSTPRP
FT                   VKLAIKPLDLSVQKLGDDMTKPLPVQLKATLNRKGSLNVTGDVTAQPLKLALKIDGNRV
FT                   DAAAFEPYFGSALNATIASALLNAQGNLTFAQAKDTMRAAYRGNVALVDVRMLDKATSD
FT                   PFAGWRSLALTNLKANYDDKGTDVDAARVTFSNFYGRVLLDAQGRLNLNDIVAKETGPA
FT                   QSLTRDASKSEPVPLSPGVTPPAAAQAASAAAAQQASAPAAASATVVVKAAPTPQRPVR
FT                   MHFGELVLQNGRVTYTDNFIKPNYTANLVAIKGTVGAFGTDSTTSAPVDVAANLAGNGP
FT                   ISIKGSVNPLIDKPALDLTATAHDIELTNLTPYSAKYAGYPITKGKLNVDLHYQLANDQ
FT                   LKANNHIFIDQLTFGDHIDNDTATKLPVKLAISLLKNTRGEIDVNLPVSGSLSNPEFSV
FT                   GGLIWRALLNLIAKAVTSPFSLLAHAFGSGGEDLGYVEFAPGSAVLTDAQQKKLDTVVK
FT                   MLTEKPSIRLDLIGRVDPDKDTPGLRTAYVDRLVRQQKLKDVVGQGESIDPMTVNVEPG
FT                   EYDKYLTRAYKAADFKKPRNLIGLQKTLPEADMKKALAEHAPADDNALRALAQQRAQAV
FT                   RQYLDGKIDAKRMFVVAPKLDAKGIEDKGATTRVDFGLQ"
FT   gene            complement(189812..190033)
FT                   /locus_tag="Bmul_3302"
FT   CDS_pept        complement(189812..190033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16986"
FT                   /protein_id="ABX16986.1"
FT                   /translation="MSTLEALRFVLDDPRTPEIIRHHVVDALQYALRNYGQVFTAKEVE
FT                   WIAQWDDARLPLSARKELERREPTVALR"
FT   gene            190270..191937
FT                   /locus_tag="Bmul_3303"
FT   CDS_pept        190270..191937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3303"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: bch:Bcen2424_5490 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16987"
FT                   /protein_id="ABX16987.1"
FT                   /translation="MRSFFGKQRHIAVMVAGALALASMGANARQDGAAGDAAHGRRVVK
FT                   HVLLLSIDGLHEQDLARCIGANTCPNLAVLAQSGVTYTNAYTPGLSDSFPGLAALVTGG
FT                   SPKTAGLFYDVSYDRNLYAPSDTTCSGKQGWNVVFDETTGIDAQNGGALVHLDGGGAFN
FT                   PQAIPHARVNGRCVPVYPHDYVKTNTVFEAVKAAVPNARTAWADKHAWGYDWLNGPSGM
FT                   GVDDLARTEINSIDPATGTDYTDVYSHTARFDNLHVQALINQIDGRDSTGTKNAPVPTL
FT                   FGANFQTLSVAQKAPVAAGGGYLDANFTPNGQVANAITYVDDAIGRIVGALKQHNLYTS
FT                   TAVIVTAKHGQSPTDRTKLVKHGDTLTKLLEANGYLDPNGNFGQNNTKTGNLNDGSGLV
FT                   GTGFVQTDDVGLIWLRDRSQRTAVVQTLNANLGCNAPGICADGPQAYVLYGAALAERFG
FT                   DPANGRTPDIIVQPNPGVIYTSSTKKDEEHGGNAPDDSHLGLLVSYPGLHRARTVTDVV
FT                   GTTQVAPTILALLGVEPRLLQAVVAENTRVLPGLGIER"
FT   sig_peptide     190270..190356
FT                   /locus_tag="Bmul_3303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 29"
FT   gene            192053..192247
FT                   /locus_tag="Bmul_3304"
FT   CDS_pept        192053..192247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16988"
FT                   /protein_id="ABX16988.1"
FT                   /translation="MRLLLALLLPWFQFFTIGRPIAGIICLILQITIIGWLPAAIWSVY
FT                   ALSQYKTDRKIEAALRERR"
FT   gene            complement(192328..192507)
FT                   /locus_tag="Bmul_3305"
FT   CDS_pept        complement(192328..192507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16989"
FT                   /protein_id="ABX16989.1"
FT                   /translation="MKTSITTTTDRADGRPDARRPRMRGWMWFVVLWAGGVIGAVTLGY
FT                   AFKIFMNLTLFAVK"
FT   gene            complement(192479..193486)
FT                   /locus_tag="Bmul_3306"
FT   CDS_pept        complement(192479..193486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3306"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   bur:Bcep18194_B0174 cytochrome bd ubiquinol oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16990"
FT                   /protein_id="ABX16990.1"
FT                   /translation="MDVTVIWAAIIALGLFMYVVLDGFDLGIGIVFPFFPDEKERDLMM
FT                   NTVAPVWDGNETWLVLGGAGLFAVFPVVYSTVLSALYLPLIFMLVCLIFRGVSFELRAK
FT                   ARRTKHLWDLAFIGGSAGATFFQGVALGAFLQGIDVKDGVFAGDAFDWLTPFSLLTGLG
FT                   LIATYALLGCCWLVAKTEGDLQRRLHRVVWPLTVVLLGFIAIVSLWTPLQDPAIAQRWF
FT                   DTGLFWRLLPVPFLVAGCAVWMRRAVRARHDMTPFVLALALVLLGYVGLLVSLFPYAIP
FT                   QTLTIWEAAAPHSSQTFTLVGAAVILPIIIAYTTMGYWVFRGKVRHEDQHYYHH"
FT   gene            complement(193517..195124)
FT                   /locus_tag="Bmul_3307"
FT   CDS_pept        complement(193517..195124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3307"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bcn:Bcen_5383 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16991"
FT                   /protein_id="ABX16991.1"
FT                   /translation="MRAARIVLDTNQRFTLQLPAARWTSATSWHISRRNIASDTPANPA
FT                   ALCRGPPASVGGYRLLRSTGMDTAFSALDLARLQFAFTVSFHIVFPAMSIGLASFIAVL
FT                   EYRWLKTGKAYYKTLCLFWSKIFAVAFGMGVVSGVVMSYQFGTNWSGFSSFAGSVTGPL
FT                   LMYEVMTAFFLEAGFLGIMLFGWNRVSPRAHFGATLMVAIGTLISTFWILASNSWMQTP
FT                   QGFEIVDGRIVPTDWFAIIFNPSFPYRLLHMAIAAFIVAALVVAATGAYHLLKGRRDKS
FT                   VKKMFSMALWLLLVLAPVQAIIGDQHGLNTLKHQPAKIAAIEGLWETEKGGTALNLFGI
FT                   PDMKAETTRYAVKVPHLGSLILTHSWDGEIRGLKEFPPEDRPNSTLVFWSFRIMVGLGF
FT                   AMIGLAVLAWFLRRRGRLYESKLLQRFALVMGPAGFVSLLAGWVTTEAGRQPWVVYGVM
FT                   RTAHAVSPLTVQQVSVSMMTFVIVYFLVFGTGVYYMLKLMKAGPALPDAKHDDTPDTRR
FT                   DHTARRPMSAVDEPLETV"
FT   gene            195413..195739
FT                   /locus_tag="Bmul_3308"
FT   CDS_pept        195413..195739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16992"
FT                   /protein_id="ABX16992.1"
FT                   /translation="MNRLKLALGAAAAVMAATSGVAHAARVGVYVGPGYPYGYPVVPAP
FT                   YYYAPPVVAVPVEPAPPPQYVEKDQPQPGGDPDLWYYCDASKHYYPYVKTCKSGWRSVP
FT                   ARPQ"
FT   sig_peptide     195413..195487
FT                   /locus_tag="Bmul_3308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            195753..196292
FT                   /locus_tag="Bmul_3309"
FT   CDS_pept        195753..196292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16993"
FT                   /protein_id="ABX16993.1"
FT                   /translation="MKQTIRSLRAPAVLALTGLLGACAYLPAGPSVMALPGTGKTFDQF
FT                   RVDDANCRQFALQQSGGVNAAQASTASALGSAAVGTALGAAAGAAFNGGTGAAVGAGAG
FT                   LLAGSVVGTGAAQGSAYDVQRRYDYGYLQCMYAAGNRVPVPGAMSDAYGGNGGGVAPRA
FT                   APPLPPPGVQPPPPRY"
FT   sig_peptide     195753..195857
FT                   /locus_tag="Bmul_3309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.935 at
FT                   residue 35"
FT   gene            196476..197489
FT                   /locus_tag="Bmul_3310"
FT   CDS_pept        196476..197489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3310"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: bam:Bamb_4817 threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16994"
FT                   /protein_id="ABX16994.1"
FT                   /translation="MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAATAE
FT                   RAGKEAGLFFPSGTQSNLAALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIE
FT                   NAPDGTLPLAKIAAAIKPLDNHFARTRLLALENTIGGQVLPEGYVQEAVAFARSRGLSA
FT                   HLDGARVCNAAVASGRSIAELCAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRK
FT                   VLGGGMRQSGILAAACLYALDHNVERLADDHANAAHLAEGLARIEPVKVLSQATNMVFA
FT                   QFPEADCAPLEAWLKARGILTQMLYASRFVTHCDVSRADIDTFIDAVGAYFAQRRA"
FT   gene            complement(197603..197815)
FT                   /locus_tag="Bmul_3311"
FT   CDS_pept        complement(197603..197815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16995"
FT                   /protein_id="ABX16995.1"
FT                   /translation="MSRRYIDCREFPSAMHCSVAISADSDNELLEAAVQHAVSVHQHTD
FT                   NAELRTQLKALFHDGTPPVDTPRQA"
FT   gene            complement(197969..198874)
FT                   /locus_tag="Bmul_3312"
FT   CDS_pept        complement(197969..198874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3312"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: bam:Bamb_4815 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16996"
FT                   /protein_id="ABX16996.1"
FT                   /translation="MSLTIDPKQAAALLAVADTGSFEQAAVRLHVTASAITQRVRALEA
FT                   SLGTPLVLRTRPCRPTVAGQRVLQHLRRVALLQADLQSTLATERETPISVTIALNSDSL
FT                   GTWFLPALTSVLAGERILFELIVEDQDHTFALLESGMAVGCVTTEPKPMRGCVATPLGT
FT                   MRYRLLAADAFAARWFPRGLTRTSARDAPVVAYSRRDTLQSSFLEQRFGLPPGAYPCHY
FT                   VPGTHAHFAAVRHGLGYAMVPEPLIGDAPLAAQQLVDLAPAHPTDVTLYWHAWTVQSPT
FT                   MASLSARVVEAARRLLAPLP"
FT   gene            199030..200100
FT                   /locus_tag="Bmul_3313"
FT   CDS_pept        199030..200100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3313"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: bch:Bcen2424_5472 beta-lactamase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16997"
FT                   /protein_id="ABX16997.1"
FT                   /translation="MIFRQLFDPQSSTYTYLLADPAAREALLIDPVFEQVRRDAALLDE
FT                   LGLRLVATIDTHVHADHVTGAWLLKQHTGSAIAISADSGAQGADRYLRDGDRCTFGARY
FT                   VTVRATPGHTSGCISLVLDDESKAFTGDCLLIRGTGRTDFQQGDPRALYRSVHGRLFTL
FT                   PAACLLYPAHDYRGLSVTSVAEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVP
FT                   ANLRCGVAASAPDARDAADWAPLAYTFAGFWEIDAQWLEDHLTAVQIVDVREPDEFTGP
FT                   LGHLPGATPIPLGELAARAGELARERPIVTVCRAGGRSAQATVLLRNAGFDRVANLGGG
FT                   MLRWRAEGRIVTDGRA"
FT   gene            200138..200884
FT                   /locus_tag="Bmul_3314"
FT   CDS_pept        200138..200884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3314"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bur:Bcep18194_B0183 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16998"
FT                   /protein_id="ABX16998.1"
FT                   /translation="MSNRRLADRRHGIDPAAPHDAAPSPERRTMLPTLYAHPFSSYCQK
FT                   VLTALYENGTPFDYRLLAHDDPAPMRELAALWPMKRFPVLVDAGRTLIEATIIVEYLDL
FT                   NHPGPVRLLPDDPHAALDVRMMDRFFDNYVSTPQQKIVLDALRPPGERDARGVADARAM
FT                   LDTAYAWLDARMADREWAAGDRFSLADCGAAPFLFYADWTHRIDPSFANVIAYRQRLLA
FT                   RPSFARAVDEARPYRPFFPLGAPDRD"
FT   gene            complement(201037..201729)
FT                   /locus_tag="Bmul_3315"
FT   CDS_pept        complement(201037..201729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3315"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   bur:Bcep18194_B0184 phosphoesterase, PA-phosphatase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX16999"
FT                   /protein_id="ABX16999.1"
FT                   /translation="MNEFDTTIQTFLTHITLSPLANHAVRVIAGLYTFKGFILIPVLCW
FT                   LWFQPGPERERQREYVVATVAGGLVALATGRVLAHALPFRVRPIYNPDLHLHFPSAGLR
FT                   AATLQNWSSFPSDHAMLWMAIATGIFIIARRIGVFALLYTIVFICVPRAYLGFHYPTDL
FT                   LAGAAIGIAITWLLTRDPIRARFAPQVLHAIRRFPAPAYTLAFLLCFELITQFDELLTL
FT                   AQSATQAM"
FT   gene            complement(201823..202098)
FT                   /locus_tag="Bmul_3316"
FT   CDS_pept        complement(201823..202098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17000"
FT                   /protein_id="ABX17000.1"
FT                   /translation="MPHSRFACGDNKRASQRAARAGTRCRRARRRVFRRIGFLPIFFRR
FT                   LRRLCAHSSDHFGRPAARRRAVRPRRTSALPQGNPGIFSHFLRNYG"
FT   gene            complement(202064..203299)
FT                   /locus_tag="Bmul_3317"
FT   CDS_pept        complement(202064..203299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3317"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0185 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17001"
FT                   /protein_id="ABX17001.1"
FT                   /translation="MSTPHRLDAAPHARPAAPSHAAASSLPGRRLVLLLAAAAGLGVAP
FT                   LYYAQPMLGALGPDLGASARAIGFVPTLTQLGYALGILLLAPLGDRFDRRRVIVTKAGA
FT                   LVVALLLAAVAPSLGLLLAASFAIGLAATMAQDVVPAAATLAHDQHRGRIVGTVMTGLL
FT                   LGILLSRVVAGFIAETAGWRAMFALAAASVAAIGIVAARGLPRFAPTTQLPYRALIGSL
FT                   RALWQRHPALRRAALAQGLLAIGFSAFWSTLAVMLHGAPFHLGSAAAGAFGLAGAAGAL
FT                   AAPIAGRLADRHGPEHVTRIGIGIATLSFAAMAAAPAMPAHAQLALLAAATIGFDLGVQ
FT                   ATLIAHQAIVYRIDPASRSRLNAVLFVGMFIGMAAGAALGSLLLAQLGWNAVIALAVVT
FT                   SLAALAVRMWRQ"
FT   gene            203402..204385
FT                   /locus_tag="Bmul_3318"
FT   CDS_pept        203402..204385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_5468 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17002"
FT                   /protein_id="ABX17002.1"
FT                   /translation="MTKKSHDSRDPQGGSRIPTVPVDSAGYRFELMETFVRIVEAGSLS
FT                   AAAAQMHTTQPTVSRRLQALERSLGVRLLQRTTHAMRLTVDGERCFKRAKDLLASWAAF
FT                   EADLRGAQEEPDGLLRVAVPHAFGQERFVEPLARFLRDYPRVSVEWLLQDDVRDFVGSG
FT                   IDCAIQVGEPTDPGVVAIRLTNVPRFVAAAPSVLGGADVPRDPDALAALPWLALSTYYR
FT                   TELTLTHATTGDTRRIRIRPRMTTANLYALRSAALLGLGACVGSSWMLAGDLARGELVH
FT                   LAPEWHAAPLPVYLIYPHAQFYPSRLVRFAAMMREAVPRLVEGRDP"
FT   gene            complement(204410..205048)
FT                   /locus_tag="Bmul_3319"
FT   CDS_pept        complement(204410..205048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3319"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bam:Bamb_4809 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17003"
FT                   /protein_id="ABX17003.1"
FT                   /translation="MNAARTATWYFDFVSPFAYLQQEQFDRLPPDAAFEPTPIVLGALL
FT                   AHWGQKAPAEIATKRIFTYRHAQYRADKLGIPFRMPPAHPFNPIQPLRLAIAMGNSRDA
FT                   IRRIFRHIWRDGHDVASPEGFAALCDAVGFPEGVRAVDAQPVKDALRANTDRAIAHGVF
FT                   GVPTFELDGDLFWGEDATDMFVDCAASRAWLDSPEVRRISALPEGIRRR"
FT   gene            complement(205210..205359)
FT                   /locus_tag="Bmul_3320"
FT   CDS_pept        complement(205210..205359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3320"
FT                   /product="activator of HSP90 ATPase 1 family protein"
FT                   /note="KEGG: bch:Bcen2424_5461 activator of HSP90 ATPase 1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17004"
FT                   /protein_id="ABX17004.1"
FT                   /translation="MSDEDAGTRVDAVHDGVPPGVPAPDNETGWRMALARLAALVEDGG
FT                   RPHA"
FT   gene            complement(205545..206294)
FT                   /locus_tag="Bmul_3321"
FT   CDS_pept        complement(205545..206294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3321"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bch:Bcen2424_5461 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17005"
FT                   /protein_id="ABX17005.1"
FT                   /translation="MMRRPQRSPVAQSPCYAMKIVAAPPQWRNGQPARRIGRATRIACA
FT                   IRGIAASAAAFPALRRAARPPTIPERPPRAPARHPCRRSAEEATMMHSHTTRISRHVNA
FT                   PRNRVYRALLDPHAVEQWKVPDGMTCRVHAFDAREGGALRVSLTAEAAALAGKTDAHTD
FT                   TYHGRFVTLVPDRQVVEIDVFETDDPMLRGAMTITITLSDEDGGTRVDAVHDGVPPGVP
FT                   PADNETGWRMALARLAALVEDGGRPHA"
FT   gene            206536..207066
FT                   /locus_tag="Bmul_3322"
FT   CDS_pept        206536..207066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3322"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bch:Bcen2424_5458 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17006"
FT                   /protein_id="ABX17006.1"
FT                   /translation="MTESVTVRRVGANEAIAYVDALSDVLIDCVEGGASVSFMLPIARS
FT                   TAVAFWTDVAERVANGERILLVAEDASGRIVGTVQIVTAQPENQPHRADIAKMLVARHA
FT                   RRQGVAARLLAAADAAARDAGKTVLVLDTVTGSDAERLYERAGWQRVGVVPNYALMPDG
FT                   APCATTFFHKQLV"
FT   gene            207090..207716
FT                   /locus_tag="Bmul_3323"
FT   CDS_pept        207090..207716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17007"
FT                   /protein_id="ABX17007.1"
FT                   /translation="MQHANLRRPAAPAIRRMKRTHVVMGCAALLVALPIAAYALIKPLR
FT                   VAVPALVPGVSCTHAPICIDDASKLADAQRLYRDGYARAAAAVGPFGDAPRVVFCSTRA
FT                   CADAFGLGERAALTLGTVGVVIAPRGWHAYFVAHELIHHRQAETLGNLAVLTKPRWLIE
FT                   GMAYSLSGDPRHPLTEPFEGWRARFDAWHAALGTRPLWDAARAVE"
FT   sig_peptide     207090..207209
FT                   /locus_tag="Bmul_3323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 40"
FT   gene            complement(208052..209254)
FT                   /locus_tag="Bmul_3324"
FT   CDS_pept        complement(208052..209254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3324"
FT                   /product="Trans-2-enoyl-CoA reductase (NAD(+))"
FT                   /EC_number="1.3.1.44"
FT                   /note="PFAM: short-chain alcohol dehydrogenase; KEGG:
FT                   bch:Bcen2424_5454 short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17008"
FT                   /db_xref="GOA:A9ALQ1"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ALQ1"
FT                   /protein_id="ABX17008.1"
FT                   /translation="MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVL
FT                   VIGASTGYGLAARISAAFGAGADTLGVFFERPGSETKPGTAGWYNSAAFERFATEKGLY
FT                   ARSINGDAFSDQVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKT
FT                   VTFRGIDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTA
FT                   FTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAI
FT                   PMMPLYLSLLFKVMKEAGTHEGCIEQVYGLFKDSLYGATPHLDDEGRLRADYKELDPQI
FT                   QKKVVELWDQVTNENLYELTDFAGYKTDFLRLFGFEIAGVDYDADVNPDVKIPRIIDTT
FT                   V"
FT   gene            209541..210176
FT                   /locus_tag="Bmul_3325"
FT   CDS_pept        209541..210176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3325"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bam:Bamb_4793 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17009"
FT                   /protein_id="ABX17009.1"
FT                   /translation="MLHILGKIPSINVRKVLWLCTELNLPFEREDWGAGFRSTDDPAYL
FT                   ALNPNGLVPVIRDGDFVLWESNAILRYLANRYGDRYGDGSLYPTEPQARARVDQWIDWQ
FT                   GTDLNRSWVGAFLGLVRKSPDHQDPAAIAQSIANWTKHMRVLNGQLEATGAFVAGEHFT
FT                   IADVAIGLSVNRWFGTPFERPELPAVKRYADRLATREGFQTYAGSANP"
FT   gene            complement(210201..211646)
FT                   /locus_tag="Bmul_3326"
FT   CDS_pept        complement(210201..211646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3326"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bch:Bcen2424_5447
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17010"
FT                   /protein_id="ABX17010.1"
FT                   /translation="MTIPLKPLIRRGVALALIAAIGYAGYQLSRLAPIATGYAAKALCS
FT                   GVFVSGRPAASVIDVDIMAGVHPLLKLVRPSIDAEHHRAHATFAGFAARDAEFRPGLGC
FT                   TLALGRAAAALPAALPPLPAAPAATAVPASLAIASASASASSAATAPNGVDMRKLHAAL
FT                   DRAFDEPDPARPRRTRAVVVMWRGHVIAERYAPGFTGDTPLPGWSMTKTVTAVLIGMLV
FT                   GQHRLSPDTAALLPEWRGAGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVAVMLFTQR
FT                   DTARFASNKPLAAPPGTRWDYSSGTSEIVARVMRVALGGSTDDYLSFPRRALFAPLGMR
FT                   SAVFEPDASGTLAAASFMYASARDWARFGQFLLQDGVWNGQRLLPEGWVRYLARATPQS
FT                   SRAAFGAHLWVKVPEPFDDRDPHAPALPADAFHAVGHEGQFVSVVPSRDLVVVRLGLSR
FT                   PESAWNHEAFLARVLDAIPASGT"
FT   sig_peptide     complement(211557..211646)
FT                   /locus_tag="Bmul_3326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.471 at
FT                   residue 30"
FT   gene            211839..212258
FT                   /locus_tag="Bmul_3327"
FT   CDS_pept        211839..212258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3327"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bch:Bcen2424_5446 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17011"
FT                   /protein_id="ABX17011.1"
FT                   /translation="MSYDDNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVI
FT                   PKEPAAQIFDLSGDAAAASIRMTQRVATAVRAALAPDGLFIGQFNGAAAGQTVPHVHFH
FT                   VIPRTEGVALRMHARDVADAATLEAIAQRIRAHIA"
FT   gene            212488..212652
FT                   /locus_tag="Bmul_3328"
FT   CDS_pept        212488..212652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17012"
FT                   /protein_id="ABX17012.1"
FT                   /translation="MVRLLVSFALLGALCGCVVAPPYGYAPAPAYYGYAPAYYAPPVSI
FT                   GIGGSFRVR"
FT   sig_peptide     212488..212562
FT                   /locus_tag="Bmul_3328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.845 at
FT                   residue 25"
FT   gene            212814..213401
FT                   /locus_tag="Bmul_3329"
FT   CDS_pept        212814..213401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3329"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG:
FT                   bch:Bcen2424_5443 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17013"
FT                   /protein_id="ABX17013.1"
FT                   /translation="MSAAGRRTGAILRRKLIEMNWFRDSAQCPNRRRPVQIRYERLLIT
FT                   LRTRKDTGMWKKIAPALVVAALAGATALPAAANDLNNALGGALGGVAGAAVGGAVGGST
FT                   GSVIGGALGGGAGGAITSNRRERTGAIIGGALGGGAGTAAGNAMGGRTGGLLGAAVGGG
FT                   AGAALGGNMSRSSYDDDRGYRHRKHRHHRHWD"
FT   gene            214020..214856
FT                   /locus_tag="Bmul_3330"
FT   CDS_pept        214020..214856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3330"
FT                   /product="allantoin catabolism protein"
FT                   /note="TIGRFAM: allantoin catabolism protein; PFAM: protein
FT                   of unknown function DUF861 cupin_3; Cupin 2 conserved
FT                   barrel domain protein; KEGG: bch:Bcen2424_5442 protein of
FT                   unknown function DUF861, cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17014"
FT                   /protein_id="ABX17014.1"
FT                   /translation="MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSW
FT                   LPFWTHTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELT
FT                   LQGSKHTLTPGGYAFIPPGADWTLHNVSDAAVRFHWIRKHYQAVDGIPLPEAFVTNEQD
FT                   VEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGK
FT                   AVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR"
FT   gene            complement(214939..215841)
FT                   /locus_tag="Bmul_3331"
FT   CDS_pept        complement(214939..215841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3331"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; KEGG: bch:Bcen2424_5439
FT                   aminoglycoside/hydroxyurea antibiotic resistance kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17015"
FT                   /protein_id="ABX17015.1"
FT                   /translation="MLGWLNFIEESTPHRRTRRLMHRRADTPVRLYHFRMFAAHLRSWS
FT                   LTPDGGPILTASGGVLPVVWRGRPAMLKVATCEEERRGNALMTWWDGHGAAQVWAHDDD
FT                   AILLERAQPQPALADFSASGHDDDAIRIACDVVAQLHAYRAPDPPPLVALRDWFASLLA
FT                   SDATDAILRRSQATAAALLAEPPVDEALLHGDIHHRNVLHFGDRGWRAIDPKALRGARA
FT                   FDYANLFCNPSHDIAVDRTRFERRVAIVADAARLDPRTLLRWILAWSGLSAIWLIEDDE
FT                   PAETRLQVAALAAHALDSR"
FT   gene            215950..218094
FT                   /locus_tag="Bmul_3332"
FT   CDS_pept        215950..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3332"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: bur:Bcep18194_B0214 penicillin-binding protein
FT                   1A; TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17016"
FT                   /protein_id="ABX17016.1"
FT                   /translation="MTDRTDSRPTPPAPPPRRRVWRMLAGALLGLTLAGAGIAGWTIHR
FT                   IWTQLPSVEQLAVYRPALPLRIFSRDGELLAEYGVERREFVPLERMPARMRDALLAAED
FT                   AQFYRHGAIDIGGLARATFANVVTGQPAQGGSTITMQVARNFYLTRDKVLSRKLAEILM
FT                   AIKLERAYGKDKLLELYMNEIYLGEPAYGFAAAAHVYFGKPLDALSVGEAAVLAGLPKA
FT                   PSAFNPVVNPARATARRNYVLGRMLALGQLDDATYRAAVDAPIALSPQAPPGIVAAPYV
FT                   AERARLMMVERFRDDAYTLGLDVTTTISMRDQRAAEAALERTLRRQRTTRDAQRTLEGA
FT                   LVSLDAATGDMLALVGGADFSCNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVD
FT                   DTQRTLTPAETGARPWRPRNYGNHYEGFIAVRRGLVRSKNLVAVSLMQAADPQYVQQHA
FT                   MRFGFDARRNPASLPLALGAGAVTPLELASAYGVFANGGTRVEPRLILSVKQRHGGVLY
FT                   DAPAPSGTRVVSARNAFVMDSMLRDVVRAGTARGALALRRDDTAGKTGTSNGSKDVWFA
FT                   GYSSGVVAVAWLGYDTPRSMGRATGATLALPVWLDYMKTAVDGRTPAEAVEPPDVARVD
FT                   GDFVYAEYTRGACTADVPAFVRSRFACDGAARAEAASAGFAASAASTAANGGAMPVAPT
FT                   PAPVDAAERARVLDLFRTED"
FT   sig_peptide     215950..216069
FT                   /locus_tag="Bmul_3332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.795 at
FT                   residue 40"
FT   gene            218106..218717
FT                   /locus_tag="Bmul_3333"
FT   CDS_pept        218106..218717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3333"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   bur:Bcep18194_B0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17017"
FT                   /protein_id="ABX17017.1"
FT                   /translation="MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVR
FT                   DVLLGHYPLGWIAHPQYLVITLVAATVASRIARHVARMKTLFVTVDALGLAAFTIIGCD
FT                   VGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILRRELYASVAFFTGALYVALQH
FT                   VGIDARVATVVALAAGFAMRMLAVRFGWEMRTFRAADVEH"
FT   gene            complement(218920..219762)
FT                   /locus_tag="Bmul_3334"
FT   CDS_pept        complement(218920..219762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_4776 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17018"
FT                   /protein_id="ABX17018.1"
FT                   /translation="MLTVQHLRVARRHRVILHDLSLTIEPGRVTALLGRNGAGKSTLLK
FT                   ALAGELTGSAAPNGVRVTGRIALNGEPLAQIDAQRLARLRAVLPQAAQPAFPFSVDEIV
FT                   LLGRYPHARSRGGALSRRDRGIAWHALARAGAETLLGRDVTTLSGGELARVQFARVLAQ
FT                   LWPSDDEAGRDARDASPTRYLLLDEPTAALDLAHQHRLLETVRTIAREWRLGVLAIVHD
FT                   PNLAARHADTIAMLADGMIVAHGTPHDVMTPEHIARCYGFAVKRIDSGDGTPPVMVPA"
FT   gene            complement(219782..220873)
FT                   /locus_tag="Bmul_3335"
FT   CDS_pept        complement(219782..220873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3335"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bam:Bamb_4775 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17019"
FT                   /protein_id="ABX17019.1"
FT                   /translation="MSARLSSIRASSAAAAAPGARRIGTQRRFAPVALGVLAVLVGAMS
FT                   VVALCVGAYRISPADAWAALAGDPAAQQARAVLLGIRAPRAVLALLVGGGFGAAGAAMQ
FT                   ALFRNPLADPGLVGVSSGAALGATAAIVLGPALFAAHAGAAALPAAAFVGALAIAALVY
FT                   RLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWST
FT                   LAAVAPCAVLGCALLVRERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVS
FT                   CAGIVGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTLAAPAEIPLGV
FT                   LTALLGAPFFLALLWKSRGSLGA"
FT   sig_peptide     complement(220823..220873)
FT                   /locus_tag="Bmul_3335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.902 at
FT                   residue 17"
FT   gene            complement(220885..221799)
FT                   /locus_tag="Bmul_3336"
FT   CDS_pept        complement(220885..221799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3336"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bur:Bcep18194_B0219 ABC cobalamin/Fe3+-siderophore
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17020"
FT                   /protein_id="ABX17020.1"
FT                   /translation="MSARTFDPRRRAVLAAAAAGALAATAPARAIAAVQSAPKRVVVIG
FT                   GALAETAFALGGEHAHGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVL
FT                   ASAEAGPPAAIAQVARAGVAVQTFDERHDADSVRKKIAGIAQALDMRDAGVALLRQFDR
FT                   DWQAARDSVAAHVPGGAQPPRVLFVLNHTGNQALVAGGRTAADAMIRYAGARNAMQGFD
FT                   HYKPLTSEALAAAAPDVVLISDEGLAAVGGRAALLAAPGFAATPAGRAQRIVSLDALLL
FT                   LGFGPRLPLAVTTLHRRLSDTLA"
FT   sig_peptide     complement(221701..221799)
FT                   /locus_tag="Bmul_3336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.667 at
FT                   residue 33"
FT   gene            complement(221796..222926)
FT                   /locus_tag="Bmul_3337"
FT   CDS_pept        complement(221796..222926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3337"
FT                   /product="Haemin-degrading family protein"
FT                   /note="PFAM: Haemin-degrading family protein; KEGG:
FT                   bur:Bcep18194_B0220 heme degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17021"
FT                   /protein_id="ABX17021.1"
FT                   /translation="MRAGCTRVPPSVKESDMMQSPVSASSVRTSTSLRDAFVKLKRERR
FT                   LRNRDVAQALGVSEGEALAAFVGEHVVRLDARFPDLFEEMPRLGRVMALTRNDAAVHEK
FT                   DGAYAQMSHDGPVGLALGDIDLRIFYRQWASAFAVRDDTPHGPLKSLQFFDAQGHAIHK
FT                   VYLRAHSDHAEYDAFVARWRAASQQPGLDVAPAVPKKPERADSAIDVAGFRAAWHAMTD
FT                   THQFFGITQRFGVSRLQALRLADPQHAYPLDAARALRHVLERAAQTGQPIMVFVGNAGM
FT                   IQIHTGPIANVREVGAWINVLDPGFNLHVREDMIATAWVVKKPTSDGIVTSVELFDRNG
FT                   EHVALLFGERKPGQPERDDWRALVASLAPAARGDAR"
FT   gene            complement(222926..225193)
FT                   /locus_tag="Bmul_3338"
FT   CDS_pept        complement(222926..225193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3338"
FT                   /product="TonB-dependent hemoglobin/transferrin/lactoferrin
FT                   family receptor"
FT                   /note="TIGRFAM: TonB-dependent
FT                   hemoglobin/transferrin/lactoferrin family receptor;
FT                   TonB-dependent heme/hemoglobin receptor family protein;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug; KEGG: bch:Bcen2424_5431 TonB-dependent
FT                   hemoglobin/transferrin/lactoferrin family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17022"
FT                   /protein_id="ABX17022.1"
FT                   /translation="MHRSTLARQPIFAALIGAVGLSAATAHADSSPSHTAASSVTADAA
FT                   AARASSALLDPVTVTATRTATAASRTAASVSVIDADDLDEQQATNIKDALRYEPGITVR
FT                   RTAYRPGNAALGGGRDGDSSINIRGLEGNRVMLMEDGIRLPNAFSFGPLEAGRGDYTDL
FT                   DTLKRIEIVRGPASALYGSDGLTGAVNFITKDPQDLLSIYHKPTYFSFRPSYDSTDRSI
FT                   GATVSAAGGNDRIQGMIIADGRRGHEIDTRGSNNSAGKLRTTSNPQHVYSESLLGKLVL
FT                   TPTVRDTIRLTAETVQRRVGTDVLSAIVAPATLGLTTSDRLERNRFSADYAFHDDASRW
FT                   LQNAHVQFYYQEATQDQYAFETRGTLPSRSRDNRYRERTFGGSAFAESGFSTGPLAHKL
FT                   LGGVDGSLSRITNLRDGTVPGVGETFPNKAFPDTDYTLFGAFVQDQIGYGRLLVTPGLR
FT                   FDTYRLKPSGNDPLFTGRAVSTHANELSPRVAVLYEIAPALIPYLQYAHGFRAPTPDQV
FT                   NSSFSNPVQGYTSIGNPNLKPETSDTFEAGLRGRAGTGYGTIRYSAAAFTGRYRNFIAR
FT                   TTIAGSGRPTDPFVFQYVNFADARVHGIEGRADWAMPNGITLRTALALTRGSTQNDGAA
FT                   SQPLNTVNPFSAVFGVRYEPTERWFVQTDLLFQAAKRDKDIDRSDCSKRACFAPPSSFV
FT                   VDLRGGYRFNKHVSATVGIRNLFDRKYWNWSDVRGIAADSPVLDAYTSPGRTVAVSMKV
FT                   DF"
FT   sig_peptide     complement(225107..225193)
FT                   /locus_tag="Bmul_3338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(225434..225661)
FT                   /locus_tag="Bmul_3339"
FT   CDS_pept        complement(225434..225661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17023"
FT                   /protein_id="ABX17023.1"
FT                   /translation="MNAQSLSGMLRAQELLLVSMVRTLPVDTRGALVDLFTEQIAFAEQ
FT                   AGLESRADRDVHDAFVAHARNLLIRLESLA"
FT   gene            complement(225769..226155)
FT                   /locus_tag="Bmul_3340"
FT   CDS_pept        complement(225769..226155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17024"
FT                   /protein_id="ABX17024.1"
FT                   /translation="MENPFNERGVTITRNGLSSGGQVFALRDIGDVDVVKVPKNRLVPS
FT                   LISLIGVVTAVAGGVASSSAALVVGVMLVVVGYLAWTTQDVTYRLMVQMPDGKREALSS
FT                   VDAEFVERVAQAVRAARTTTAAAG"
FT   gene            complement(226303..226563)
FT                   /locus_tag="Bmul_3341"
FT   CDS_pept        complement(226303..226563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17025"
FT                   /protein_id="ABX17025.1"
FT                   /translation="MIEDTVFSHLHTILTREHSLPVQSCRVSVEMQRPWGRPYRLVEWT
FT                   MHLDAPARRQIVPAESTDAEIAEVVASHVPGRLYGDGRLQF"
FT   gene            complement(226774..227934)
FT                   /locus_tag="Bmul_3342"
FT   CDS_pept        complement(226774..227934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3342"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bam:Bamb_4768
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17026"
FT                   /protein_id="ABX17026.1"
FT                   /translation="MNKKLLTTAILAATAGVAHAQSSVTLYGVIDAGISYVNHSKNATG
FT                   GSSKLFKYDDGVAQGSRWGLRGTEDLGGGLKAIFVLENGFNSGNGTLGQGGAIFGRQAY
FT                   VGLSQTQYGTLTFGRQYSFSTDVLGSNYSTGGNTVAGNYAYHVNDVDQLTSSRINNAVK
FT                   FQSANYAGFTFGALYGFSNSTDFAGAPATTTGTTTTAGSSRAYSFGLNYANGPFALGAA
FT                   YTDIRFPSQATPAFSTTIANISTGNIRDLRTYGVGGRYIFGPATAWLLWTRTQFTPLAN
FT                   GASGTFYNAYEGGLKYAITPALSAAAGYTYTNATQNGASAHWNQGNLALDYALSKRTDV
FT                   YGLVIYQKASGNNVQAQIGSSTSYFNTSGNGSSNQIAARVGIRHKF"
FT   sig_peptide     complement(227872..227934)
FT                   /locus_tag="Bmul_3342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            228268..229074
FT                   /locus_tag="Bmul_3343"
FT   CDS_pept        228268..229074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3343"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: bam:Bamb_4767 lipoprotein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17027"
FT                   /protein_id="ABX17027.1"
FT                   /translation="MRRSILTGFAALGAALAFAAPGAHADPQTLKIGTMSGPDAQIWSE
FT                   VTKIAAREGLAIKVIEFNDYVQPNAALDAGDLDANGFQHQPFLDSQIKQRGYKIVSVGL
FT                   TYTAPMGFYSKKYKSLKDLPAGAKVGIQNDPSNGNRALLLLQKYGVIKLKPGVGTNGVN
FT                   ATPLDVAENPKKIRIVELDAAQLPRALPDLDAASINTDYAVKAGLTPVKDAIAIEDLRG
FT                   PYANLIAVREQDRNKPWVKKLVAAYESDDVRKFIEQKFGGAIVPAF"
FT   sig_peptide     228268..228345
FT                   /locus_tag="Bmul_3343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            complement(229232..230347)
FT                   /locus_tag="Bmul_3344"
FT   CDS_pept        complement(229232..230347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3344"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bvi:Bcep1808_3625
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17028"
FT                   /protein_id="ABX17028.1"
FT                   /translation="MQTQTHPLISPAVGTERQITSFHYGPRGGKKVYIQSSLHADELPG
FT                   MLVAVLLRRKIAALEAAGKLRGEIVIVPVPNPIGLSQHVFGDHLGRFELGSMQNFNRNF
FT                   HDLAALVLPRIEGRLTHDAQRNVEAVRAAMREALDEQKPRTELESQRLALQKLSYDADI
FT                   VLDLHCDNDAVMHLYTNPDLWEDVEPLARYLDAQASLLALNSVGNPFDEIHSFCWSDLR
FT                   TRFGERFPIPNGAISVTVELRSERDVSYELAEKDAQAIVEYLTERGIVEGTPAPLPPLA
FT                   HPATPLAGTDPLVAPVSGVLVFRTPVGVWIEAGQEVADIVDPLTDRVVTLKSSVSGVLY
FT                   ARQVVRFATAGMEVARIAGATPIRTGSLLSA"
FT   gene            230550..231077
FT                   /locus_tag="Bmul_3345"
FT   CDS_pept        230550..231077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3345"
FT                   /product="HMG-I and HMG-Y DNA-binding domain protein"
FT                   /note="PFAM: HMG-I and HMG-Y DNA-binding domain protein;
FT                   KEGG: bam:Bamb_6206 HMG-I and HMG-Y, DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17029"
FT                   /protein_id="ABX17029.1"
FT                   /translation="MTKYDERFRRRVVQAYLAGEAGTKTLAHRYGVGSTMVRRWVASYR
FT                   EHGEDGLSKKHSHYDARFKLSVLQRMWRDELSYARVAVVFGIRNERSIPVWERLYHEGG
FT                   IEALMPRRRGRPPKMTTLPPPKPTDDAAQKEPSREELLKEIVYLRAEVAYLKKLDALLQ
FT                   SKKQTAPRKKRK"
FT   gene            231167..231913
FT                   /locus_tag="Bmul_3346"
FT   CDS_pept        231167..231913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3346"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bam:Bamb_6205 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17030"
FT                   /protein_id="ABX17030.1"
FT                   /translation="MDAGDRYAELKVKIRSVYDHHKGRYGYRRITTVIRQAGHAINHKT
FT                   VQRLMGQLQLKSLVRPKRYRSWRGEVGRVAPNLLRRQFDAERPNQKWVTDVTEFNVGGQ
FT                   KLYLSPVMDLYNGEIVAYQMDERPSFELVSGMLKKAVAKLDDEGRPLLHSDQGWQYQMP
FT                   AYRRLLKQHALTQSMSRRGNCLDNAAMESFFGTLKSECYRLARFANVEQLRDALSRYIH
FT                   YYNHERIKLKLNGLSPVQYRTQPSAA"
FT   gene            complement(232026..232808)
FT                   /locus_tag="Bmul_3347"
FT   CDS_pept        complement(232026..232808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3347"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; KEGG: bam:Bamb_4765
FT                   cationic amino acid ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17031"
FT                   /protein_id="ABX17031.1"
FT                   /translation="MKKILAAVTVALLAVSAGSAYAKDWTTVRFGVDASYPPFESKDAS
FT                   GKVVGFDVDLGNEICRRLNAKCVWIENDFDGMIPALKARKFDGVLSSMSMTPARQEQIA
FT                   FSSKLFNTPTRLVAKKGSGLMPTAESLKGKSIGVEQGTIQETYAKTYWAPKGVKVVPYQ
FT                   NQDQVYADLIAGRLDGALQDAVQAEIGFLKTPRGANFDFAGKDLDDPKTLGEGAGIGLR
FT                   KEDTDLKAKIDAAIAAMRKDGTYDKIAKKYFDFDVYGK"
FT   sig_peptide     complement(232740..232808)
FT                   /locus_tag="Bmul_3347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(233036..233956)
FT                   /locus_tag="Bmul_3348"
FT   CDS_pept        complement(233036..233956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3348"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4764 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17032"
FT                   /protein_id="ABX17032.1"
FT                   /translation="MTRIRNHLNVAQLQAFVCAAHHKSLRAAARELGVTQPAITHTIRE
FT                   LETALNAELLVRSVRGVELTACGHALLPRAEQLLGDMRRTLEAVEQVKGEMSGRVAVGT
FT                   MPSIALTALPHAVTAFRRAMPNVSLHLEEVTVPDALAQLRNGTLDIAAMHHVPALDRDF
FT                   TQSPLLSTEFVVAMRDGHPLAHARRLEELLDAEWIVTVGAEQFPHSVMTAMFDARGLPL
FT                   PKRLLRSPMSFAVTLGLVARSDVIGCFTRPLAAMVAPLGIRTAELDDAMPRFDLSIIAR
FT                   RDLLPTPAVSQFVACLRRAVNETLG"
FT   gene            complement(234194..235582)
FT                   /locus_tag="Bmul_3349"
FT   CDS_pept        complement(234194..235582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3349"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bur:Bcep18194_B0234
FT                   xanthine/uracil/vitamin C transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17033"
FT                   /protein_id="ABX17033.1"
FT                   /translation="MSDTPVQPTVGVGTEENDFGTPGVIDRYFGISTRGSTQRREIVAG
FT                   VTTFLAMVYSVFVVPGMFGKAGFDTSAVFVAVCLTTAFGSLLMGLWAKLPIAIGCAISL
FT                   TAFTAFGLVLGKGLHPTVALGAVFLMGLVFTGISITGVRSWILRNLPAGVAHGTGIGIG
FT                   LFLLLIASNDVGLVIKNPGAGLPVSLGQITAFPVIMSVIGLAAIFGLEKRRVPGGILLV
FT                   VIAISLFGLGFDPAVKYRGVFALPSLSTPGHASLIGAMDLRGALSMAVLPSVLALVMTA
FT                   VFDATGTIRAVAGQAGQLDENGRIVNGGRALTADSVSSIFSGFLGGAPAAAYIESSVGV
FT                   AAGAKTGLAAAVVGLLFLVVMFFSPLAALVPSYATAPALMYVGLLMLGSVAKLHMDDMV
FT                   DAMSGLVCAVFIVLTANIVTGIMLGFSTLVIGRIASGEFRKLNAGTVIIAAVLVTFYLG
FT                   GWAI"
FT   gene            complement(236234..237349)
FT                   /locus_tag="Bmul_3350"
FT   CDS_pept        complement(236234..237349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3350"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bch:Bcen2424_5413 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17034"
FT                   /protein_id="ABX17034.1"
FT                   /translation="MTQDPLFQPLRLGALTLPNRIVMPPMTRSRASQPGDVANELMAAY
FT                   YAQRASAGLIVSEGTYIAPLGKGYAWTPGIHTPAQVAGWRKVTDAVHAAQGRIFAQLWH
FT                   VGRLSHTSLLGGRQPVSSSPLQANGVNVFIAGEDGSTPGFVQASEPRALTIDEIRDIVE
FT                   QYRVAARNAIEAGFDGVELHGANGYLVNQFIDSNANTRTDAYGGSLENRLRFLREVTQA
FT                   LIDGTGDASRVGVRLAPLTTLNGCVDDDPETTYLAAAKLLGELGIGYLHIAEADWDDAP
FT                   LMPVAFKQQLRAAFPGVLIYAGKYTAERAREAIAAGWADLIAFGRPFVANPDLPERLRT
FT                   GAPLALHDRNTLFGGGARGLTDYPTLAQAAA"
FT   gene            complement(237415..238221)
FT                   /locus_tag="Bmul_3351"
FT   CDS_pept        complement(237415..238221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3351"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bur:Bcep18194_B0240
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17035"
FT                   /protein_id="ABX17035.1"
FT                   /translation="MNPIPAFGLGTYRLKGQVVIDSVRNGLELGYRAIDTAQIYGNEAE
FT                   VGEAIAASGVSRDALFLTTKIWVDNYAPDKLVPSLEDSLRKLRTDYVDLTLIHWPAPDN
FT                   GVPLATFMTALADAQAKGLTRRIGISNFNIALTKEAIAAVGKDAIATNQIELSPYLQNR
FT                   KLVEFLNAEGIHVTSYMTLAYGKVLGDPVLGAIAKRHDATPAQVALAWAMQLGYSVIPS
FT                   STKRENLASNLLAQTLRLTDDDMAQIAALERNGREVDPAGLAPKWD"
FT   gene            complement(238326..238466)
FT                   /locus_tag="Bmul_3352"
FT   CDS_pept        complement(238326..238466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3352"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="KEGG: azo:azo3630 putative transmembrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17036"
FT                   /protein_id="ABX17036.1"
FT                   /translation="MPLALLAPPLTAFAVGTTECAIARLIATIDADLGVGLPSPAKPRD
FT                   P"
FT   gene            238568..239515
FT                   /locus_tag="Bmul_3353"
FT   CDS_pept        238568..239515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3353"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4749 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17037"
FT                   /protein_id="ABX17037.1"
FT                   /translation="MKITLDELQAFAAVVDSGSITAAAQQLDLTVSAASRTLARLEEKL
FT                   KTTLLRRTTRRLELTEEGRAFLQDARAIIESVENAEEQMLARREMPSGRLRVDAATPFM
FT                   LHVIVPLVRGYRERFPKVELELNSNEGIIDLLERRTDVAFRIGRLKDSTLHSRRIGSSR
FT                   LRMLASPAYVEAHGLPRKVEDLGRHTLLGFTQPESLNVWPILGADGEPQRIEPAIWSSS
FT                   GETLRQLALDGAGIVCLSDFMTAHDRDAGRLVQVLARQTLDVQQPINAVYYRNTAISSR
FT                   IASFVDYLVDALGGGAAAAGSAPSRRKAAWLSPS"
FT   gene            complement(239567..241042)
FT                   /locus_tag="Bmul_3354"
FT   CDS_pept        complement(239567..241042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3354"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: bch:Bcen2424_5407 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17038"
FT                   /protein_id="ABX17038.1"
FT                   /translation="MTNQPTQTAADRPVDMIIFGGGGDLAARKLLPALYMAHLHRNLPP
FT                   DTRIIAVGRRDWGIDGYRKFMDEQSRPFIDEKAFDADAWRRFLDLFQYVLIDVNAPDDY
FT                   ARLAAASRDGAIRVFYLSTSPELFTTICDNLSAAHLVDAHSRVVLEKPLGHDLASAKAI
FT                   NDSVGKHFEESQIYRIDHYLGKETVQNLMVLRFGNPIFGPLWQAPSIRSVQITVAETVG
FT                   VGSRAGFYDHTGALRDMVQNHLLQLLCIVAMEPPVSLDPDAVRDEKLKVLRSLRPMSLS
FT                   DVARDTVRGQYTAGAVDGQPVKGYLEEENVPPDSRAETFVALRAYINNWRWANVPFFLR
FT                   TGKRLQRRQSEIVIEFADMPFSIIPSGPRHYGNRLVIQLQPEESIQLQMLAKEPGSGMN
FT                   MVPVSLNLDLQQAIPERRAEAYERLLIDVIRGRLTHFMRRDELEAAWTWVEPILDGWQQ
FT                   LGDRPRLYTAGTFGPAASSALLARDNMSWSEEA"
FT   gene            complement(241336..241914)
FT                   /locus_tag="Bmul_3355"
FT   CDS_pept        complement(241336..241914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3355"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: bvi:Bcep1808_3598
FT                   uncharacterized peroxidase-related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17039"
FT                   /protein_id="ABX17039.1"
FT                   /translation="MSTATPAPVSRFPVPALDDLPDDIRARIAAVQEKSGFIPNVFLTL
FT                   AHRPDEFRAFFAYHDALMDKPGNLTKAEREMIVVATSSANQCQYCVIAHGAILRVRAKD
FT                   PLIADQIATNYRKADITPRQKAMLDFAMKVSQAAQQVGEADFDTLKSHGFTEEDAWDIA
FT                   AISAFFGMSNRIANVTNMRPNAEFYALAR"
FT   gene            complement(242013..242996)
FT                   /locus_tag="Bmul_3356"
FT   CDS_pept        complement(242013..242996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3356"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bch:Bcen2424_5401 alcohol dehydrogenase, zinc-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17040"
FT                   /protein_id="ABX17040.1"
FT                   /translation="MFHGILIDKDDTGQRTRVQTLDDAQLPDGNVTVRVAYSTLNYKDA
FT                   LAITGKSPVVRRFPMVPGIDLVGEVEDSAHPDYRRGDRVVLNGWGVGETHWGGLAQKAR
FT                   VDGDWLVPLPDAFSPQQAMAIGTAGYTAMLCVMALERHGVRAGDGEIVVTGAAGGVGSV
FT                   ATAILARLGYRVVAVTGRPEDGDYLRALGAAEILDRAQFSAPGKPLGKERWAGAVDVAG
FT                   SHVLANVCATTRYRGVVTACGLAAGMDFPATVAPFILRGVTLVGIDSVMCPRDERLTAW
FT                   RRLAADLDVAKLGDIGREVGLADAIPLADELIRGKVRGRIVVDVNA"
FT   gene            complement(243039..243674)
FT                   /locus_tag="Bmul_3357"
FT   CDS_pept        complement(243039..243674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3357"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: HMG-I and HMG-Y DNA-binding domain protein;
FT                   regulatory protein TetR; KEGG: bur:Bcep18194_B0251
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17041"
FT                   /protein_id="ABX17041.1"
FT                   /translation="MDTCTELPRRRGRPPKQHDDLVATRDMLLRTGLEILTEKGFSSTG
FT                   LDEILGRAGVPKGSFYHYFDSKEAFGLALIDRYAEFFARKLDRHFGDTKRSPLQRVRAF
FT                   VDDARDGMARYDYRRGCLIGNLGQEMGALPETFRARLQATFEDWQRRLADCLRGAQQAG
FT                   ELSHAAAPAELAAFFWIGWEGAVLRAKLERRDAPLVLFAQHFFDALRR"
FT   gene            243871..245058
FT                   /locus_tag="Bmul_3358"
FT   CDS_pept        243871..245058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3358"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bch:Bcen2424_5374 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17042"
FT                   /protein_id="ABX17042.1"
FT                   /translation="MTDTRFTEIEDLLPAAGALREIRHHIHSHPELAYEEHDTAALVAD
FT                   KLEQWGWQVTRGVGKTGVVGTLRVGDGTRSIGIRADMDALPIVEATGLPYASATHGKMH
FT                   ACGHDGHTTMLLGAAQHLAKTRRFSGTVHLYFQPAEEHGVDSGAKKMIDDGLFERFPCD
FT                   AVFGMHNHPGAAPGVFLTRRGPFMSAGDKAIITIEGVGGHAARPHLTVDPVVVAASIVM
FT                   ALQTIVARNVDPAQPAVVTVGSMHAGTANNVIPNGARLELSVRSFSPDVRALLKRRIVE
FT                   LAETQAASYGATAQVEYIEGYPVVVNTDAETDFAAQVARELVGDAQVVEQADLLMGSED
FT                   FAFMLQQRPGSFVRLGNGEGEDGCMVHNPKYDFNDRNLPIGAAFWARLVERYLAQ"
FT   gene            245112..246434
FT                   /locus_tag="Bmul_3359"
FT   CDS_pept        245112..246434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3359"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5373
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17043"
FT                   /protein_id="ABX17043.1"
FT                   /translation="MQKDPVALHPAHAAAMAVGAPAGTRRGAIAAAVIGNWLEFFDFTV
FT                   YGFFAVLIGKLFFPSSDATTSLLLSVATFAAGFFTRPLGSVVLGVYADRKGRKAALNLT
FT                   IMLMAIGTGLIAIAPTYAQIGVAAPLLVVCARLMQGFSQGGEFGAATSTLLEQGGASRR
FT                   AFRASWQLATQGGAALMGSGFAALLSNTMTKAALESWGWRLPFLVGVLIAPVGMFLRRR
FT                   LADDAPADRHHSIERGVLRELFSKHARTVLLLMLTVMGGTVSTYILTFYMPTYAIHTLG
FT                   LPMKLSMFVGVASGCVMLVTCPLFGWLSDRIGSRRLPIFVGRGVLVALLFPAFWLMNHH
FT                   PSLSVILPLTALMLLFYSLGSASEMALMCESLPRHVRATGISIAYALAVTLFGGTAQLI
FT                   ATWLVKVTGSKLAPAGYVAACVVLSLIAVAMLRETAHESMD"
FT   gene            complement(246460..247245)
FT                   /locus_tag="Bmul_3360"
FT   CDS_pept        complement(246460..247245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3360"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: bam:Bamb_4718
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17044"
FT                   /protein_id="ABX17044.1"
FT                   /translation="MTTEDIQKPGDSYVQSFARGLAVIRAFDAQRPEQTLTEVASATGL
FT                   TRAGARRILLTLQTLGYVEADGRLFRLTPKILELGFAYLTSMPFWNLAEPVMEQLSARI
FT                   HESCSAAVLDRTEIVYVLRVPTHKIMTINLSIGSRLPAYCTSMGRVLLSALDDAALDET
FT                   LAQSGIRAHTPRTITDPAELKATIAQVRQQGWAVVDQELEVGLMSISAPIRNRRGQIIA
FT                   AMNISGNAQRHTAKQMVKEFLGPLQEAAQTVSELVARRG"
FT   gene            247501..248703
FT                   /locus_tag="Bmul_3361"
FT   CDS_pept        247501..248703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3361"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bch:Bcen2424_5368 beta-ketoadipyl CoA
FT                   thiolase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   beta-ketoadipyl CoA thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17045"
FT                   /protein_id="ABX17045.1"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVD
FT                   WNAIDDVIYGCANQAGEDNRNVARMSLLLAGLPQGVPGSTINRLCGSGMDAVGVAARAI
FT                   KSGEAALMVAGGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSM
FT                   PETAENVAVDYNVSRADQDLFALRSQQKAARAQQDGTLAEEIVSVTIPQKKGDPLVVSR
FT                   DEHPRETSLEALAKLKGVVRPDGTVTAGNASGVNDGACALLLANEASAKRFGLTPRARV
FT                   LGIATAGVAPRVMGIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   gene            249357..250901
FT                   /locus_tag="Bmul_3362"
FT   CDS_pept        249357..250901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3362"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   HAMP region domain protein; chemotaxis sensory transducer;
FT                   PAS fold-3 domain protein; PAS fold domain protein; KEGG:
FT                   bur:Bcep18194_B0267 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17046"
FT                   /protein_id="ABX17046.1"
FT                   /translation="MRNNQPVTQQEFDFPDDATLMSTTDADSVITYANTAFAQVSGFSN
FT                   DELVGQPHNVVRHPDMPRDAFADMWATLRRGEPWTALVKNRRKNGDHYWVRANAVPMMR
FT                   DGVPVGYMSVRTKPPRDEIDGAEALYRAIREGKAGRRRFHKGLVIRTGLLRVASLTQTM
FT                   SVRTRVHAALAVLAPAVVGAAYACGLSGAGLAAFGAAAVGATAVAALWLDAQIVRPLKR
FT                   LHDQALNVATGASRRGVRMNRVDEIGMTLRTINQLGLMLRWLVDDVTEQVHTVQRASNE
FT                   IAQGNDDLSARTEQAASSVQETAASMAEMTTTVDSNAETALQANRLAMSASDAAERGGQ
FT                   AVSDVVATMREITDSSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSAHAAKEIKTLIGASVERVESGARRVDEAGRTMEDIVAQVKRVSDLIAAIS
FT                   ASTAEQSTGVAQVDQAVVHLDTITQQNAALVEQSAAASASLKQQAARLVDAIEVFR"
FT   gene            complement(250998..252467)
FT                   /locus_tag="Bmul_3363"
FT   CDS_pept        complement(250998..252467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3363"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: bch:Bcen2424_5362 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17047"
FT                   /protein_id="ABX17047.1"
FT                   /translation="MSTVQETLALKDPSLFRQQAYINGEWQGTANGETFEVRNPATGGL
FT                   VGTVPTMGAAETRQAIDAANAAWPAWRKKTAKERAAILRKWHDLMMENADDLALILTTE
FT                   QGKSLAEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPASDKRIVVTKEPVGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGDPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   QGAIASKYRNSGQTCVCTNRFYVHEAVYDQFAQKLAAAVAELKVGRGTEPGVMQGPLIN
FT                   EAAVLKVEAHIEDALAKGATVVTGGKRHALGHGFFEPTVLTGVTPAMKVAKEETFGPLA
FT                   PLFKFGSDDEVIRLANDTEFGLAAYFYSRDIGRVWKVAEALEYGMVGVNTGLISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYLCLAV"
FT   gene            complement(252543..253832)
FT                   /locus_tag="Bmul_3364"
FT   CDS_pept        complement(252543..253832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3364"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III; KEGG: bch:Bcen2424_5361 4-aminobutyrate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17048"
FT                   /protein_id="ABX17048.1"
FT                   /translation="MTVKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFI
FT                   DFAAGIAVLNTGHRHPKIVKAIAEQLELFTHTAYQIVPYASYVELAEKINERAPGDFPK
FT                   KTAFFTTGAEAVENAIKIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPF
FT                   PGDVFHAPYPNAVHGVTTADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEF
FT                   VRALRKICNEHGILLIADEVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVV
FT                   GRADVMDAAAPGGLGGTYAGNPLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLNALQ
FT                   AEVPQIADVRGPGAMIAVEFMKPGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRF
FT                   LFPLTIPQAVFDEALAILEEVLKETVGVPA"
FT   gene            253953..255464
FT                   /locus_tag="Bmul_3365"
FT   CDS_pept        253953..255464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3365"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bch:Bcen2424_5360 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17049"
FT                   /protein_id="ABX17049.1"
FT                   /translation="MRASVLSDWLAQRLVRGGEQPIYRQLHRLLQQAILSRELPAGARV
FT                   PSSRLLAAELGIARNTVTQVYEQLALEGYVHSATGRGTFVADSAPDEIVGAPPETGARH
FT                   AAVQPSARALSARGTRLVEGAGVSKRQGGAFMPGVPDVSRFPARVWTRLHNKYWRRLRP
FT                   DLLTYAPGGGLALLREALADYLRTSRSVRCTPEQIVITTGIHQSIDLAVRLLTDPGDAI
FT                   WTEDPCYWGVRSVLNVSGLTTRPIPVDDEGIAPSAADLAEPPKLMLVTPSHQYPLGMVM
FT                   SLARRRMLLEYARQHGCWIIEDDYDSEFRYGSRPLASLQGLDTAGQVIYVGSFGKTLFP
FT                   GLRVGYLVAPEPLAESFATASAELYREGQLLQQAVLAEFIAEGHFVSHIRKMRTLYGQR
FT                   REVLLDAVARRYGDALQALGSDAGLHLVTRLPDGVDDRAVAQAALERNIVVRPLSGYYA
FT                   DRARASSGLLLGYACVPEDEIETAFATLAEAIDARAFVGPDTAAA"
FT   gene            complement(255511..256347)
FT                   /locus_tag="Bmul_3366"
FT   CDS_pept        complement(255511..256347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3366"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bam:Bamb_4709 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17050"
FT                   /protein_id="ABX17050.1"
FT                   /translation="MDHLFIGLVLCSALLHAIWNAFLHVSDDRLVQLGTMSLPYLAFGV
FT                   LGTALLPAPARSAWPYVGASSVLEVAYCFTLVRAYRSGEFGQIYPIARGLSPLLVSVLA
FT                   FAALGERPTPFGFAGIALVSLGIMSLALRRGFRFSGEGVPYALLTGVFIAAYSICDGIG
FT                   ARESGSALGYIAWVYLLWSVPQLALVCALRGGPQAVFGSRATLRPGAIAGTISLAAYGI
FT                   VIVAYRHLPVATVSALRETSSIFAVAIGWFAMRERPGAQRLVACALVVAGAALIRL"
FT   gene            256462..257535
FT                   /locus_tag="Bmul_3367"
FT   CDS_pept        256462..257535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3367"
FT                   /product="selenide, water dikinase"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: bur:Bcep18194_B0287 selenophosphate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17051"
FT                   /protein_id="ABX17051.1"
FT                   /translation="MPTMTEATQAPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPP
FT                   ALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAM
FT                   GGKPILALALVGMPINVLPHDTIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGLAAI
FT                   GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNRLDDAGYAQMIATTTKLNRPG
FT                   AELAALPGVHALTDVTGFGLLGHTLELARGAALTARVHYASLPWLAGVEAFAADGVVTG
FT                   ASGRNWAAYGADVRLADTLPPVAQALLTDPQTSGGLLVACAPDAVNDVLACFRADGFDR
FT                   AAVIGEMIDGPARVDVA"
FT   gene            257600..258190
FT                   /locus_tag="Bmul_3368"
FT   CDS_pept        257600..258190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3368"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0288 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17052"
FT                   /protein_id="ABX17052.1"
FT                   /translation="MNDFLFGLMIALSVGPVALMIANYGMRAGTASGVRAAVGVATADG
FT                   CYAVVAFTIGAMLASTLASHLSLFRVVGALVLLAMGARMLWQALRDRRRTLDGAAPPPG
FT                   ARPFTSMFLMTLANPLTILLFYGYATAAAASHCHWLLGAACVFAGSLVGQLVFAFGGSA
FT                   IGRLVKSPALLAASHVVAALVVLGYGVAGLARL"
FT   gene            258318..259391
FT                   /locus_tag="Bmul_3369"
FT   CDS_pept        258318..259391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3369"
FT                   /product="purine nucleoside permease"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   bch:Bcen2424_5356 purine nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17053"
FT                   /protein_id="ABX17053.1"
FT                   /translation="MLTRSILSAAAFSLAACATAPSIAQDNQGNAGNDSAETGAQGRPV
FT                   KVMIITMFGPEGQAWLDRLGPWRDVAVPGLSPDYPAVHCNRQDVCVITTGMGYANAAAS
FT                   IMALTFSKRFDLRRTYFLISGIAGVDPAQGTVGSAAWAKYLVDFSLQWELDAREIPAGW
FT                   NTGYLGINTKSPNDKPPLDYRTEVFQLNPQLADAAYALSRNVVLADSAQAQAARAKFSY
FT                   APANRPPTVIRCDTSSGNTWFSGTLLGERARQWTKILTDGKGTYCMTAQEDNATFEALK
FT                   RAASVKRVDLSRVAVLRTGSDFDRPYDGQTSADNLLNYADQGGFAPATENLYRAGNPLV
FT                   QDIVSHWSEWRNGVPRR"
FT   sig_peptide     258318..258392
FT                   /locus_tag="Bmul_3369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(259610..259903)
FT                   /locus_tag="Bmul_3370"
FT   CDS_pept        complement(259610..259903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17054"
FT                   /protein_id="ABX17054.1"
FT                   /translation="MNRRHLLSAVAVALAVSAPAFADTDTPHVGDYGNTSSYTQHNGPR
FT                   TRAEVRAEVEQARRDGTLAYLRKATSYPQGIELAQGPYRPTPEGNQLAGAGR"
FT   sig_peptide     complement(259835..259903)
FT                   /locus_tag="Bmul_3370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(260359..261363)
FT                   /locus_tag="Bmul_3371"
FT   CDS_pept        complement(260359..261363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3371"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4701 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17055"
FT                   /protein_id="ABX17055.1"
FT                   /translation="MDRLQAMQVFTRVVDTSSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQNNNRKPHGKLRVDMPGSIGR
FT                   LLVIPSLCEFHTRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEG
FT                   VSVAAPAYLEKYGEPQTIEDLSQHKAVNYFSSRTGRTIDWSFLIDGKEVEVKMNGIVSV
FT                   NDADAYVTCGLEGFGLIQPPLFMVLPHLREGRLKEVLPGFKPLPMPISVVYPHSRHLSP
FT                   KVRVFVDWVAEVFDRCPLLSGKGSLDATCSKRTFEEAERAPVLDTPVINEWVA"
FT   gene            261537..262397
FT                   /locus_tag="Bmul_3372"
FT   CDS_pept        261537..262397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3372"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bvi:Bcep1808_3581 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17056"
FT                   /protein_id="ABX17056.1"
FT                   /translation="MDASEFSKFLKSALPAEARAGAALAVTELEIPGYAQDIALRLYRR
FT                   PDKTGLPVVLYFHGGGFVRGTLDDADFAARFLAERLPALVVSVDYSLAPAFPFPAAPED
FT                   AYRAAVWAATRARAFGGNPKKIGVAGHDAGGQLANCLAFIARDRGDVPIVAQALFGPML
FT                   DPSMTRIGDAERLASDITARECAACYRAYLPQASQRMHPYAAPLESVRLSGLPPTLIVT
FT                   AQNDVLHVEAEKYAGCLISSGVLTQVIRYPDVTHAALATHEAAFDEAVRFFQCRFQARQ
FT                   PNRNE"
FT   gene            262429..263646
FT                   /locus_tag="Bmul_3373"
FT   CDS_pept        262429..263646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3373"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bch:Bcen2424_5352 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17057"
FT                   /protein_id="ABX17057.1"
FT                   /translation="MAILRTSRSRIATAAVATLAVVGLGTFGAMRVNANAPEKAAAPLT
FT                   EVDVATVVPQTVTDWQSYSGRLEAVEKVDVRPQVSGTIVAVNFKDGALVKKGDVLFVID
FT                   PRPYQAEVDRAAAQLAAAQARNGYAQSDWQRAQRLIGDNAIAKRDYDEKQNAAREAAAN
FT                   LKAAEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAPPLTTLVSVSPIYA
FT                   SFDADEQTYLQYINGARNGRKVPVELGLANETGYSRSGEIDSVDNRLDTSSGTIRVRAR
FT                   FDNADGTLVPGLYARVKVGGSAPHAALLVDDAAINTDQDKKFVFVVDQQGRVSYREVQP
FT                   GMQHGNQRVIVSGLAAGDRVIVNGTQRVRPGEQVKPHMVPMTGGDAPSAPIASTAKPAA
FT                   PAKADS"
FT   sig_peptide     262429..262533
FT                   /locus_tag="Bmul_3373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 35"
FT   gene            263692..266877
FT                   /locus_tag="Bmul_3374"
FT   CDS_pept        263692..266877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3374"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bch:Bcen2424_5351 transporter, hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17058"
FT                   /protein_id="ABX17058.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVLILLGGVIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPDNRYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGSGDYAMRVWLDPQKVAQRGLAAEDVVQAIREQNVQVAAGVI
FT                   GASPSLPGTPLQLSVNARGRLQTEEEFGDIVVKTTPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLQISDEVRKTMAELKQDMPAGVDYKIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTFSLLLGFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIENGMSARQATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRRFNKVFHRGAENYGRGVRGVLSRKAVMLGVYLVLVGATVLISKVVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGSIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFSERHGKALSAGAIAGALNQQYASIKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYAKLSDATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVSVTDV
FT                   FNTMQVYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNAAGEMVPLSSLV
FT                   TVTPTFGPEMVVRYNGYTAADINGGPAPGYSSGQAQAAIERIAHETLPRGVRFEWTDLT
FT                   YQQILAGDSAIWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTHGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGKTPLEAAIEASRLRLRPILMTSIAF
FT                   IMGVVPLVTSTGAGSEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAG
FT                   KDSAGYGVPAPDA"
FT   gene            266870..268423
FT                   /locus_tag="Bmul_3375"
FT   CDS_pept        266870..268423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3375"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bvi:Bcep1808_3578 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17059"
FT                   /protein_id="ABX17059.1"
FT                   /translation="MLEDNKMDNMHNTNGLMRIAKVAAASTLLATLLAACAVGPDYKRP
FT                   DVTTPAAFKEAPTLAPGEQAGTWKPAEPADGAHRGEWWKVFGDPVLDALEEQALAANQN
FT                   LKAAAARVEEARAATRTARSQWFPQVGVGFGPTREGLSSASQFQPQGTGPTNATLWRAQ
FT                   GTVSYEADLFGRVSRNVEASRADQAQSEALFRSVQLALQADVAQNYFELRQLDSDQDLY
FT                   RRTVELREEALKLVQRRFNEGDISELDVSRAKNELASAQADAVGVARRRAASEHALAIL
FT                   LGKAPADFAFKETPLVPVAVKIPPGLPSALLERRPDVAAAERAMAAANARIGLAKSAYF
FT                   PKLDITGSFGYEASTLGNLFLWSSRTFLLGPFAGTALTLPLFDGGRRAAGVQQARAQYD
FT                   EQVANYRQQVLVAFREVEDNLADLRLLDDQIRAQNAAVNASRRAATLSRTQYQEGEVAY
FT                   LDVIDSERSVLQSQLQANQLTGAQAVSTVNLIRALGGGWGEAPTAVDGAAAAKAEIAGR
FT                   "
FT   sig_peptide     266870..266983
FT                   /locus_tag="Bmul_3375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.883 at
FT                   residue 38"
FT   gene            complement(268602..268952)
FT                   /locus_tag="Bmul_3376"
FT   CDS_pept        complement(268602..268952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3376"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: bvi:Bcep1808_7444
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17060"
FT                   /protein_id="ABX17060.1"
FT                   /translation="MVKRVKFERGDIVRVSPNPTLGREQQGDFRPALVLSPAAFNALGV
FT                   ALVAPITQGGEFARFAGFAVPLSGAGTETQGVALVNMIRMLDLEARGARKVERAPVEVV
FT                   EDALARLQTIIE"
FT   gene            complement(268946..269197)
FT                   /locus_tag="Bmul_3377"
FT   CDS_pept        complement(268946..269197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3377"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG:
FT                   bvi:Bcep1808_7445 transcriptional regulator/antitoxin,
FT                   MazE"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17061"
FT                   /protein_id="ABX17061.1"
FT                   /translation="MELKIQKWGNSAAVRLPSVLLEQIKATVGSSLSADVRPDGVLLTP
FT                   ARRKYSLDELVAQCDTKAPFPADMAAWGEVKPVGREAW"
FT   gene            complement(269325..270872)
FT                   /locus_tag="Bmul_3378"
FT   CDS_pept        complement(269325..270872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3378"
FT                   /product="MlrC domain protein"
FT                   /note="PFAM: MlrC domain protein; Microcystin LR
FT                   degradation protein MlrC-like; KEGG: bpe:BP2111
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17062"
FT                   /protein_id="ABX17062.1"
FT                   /translation="MGAGRTSRTPTVLPGFSLMTTRILIAGFQHETNTFAPTRAAYANF
FT                   ERGEGFPAMVRGADLLALRDVNIPAGGFIHAAQRRGWALQPVIWAGASPSAHVTEDAFE
FT                   RIAGEIVDAARHGGFDAVYLDLHGAMVAEHTDDGEGTLLERIRAVVGPAVPVVASLDLH
FT                   ANVTERMLSRADALVAYRTYPHVDMAETGERAAALLERLLAGGGPLHRAARRLPFLIPI
FT                   NGMCTLLDPARDMYARLAALETDGVASLSFAPGFPAADFPECGPVVWGYGDADAVDAAV
FT                   QALYDKMLSDEAKWQVPFLSPDDAVREAMRLAEGASKPVVIADTQDNPGAGGDSNTTGL
FT                   LRALLRNGARDAALGLLWDPAAAAAAARAGVGACIELSLGGSGVPGDEPFHGRFEVVAV
FT                   SDGVCRYDGPMMNGMLADVGPVACLKIDGVRIVVSGGKAQMLDRNLYRVGGVEPEAMKI
FT                   LVNKSSVHFRADFQHIAHAVLVAKAPGPMQADPADLPWTRLAHGMRTKPMGDAFKGA"
FT   gene            complement(270918..272222)
FT                   /locus_tag="Bmul_3379"
FT   CDS_pept        complement(270918..272222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3379"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_3262 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17063"
FT                   /protein_id="ABX17063.1"
FT                   /translation="MSAVPSSRHATAQDSAPVQALYRKLNWRLLPLLLLCYTFAYLDRV
FT                   NIGFAKLHMQSALGFSDAAYGLGAGIFFLGYVLFEIPSNLLLPKIGARKTISRIMVLWG
FT                   LTSAGMMFVRGETSFYVLRFLLGVFEAGFAPGMIFYLTYWYGARRMAGVMAVVMLAGPI
FT                   GGIVGSPLSTWLMTALDGAHGLAGWQWMFVVEGLPCALLGLLVLKVLADRPADAAWLTD
FT                   REKNLLASELRTPAAGHHAFGQAARDPRVYLLAFAYFTMICGIYAVSFWLPSILKANGV
FT                   TDTMQIGFYSMIPYIAAAAAMLAIGRRSDRRGERRLHSAVSALVGAAALAAATFADGHL
FT                   AVSLVCMTIATALTWAAYTVFWAIPSQYLTGNAAAGGIALINTIGLIGGFLSPTVIGEI
FT                   RTATGSMQAGLLVIVALMVAGAAALIMNRLPVATR"
FT   gene            272364..273335
FT                   /locus_tag="Bmul_3380"
FT   CDS_pept        272364..273335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3380"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II2256 transcriptional
FT                   regulator, LysR family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17064"
FT                   /protein_id="ABX17064.1"
FT                   /translation="MRELNQRRLRYFHEVLTHGSIRGAADSINTAPSVITRQIRLLEEE
FT                   IGVVLFERQARGVRPTEAAAHLLEYWRGCRSQQELFEERLQALQRLQSGQVRIVTSEGY
FT                   VDVLMDEVLTDFCMRYPKLDVIVDVLPVNNVLQEVAESRAHIGLAYNPPAHPEIRYLAT
FT                   SSQPVVALVHAAHPLAVRGGPVRAHELGEYPLALMPPAFGLGQVAQMLAYTENLPIRPT
FT                   LTTNSLAVLRHFVKRHRGITLIGAFAAYRELDSGELVALPIEHPLFDSAKARLLVKTGR
FT                   PLGVAADTLLNCLLSDMKMFAAANGGGRTRDAARKRAVRRAR"
FT   gene            complement(273348..274238)
FT                   /locus_tag="Bmul_3381"
FT   CDS_pept        complement(273348..274238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3381"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4696 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17065"
FT                   /protein_id="ABX17065.1"
FT                   /translation="MLTSDHIDMLLTVIDKGSFSAAARALGRTPSAVSMAIANLEAELG
FT                   LVLFDRGTREPTPTAAMAALLPDARAIAERLHALRAHAQHLSEGVEDTLRLGLAAEVDD
FT                   APVARALAAVSATYPALAISIVTAPQDVIVDALHRGAVDLCVAYGGLDLHPQEQIHALW
FT                   TETLVAVAAPTHPLIAEAAHPEGIERLSGFRQIVIADPDRPLTDVRPVIGNRTWKVTDM
FT                   ATAIALVTAGHGWANLPASMIGRYVAAGELVPLTFANIRNGLPLPVYLRRPKHTGLGKA
FT                   ANELVRALRADGDAA"
FT   gene            274338..274778
FT                   /locus_tag="Bmul_3382"
FT   CDS_pept        274338..274778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3382"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   bam:Bamb_4695 transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17066"
FT                   /protein_id="ABX17066.1"
FT                   /translation="MQGWKRRVVYVVMFEVLGILIASTVLGALSGASVETSGLLGVMIS
FT                   TTGVTVNFLYNLAFEAWERRRAATTRTIGRRVAHAIGFQVALVTFLIPLIAWWLGVSLL
FT                   QAFLFDAVLIVFFPIFTFVYNWSFDYVFGLPDAVTRNGEPAA"
FT   gene            complement(274921..275775)
FT                   /locus_tag="Bmul_3383"
FT   CDS_pept        complement(274921..275775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3383"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B0304 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17067"
FT                   /protein_id="ABX17067.1"
FT                   /translation="MNMRIEPSVLANPDLQFATLSSGISLPYVEQGSGAPMVFVHGSLC
FT                   DYRYWDPQLAALSAHYRCIAPSLSHYWPAVEAGIQDEFSWQNHVDELAEFIDALDLGPV
FT                   HLVGHSRGGSVAFNVARQHPHLVESLTLADPGGPLQRDGVREEAKLPAAAMALRTKAVE
FT                   LIGSGSVEAGLEMFVDSVSLPGAWKKSTARFRAMAIDNASTLPKQLRDPLPAYSASTAG
FT                   DIACRTLLIDGQRSPKMFRNNVETLSQWIPNAQRQTVAGASHGMNAASPAVFNRFVHEF
FT                   VAA"
FT   gene            276344..276925
FT                   /locus_tag="Bmul_3384"
FT   CDS_pept        276344..276925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_1060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17068"
FT                   /protein_id="ABX17068.1"
FT                   /translation="MNRRIAVVGDGLSSGGTIAPYGGPRLLVHGHQAALIGGQAFCAAC
FT                   KTTGIIAKAGGPYRLRFQGEVALEHDIVLCGCSTPPSIVAILAGEAWCDDRLEGLGEVV
FT                   SSRTSTDGVVSLKKGAFDEQIEAATRDSISGGWENYPYYIETVDGRIYSGVLDARGTLP
FT                   RVNTGDESHNYTVYWGDEAIAKEHSGVNHA"
FT   gene            276918..277553
FT                   /locus_tag="Bmul_3385"
FT   CDS_pept        276918..277553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_1059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17069"
FT                   /protein_id="ABX17069.1"
FT                   /translation="MPNRPTKVRTNDTPNSKRSVQLQALSFQALWDAYPKNDPYDDPTG
FT                   EYKNQCAIRMSVTFHRIGSDMKSFSQNVLKPMPGKRTLGRLILGGKATATRAYELAEWL
FT                   KLRPFLGLGKPENITGQDWQEKIDGRTGIIYFFGYWRQEGDSRDALSGGHIDLWNKDTL
FT                   TPSFASFWRFRVGRRTMPDLRSWFRPGGNENWISDLAASKEILFWEVR"
FT   gene            277550..277858
FT                   /locus_tag="Bmul_3386"
FT   CDS_pept        277550..277858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3386"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc2281 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17070"
FT                   /protein_id="ABX17070.1"
FT                   /translation="MKRMAFAVLGFVWGLLVTGASFYVFNRLDWAKPSRPAVGCGESCA
FT                   SHAGLVATMLFILLWPSIACAVLNAIAYRRWSVRKWCIAFVIVTLLAILFHLATYVT"
FT   sig_peptide     277550..277609
FT                   /locus_tag="Bmul_3386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.574 at
FT                   residue 20"
FT   gene            complement(277922..278251)
FT                   /locus_tag="Bmul_3387"
FT   CDS_pept        complement(277922..278251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17071"
FT                   /protein_id="ABX17071.1"
FT                   /translation="MDRIDITEHGRLDGFLIRGITHAQKTFRPSDWPERLAGVITLFVG
FT                   ERRPGYPCALTRLAMPVVDGGVKCLFVSGELRAVCADAFEFAMQFAADNDLPVEVKTAP
FT                   VLAVR"
FT   gene            complement(278275..279636)
FT                   /locus_tag="Bmul_3388"
FT   CDS_pept        complement(278275..279636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3388"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase; KEGG: bam:Bamb_4692 two
FT                   component, sigma54 specific, transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17072"
FT                   /protein_id="ABX17072.1"
FT                   /translation="MEDEIRVLVVEDDENVRIGVEQAVALAGFPVQAFASAADALAHVA
FT                   PGAPVVIVSDVRMPGIDGLQLLERVMAVDSQIPVVLISGHADISTAVGAMHDGAYDFIE
FT                   KPFSSDLIAGRVARAVEKRRLTLEVQGLRAALHNWQGIEALVLGKSPAMADVRKKILRL
FT                   ADTSVSVLITGETGTGKELIARSLHDFGGRRDAHFVALNCGGLPEQIFESELFGHEAGA
FT                   FTGAIKKRIGKIEWAQGGTLFLDEIETMPIPLQIKMLRVLQERVVERLGANELIPVDCR
FT                   VIAASKADLAELAADGRFRADLLYRLNVAQIELPPLRERREDVPLLFEHFVLAAARRFG
FT                   QPAPVVSAAQVSELMTHAWPGNVRELQNVADRFVLGLTGDSLLSGDGPRPTSGTLAEQL
FT                   AYFERMLIEDMLRRHHGNVADASIALGMPKKTLYHKLRHLRIPARGDTAPDGGE"
FT   gene            complement(279626..281509)
FT                   /locus_tag="Bmul_3389"
FT   CDS_pept        complement(279626..281509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3389"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bvi:Bcep1808_3572
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17073"
FT                   /protein_id="ABX17073.1"
FT                   /translation="MRANVQKSFKGIPWWGWASAAVLYVGVAGAVVDFAWERAIDALEE
FT                   AGAHRLDLYASSLKSELGRFEILPALVARQDSVRALLKASPQQARDLLHPVDVYLEAVN
FT                   RDAGSGAVDVIDLHGDVIAASNWNEPVSFVGTNVSYRPYFKDALARGSGRFFGIGTNTG
FT                   VLGVYFASAVRDDGTPIGVAAAKISVDPLESAWRAPGVAAMVVDGNGVVVISTEPAWKF
FT                   TALRPITAQQQRDIQASRQYAGRTVDALPYHRIGEHSAAAWFGTFSDPHRAGRTARYLV
FT                   MSRPAPQAGDSLMVLLDTAGARRQQQTAFVFVTGAFLIVALLVGYAIQRRRAIAARLSA
FT                   QDALRRANDRLELTVAQRTAALTEANERMQREIVERERTEQRLRDSQQEVVHAGKLAVL
FT                   GQMAAGLTHELNQPLVAIRTLCDNARTFFERDQPAQAFANLERIGKLVDGMAVLTGELK
FT                   TFARKPDVERVAVSLNEAVAHARLIYDARLRDEGVQLDVNIAPGTTVSAESSQLQQVIV
FT                   NLLGNALDAVHDAPVRRIAIAADAPDAHGRVRFTVTDSGAGIAPDVLPHLFEPFVTTKP
FT                   RGQGLGLGLAITSRIVEGFGAKIAATNRDGGGAQFTIEFAAATPQRTEHGR"
FT   gene            complement(281694..283058)
FT                   /locus_tag="Bmul_3390"
FT   CDS_pept        complement(281694..283058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3390"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG:
FT                   bch:Bcen2424_5340 citrate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17074"
FT                   /protein_id="ABX17074.1"
FT                   /translation="MQTSIPTPSHPESVVEAGSTARTRFWPEGWWKLMEIGIGIIPLPV
FT                   YLILFALIVGFAVTGKVPGEISMAIAVLAFFGFTCAELGKRLPLLRNIGAAAIFATFVP
FT                   SALTYYHVLPKPVLNLTVEFTKSTNFLYLFIASIIVGSILSMDRRVLIQGFLKIFVPLA
FT                   LGSVAAAIVGTAVGTALGLGARHTLLYIVVPIMAGGVGEGAIPLSIGYSEILHLPQGEM
FT                   FAMVLPSVMLGSLTAIILSGALDMLGKRLPHLTGNGRLQVGETGDMTPEHEEKRGLVDV
FT                   THIAGAGITAITLYLVGLMAHKLFGLPAPVAMLFLAVLVKLARAVSPPLQEGAFVVYKF
FT                   FSTAVTYPLLFAIGVAMTPWDKLTAAFTLVNVVTIVATVATLMGTGFVVGRLLKMYPID
FT                   TAIVNACHSGQGGTGDVAILTAANRMQLMPFAQIATRIGGAIVVTVTLILLAHFG"
FT   gene            283474..284325
FT                   /locus_tag="Bmul_3391"
FT   CDS_pept        283474..284325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3391"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bam:Bamb_4689 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17075"
FT                   /protein_id="ABX17075.1"
FT                   /translation="MPHAVLSVRFVAARLARTARLFATALFAASLGLALPNGAHADSAP
FT                   LKVGIATSPQIDALKVAAKEAKAQGLDVKIIEFTDWNTPNAALANKDIDVNYFQHIPFL
FT                   ENAKKQGGYDFVAIAPGTIMKIGLYSKKVKSFGELKDGAKVAIANDPVNGGRGLLLLQR
FT                   AGLITLKPGVDYRATTRDIVANPKHLKIVQLEASQLARSLDDVDLAQGYPSFIKLAGTT
FT                   DPNSALLFDGTENKNFAIQWVVRPDSVNDPRIRKFITIYQHSPAVRKALDNAFGSLYAV
FT                   AW"
FT   sig_peptide     283474..283599
FT                   /locus_tag="Bmul_3391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            284337..285734
FT                   /locus_tag="Bmul_3392"
FT   CDS_pept        284337..285734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3392"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /note="KEGG: bur:Bcep18194_B0310 flavin-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17076"
FT                   /protein_id="ABX17076.1"
FT                   /translation="MANRKKILLNAFNMNCVGHINHGLWTHPRDRSAHYTDLDYWTDLA
FT                   KTLERGKFDGIFLADIVGVYDVFGGGPEVALRESVQVPVNDPLLLVPAMAQVTRHLGFG
FT                   VTANLTYEPPYLFARRMSTLDHLTKGRIGWNIVTGYLDSAARGMGLARQIGHDDRYERA
FT                   DEYMDVVYKLWEQSWDDDAVIRDARARVFARPDKVRRVKHDGPFYSIDAIHLSEPSPQR
FT                   TPVLYQAGSSARGVEFAGRHAECVFVNGQSKAAARAAALDIRAAAARQGRDPASIRIFA
FT                   GVSVVTAETERLAREKFDEYRRYASPEAGLAHFASSTGIDFAKYGLDEPISYVKTDSIQ
FT                   SAVDAISRKSTSGAWTVRRMLEQMSLGGRYAPIVGSPSQVADELQSWIDETGIDGFNLT
FT                   RTVMPESFEDFVDCVVPELQNRGVYKEDYDPAPTLREKLFGAGARLPAWHTGAQHRPSA
FT                   ARESAHA"
FT   gene            285753..286928
FT                   /locus_tag="Bmul_3393"
FT   CDS_pept        285753..286928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3393"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B0311 ABC metal ion transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17077"
FT                   /protein_id="ABX17077.1"
FT                   /translation="MTHWFDTLGFIDAAAAQAGAHARAHVQPAAETGGAAVSLEHVGKV
FT                   FASPRGQAAALRDVTLDVRRGEVFGIIGRSGAGKSTLLRLMNGLERPSSGRVRVQGVDV
FT                   GTLDEDGLVALRRRTGMVFQHFNLLSAKTVFENVALPLKIAGVPKAERTRKAEALLELV
FT                   GLAAKRDAYPASLSGGQKQRVGIARALVHDPEVLLCDEATSALDPETTQSILALLADIN
FT                   RRLGLTIVLITHEMEVIRAVCDTVAVIEQGEVVETGPVWRVFGDPRHGATRALLSTLVH
FT                   DLPAELAARVQPLHDEAALPDGAQIVLDVRYTGESGGEPDVGALAAALGGSVRFLHGGI
FT                   ERIQGHAQGRLVIAAAPHADEAGGTRGHHAVAALLERARRHANHAEVLGYV"
FT   gene            286921..287577
FT                   /locus_tag="Bmul_3394"
FT   CDS_pept        286921..287577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3394"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0312 ABC
FT                   metal ion transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17078"
FT                   /protein_id="ABX17078.1"
FT                   /translation="MFELWWPELLDAIRDTLSMVAASAAIAALLGIPLAVVLVTTAPGG
FT                   IYERRAVNAVLGALVNVFRSTPFIILLVALLPFTRVLIGTTIGVWAAVVPLSIAAIPFF
FT                   ARIAEVSLREVDRGLIEAALAMGAKRRHIVWHVLLPEALPGMLGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTAVMATVIVILIALVSAVQFTGDRLVRRVTRRA"
FT   gene            287633..288487
FT                   /locus_tag="Bmul_3395"
FT   CDS_pept        287633..288487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17079"
FT                   /protein_id="ABX17079.1"
FT                   /translation="MTLPIGAPREWNGQFEEALFVDVARRHRPDFPDKLAAPPREPRTA
FT                   DELAAVADYYTKMASHDLFIVQVVAKAIDTLFRDDPHFQLILSRQLGDDGAHAAIGRER
FT                   VTELTGRDPLPDVDRLVAAHWARIGDLAVRDLAGFLAFEWHYELHILAKLWIQRKTGRI
FT                   ADGAMREHGENRIRPDEEWHRVQIVNWWFATLAALPAAERDALIDRVIAADEQMQARLD
FT                   GYLHDEYAHTAHVFGADIADYRAIYDDWRREMLSRLTGRRLDALVPLSRDSVGQEHDRE
FT                   VVA"
FT   gene            288484..289695
FT                   /locus_tag="Bmul_3396"
FT   CDS_pept        288484..289695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3396"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bch:Bcen2424_5334 acyl-CoA dehydrogenase, type 2,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17080"
FT                   /protein_id="ABX17080.1"
FT                   /translation="MNDPRGPATLARDDDSPAIDRDALARTIDALRDTAAVRDRAGGHA
FT                   AREKQWLADAGLLTLAVPRAFGGRGAEWPAIYEAIRQIARVDSALAHLVGFQCLQVVSI
FT                   DVWGNAAQRERYLRGTVEHRWWWGNAVNPLDTRLVATATRDGGYRLDGVKGFCSGTRGS
FT                   QRMTVSAQDRDTGRTVFGVVPTDRDGITVNDDWDPIGQRQTDSGSVRFDAVTLAPDEVL
FT                   HRSESPPTPRATLRTLVSQLVLTNLFVGLAEGALEAARDYVLQHGRPWIHADVAHASDD
FT                   PYTLQRFGDMRVQAVAAASLADRAAHALQHAWVQHDALGADARAEVALAVSEAKIVAQR
FT                   AALANGEALFDACGARATGASLALDRFWRNARTHTLHDPLDYRLRDVGRFALTGALPQA
FT                   SLYT"
FT   gene            complement(289724..290572)
FT                   /locus_tag="Bmul_3397"
FT   CDS_pept        complement(289724..290572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3397"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bam:Bamb_4683 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17081"
FT                   /protein_id="ABX17081.1"
FT                   /translation="MNPTAALHSIPPSAGRASGVGPLLRTWRQRRRLSQMALALEADVS
FT                   ARHLSFVESGRAQPSREMVLHLAERLDVPLRERNALLVAAGYAPLFRERPFSDPQLDAA
FT                   RHAVEAVLRGHEPYPALAVDRHWTLLAANRMLGALVAQADPALLQPPVNVLRLSLHPDG
FT                   LASQIVNWQEWRAHILHRLQRQIDASGDRTLHTLRDELAAYPAPAGQPDETHTRTDYAD
FT                   IAVPLRLRTAAGELTFFSTTTVFGTPVDVTLSELAIEAFFPANAQTADAMRALADALPA
FT                   T"
FT   gene            complement(290719..292095)
FT                   /locus_tag="Bmul_3398"
FT   CDS_pept        complement(290719..292095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3398"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: General
FT                   substrate transporter; major facilitator superfamily MFS_1;
FT                   KEGG: bur:Bcep18194_B0327 D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17082"
FT                   /protein_id="ABX17082.1"
FT                   /translation="MTNQTPSRDLPIDLARTERRTAVRYWILAMLFVVTTLNYADRATL
FT                   SITGTPIRQAFGIDPVTMGYIFSAFSWAYVLAQLPSGWLLDRFGARRVYAASIFLWSAF
FT                   TLLQSTIGLGGSAAFAVVALFAMRFAVGIAEAPAFPANAKVVASWFPTAERGTASAIFN
FT                   AAQYFAAVVFSPLMAWLTHAYGWHHVYLWLGLAGIALALLWLRVVKDPADHPAVNRAEL
FT                   EHIEQGGGVVRAAARRDGTRAEGSRVAGWYYVRQLLSNRMLIGVYIGQYCVNVLTYFFL
FT                   TWFPIYLVQARGMSLLKAGFMTSLPAVCGFLGGVLGGMLSDALIRRGVSLTLARKIPIV
FT                   GGMLLSMVIIGCNYVDSEALVIVLMAVSFFGKGIGSLGWAVVADTAPKEAIGLSGSLFN
FT                   MFGNTAGIVAPIAIGYLVGASGSFNGALVFVGLNALVTVFSYLVIVKDIRRVELRHQAA
FT                   "
FT   gene            292345..293922
FT                   /locus_tag="Bmul_3399"
FT   CDS_pept        292345..293922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3399"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bam:Bamb_4679
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17083"
FT                   /protein_id="ABX17083.1"
FT                   /translation="MQLTGEMLIGADAVVGSAGTLYAFDPSKGAPIDVPAFGIATQADV
FT                   DRACELARGAFDAYRAQPLPVRASFLEAIADEIVALGDALIERAHAETGLPAARLQGER
FT                   ARTVGQLRLFARVVRDGRFLAASIDPAQPTRTPLPRSDLRLQKIPLGPVAVFGASNFPL
FT                   AFSVAGGDTASALAAGCPVIVKGHEAHLGTSELVGRAIRAAVEKCGMPAGVFSLLVGPG
FT                   RVVGTALVNHPAIQAVGFTGSRQGGMALVQLANARPQPIPVYAEMSSINPVVLFPAALA
FT                   ARGDAIATGFVESLTLGVGQFCTNPGLVLAIDGPELDRFEAVAAQALAKKPAGVMLTRG
FT                   IADAYRNGRGTLAELPGVREIGAGEPAQTECQAGGALYDVAAQAFLSEPAFGHEVFGPS
FT                   SLIVRCRDFDEVARVLDALEGQLTATLQMDADDKPLARRLLPILERKAGRLLVNGFPTG
FT                   VEVCDAMVHGGPFPATSNAAFTSVGATAIDRFLRPVCYQDFPDDLLPEALQQDNPLSIP
FT                   RLRDGKAE"
FT   gene            complement(294165..295493)
FT                   /locus_tag="Bmul_3400"
FT   CDS_pept        complement(294165..295493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3400"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: reh:H16_B1957 transcriptional
FT                   regulator, MocR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17084"
FT                   /protein_id="ABX17084.1"
FT                   /translation="MAEPRYKSIVDDLVGHIRAGTLPPGTQLPTIRALMKQHGVALATA
FT                   SRVYGELEAMGLVVGEVGRGTFVRDTSLPRGLGLEQNPARSGAIDLTFNYPSLPGQVEL
FT                   LRTGLRTLAASGDLDALLHSAPQGGRRHERQTVAKHLRNRDIRVPGEQVLIVNGAQQGL
FT                   AVTVMALLQPGDILAIDALTYPGMKALAQLHRLDLAPLPSCAGGGPDLDRLDALCRRRP
FT                   VRALYTMPTLHNPLGWVMSEPDRIRLAELAERHDFLIIEDGAYAFLAEPAPKPVFTYAP
FT                   ERTVYVSGLSKSVASGLRMGFVAAPEHLIPALERAIRVSTWNTPSLTVALACQWIESGI
FT                   VDTLEDQKRKDARRRQSLARRILRGGAIVAHPNSYYVWLELPDDLRADRVAADLERDGV
FT                   LVTTAEPFSTTPNTRHALRLALGSLSLDALGDALHKVRRAVIG"
FT   gene            295575..296204
FT                   /locus_tag="Bmul_3401"
FT   CDS_pept        295575..296204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3401"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   reh:H16_B1958 putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17085"
FT                   /protein_id="ABX17085.1"
FT                   /translation="MIDTSTLLIFSGAVMSLLLSPGPNMAFVMAHGMAYGLGGGAAAAL
FT                   GIGLADLILTLLTATGVTAMVAAWPPSFDVIRYAGAAYLLWMAYKAMRRPGELGRVAAS
FT                   QATLRSVFVRAALNSLLNPKALLFFMVFLPQFADRGKGAVGHQLIVLGCVLTAISTVFH
FT                   TLLGSVGGSVRRFLGRHACAAKLQSRGLAALLVLLAVRLAVMSRPV"
FT   sig_peptide     295575..295655
FT                   /locus_tag="Bmul_3401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.631 at
FT                   residue 27"
FT   gene            296249..296587
FT                   /locus_tag="Bmul_3402"
FT   CDS_pept        296249..296587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3402"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   reh:H16_B1959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17086"
FT                   /protein_id="ABX17086.1"
FT                   /translation="MYIAAFIYKPGEVDDEFHRLSAIIDGIAARLPGFVGAESWRSADG
FT                   RLVNASYYWRDEASLKAFASAPQHLDAKRQFRKWYGGYHVVISKVERAYGDGSVEHFVP
FT                   DSRRSGGR"
FT   gene            complement(296888..297802)
FT                   /locus_tag="Bmul_3403"
FT   CDS_pept        complement(296888..297802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_6111 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17087"
FT                   /protein_id="ABX17087.1"
FT                   /translation="MRSSSEKLSGSISVFAAVVDAGTFVGAAEVIGMTPPGVSRAIARL
FT                   EKRLNVRLFNRTTRSVSLTEEGRRFYEQVMPHLAGLEEAAAAAAGGASAVRGKLRINLD
FT                   PVVYRTVLGQPLDAFMDTHPELEIEFIARDSLGDLVMDGFDLAVRFGEPKASTLIARKL
FT                   LDSRIVTVAAPSYVARWGRPAKPEDLEGRRHRCLEFRNPETGKPFQWEFHRKRKRIVVN
FT                   TQGRLTVNDPGALLNACLAGSGIAQMLLLGAEPLIADGRLINLFPEWVDERYPLYVYYA
FT                   SRHHVPAKTRAFLDFVVELMRNH"
FT   sig_peptide     complement(297737..297802)
FT                   /locus_tag="Bmul_3403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.507 at
FT                   residue 22"
FT   gene            297954..298268
FT                   /locus_tag="Bmul_3404"
FT   CDS_pept        297954..298268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17088"
FT                   /protein_id="ABX17088.1"
FT                   /translation="MVLVQNTSRRRIRWTSTQIGRGLVFRRRRALQCRDSFIREETRMA
FT                   VQTDRRRLLKGASSLLALATLGGVASRDAQAPFYDARVVDLYGALRAGVLRRFASRLND
FT                   "
FT   gene            298324..299190
FT                   /locus_tag="Bmul_3405"
FT   CDS_pept        298324..299190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3405"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bam:Bamb_6112 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17089"
FT                   /protein_id="ABX17089.1"
FT                   /translation="MYAITGITGKVGGALARELLAAGQPVRAVVRDATRAEAWAERGCE
FT                   IATAFMEDSSSLAAAFEGATGVFILPPSEFDPEPGFPEARTVIDAVSAALLKARPGKVV
FT                   CLSTIGAQADEVNLLTQRMLMEQALREMPMPVTFLRPGWFMENAAWDVASASDDGVIAS
FT                   YLQPLDKPVPMVATADVGRVAADLLRQTWYGVRVVELEGPRRVSPNDLAAAFASVLRRQ
FT                   VRAEVVERHTWEALFRTQGMKHPLPRMRMLDGFNEGWICFESNSHEILRGHVELETVVG
FT                   ELVSRRI"
FT   gene            299270..299386
FT                   /locus_tag="Bmul_3406"
FT   CDS_pept        299270..299386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17090"
FT                   /protein_id="ABX17090.1"
FT                   /translation="MEYGTLGRTGLRVSRLSLGAMTFGAGSGIWGDIAGVRP"
FT   gene            299530..300084
FT                   /locus_tag="Bmul_3407"
FT   CDS_pept        299530..300084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17091"
FT                   /protein_id="ABX17091.1"
FT                   /translation="MNISKRGDHLFATGLPKTIGDVAKLVRAQIGEYSEGRVLADELFA
FT                   MQRELGGNEFDLTINRGRPFSGHDTHSLIFGTIVDGFRRDMQAVVFAVKHRRSIDARDG
FT                   AQRSEALTQANAHLATAKQYAAFTVGRLFDAVVDRDVLKQILDATSTTRGRAPAEQKGI
FT                   EEAKHKLSDARYRILGAIARM"
FT   gene            complement(300177..301091)
FT                   /locus_tag="Bmul_3408"
FT   CDS_pept        complement(300177..301091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3408"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /note="TIGRFAM: 5-dehydro-4-deoxyglucarate dehydratase;
FT                   PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bch:Bcen2424_5317 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17092"
FT                   /protein_id="ABX17092.1"
FT                   /translation="MTSPQELKQIISHGLLSFPLTDFDADGSFRPTTYAERLEWLAPYG
FT                   ASALFAAGGTGEFFSLTQREYSDVIRVATETCKGKVPILAGAGGATRVAIEYAQEAERL
FT                   GASGVLLMPHYLTEASQEGIAEHVEQVCRALKIGVVVYNRANSKLNADMLERLADRCPN
FT                   LIGFKDGVGDIESMVTIRRRLGERFAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPK
FT                   TAMTFYEAIAKDDHATVGRLIDEFFLPYLKIRNRRAGYAVSIVKAGAKLVGHDAGPVRA
FT                   PLVDLTEEEVAQLDVLIKKMGPQ"
FT   gene            301321..302877
FT                   /locus_tag="Bmul_3409"
FT   CDS_pept        301321..302877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3409"
FT                   /product="galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="KEGG: bam:Bamb_4675 galactarate dehydratase;
FT                   TIGRFAM: galactarate dehydratase; PFAM: D-galactarate
FT                   dehydratase/Altronate hydrolase domain protein; SAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17093"
FT                   /protein_id="ABX17093.1"
FT                   /translation="MTASPLYIRVHPDDNVAIVVNDGGLPEGATFADGLTLREGVPQGH
FT                   KVALTDLAAGDPIVRYNVVIGYALTDLRRGSWVNERTMRMPEPPGLDNLPLATRRAPPL
FT                   APLEGYTFEGFRNPDGSVGTRNILAITTTVQCVAGVVEHAVKRIKAELLPRYPNVDDVV
FT                   GLEHTYGCGVAIDAPDADIPIRTLRNISLNPNFGGEVMTVSLGCEKLQPDRLLPPGAIP
FT                   VVAAEGEPDNGGVVCLQDAAHVGFQSMIDSIMTMAESHLERLNRRRRETCPASDLVVGV
FT                   QCGGSDAFSGLTANPAVGFAADLLVRAGATIMFSEVTEVRDGVAQLTSRAANEDVAREI
FT                   IREMDWYDRYLQRGRVDRSANTTPGNKKGGLSNIVEKAMGSIVKSGSAPIAGVVRPGER
FT                   ARQKGLLYTATPASDFICGTLQLAAGMNLHVFTTGRGTPYGLAQVPVIKVATRSDLARR
FT                   WHDLMDLDAGRIATGAATIEDVGWELFHMMLDVASGKRRTWAEQWKLANALVLFNPAPV
FT                   T"
FT   gene            303090..303476
FT                   /locus_tag="Bmul_3410"
FT   CDS_pept        303090..303476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17094"
FT                   /protein_id="ABX17094.1"
FT                   /translation="MNTAAQSVHTDLIDRYFDAWNEPDVARRRALIDATYASDAAYRDP
FT                   LMAGDGHAGIDTMIAAVQERFPAYRFRRTTDVDGFGQHLRFSWALEAPDGTAIVKGSDF
FT                   GTVDASGRLKSVTGFIDEMPAAAA"
FT   gene            303522..304010
FT                   /locus_tag="Bmul_3411"
FT   CDS_pept        303522..304010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3411"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG:
FT                   bch:Bcen2424_5312 RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17095"
FT                   /protein_id="ABX17095.1"
FT                   /translation="MRFVPAPGAPDMLKNLDPLLHADILHTLRAMGHGDEVAICDANFP
FT                   AESVAQHTVVGRALRIDGADSARVVRAVLSVLPLDTFVETAAWRMEVVGDPAALPPVQR
FT                   EVQAEIDRAEGRAVPLAGIDRFAFYERAQHAYAVIVTGELRGYGCFLFKKGVLLSDAG"
FT   gene            304183..304620
FT                   /locus_tag="Bmul_3412"
FT   CDS_pept        304183..304620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3412"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bur:Bcep18194_B0336
FT                   DoxX family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17096"
FT                   /protein_id="ABX17096.1"
FT                   /translation="MTRSVDSGVIFFARLALAALFLWGGVIKLLGYGDFVGYLRGLNVP
FT                   YPQFVAPIVVAIEALGGLLLIVGYRVKPLALLMAIYTVATAMVGHNFWDATDAAVQHDM
FT                   VIHFWKNIAIAGGFLLLFVTGAGGASIDGLRRPSSSYGGLR"
FT   gene            complement(304764..306074)
FT                   /locus_tag="Bmul_3413"
FT   CDS_pept        complement(304764..306074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3413"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bvi:Bcep1808_3557
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17097"
FT                   /protein_id="ABX17097.1"
FT                   /translation="MQASELSGVPRAAERALTRSDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGGVIMAHFGDLVGRKRMFTLSVLL
FT                   MSVPTLLMGLLPTYDTIGILAPVLLLLFRILQGAAVGGEVPGAWVFVSEHVPSRHIGYA
FT                   CGTLTAGLTAGILLGSLVAAGVNSRYSTAEVAAFAWRIPFLLGGVFGLFSVYLRRWLHE
FT                   TPVFAEMKAKKALAAEIPLKAVLRDHGRAVIVSMLLTWMLSAAIVVVILMTPALLQKQF
FT                   HLTPATTLFANSVATLCLTAGCISAGSLAGWFGAKRVLGIGGLVLAACYYLLFVQVAAD
FT                   ASTLPLYYGIAGFTVGTIGAVPFVMVKSFPPVVRFSGISFSYNVAYAIFGGLTPVIVSL
FT                   MMKWNPMAPVVYVAAICVLGAIAVQFAKDAKDATAAR"
FT   gene            complement(306407..307543)
FT                   /locus_tag="Bmul_3414"
FT   CDS_pept        complement(306407..307543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3414"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bam:Bamb_4669 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17098"
FT                   /protein_id="ABX17098.1"
FT                   /translation="MKLKVSHVALAAACALSGAHAIAADVVKIGFAAPLTGPQSNYGTD
FT                   MQKGVQLAIADFNATHPTIGGKPVTFQLDSQDDQADPRTGTTVAQRLIDNNVRGIIGHF
FT                   NSGTSIPASDLYDRAGLPQISMATSPQYTARGYKTTYRLLTSDAQAGRIVGTYAVKNLH
FT                   FKRIAIIDDRTAYGQGIADEFAKAVQAAGGTIVKRDFTNDKALDFSAILTNLKGINPDA
FT                   VFYGGGDAQSSPMIRKMRQLGMKSAFVTGEMSRSPTFLKVGGDAAEGAIVYMGGLPKEK
FT                   MPGFAGYAARYKARFNEDVITYSPYSYDGTMALLTAMKNANSTDPKVYTPYLGKVSIKG
FT                   VSADRIAYDAKGDLKDAPVTIYRVEHGAFKPVDTIAGN"
FT   sig_peptide     complement(307472..307543)
FT                   /locus_tag="Bmul_3414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.858 at
FT                   residue 24"
FT   gene            complement(307779..308087)
FT                   /locus_tag="Bmul_3415"
FT   CDS_pept        complement(307779..308087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17099"
FT                   /protein_id="ABX17099.1"
FT                   /translation="MHREPRARVRARWRTTVGAGRSARDAARGARSPPRHSTHAATTVP
FT                   TRAAPRQAAIVESPARRVLAGLRTRDDDFRIYQGNRRYAEIVAAHAPNAQDVRIFAT"
FT   gene            308144..308983
FT                   /locus_tag="Bmul_3416"
FT   CDS_pept        308144..308983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3416"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; PAS fold-4 domain protein; KEGG: bam:Bamb_4668
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17100"
FT                   /protein_id="ABX17100.1"
FT                   /translation="MTPTLAVPPHSLSDTLRYRTDNADLGAMLAHFRLLEPVFDALPDV
FT                   AFFVKDANGRYALVNRTLALRCGYKDKRDLLGKTTDEVFPRRFGRSYFEQDMATINAGQ
FT                   QLTDQLELHLYPGRQPGWCLTCKEPLRDASGKVVGLAGISRDLKAHEGSHPAYSKLADV
FT                   VQHIQDHYVQPLNLKQLAQMAGMSVAQLERYFHKVFHLTPRQVLLKTRLDAATALLVTH
FT                   DKVTDVAALCGYTDHSAFTRQFKATVGVTPTEYRMMLQDRAGERSARGGAPEAAAQR"
FT   gene            complement(308974..309237)
FT                   /locus_tag="Bmul_3417"
FT   CDS_pept        complement(308974..309237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17101"
FT                   /protein_id="ABX17101.1"
FT                   /translation="MSAVEAPAGRPAAPPAKKTMLRRLLSHHEIATLLVLLHAPIGANA
FT                   KPELPALQEAGLVEMVKLDADAAPSFRLTKDGTAVLKGLGYR"
FT   gene            complement(309399..311291)
FT                   /locus_tag="Bmul_3418"
FT   CDS_pept        complement(309399..311291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3418"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; Xylose isomerase domain protein TIM
FT                   barrel; KEGG: bam:Bamb_4666 4-hydroxyphenylpyruvate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17102"
FT                   /protein_id="ABX17102.1"
FT                   /translation="MQRSIATVSLSGTLAEKLAAIQAAGFDGVEIFENDLVYFDGSPAD
FT                   VRRMAADLGLDIVLFQPFRDFEGVSAAQLARNLDRVRRKFDVMHALGTDRILVCSNVSP
FT                   DTIADDALLVDQLGALAEAAREAGVVVAYEALAWGRVVKRYGHAWQLVNAVNSPHLGLA
FT                   LDSFHTLSLDDSPDAIADIPGDRIAFVQIADAPKLAMDVLEWSRHYRSFPGQGDFDLAR
FT                   FTARVIESGYPGPLSLEIFNDGFRAAPTAITAADGHRSLLYLEELTRAQLAADGRAPAA
FT                   DQPLFAPPAPPAHVGFQFIEFAVDAQAAATVGDWLRRMRFRLAGRHRSKDVTLFQHGAA
FT                   SIVLNAERDSFADAFFQQHGLSLCASAFRVDDAKVAFERAAGFGYAPFSGRVGPNERVL
FT                   PSVKAPDGSLDYFVDEAPNGPTLYESDFVLTDIDGPTEVGPLTGIDHVCLALPADALDT
FT                   WILFFKTAFGFEAERSWLVPDPYGLVRSRAVRSADGSVRIALNASVDRHTAVAESLNRY
FT                   HGTGLNHVAFRTDDIVKAIAAFAADGVSFLRIPANYYDDLAARYGLSDEMIDTLSTHHL
FT                   LYDRDERGGEFLHAYTELVDNRFSFELVERRGGYDGYGAANAAVRLAAQAQRRK"
FT   gene            311544..311999
FT                   /locus_tag="Bmul_3419"
FT   CDS_pept        311544..311999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3419"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bur:Bcep18194_B0344 3-dehydroquinate
FT                   dehydratase; TIGRFAM: 3-dehydroquinate dehydratase, type
FT                   II; PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17103"
FT                   /protein_id="ABX17103.1"
FT                   /translation="MSKHKVLVLNGPNLNLLGTREPHIYGAETLADVEQRCRAEAESLG
FT                   IDLDFRQSNAEHELIDWLHAARHDTHGIVINPAAYTHTSVALADALSAIAKPVIEVHIS
FT                   NVHRREAFRHHSYVAALAEAVICGCGTDGYIFALQRMATLLARGAAR"
FT   gene            311996..312865
FT                   /locus_tag="Bmul_3420"
FT   CDS_pept        311996..312865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3420"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; Shikimate
FT                   dehydrogenase substrate binding domain protein; KEGG:
FT                   bur:Bcep18194_B0345 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17104"
FT                   /protein_id="ABX17104.1"
FT                   /translation="MNRPSFLIGLIGQGIGGSLSPAMHEEEGFRQGFGYVYRRIDLDAL
FT                   GLSVDALPALLDAAQRMGYNGLNITHPCKQRVIEHLDELSDDARALGAVNTVLFRDGRR
FT                   IGHNTDWSGFAKSFRRGLPGASLERVVQLGAGGAGAAVAHAALQMGAAELTLFDVDATR
FT                   AASLAGELQQRFPAARVVAGGTPSGDALAAAMRAATGLIHATPTGMIKHPGLPLPAELL
FT                   HAGMWVADIVYFPLETELIRAARAAGCATLPGGGMAVYQAVDAFELFTGRTPDAERMFE
FT                   HFQSLVAR"
FT   gene            312899..314233
FT                   /locus_tag="Bmul_3421"
FT   CDS_pept        312899..314233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3421"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5302 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17105"
FT                   /protein_id="ABX17105.1"
FT                   /translation="MQHSTRTSAAPAQAAAGAARRTSARYKILALLAIGTMINYLDRTV
FT                   LGVAAPQLTKELGINAAVMGIMFSAFSWTYVVAQVPGGLVLDRLGSKVTYYWSMTLWSL
FT                   CTFLQGFVPGVATLLACRLGLGLSEAPCFPTNSRVVATWFPQNERAMATGTYTVGEYIG
FT                   LAFFSPVLFALMGAFGWRSLFWVVGAAGILFGLVWWKFYHEPRNHPGANAAELAYIEAG
FT                   GGLVHGVRKNDKPAQKAFSWAMAGRLLKKRQLAGICLGQFAGNSTLVFFLTWFPTYLAT
FT                   ERHMGWLKIGFFAVMPFIAASVGVMFGGIFSDWLLRRGKSANLARKLPIIAGLLLASTI
FT                   ILANYVQSNEAVIAIMSVAFFAQGMAALGWTLVSDIAPDGLLGVTGGIFNLAANLAGIV
FT                   TPLVVGFIVASTGSFVGALVFIGAIALIGALSYIFVVGDIKRIEL"
FT   gene            complement(314303..315412)
FT                   /locus_tag="Bmul_3422"
FT   CDS_pept        complement(314303..315412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3422"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate--pyruvate
FT                   transaminase; 2-aminoethylphosphonate aminotransferase;
FT                   PFAM: aminotransferase class V; KEGG: bch:Bcen2424_5301
FT                   2-aminoethylphosphonate--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17106"
FT                   /protein_id="ABX17106.1"
FT                   /translation="MSDPILLTPGPLTTSATTRHAMQHDWGSWDAAFNRLTASVCADLV
FT                   EIAHGGDEYVCVPMQGSGTFAVEAALGTLVPRDGVVLVPENGAYCTRILTILERLGVAA
FT                   IALPFGEDAAVDAAAIDATLAREPRITHVALVHLETSAGILNPLDAIAAVCRRHGKRLI
FT                   VDAMSSFGALPIALAGSGIDALISASGKCLEGVPGMGFAIVRRDALDACAGNARSLALD
FT                   LHDQYAYLRRTGQWRFTPPTHVVAALRAALDQYRAEGGQPARGARYRENCRTLIESMRA
FT                   LGFVPFLDAGIQAPVIVTFHAPADRAYAFRPFYDAVRDAGFILYPGKLTRVETFRVGCI
FT                   GAIDAADIRRAVAAIARAIESLGIALQPA"
FT   gene            315713..316804
FT                   /locus_tag="Bmul_3423"
FT   CDS_pept        315713..316804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3423"
FT                   /product="2-aminoethylphosphonate ABC transporter,
FT                   2-aminoethylphosphonate binding protein"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate ABC transporter,
FT                   2-aminoethylphosphonate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   bvi:Bcep1808_3548 ABC transporter, periplasmic binding
FT                   protein, ThiB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17107"
FT                   /protein_id="ABX17107.1"
FT                   /translation="MTLQNSTRAAAGAFRKLALAACAAGLLQGAALPAHAANAVVLYTA
FT                   DGLENLYRDVLPAFEKKEGVRVNIVTAGSGEVVNRANIEKNSPKADVIVTLPPFIQQAG
FT                   QMGLLQAYQSVNYKNVPAIAKAEDGTWATFVNNYFSFAINPEVVKNQPKTFADLLSPSY
FT                   AGKVAYSNPATAGDGMAVLILTTSLMGEDKAFDYLAKLSQSVKFHTKGTGYLNVLLSRN
FT                   EIAVANGDLQMDLDDAEHGALSVKPIFLAAKEGDQPTTFQLPYGIGLIKGGPNQDAGKK
FT                   LIDYLMSTDVQSKVPDMYGIPGRTDVPLTGKNGEAVKKAIAGVKLIPVDWNQVMAKKPV
FT                   WLERWKKDVIGSSGKPLDVVKPK"
FT   sig_peptide     315713..315823
FT                   /locus_tag="Bmul_3423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 37"
FT   gene            316839..317942
FT                   /locus_tag="Bmul_3424"
FT   CDS_pept        316839..317942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3424"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding component PhnT"
FT                   /note="KEGG: bvi:Bcep1808_3547 ABC transporter related;
FT                   TIGRFAM: 2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding component PhnT; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17108"
FT                   /protein_id="ABX17108.1"
FT                   /translation="MTLVDTALTHPGAFGAAEPRTTLRSGAPGGVQIEHLSVRYGARTV
FT                   LEDLSLSIGAGEFLTVLGKSGCGKTTLLRFIAGFVKADGLTGTLTVAGRDLTDAPPHKR
FT                   NLGLLFQNYALFPHLSVFENVAFGLRARRMASPEVTRRVADALKLVQLGDAGHHLPAQL
FT                   SGGMQQRVALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTH
FT                   DRDDALVLSDRALLLRDGRIAQLGTPQQLYDAPNDGYVARYLGPANLLPPHVIFPLGDP
FT                   RHDVRDKVACVRPERLTVMPLAAGGLHGTVASVEWQGADLSIAVVLDAAPDEPVRVTMQ
FT                   RGRAAAPARGARVSLHCEADDVVLIEP"
FT   gene            317920..318840
FT                   /locus_tag="Bmul_3425"
FT   CDS_pept        317920..318840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3425"
FT                   /product="2-aminoethylphosphonate ABC transporter, permease
FT                   protein"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate ABC transporter,
FT                   permease protein; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bur:Bcep18194_B0350
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17109"
FT                   /protein_id="ABX17109.1"
FT                   /translation="MSSLSSPEAGLPPQVRASAAAHAAAAKRRKRIADFHLLALAIVVL
FT                   GPLVVYPLVRLVLLSLSGDHGLSFAAYRTFFGNPDTRQVLLTTLGVLFASAGTASLLGV
FT                   MLAALLFFRPFPGAALVTRFLELYVAFPSFLVAFTLIFLYGSQGSVSIALQQLFHLEAP
FT                   PLDFLFGIGGVILAQTVFYTPFVVRPTLASFATLDLRLIEAARSLGASGWMLARRVVLP
FT                   IAWPGIAAGTVLCFLLTLNEFGILLVLGSARLVTLPVAIYSSATVDLDLPTASAGAVAM
FT                   LALSLALYAVYRRVNRRATGGNDVR"
FT   gene            318830..319690
FT                   /locus_tag="Bmul_3426"
FT   CDS_pept        318830..319690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3426"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   membrane component PhnV"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate ABC transport
FT                   system, membrane component PhnV; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: bvi:Bcep1808_3545
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17110"
FT                   /protein_id="ABX17110.1"
FT                   /translation="MSAEIHVAHAVPRRRADWRDALLKHAARAALALAAFACFWLFVLP
FT                   VIVVALSSVATQWSGTILPAGYSLRWFARLGSPEYDALLTSLEIGFGVAALGTLLGLWL
FT                   ALALEGRDRHGIGAVVDALVMVPNGVPSVVLGLAVLIAYHQKPVDLSSSAAIVVLVQLA
FT                   LILPFCYRCAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPALRASLALGFALS
FT                   LGELGATLTVYPPGFATVPIVVIGQVERGYYLPASALSLLMLGASLAALLLIAARVPRG
FT                   TRSAA"
FT   gene            319687..320997
FT                   /locus_tag="Bmul_3427"
FT   CDS_pept        319687..320997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3427"
FT                   /product="phosphonoacetate hydrolase"
FT                   /note="TIGRFAM: phosphonoacetate hydrolase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; KEGG:
FT                   bam:Bamb_4657 phosphonoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17111"
FT                   /protein_id="ABX17111.1"
FT                   /translation="MNAAFALRAPGTAPASCGAPADLADRFVDVNGRRYRLPSEPTAVV
FT                   CIDGCGYDDLARAVDAGVAPFIGRMLAEGSAWRADCVVPTFTNPNNVSIVCGVPPSVHG
FT                   VCGNYFWDPDADGGRGAEVMMNDPAYLRAGTLLAAASDAGARVAVVTAKDKLRRLLGWQ
FT                   LNGVCFSAEKAAQANLAENGIADVLDWVGLPSPDVYSAALSEFVFAAGVRLAQTRQIDL
FT                   MYLSTTDYVQHKCAPGSVGANAFYAMTDRYLAQLDALGWAIGITADHGMNAKHDPATGR
FT                   PNVVYLQYALDGWFGARAARVILPITDPYVVHHGALGSFATVYLAPAIDRTDAMWRVGG
FT                   LDGVECVLDNAEAAARFSLPVDRIGDLVVIARRDTTLGTRERDHDLSGLTVPLRSHGGV
FT                   SEQEVPLLFNRRIERGDFERRPRNFDVFDFVLNRVAR"
FT   gene            320994..322448
FT                   /locus_tag="Bmul_3428"
FT   CDS_pept        320994..322448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3428"
FT                   /product="phosphonoacetaldehyde dehydrogenase"
FT                   /note="TIGRFAM: phosphonoacetaldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: bur:Bcep18194_B0353 aldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17112"
FT                   /protein_id="ABX17112.1"
FT                   /translation="MMAHPRQDHPAFRAEALRWCGTRATRERTFDVMDPYTGTRVGTAP
FT                   LASVDDVRAAFDYAAAYRPTLTRYERSQILERAAALLRERAEEASDLITLESGLSKQDS
FT                   RYEIGRVADVLKFAAVEALRDDAQSFSCDLTPHGKARRVFSQRQPLEGVIVAITPFNHP
FT                   MNQVAHKIAPAIATNNRVIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGDPREIAD
FT                   ELVTHAQASLITFTGGVAIGKAIAAKAGYRRVVLELGGNDPLIVLDDADPERAASLAAL
FT                   GSYRNSGQRCTAVKRILVQRSIAPAFTEALVEKTRAWRYGDPFDPTNEMGTVIDDAAAR
FT                   LFEARVADALAHGARLLTGNVRRGALYAPTVLDRVDPSMTLVREETFGPVSPVIAFDTI
FT                   DDAIRISNGTAFGLSSGVCTDSTAAVVRFVNELNVGTVNVWEVPGYRIELTPFGGIKDS
FT                   GLGYKEGVQEAMKSFTNLKTFSLPWE"
FT   gene            322453..323004
FT                   /locus_tag="Bmul_3429"
FT   CDS_pept        322453..323004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3429"
FT                   /product="HD phosphohydrolase-like protein"
FT                   /note="KEGG: bch:Bcen2424_5294 HD phosphohydrolase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17113"
FT                   /protein_id="ABX17113.1"
FT                   /translation="MALTVEDIDRLYREHGHVAYSGEPVTQLEHALQSGLLAEEAGADE
FT                   ALVAAAFLHDLGHLLNRQGETPSARGIDDLHQYFVLPFVRPLFSDAVLEPIRLHVDAKR
FT                   CLCRTDAGYLESLSPDSVRSLALQGGVFSEEEAAAFMRRPYAEDALRLRRWDDTAKAEG
FT                   KPTPDLDHYMEIVARQVRAG"
FT   gene            323521..325046
FT                   /locus_tag="Bmul_R0072"
FT   rRNA            323521..325046
FT                   /locus_tag="Bmul_R0072"
FT                   /product="16S ribosomal RNA"
FT   gene            325108..325184
FT                   /locus_tag="Bmul_R0073"
FT                   /note="tRNA-Ile4"
FT   tRNA            325108..325184
FT                   /locus_tag="Bmul_R0073"
FT                   /product="tRNA-Ile"
FT   gene            325225..325300
FT                   /locus_tag="Bmul_R0074"
FT                   /note="tRNA-Ala6"
FT   tRNA            325225..325300
FT                   /locus_tag="Bmul_R0074"
FT                   /product="tRNA-Ala"
FT   gene            325595..328476
FT                   /locus_tag="Bmul_R0075"
FT   rRNA            325595..328476
FT                   /locus_tag="Bmul_R0075"
FT                   /product="23S ribosomal RNA"
FT   gene            328590..328702
FT                   /locus_tag="Bmul_R0076"
FT   rRNA            328590..328702
FT                   /locus_tag="Bmul_R0076"
FT                   /product="5S ribosomal RNA"
FT   gene            328961..330385
FT                   /locus_tag="Bmul_3430"
FT   CDS_pept        328961..330385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3430"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_4654 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17114"
FT                   /protein_id="ABX17114.1"
FT                   /translation="MTARSASGDRTTDFLPYLVAATFFMEYLDTTVIATALPQMAHTFG
FT                   VGPNALSLGMTAYMLALAVFIPISGWIADRYGSRTVFGSAIVVFTGASILCGLSNGVGT
FT                   FTAARLLQGVGGAMMVPVGRMIVVRSTEKSRLMRAIATITWPGIVAPVVGPPIGGFITT
FT                   YASWRWIFLLNVPFGIAALVSTWLIVRNTRAEQQRPLDWIGFVLAGGALTCLLLGTETA
FT                   GQQNARFAQAGMLVGASVLFGIAAWVHARRCAHPLLDFTTLKVPTFSVTVITGSITRIA
FT                   INAVPYLLPLLFQIGFGLSPFQSGLLLLASALGNLGMKAGTSWILDRFGFRRVALVDVT
FT                   IVGICTIACGWLTASTPLAITLLVVFVYGLTRSMQFTTLATLAYADIPAQQTSAASTLW
FT                   SAAQQMTIGMGIAFGALSLRVAASLRGDTGGVHYLLADFRWAFVAAGVLALLTLPGYAR
FT                   LARDAGDRLRASAARG"
FT   gene            complement(330479..331351)
FT                   /locus_tag="Bmul_3431"
FT   CDS_pept        complement(330479..331351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17115"
FT                   /protein_id="ABX17115.1"
FT                   /translation="MVLSCIASCRAHIAAYRSVRFPQAATQTISQLQRRTADERSTSVN
FT                   IADLPRTAEPVDVASRVDALDWHLIDTDLDGYGCAHVPRLLSADECRALAALYPDDTRY
FT                   RSRVVMARHGFGRGEYKYFAYPLPTLVDAMRTALYRHLAPIANRWNRALGIDTRYPADL
FT                   AAFLARCHEAGQTRPTPLLLQYGPGDYNCLHQDLYGEHVFPLQVAILLSAPERDFTGGE
FT                   FVLTEQRPRMQSRAEVVPLAQGDAVVFAVHSRPVQGTRGVYRVNLRHGVSRIRSGHRHT
FT                   VGIIFHDAQ"
FT   gene            complement(332115..333749)
FT                   /locus_tag="Bmul_3432"
FT   CDS_pept        complement(332115..333749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3432"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: bch:Bcen2424_5291
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17116"
FT                   /protein_id="ABX17116.1"
FT                   /translation="MATLGSDGTPSRDAAMNQPAPSAANQGSVERTRQIGYAAFLLVLV
FT                   GGGVYIATHLLADLAPVREGSLFPYLMLGAALLIALGFEFVNGFHDTANAVATVIYTHS
FT                   LTPNVAVIWSGMWNFLGVMVSSGAVAFGILQLLPVELILQVGSGAGFAMVFALLIAAIV
FT                   WNLATWYFGLPSSSSHTLIGSIIGVGLMNQLMHGSSGTSGVDWGQALGVGKSLLFSPIV
FT                   GFVCAALLLLALKAVVRIPELYSEPQKDQPPPFWIRCLLILTCTGVSFAHGSNDGQKGM
FT                   GLIMLILIGTVPTAYALNKAVTPAESQTFVAVANQAAATLGKYANGVAPSANPRADVEH
FT                   YVQHRELTPAVIPAVQQLSRSLAGAVGSSGSMAAVPQGDVDNVRNTMYLVSEAIRLIEK
FT                   SGQPAFAADDKLAIDNYRSQLDHATKFIPTWVKVAVAIALGLGTMVGWKRIVVTVGEKI
FT                   GKQHLTYGQGASAELVAMLTIGAADAYGLPVSTTDVLSSGVAGTMAANGSGLQWGTVRS
FT                   LVLAWVLTLPASIVLAGALYWVFRSLA"
FT   gene            complement(333792..334760)
FT                   /locus_tag="Bmul_3433"
FT   CDS_pept        complement(333792..334760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3433"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0361
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17117"
FT                   /protein_id="ABX17117.1"
FT                   /translation="MALFHSSIKSVHVSGSPAHAMLERFHLVVIREVERQGSLTAAANA
FT                   LHLTQSALSHTVKKLEQQLGTPIWYREGRGLRLTQGGQYLLRLAHRLLPQFELAEERMK
FT                   QYAKGERGTLRIGMECHPCYQWLLKVVSPYLSRWPDVDVDVKQRFQFGGIGALFGYDID
FT                   VLVTPDPLNKPGLRFDPVFDYEQVLVVADAHRFARADYVTPEQLVDEVLITYPVETDRL
FT                   DIYNQFLTPAGIVPRRHKSIETTDIMLQMVASGRGVAALPRWLADEYADRMPVVPVKLG
FT                   KKGIAKQIFLGIREADAQIDYLAAFVALARESTWNAPRLLR"
FT   gene            334788..337121
FT                   /locus_tag="Bmul_3434"
FT   CDS_pept        334788..337121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3434"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /note="TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein; KEGG: bch:Bcen2424_5286
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17118"
FT                   /protein_id="ABX17118.1"
FT                   /translation="MAADPSFLQNGSSMVTTHNLGFPRIGAKRELKFGLERYWNGESSR
FT                   DELTALGAALRRQHWNDQRGLDLVPIGDFAFYDQVLDMSFTLGNLPKRVRDFHGDPLDN
FT                   YFRVARGRSAQSADAHAACCGGVAAGEMTKWFDTNYHYIVPEFHGDTNFSLDPSRLLQH
FT                   LAEARAAGVTAKPVILGPVTYLWLGKSKDDSDRLALLPKLLPVYGALLDTLTAQGVEWV
FT                   QVDEPILVTELDAEWRHALRTAYAALETRRIKLLLATYFGELQDNLTLAASLPVDGLHV
FT                   DAINARDEIAAVVRELPADRVLSVGAINGRNIWKTDLNATLDWLEPLAKQLGDRLWLAP
FT                   SCSLLHVPVDLASEDRLDADIRSWLAFALQKLDELKVLATALNEGRDKVADALAANAAA
FT                   IDSRRRSPRVHNPAVKDAIARIDARLGDRASPYPQRAAKQAARLNLPAFPTTTIGSFPQ
FT                   TAEIRHARSRFKAGTLDEAGYRAAMRAEIERSVREQESLELDVLVHGEAERNDMVEYFG
FT                   EQLDGFAFSRFGWVQSYGSRCVKPPILFGDISRPNAMTVEWITYAQSLTHKPMKGMLTG
FT                   PVTILNWSFVRDDQPRSVSCRQLALAIRDEVLDLEKAGVRVIQIDEAALREGLPLRRSQ
FT                   WSAYLQWAVESFRIAANGVRDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDME
FT                   LLDAFDSFRYPNEIGPGVYDIHSPNIPTQDHIVALMKKAAERIPADRLWVNPDCGLKTR
FT                   RWAEVIPALANMVAAAKTLRAQQQ"
FT   gene            complement(337181..338521)
FT                   /locus_tag="Bmul_3435"
FT   CDS_pept        complement(337181..338521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3435"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bam:Bamb_4645 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17119"
FT                   /protein_id="ABX17119.1"
FT                   /translation="METSVKQPKRAALASFVGTTIEWYDFYSYATAAAIVFGPLFFPGE
FT                   NRFVSLLASFGSFAVGFFARPFGGVLFGYLGDRFGRKRSLLATLMLMAVSTVAIGLLPT
FT                   YATAGMLAPILLVLMRVLQGIAVGGEWGGAVLLAGEHAPAGKRTFFASFAQLGSASGLI
FT                   LSMLAFGAISTLPKEDLMSWGWRLPFLASAVLLAVGFVIRASVSESPEFEEVRKSGDTA
FT                   RNPVREALKYWPLLLLAIGANVYGIAGVYFSNIFMISYATQFLSLDRSMVLHCMTIVAV
FT                   LQFVVQLAAAFFAQRFGTTRVLLITGAWAAIVPFVMLPLVHVGTPLSITVGVGLATLAE
FT                   SGYYSVVAGFVSGIFVARIRYTAISIAYQVCGALAGGLTPLVATIIAQNTAPQWWPLAI
FT                   QYTSAAVLSSLCVWLISRRVSIDDAGSSAKDVDALPRAGAHTAARTA"
FT   gene            complement(338573..339529)
FT                   /locus_tag="Bmul_3436"
FT   CDS_pept        complement(338573..339529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3436"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   bur:Bcep18194_B0366 putative agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17120"
FT                   /protein_id="ABX17120.1"
FT                   /translation="MNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAAGLDACFVGVPF
FT                   DLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIA
FT                   RIEAAYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEK
FT                   IAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAP
FT                   LMDEVRERVGDTPVYISFDIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGARGLNIVGC
FT                   DLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD"
FT   gene            339668..340582
FT                   /locus_tag="Bmul_3437"
FT   CDS_pept        339668..340582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0367
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17121"
FT                   /protein_id="ABX17121.1"
FT                   /translation="MLGNLSTLDLRLIRVFLAVTDAGGVSAAQAVLNVGQSTISAQLSS
FT                   LETRLGYRLCERGRSGFRLTPKGERFHAMSRKLLAALDEFGMAARHMDRQLVGTLNIGL
FT                   IGHTPVSQNARIAEAIAAFRTRDEAVRFSISVRAPGDLEEKLLSDEIQIAVGYFWHRVP
FT                   SLEYTPLFVERQVAYCGRGHPLFARAGTLTPEDVAGFEWAWRSYPLPEAQMSTTPDRVT
FT                   ATADNMEAVALLILSGHHLGYLPQHFAAPYVAQGLLAPLDPERLRYDVTFHMVVARSGR
FT                   GNPLVEAFLEDLERAHHTPDTPA"
FT   gene            complement(340629..341093)
FT                   /locus_tag="Bmul_3438"
FT   CDS_pept        complement(340629..341093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3438"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bvi:Bcep1808_3534 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17122"
FT                   /protein_id="ABX17122.1"
FT                   /translation="MTELDKTDRAILAAVQRDGRLSIARLADSVGLSETPCARRLKRLE
FT                   NDGYIERYRAQLSRKALGFGVVAFVLVRFATHDRKVADRFEREVLGIERILSCHNVAGT
FT                   ADYLLQIVARDLDDYGTFLRDSLRMLPGVTSIESALSLREVKHDAGLPVP"
FT   gene            341228..341851
FT                   /locus_tag="Bmul_3439"
FT   CDS_pept        341228..341851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3439"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bam:Bamb_4641 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17123"
FT                   /protein_id="ABX17123.1"
FT                   /translation="MISTHLLLIYLAALAAIYAVPGPDMALVLQTSIGRGVRPGIAAAA
FT                   GLSLSRSAHVTLSACGVAALIRSAPWLYEAIRYGGALYLGYVAIQVFRSPVFDVGNGDA
FT                   AATGELRQSFVKGLLTNLLNPKALLFCSVLLPQFVRPEAGPVVWQMFALGALLVAAGVC
FT                   FDLACVFGASRIAAWMRAHPLAQTVQRWTFSAALLGFALRLSMD"
FT   sig_peptide     341228..341308
FT                   /locus_tag="Bmul_3439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.668 at
FT                   residue 27"
FT   gene            complement(341868..342833)
FT                   /locus_tag="Bmul_3440"
FT   CDS_pept        complement(341868..342833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3440"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17124"
FT                   /protein_id="ABX17124.1"
FT                   /translation="MSAPSLVTVGIDVAKDHVDVSVLGAHLDTQRFDNDAEGHSALAVA
FT                   LQPLDVALVVMEATGGYEAEMACALQSAGLPVAVVNPRQARDFARSMGRLAKTDRIDAR
FT                   MLAQLASVLVRREDLSRLLRPVPDERQQWLAALLTRRRQLLTMLLSERQRLQITPVGLH
FT                   PSLLAIIAAVQAQLDDIDAQMVGHVREHFSELDRLLQSTHGIGPVSSACLIAELPELGK
FT                   LSRRQIAALVGVAPIACDSGSRNGRRRVQGGRFEIRRVLYMATLTATRHNPAIKTFYRR
FT                   LKAAGKLPKVALVACMRKLLTILNAMVRSNTPWDDSLHKA"
FT   gene            343238..344827
FT                   /locus_tag="Bmul_3441"
FT   CDS_pept        343238..344827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3441"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Peptidase S53 propeptide; KEGG: bam:Bamb_4640
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17125"
FT                   /protein_id="ABX17125.1"
FT                   /translation="MARHLHADREPRIVADSKCLGPCDPAERIHVTIMLRRQEEGQLDT
FT                   LLQRLASGDPQAKPLSRDAFAQRFSASPDDIRKTEDFARRHQLTVDRVDPAESVVVLSG
FT                   TIKQFETAFGVTLERFEHHAIGQYRGRSGPIALPDELGDAVTAVLGLDSRPQARPHFRL
FT                   RPPFKPARGAASVTFTPPQLASLYGFPAGDGAGQCIAIVELGGGYRAADIARYFSGLGI
FT                   KTPPRLVDVNVGTGRNTPTGDPNGPDGEVALDIEIAGAIAPAATIAVYFAPNSDAGFIQ
FT                   AVNAAVNDTKNKPSVISISWGGPEAIWQAQSAQAFNRVLQAAAAQGITVCAASGDSGSG
FT                   DGLQDGTDHVDFPASSPYVLGCGGTQLDALPGQGIRSEVAWNDEASGGGAGGGGVSTLF
FT                   DLPAWQHGLSLTRADGSRAPLAKRGVPDVAGDASPQTGYEVSVAGTPAVMGGTSAVAPL
FT                   WAALIARINAAAGTSAGWINPTLYRHPDALRDITKGSNGTFAAAAGWDACTGLGSPDGA
FT                   KLAAILARKPSS"
FT   gene            344899..346575
FT                   /locus_tag="Bmul_3442"
FT   CDS_pept        344899..346575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3442"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   bam:Bamb_4639 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17126"
FT                   /protein_id="ABX17126.1"
FT                   /translation="MGIDSASSGGVYPLHHGDHNSHGVPPSVDPVALSHGRDQPFFDPV
FT                   AYGNGPDDSITDTTEAAAITHHTILIGGRRIAYTATVGHLVTVDPSSSQPAAKIFYVAF
FT                   TADNAKEETRPVTFFYNGGPGSSSVFVLLGSFAPKRIKTAMPGFTPPAPYQIEDNPDSL
FT                   IDHSDLVFINPVGTGYSAAVAPNKNRDFWGVDQDADSLKQFIKRYLTKNNRWNSPKYLF
FT                   GESYGTARSCVLAYKLHEDGVDLNGITLQSSILDYRQAGNPVGTLPTAAADAWYHKRLG
FT                   ITPAPADLGAFVEEVAQFARTDYLSALRKRPHADPAVVKKLSDYTGIDTDTLKSWNLDI
FT                   AGYDARGNSLFLTTLLHARGLALGAYDGRVTAISTGIAGKIDPNSGGNDPTMTAVTGVY
FT                   TAMWNSYLNEQLKFTSNSAFTDLNDQAFRNWDFSHIDPTGEQQGIDAKGNLILYTAGDL
FT                   AAVMALNVDLKVLSANGLYDFVTPFYQTVIDLQQMPLEDQKVRQNLSARFYPSGHMVYL
FT                   DAGSRTALKRDLATMYDATVADTGARMRIRALQAKKTGGHA"
FT   gene            complement(346654..347631)
FT                   /locus_tag="Bmul_3443"
FT   CDS_pept        complement(346654..347631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3443"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase; KEGG:
FT                   bch:Bcen2424_5278 NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17127"
FT                   /protein_id="ABX17127.1"
FT                   /translation="MRNARPHNRPRRAAAHGDCAYDERLAFRSGTFPMTAADYASRQRA
FT                   IIAELNVAPHFDADAEIARRVDFLAQYLRSTGLRTYVLGISGGVDSSTAGRLAQLAVER
FT                   LRGEGYDARFIAMRLPNGVQNDEADAQRALAFVRADEVLTVDVKPAADAMLKSLIASGH
FT                   AFDTPAQQDFVHGNIKARERMIAQYAVAGARRGIVIGTDHAAESLMGFFTKFGDGGADI
FT                   LPLAGLNKRRVRAVARALGAEDAVVMKVPTADLEELRPLRPDEHAYGVTYDEIDDFLEG
FT                   KPVEDRVYETVLRFYDGSRHKRALPYTPFDWPGLGIASNAGHGA"
FT   gene            complement(347982..348857)
FT                   /locus_tag="Bmul_3444"
FT   CDS_pept        complement(347982..348857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3444"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bur:Bcep18194_B0373 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17128"
FT                   /protein_id="ABX17128.1"
FT                   /translation="MLTSLVAALFVALWSTGFIVARAIKPYADPNLFLLARFAGTAALF
FT                   AVVALAARAPWPARREWPRHLIAGALLQGVYLGASYWAVAQGLNAGVMALLGALQPLAT
FT                   AVLAVPLFNERLPARGWLGMALGLVGVALVLAPKVSGGVAAASPGAAPAWLVVGVSVLS
FT                   VGAITAGSLYQKGKLAQSDLRTAVAVQNLGAALVAAVFVVLLHESRWIGAPALWVSLVW
FT                   GVVFLSGGAVTMLMWMLRRGNAARATSLLFLAPPLAALQGYLMFDETLAAIQLAGFVLA
FT                   LAGVVLARQR"
FT   sig_peptide     complement(348792..348857)
FT                   /locus_tag="Bmul_3444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.495 at
FT                   residue 22"
FT   gene            complement(349012..349197)
FT                   /locus_tag="Bmul_3445"
FT   CDS_pept        complement(349012..349197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17129"
FT                   /protein_id="ABX17129.1"
FT                   /translation="MYRKGSVLEIQFSPERLNDGAGDPYWIDLTLDEARRLYEQLAARF
FT                   ASDARANQPLDTFSLD"
FT   gene            349405..350163
FT                   /locus_tag="Bmul_3446"
FT   CDS_pept        349405..350163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3446"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bam:Bamb_4635 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17130"
FT                   /protein_id="ABX17130.1"
FT                   /translation="MLAEQRHQYILSELGRSGALSVAELVRSLDVSRETVRRDLNALAA
FT                   RGLLVMTHGGALAADRREPSLSEREAANADAKRAIGRRAAEFVPDGASVLIDSGSTPHA
FT                   VALALADRHRLSVYTNDWRTALVLARRNGNRVTLLGGELSDDEDATFGLDTIQQLAQYH
FT                   VDFAFVGAGGITADGDCTDYSRLAAEVRSRMIAAAGTAIIVADHSKFGRVTPVRINGTS
FT                   AARYLVTERAPERAVRRALTARGIELVLCG"
FT   gene            350395..352236
FT                   /locus_tag="Bmul_3447"
FT   CDS_pept        350395..352236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3447"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /note="KEGG: bch:Bcen2424_5274 phospholipase
FT                   D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17131"
FT                   /protein_id="ABX17131.1"
FT                   /translation="MSVRVRSYLSPTLVLLAFDWPDAQSRADFLGFAIRRTPGFRSADG
FT                   SRRASASWLPNRLTFDGPAADTQGDAPTDQAPIQKFMWWDARIDPQDRGAAFRYDVYPV
FT                   VGTPERLQLLDAQAGVCRIVLPAHIEDGIGTWFNRAVVSSQAFARQVAALGLAPDAAPS
FT                   DAQALKLRTWLANDMEQVFAEMLDPASRAVSAVYHLTDTLWALPAFEAFGRAHGKASLA
FT                   IVYDAHVTTRKGKRPLPSPNQPAVDALQGLATLAPRDRTHIMHDKFIVTNTGAGVAPAR
FT                   VLTGSANFTTEGLTEQANVLHAFDSPELAELYDERARALAANPSIAETARLSSGWSAPV
FT                   TIGGAQVRVAFSPEPAGRRTEIDTIVAAIAAAKHSVSFCLFMPTDAALRDACFAAGDRG
FT                   LMMFGLVNRISAGSATKADAAQQAGQSLDAATLANLELYHRRRDHRDVIDAAYFSPATV
FT                   PQGFEPELRLFPGEPAPTYPPVVIHHKFIVIDAEGENPIVYTGSANMSRNSEQYNDENL
FT                   LEIRDARIAGTYLAEFLRLYEHYRARALAIEAKQGSTGAHARLALAPDARWARKYFVAG
FT                   SPEEKARRALASPVSADASAETETETSDRERLRYAAM"
FT   gene            complement(352221..352943)
FT                   /locus_tag="Bmul_3448"
FT   CDS_pept        complement(352221..352943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3448"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5273 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17132"
FT                   /protein_id="ABX17132.1"
FT                   /translation="MLECPFHAAAKPEQPHMKAGSKAATSDNRALPSDARRKYDPEQTK
FT                   RNILDVATQEFSAMGLAGARVDAIAERTNTTKRMLYYYFDSKEGLYEAVLEKVYGDIRA
FT                   LEQELHVGDMEPREGMRRLVEFTFDYHDKHRDFVRLVSIENIHGAKYLEQLKSFKNRNV
FT                   SIIKTLEELLERGAASGAFRKDIDAFDLHLLISSFCFHRVSNRYTFGAAFGRDPSAPRL
FT                   RTRHRDTIAEAVLRYIAA"
FT   gene            complement(353021..354289)
FT                   /locus_tag="Bmul_3449"
FT   CDS_pept        complement(353021..354289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3449"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bam:Bamb_4632 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17133"
FT                   /protein_id="ABX17133.1"
FT                   /translation="MQNFYEATVTRPPYPQLSGTLDTQVCIVGGGLAGLCTALGLVERG
FT                   VRDVIVLDGERVGFGASGRNGGFVFGGYSLDNADLLRTLGRDEARRLYRLTVDAVDLIR
FT                   ARIARYGIDCDIVDRGVMLANWFDDPSRLDSVRSLMKREFDVDWEPVTRDALRAQLHTA
FT                   RYHGGLFEPNAFHFHPLKYVLGVAAAAARGGARIYERSAALGIAREGAGYVVRTAHGSV
FT                   RAKDVVFAGGGYARGVSPRIERAVLPIATYVIATEPLGERLKDAIDAPYAIYDTRFAFD
FT                   YYRPLKDTRILWGGRISVLDRGPDAIARLLRRDLLRVYPQLADAKVDYAWGGLMSYARH
FT                   KMPQIGRDADGVWHAIAFGGHGMAPTTVAGETLAAALAEDRPVPDGFRAFGLTRTFGLA
FT                   GLAAAQLTYTAYQARDALAAYRR"
FT   gene            complement(354431..356011)
FT                   /locus_tag="Bmul_3450"
FT   CDS_pept        complement(354431..356011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3450"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0379 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17134"
FT                   /protein_id="ABX17134.1"
FT                   /translation="MHSDARPDSSRPPGSRAAKPALHRRLQARHLRMIAIGGSIGTGLF
FT                   VASGASISQAGPGGAMFAYMVIGLMVYFLMTSLGEMAAFMPVSGSFATYGAKFVDEGFG
FT                   FALGWNYWYSWAVTLAVELVAAQLVMHYWFPHVPGVWWSALFLTLIFALNALSVRGFGE
FT                   AEYWFALVKVLTVIAFLGVGLLMIFGIMKGGPSAGLANFTIGDAPFVGGLPAMLGVAMI
FT                   AGFSFQGTEMIGVAAGESENPRTTIPRAVSQIFWRILLFYVLAIFVIGVLIPYTDPSLL
FT                   KTDVTDIGVSPFTLVFRHAGLAFAAGVMNAVILTAVLSAGNSGMYASTRMLYNLATEGR
FT                   APKLFAKLSPGGVPRNALYATTAVGALCFLTSLYGDKTVYMWLLNTSGMAGFITWLGIA
FT                   VSHYRFRKGLLKQGYRLDQLPYRSKWFPFGPIFAFVLCAIVALGQDYQAFFAARIDWVA
FT                   VAATYIGLPFFFAIWIGYALVRKCRLVRYEDMDIAPWIERNATPEPATDTSAGYAAYVA
FT                   RPANPTSGA"
FT   gene            356618..358129
FT                   /locus_tag="Bmul_3451"
FT   CDS_pept        356618..358129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3451"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bvi:Bcep1808_3523 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17135"
FT                   /protein_id="ABX17135.1"
FT                   /translation="MQFNDILAALDIDLAQWKGNALTARSPLDGATLATLAVDTPADAE
FT                   RKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAALGRLVTLEAGKIASEGLGEVQ
FT                   EMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPLGVCGVISAFNFPVAVWAWNAAL
FT                   AFVCGDPVVWKPSEKTPLTAIACHVLLGKALREFDKTHPGVAPEGLHQLVLGTRDVGEV
FT                   LTSSKKVPVVSATGSVRMGTEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVT
FT                   FAAVGTAGQRCTTLRRLIVHRSIVDQLLPRLEKAYASVKVGNPLEEGTLVGPLVDRASF
FT                   DAMQKALADAREQGGEVKGGERVDVGHADAYYVRPAIVRMPKQTAVVERETFAPILYVM
FT                   VYDNLEDAIAVHNAVPQGLSSAIFTNDMREAEYFMSAAGSDCGIVNVNIGTSGAEIGGA
FT                   FGGEKETGGGRESGSDAWKAYMRRATNTINYSRELPLAQGVKFDV"
FT   gene            complement(358244..360694)
FT                   /locus_tag="Bmul_3452"
FT   CDS_pept        complement(358244..360694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3452"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bam:Bamb_4629 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17136"
FT                   /protein_id="ABX17136.1"
FT                   /translation="MFIQRLSHFARRIALIALLQFAVVATASAFPAAASAPSASAVGAA
FT                   PVPTISLSDALAQLKQMQAEQDRIKQKTSTSTTSKELDALEDATQQLSAAVEKLQGELT
FT                   PQRVQLQAQLDVLGPPPAPGAAPETPAVAQQRATLNARKAQIEAALKQAADQKTNLANL
FT                   SDQFAKLHRSLLRNQLAFRSASIFSAQFWLPLFHLPPDDVQRLGDFQRELRDMLGSSWT
FT                   PGQRATTVLLLIAAFAAWLGGRRLLEYGLAWICLNRLPPTRLRRSALALSTAVATLVAT
FT                   AIAVQILYLALARHYTPTPAMSDLWDQFVKLAATCALIAGLGRALLCTKHPSWRLPALA
FT                   DPVALAMRPFPGVLAALLLISGTLESIDRIADTSLSVTLLGRGFVSLVVALTVGASLLR
FT                   ANRVRSALAAAGESPEQRSTLAGLIHAGVTLAIVVSLIALAIGYITVARFITYELVWFE
FT                   IVLCSVYVLTQLTRDASESLFSVNLSTGKQIKHLFALDDRHLEQAHTVVSGIGTSLLML
FT                   VAAIALLTGGFGTTPSDLLDSAIAMIGGQRLQSLNIMPDRIMNAVIGFAIGFYLLRSVR
FT                   RWLDNEFLPALGMDSGMRASLVTLFANVGYVLLVLMTLGLLGVKWSNLAWIVSALSVGI
FT                   GFGLQEIVKNFVSGLILLTERPVKVGDMISIAGVEGDIRRINVRATEIQLSDRSTVIVP
FT                   NSQLISQNLRNVTMGNSTQGVATLMLTFPLNTDPEQVRDLLLEAYRAHPAILEKPAPSV
FT                   TFSQLAPDGITLSVTGYVASPRIAGSTKSDLLFEILKQLRAAGITLSSPQMLVVQNMPS
FT                   ADGA"
FT   sig_peptide     complement(360590..360694)
FT                   /locus_tag="Bmul_3452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.437 at
FT                   residue 35"
FT   gene            361134..362552
FT                   /locus_tag="Bmul_3453"
FT   CDS_pept        361134..362552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3453"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5266
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17137"
FT                   /protein_id="ABX17137.1"
FT                   /translation="MASTDSIPQAPARSPLIDAGTISARLDRLPPTRSVWKLVVLLSLG
FT                   FFFELYDLLYSGYVAPGLVKSGILSATTHGLFGTTGVASFIAALFSGLFVGTIACGFLA
FT                   DRFGRRAIFTWSLLWYTAANVVMAFQDTATGLNFWRFVVGLGLGVEMVTIGTYISELVP
FT                   KQIRGRAFACEQAVGFVAVPVVAFLAYLLVPRAPFGLDGWRWVVLIGAHGAIFVWWIRR
FT                   ELPESPRWLAQQGRLDEADRVMRALEAKVEAEYGRPLPAPAPAEPVAERGSFRDMWVPP
FT                   YRSRTIMMTIFNVFQTVGFYGFANWVPTLLIKQGITITSSLMYSSVIALAAPVGPLIGL
FT                   VIADRFERKSVIVAMAATVLVCGLLFSQTTIGALLIVLGIGLTLASNIMSYSFHAYQAE
FT                   LFPTSIRARAVGFVYSWSRFSAIFSSFVIAAVLKGFGTVGVFAFIAGAMAIVMAAIGIM
FT                   GPRTRGIALEAISR"
FT   gene            362775..364019
FT                   /locus_tag="Bmul_3454"
FT   CDS_pept        362775..364019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17138"
FT                   /protein_id="ABX17138.1"
FT                   /translation="MAFRAMRAARPARAPARPMVNDRMMLSNLTRRIARPRRRTLAVAA
FT                   CMWLAAVPSLSVVAPSAAWAASDTPSSATAGSSPAASAAPAASRPHAASGASGASAASA
FT                   ATPASSASTASGASSASATSAATPASAASETPASEAAPTPPRRHPPLSAHEAESATARA
FT                   LDMRKRFAQEVTRRLNVPANEQRAYGERLQRALAAADLADLAGEYVVMVDRAPNVQALF
FT                   IYFRATPANAWLLIGAAPVATGLPGQYDHFLTPLGVFHHSPDHMDFRAEGTTNENGIRG
FT                   YGHRDMRIFDFGWVDGERGWGKGGKSAMRFQMHATDPDRLEPLLGIRHSKGCVRIPASL
FT                   NTFLDRHGILDDDYQARVEAGKSLWVLRGDREISPIAGRYLVVIDSARKTRPAWSPLPG
FT                   RGAWSKLPKGGDTAD"
FT   sig_peptide     362775..362945
FT                   /locus_tag="Bmul_3454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.316 at
FT                   residue 57"
FT   gene            complement(364024..366387)
FT                   /locus_tag="Bmul_3455"
FT   CDS_pept        complement(364024..366387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3455"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   bch:Bcen2424_5259 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17139"
FT                   /protein_id="ABX17139.1"
FT                   /translation="MARRKGCRRATNVIVCKSCKRNAACAAFAARAFASIAAFSAPPAV
FT                   NRFVSFLRLALARCRARVAPFAAGCAARLRAALRSAAHALRHPTRRGIALTLAAIPTLA
FT                   VLVLLAFVPFTPSIGDIRKARIERPARVLSADGKLIAEFRPVNREWVPLKLISPHTVDA
FT                   LIATEDRRFYAHHGIDWRRTLAAALHTFGGERQGGSTITQQLARNLYPDEVGRAPTLTR
FT                   KLKELVTAFKIEMVYSKAEILETYLNTVPFLYNAYGVEMAARTYFGKSADQLDVVESAT
FT                   LVGMLKGNSYYNPVLNPERALQRRNVVLEQMAKAGMLSASELARLQRRPLRVDFERQTA
FT                   EPGLAPHFAVQVRKWLIAWADSHDYDLYSDGLVIRTTLDARLQQMATRALVQQTDRLQA
FT                   VADAAWRGPSGCGLRNALFRGFMRQTPDYRDARDAGLTDAAALTQLGANRAFVRALCER
FT                   KTQVQAGFVAIDPRNGAIRAWVGSPDFGDEPFDHVEQARRQPGSTFKPFVYGAAFADGA
FT                   RPSDTFVDRDVAIPLGDRSVWRPTDAEPPTGAPMTLRDALALSRNRITAQLMQREGAAK
FT                   VVRLARAMGVRDSPLEAVPSLALGTSPVTLKEMVSAYATIANRGVYVAPQAITQIEDRN
FT                   GKVLARFADAPPQRALPANAALTLVDVMRDVVDRGTGADIRTRYGIRGDVAGKTGTTQD
FT                   NADGWFILMHPQLVAGAWVGFDDGSVTLRSDYWGAGAHSALPIVGAFYVDALRARAIDP
FT                   HAQLSPDFRPRAAPAPAPKRRAHPGLFDWLRLFR"
FT   sig_peptide     complement(366265..366387)
FT                   /locus_tag="Bmul_3455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.962 at
FT                   residue 41"
FT   gene            complement(366419..367924)
FT                   /locus_tag="Bmul_3456"
FT   CDS_pept        complement(366419..367924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3456"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_4617 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17140"
FT                   /protein_id="ABX17140.1"
FT                   /translation="MARTARIVDIPSLGALDRAAGDLSRQLAQALREAVRRGDVRPGDT
FT                   LPATRLLAASLQVARGTVVDAYAQLVAEGFLESRAGAGTRVAHALAAPPPARSAVRRPR
FT                   ARTGLPEPAATFARIAQEFRPLPPAPFAISVPAGLTAPDDVWRRLGNRLRARGAGAPSG
FT                   YADPQGALPLREAIADYVRRSRSVRCEADQVVITSGTQQGLHLATQVLLGAHDRAWVEN
FT                   PAYRGITALLDSTGRRDAMVRVPVDADGIDVDAGMRAAADARVAFVTPSHQYPLGMPMS
FT                   MARRNALLAWARAHRAWIVEDDYDSELRYEGHPFPSLQGLDPERVVYLGTFSKVLFPSL
FT                   RLGYVIAPDDLVPAFCGARVLMDRHAPTADQYVLAAFIAEGHLDRHIRRVRGVYAEQRS
FT                   LLIDTLGARLPRALAWVQPGDQGMHVVLWLADGIDDLDVVARAADAGIAVRAVSPMFAP
FT                   GTARPGLVLGFGGFGRARMEAAAQRLAEVIVEAAGAARRRRAR"
FT   gene            368081..368719
FT                   /locus_tag="Bmul_3457"
FT   CDS_pept        368081..368719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3457"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   bur:Bcep18194_B0396 negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17141"
FT                   /protein_id="ABX17141.1"
FT                   /translation="MYVPADFAESRPDVLRELIVRHPFGSLITHGKDGLDANHLPFEWL
FT                   PADGGLGELHAHVARANPVWQAVANGDDVLVIFHAGDAYISPNWYPSKHATHRQVPTWN
FT                   YVVVHAHGRITVRDDEKFVRGVVARLTRTHEASQPVPWKMGDAPPDYLEAMLQSIVGLQ
FT                   IEITRLVGKRKLGQNKAAADIRGAGEALVASGNVAIGGAMLAAADAKRE"
FT   gene            complement(368801..369382)
FT                   /locus_tag="Bmul_3458"
FT   CDS_pept        complement(368801..369382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3458"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bch:Bcen2424_5256 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17142"
FT                   /protein_id="ABX17142.1"
FT                   /translation="MLPRFRTAAFVFALAATVGLAAFAGTRDEAGTITSLAGSRAPEFA
FT                   GIERWHNSAPLTLDRLRGKVVLVDFWTYSCINCIHTIPYVNDWYRKYRDQGLVVIGVHT
FT                   PEYPFEREAKNVADAIARFGIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVYTRY
FT                   GEGAYDKTEAAIRAALAQAGERAKDATRTQ"
FT   sig_peptide     complement(369308..369382)
FT                   /locus_tag="Bmul_3458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            369611..370351
FT                   /locus_tag="Bmul_3459"
FT   CDS_pept        369611..370351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3459"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B0398 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17143"
FT                   /protein_id="ABX17143.1"
FT                   /translation="MDKPDHVLIVDDDRAIRELIADYLEKNGMRVSLAANGREMRSVLD
FT                   DGAPDLIVLDLMLPGEDGLTLCRDLRAGKFRTVPVLMLTARSEETDRIVGLEMGADDYL
FT                   AKPFAVRELLARIRSVLRRARMLPPGMQVTETAGMLAFGEWRLDTTGRHLLDAEGTLVA
FT                   LSGAEYRLLRVFLDHPQRVLTRDQLLNLTQGRQSDPFDRSIDLLVSRLRQRLRDGAREP
FT                   RYIKTLRNEGYVFSSAVTAIEGTS"
FT   gene            370348..371676
FT                   /locus_tag="Bmul_3460"
FT   CDS_pept        370348..371676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3460"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bur:Bcep18194_B0399
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17144"
FT                   /protein_id="ABX17144.1"
FT                   /translation="MNARIAWHWPRSLFARLALILCVGLALAQTLSFWLTVTERDQATT
FT                   NLMMGYIEREVASSVALLDHLPPDERAAWLPRLARRSYAFILGPGETGTPPEARLSARV
FT                   ERSISDGIGGRYPLTANAIPGDREHLQVHLRLTDGSPLTIDIHPMSTVPLSDWLPVVLA
FT                   LQLAVLAACCWLAVRLATRPLKQLALAADALGPDLKGERLSEDGPSEVARAARAFNAMQ
FT                   DRIAQYMTERMQILASISHDLQTPITRMRLRVDVMDDDAQGAKLRQDLLEMEHLVKEGV
FT                   AYARTLHGSDEAARRIDLDALLDSIVCDYVDAGQDVALHSRAPLALVTRPKALRRIVGN
FT                   LVDNALKFAGAAEIDVQPAPDGGAVIVVRDRGPGIPDDQLDAVFEPFRRVETSRNRETG
FT                   GTGLGLAIARQLALAMGGTLTLSNRQDGGGGLDARLTLVNAAA"
FT   sig_peptide     370348..370434
FT                   /locus_tag="Bmul_3460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            complement(371784..372518)
FT                   /locus_tag="Bmul_3461"
FT   CDS_pept        complement(371784..372518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3461"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bam:Bamb_4612
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17145"
FT                   /protein_id="ABX17145.1"
FT                   /translation="MKIAALSDIHGNLAALDAVLADIRRRGADVIVNLGDIVSGALHPA
FT                   ETADRLIALDLPTIKGNHERQLLSGDRESLRLSDRWARDTLRDAHLAWIAALPPRLMLD
FT                   DDVLMVHGTPASDLAYFLETVTPEGCRAATPDEIAQRAGDETASLILCGHTHVPRAATL
FT                   EDGRLIVNPGSVGLQAYADDHPHPHRIENGTPHARYAMVSRTAAGWHAEFHAVDYDWDT
FT                   AAATAAARGRDDWTVALRTGRC"
FT   gene            complement(372616..373158)
FT                   /locus_tag="Bmul_3462"
FT   CDS_pept        complement(372616..373158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3462"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_4611 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17146"
FT                   /protein_id="ABX17146.1"
FT                   /translation="MKIDTPPASGFPGLSVRQLDRADLDAWFAYLSMPDVVRHTSWNLR
FT                   SRNDLLPLFDGLESSDPDSIRRLAIVDDASGALVGTIGLHTVSTANRCAEIAYDLAPTH
FT                   WGRGIARAVCASVTAWAFAEGGFMRMQGVVLTDNIRSARVLEKCGYRYEGLLRAYRMVR
FT                   GVPGDFAMYARLATDTA"
FT   gene            373431..374768
FT                   /locus_tag="Bmul_3463"
FT   CDS_pept        373431..374768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3463"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_B0404 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17147"
FT                   /protein_id="ABX17147.1"
FT                   /translation="MRHRARLRASMRAARRRLAAPRDYSPAVRPRAAEHSYNNGPEPGD
FT                   ITIMNKQLIAAPLLLSLAGLASAQSSVTLYGIVDAGVTYRSNERVGTAGAYTGHSSVGL
FT                   TTGNLSGSRWGIKGSEDLGGGLRALFVLENGFDITNGTSGQGGRQFGRQAFVGVGSDRY
FT                   GSITLGRQYTSLDDFVSPVGPSSFIGGFGAHPGDIDDLDQTARVDSSIKYTSANYAGFT
FT                   FGALYGFGGQPGSMKQRNTWSVGAAYAAGPLRVGVGYERSDNSKTGATDTTLGKWQSTD
FT                   DGLFNSSINEGYASAQSQQIIATGATYDFGPAVVGVNYSNVQYRSGDRSLFSGHATFNV
FT                   AGVFARWNVRPQTQLFAGYSYTRGSDVDGIDDRAQYHNVTLGAVYDLSKRTSVYLLGAY
FT                   QHASGMTLDALGRPVAATASVSDKANGHSSDTQSQAIVSLGLRQRF"
FT   gene            375303..377225
FT                   /locus_tag="Bmul_3464"
FT   CDS_pept        375303..377225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17148"
FT                   /protein_id="ABX17148.1"
FT                   /translation="MSMKQIRAALLGMCMILLAPVAQAQAQYTTDWLANTFGTLAAHVG
FT                   NGARSMWVAPEGVIYTASRWDENAGGVAIYQNGQSLGTIGIHDEFQGGAITGNATSLFV
FT                   ALGYNRTFGSGSVGRYNRSTNARDLRIPVSTWTGIQYADVITGLATAGNLLYASDFYGN
FT                   RVRVYTTDGVWQRDISVQGPGALAIDSAGNLWVARMSAGVVVQFSPTGTQMNTIQMAAG
FT                   ARPSSLYFDASTGQLMVGDQGPDMNIKIYALIGVPLQIGTFGVQGGYLNTTTGIKGQVG
FT                   DKRFTRVVGIGKDAAGNLYVLNNAWGGGWDLGRNGSTDIHAYSPIGALQWKLQALNFEG
FT                   AAAPDPATDGAFFYSGNNIYTGTAGGTFVANTIDPFTYPKDPRLDMNDYQRGQHFGQLV
FT                   TVGGNRILVASGQNPGNFNFYHFNRASGYIAIPDGSIPGKPFNTSLQVTAGFAIDGNGD
FT                   VWAGLDRTNNISHYPMTGFDANGKPSWGAPEQIQIPRSVLPLTRIIYQSDSDTMILAQG
FT                   ISGSWDWTAMNGHIEIYRGWKAGNKTTPSLAIDLTSANPKSIAAAGHYLFVGYVHTVPN
FT                   IDVYDLNTGGLVTTLTNSNPSAMDVGNDVDSMYGIRAYLRSTGEYVITKDNYNGSSLVV
FT                   YRWRP"
FT   sig_peptide     375303..375377
FT                   /locus_tag="Bmul_3464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.702 at
FT                   residue 25"
FT   gene            complement(377270..378016)
FT                   /locus_tag="Bmul_3465"
FT   CDS_pept        complement(377270..378016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3465"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_B0422 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17149"
FT                   /protein_id="ABX17149.1"
FT                   /translation="MTAATARTMTATAKAERADAPRAPAGRKSQQRVQDILRAGRDVFA
FT                   EKGYEHATAAEIAQRVGVSEATVFSYFRGKRELCARVIADWYDEIIAAFEHGMPQEATV
FT                   QQQFAFIVRTHLRLMLVNGTGLCALVLSEGRAKQHALSDELTALQRRYTAPLMSVLARG
FT                   QAAGQVRRDMPLSLLRSIVFGPIEHVLWDAILGHRKLDTEATATQLIDMLWAAVQPPAP
FT                   EQAALVRFKNEVAEAMKRLEASPERE"
FT   gene            378186..379367
FT                   /locus_tag="Bmul_3466"
FT   CDS_pept        378186..379367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3466"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_4588
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17150"
FT                   /protein_id="ABX17150.1"
FT                   /translation="MSNLPGVQFMLGEDIEMLRDAVATFAAKEIAPRAAEVDRTDQFPM
FT                   DLWKKFGDLGVLGMTVAEEYGGANMGYTAHMVAMEEISRASASIGLSYGAHSNLCVNQI
FT                   HRNGTAAQKQKYLPKLVSGEHIGALAMSEPNAGSDVVSMKLRADKRGDRYVLNGTKMWI
FT                   TNGPDCDTLVVYAKTDVDAGPRGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQD
FT                   VEVPEENILGQLNGGVKVLMSGLDYERAVLSGGPTGIMAACLDAVVPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTTFQACRAYLYAVGRHLDSAGSDHIRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETM"
FT   gene            379398..381005
FT                   /locus_tag="Bmul_3467"
FT   CDS_pept        379398..381005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3467"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: bam:Bamb_4587
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17151"
FT                   /protein_id="ABX17151.1"
FT                   /translation="MPIIESKLNPRSEEFRANAAALEAVVADLRAKIEQLAQGGGQAAR
FT                   DKHLARGKLLPRDRIAQLLDPGSPFLELSQLAANGMYNDDAPGAGIITGIGRIAGRECV
FT                   IVCNDATVKGGTYYPITVKKHVRAQEIAAENRLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFFNQATMSAAGIAQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAQNDAHALSIARSIVGHLAPKMPSPVAVREPKP
FT                   PRYDAASLYGVIPVDTRKPFDVREVIARIVDDSEFDEFKARYGTTLVTGFAHIWGYPVG
FT                   IVANNGILFSESAVKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVSNAKVPKFTVIIGGSFGAGNYGMCGRAFGPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEAKGGTWSAQEEEAFKQPIRDQYERQGHPYYASARLWDDGVIDPAQTRDVLGLGL
FT                   AASMNAPIDETRFGVFRM"
FT   gene            381025..381810
FT                   /locus_tag="Bmul_3468"
FT   CDS_pept        381025..381810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3468"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B0425 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17152"
FT                   /protein_id="ABX17152.1"
FT                   /translation="MRYETIKVSEAGRVATVTLARPDVRNAFNETAIAELTTAFEWLDA
FT                   HEGVRAVVLAAEGPAFCAGADLNWMKKMAGYSDDENRADARKLARMLEAIHRCGKPVIA
FT                   RVHGDAYAGGVGLVAAADIAIAADTAKFCLSEARLGLIPATIAPYVVRAMGERAARRYF
FT                   TTAEVFDSARAASLGFIHDAVPAAALDETVAKLAATLVANGPDAVRACKRLVADVAGRP
FT                   LDAALIEQTADWIARTRAGAEAREGIASFLEKRTPSWRD"
FT   gene            381870..383882
FT                   /locus_tag="Bmul_3469"
FT   CDS_pept        381870..383882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3469"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bch:Bcen2424_5237
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17153"
FT                   /protein_id="ABX17153.1"
FT                   /translation="MFDKILIANRGEIACRVAATCKRLGIASVAVYSDADANAKHVAAC
FT                   DEAVHIGGSAAADSYLRIERIIEAARATGAQAIHPGYGFLSENEDFAQACAAAGIVFIG
FT                   PPVDAIAAMGSKAAAKALMHAAAVPLVPGYHGDDQNPATLHREADAIGYPVLLKASAGG
FT                   GGKGMRVVERSDDFPAALASCQREAASSFGNDRVLIEKYLTRPRHVEVQVFGDTHGNTV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLSDDVRRAMGEAAVAAARAVGYVGAGTVEFIMTGD
FT                   AFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLKQDELRVQGHAIEARLYA
FT                   ENPSRGFLPSTGTLKHLRLPDGVEFDIGAPVRVDSGVREGDAITPFYDPMIAKLIVHGA
FT                   DRDEALGRMLRALRACEVVGLHTNAGFLQRIVACEPFATADLDTGLIERNHDVLFAPQQ
FT                   PPRASLALACAALLARERDAAGDGSSPWSALSDWRLNAGYRRTFEWHAVEREADVTVAY
FT                   DHDGAAARIAVGDGAAQSFAWSRGATPLDFDVLLDGVRSSGRVIVDGDSFHVFTQGTAE
FT                   TFEWRNLLAHAGDAEHGGGRLTAPMPGKVIAVLVEPGQRVEPGTPLIVMEAMKMEHTIG
FT                   APSAGVVAEVLYAVGDQVADGAQLLVMAEAEAARA"
FT   gene            384148..385290
FT                   /locus_tag="Bmul_3470"
FT   CDS_pept        384148..385290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17154"
FT                   /protein_id="ABX17154.1"
FT                   /translation="MTSPVLNGLRIGITIGLRTPDESLWINGIKQNALFLAKLLMASPH
FT                   GYRVTLVNTTAVPLTDALPWDRRVFDTRAFADMKDALDVLIELGGQIDAEQTAYLKARG
FT                   AKIVSYCCGVEYINAMESILFGRRLWDTLFINRGYDEVWAIPQIAPSSLPFLQSLRRCP
FT                   GRVVPFVWDPMFLTERAQSLPEHGEYRPRGERGKRLTVMEPNHDVVKFCVYPMLIIDEA
FT                   YRRDPDAIAFTHVTNAERLARESPEFVMLMNYLDIVRAGKASFVGRFDTPVFLAELTDV
FT                   VVSHQWSNPLNYFYFDVCWQGYPLVHNASLAPDLGYYYPDNDVQQGADALLRALHAHDD
FT                   DWEAYTRRQRQILRRYTSASPALVAEYDALLANLIGAKAA"
FT   gene            386000..386815
FT                   /locus_tag="Bmul_3471"
FT   CDS_pept        386000..386815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3471"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bur:Bcep18194_B0433
FT                   diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17155"
FT                   /protein_id="ABX17155.1"
FT                   /translation="MNAVEPRLMADREQNREASRDEIGKVFGVPDGPVDLASVRSFVES
FT                   RLEFVYEPVCRADLSGGVLYDECLARLRRDARGAWPPIAFLPRLESLGLMRWFDRLVVN
FT                   RTIDQLRADPTAVYGCNMSAASAVMDDAWRPIFARLEREPSVAARLVVEITETGPLNPV
FT                   AGRTFVARFRQAGCRIAIDDFGIGFSALNNLAVGNPDIVKLDRSILPMIKRNAIGRYQL
FT                   RRLIAFAHEGARHVVVEGVETEMDRQMIVEAGVAWAQGIRFSWRSPAAA"
FT   gene            386767..387309
FT                   /locus_tag="Bmul_3472"
FT   CDS_pept        386767..387309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17156"
FT                   /protein_id="ABX17156.1"
FT                   /translation="MGAGHSFLMAFARCRMTAHARSHGVACACALPRDRNRGISMAGTT
FT                   QAATEEAALPVVDARALAAIVELADMLRQLGAASSGRPIDVAPFLDGLTAVSARIHRIK
FT                   PLDAADRQLAARHYYAGVLAGACGDESAVALGVAERLARLAAGASRASMRRFAVLVRIG
FT                   RLHGRAFAAHCERRARL"
FT   gene            complement(387636..388772)
FT                   /locus_tag="Bmul_3473"
FT   CDS_pept        complement(387636..388772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17157"
FT                   /protein_id="ABX17157.1"
FT                   /translation="MKINVAITMNVQRDATQSIWYNGANQHCVYLYMLLKRSPLIGEVW
FT                   LAHDDGIAEYPQALMMDAFRDALRPLSSVIHQTDLLIEMNAFIDSTHAQAVRQRGGKCV
FT                   SYRFGNDYVIAVETINFEKNNWRPNPHRVQFDEIWTNPQHMHTCAAYFQAVYRAPVVEL
FT                   PHIWSPYFIERSLDADPELKARFGYRNHGRAKRIAFFEPNLNVVKSALVPMLAANACYV
FT                   EHPELVEHVYMTNTFDKKENVAFKHLALGLEMVRDGKATADVRAPFVAWAAHHTDIVVS
FT                   HHWENGLNYLLYDALYGNYPLVHNSAFLRDVGYYYPDFEIFDAARAIATAAQTHDERLD
FT                   DYAAAARRCLQQVDALAEHNVRIHTEHVQRLFAGRALG"
FT   gene            complement(388922..390076)
FT                   /locus_tag="Bmul_3474"
FT   CDS_pept        complement(388922..390076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17158"
FT                   /protein_id="ABX17158.1"
FT                   /translation="MSDSTARHASGDGKRLVVGVSLYVRGAGQSLWENGIFQNCLLLIL
FT                   LLRQSPLVAEAVMVNGGAQLADPQMMLGEWDVPLLSMDEALQRCDVLIEMSAQFGADYL
FT                   RAFRERGGKVVTMRVGNDYVIDIERAMFNKPSGFLFSGAPYDAVWTIPEFERSCLHYYQ
FT                   TGLRAPVTIVPHIWHPMLFDKARATLGPGLSYGYRPGRSRWRVTMFEPNICMVKTSIIP
FT                   MLVTEEAYRAQPAFLDIVRVCNTLHMKEHATFVHFAKSLDIVNHGITTFESRYAVYEFM
FT                   AAYGDAVVSHTWENAQNYLYYELLYGDYPLIHNSPFLGKAGYYYPDFDCQAGGRALLQA
FT                   FAEHDANLDAYREQSKHVLDSVSIYNPENVAAYTDAIAALYRDA"
FT   gene            complement(390091..391236)
FT                   /locus_tag="Bmul_3475"
FT   CDS_pept        complement(390091..391236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17159"
FT                   /protein_id="ABX17159.1"
FT                   /translation="MTDINETASGRARKQRPAVGISLFARDGQAIWENGIHQNIAFLAM
FT                   MLKRSDRVGPVYFLNGGDAKALPAGLDLDGLDVPLVNPADVTHDIDVVIEMGAQLPVEW
FT                   LRHVKALGAKLVACYVGHTYSGLAETPIFDKPSGHIFNGTQFDEVWVLEKSQKIDVPLL
FT                   RTLTRAPVHTIPHLWSPYFLDRRIAALAAEGVTFGYRPGRRPWRLATLEPNISVVKTCH
FT                   YPMLVCDELYRARPDAVQHLFVVNSMHMKEHPTFVHFANSLDLVRQHKATFEPRLDLPG
FT                   FMARHADAVVSHHWENAQNYLYYDVLYGGYPLLHNSPLLGDAGYYYPDFDSATGGRVLL
FT                   DAWLHHDERLDDYRAKADRLLRAVSIDNPANLDAFVTRLVA"
FT   gene            complement(391520..392182)
FT                   /locus_tag="Bmul_3476"
FT   CDS_pept        complement(391520..392182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3476"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bam:Bamb_4576
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17160"
FT                   /protein_id="ABX17160.1"
FT                   /translation="MNKLALALALSSAALAACSTASGPTFSASELQPRDGVRTFQVDCH
FT                   GLLSGPQTCMKAARKICGEQPVRAVDTMRALRDGSDPATLVFQCGAPPADAAPAAEPAP
FT                   AAVEHVSLAGDALFASGLATLTPAARASLDKLLNAHADRSYTQVSVTGYTDSVGSDASN
FT                   LALSKRRAEAVAAYLQQRGLNARTLTVTGRGSADPIASNATAEGRATNRRVEISLQR"
FT   sig_peptide     complement(392099..392182)
FT                   /locus_tag="Bmul_3476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.768 at
FT                   residue 28"
FT   gene            complement(392304..399821)
FT                   /locus_tag="Bmul_3477"
FT   CDS_pept        complement(392304..399821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3477"
FT                   /product="Haemagluttinin domain protein"
FT                   /note="PFAM: Haemagluttinin domain protein; Hep_Hag
FT                   repeat-containing protein; KEGG: bch:Bcen2424_5223
FT                   haemagluttinin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17161"
FT                   /protein_id="ABX17161.1"
FT                   /translation="MNRTYRSIWNEALGAWVAASELDAARGKPNKSAVAIAAAVVLTAL
FT                   PALASANTFVPGTTNGSQFTVSSCTSSGGNGTVGRTTTGNTNAYASDGSGTYSTVAGCN
FT                   ASGNNNLAATAYGAFAQITGTGGTATGFLSSAALWGTAAGLESTASGAGSTALGFGATA
FT                   NALNSVAIGGAAGNGTTPLSYANSTIASGAGAVAIGSNATKGAQAAASDGIAIGGQSSV
FT                   ASAATSGIAVGRGATVNGAYGIAQGDGVVSGATGRNVAIGSTGTTANGSTAGGGAVAIG
FT                   RGQTATGDGAVAIGDPNSATGTGALAVGANNTSNGQGAVALGNANSASGTGSVAMGNSN
FT                   TASNSSVAIGSSANATGTNGSVAIGNSATANGTGAIALGNVGSFAANTQATGADALALG
FT                   NGATASGNAGAVAVGAAAVASNSYATAFGSNSTASGAGSVAFAQNATASVTNAIALGVG
FT                   STANVANSVALGSSSVTSSALTSTSGGTTSVSNTTIGGQTFGNYAGAAAAGGVVSVGQP
FT                   NAERRVQNVAAGLVSATSTDAINGSQLYAVASTTTSSIASLSTSASTGISSANSSIGSL
FT                   STATSSSIASLSTSTSTGISSANSSIGSLSTGLSSTNSSVTSLSTSASTGISSANSSIG
FT                   SLSTGLSSTNSSVTSLSTSASTGISSANSSIGSLSTATSSSISSLSTSASTGISSANSS
FT                   IKSLSTGLSSTNSSVTSLSSSASTGISSANSSIGSLSTGLSSTNSSVTSLSTSASTGIS
FT                   SANSSIGSLSTGLSSTNSSVTSLSSSASTGISSANSSIGSLSTGLSSTNSSVTSLSTSA
FT                   STGISSANSSIGSLSTGLSSTNSSVTSLSTSASTGISSANSSIGSLSTATSSSISSLST
FT                   SASTGISSANSSIGSLSTGLSSTNSSVTSLSTSASTGISSANSSIGSLSTGLSSTNSSV
FT                   TSLSTSASTGISSANSSIGSLSTATSSSISSLSTSASTGLSSANSSIGSLSTGLSSTNS
FT                   SVTSLSTSTSTGIASLSTSTSTAIEAAKTHYYSVNDGGTQKANYANDGATGVNALAAGV
FT                   AASATGASSVAVGDSANAKANGTVAIGQNAVANNVGDVALGSGSVTAAPNPTPTGSVGG
FT                   VTHTFAGGNPTSVVSVGDKGAERQVTNVAAGRITADSTDAINGSQLFATNSAVDSLSTT
FT                   VSSSSSAISSLSTGLSSTNSSVASLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSIA
FT                   SLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSIASLSTSTSTGLSSANSSIGSLSTG
FT                   LSSTDSSVASLSTSTSTGISSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSAT
FT                   SSITSLSTSTSTGLSSANSSIASLSTSTSTGLSSANSSIGSLSTGLSSTDSSVASLSTS
FT                   TSTGLSSANSSIGSLSTGLSSTDSSVASLSTSTSTGLSSANSSITSLSTSTSTGLSSAN
FT                   SSIGSLSTGLSSTDSSVASLSTSTSTGLSSANSSITSLSTSTSTGLSSANSAIGSLSTG
FT                   LSSANSSITSLSTSTSTGLSSANSSIGSLSTGLSSTDSSVASLSSSTSTGLSSANSSIG
FT                   SLSTGLSSTDSSVASLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTG
FT                   LSSANSSIGSLSTGLSSTDSTVASLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSIG
FT                   SLSTGLSSADSSITSLSTSTSTGLSSANSSIASLSTGLSSADSSITSLSTSTSTGLSSA
FT                   NSSITSLSTSTSTGLSSATSSIGSLSTGLSSTDSSVASLSTSTSTGLSSATSSIGSLST
FT                   GLSSTDSSVASLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSIGSLSTGLSSADSSI
FT                   TSLSTSTSTGLSSATSSIGSLSTGLSSANSSIGSLSTGLSSTNSSVASLSTGLSSTDSS
FT                   LASLSTSTSSGLSSATSSIGSLSTALSSTDSTLTSLSTSTSSGIGSLSTGLSTANDSIT
FT                   SLSTSTSTAIQAAKTHYYSVNDNGTQQGNYNNDGATGINALAAGTNAGATGASSVAVGD
FT                   GATASSDDAVAIGHDATATGGKAVSIGSANAASGDGAVALGANNAATGTGAVALGNANT
FT                   ATGDGSLAIGNTSTAAGAGSLAFGTNAVAKNVNDVALGTNSVTANANPTSSATIGGVTY
FT                   LFAGSAPTSVVSVGAPGAERQITNVAAGRISADSTDAINGSQLNATNQAVNSLSTSTAS
FT                   NISSLSTGIGSLSTGLSSTNSTVASLSTSTSTAIGSLSTGLSATNSNLTSLSTSTSTGI
FT                   GSLSTGLSSTNSTVASLSTGVTNINNQLTQLSTTLNNNTTRSLTTNGVTADMNGTGNDR
FT                   PVVAAGSNSVAIGANSTDGGRSNVVSVGNDTQQRQITNVAPGTQGTDAVNVNQLTAVQS
FT                   TLSTALSGQQAQINSLGSQLQQTDQMAKQGIAAVGAMASIPQLDRDANFGMGIGASTFL
FT                   GQKAMAVNMQARISENLKASINGGFSGNQKVIGAGMLYQWK"
FT   sig_peptide     complement(399672..399821)
FT                   /locus_tag="Bmul_3477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.694) with cleavage site probability 0.612 at
FT                   residue 50"
FT   gene            complement(400150..401142)
FT                   /locus_tag="Bmul_3478"
FT   CDS_pept        complement(400150..401142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3478"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17162"
FT                   /protein_id="ABX17162.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   gene            complement(401983..402885)
FT                   /locus_tag="Bmul_3479"
FT   CDS_pept        complement(401983..402885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17163"
FT                   /protein_id="ABX17163.1"
FT                   /translation="MTDTLQEEHAAADHAMRNWTFERQGPVKIGSDAHKQMFCRMLLDT
FT                   HNPYKPAVIDWPPLKPDELERLTSLPIWDIAVQTEGRASIRVATFAATVDDPLLRQALE
FT                   MDGGEEARHKVVLSKLVEAYGIKLAPEPPYPAPKDPEWSWMVTGFSECIDSFFAFGLFR
FT                   SAQRSGYFPPELVETFEPVIQEEGRHILFFVNWFAWYWRNMPWWRRPWFFARVAAVWAF
FT                   LIWERIGIARGIDADGVAHDANFPATGTAAVGDALNPRELLELCLTENDRRMAGYDTRL
FT                   LRPMFVPRLARFALRFLRK"
FT   gene            complement(402982..403200)
FT                   /locus_tag="Bmul_3480"
FT   CDS_pept        complement(402982..403200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17164"
FT                   /protein_id="ABX17164.1"
FT                   /translation="MNRTIRYKGYEVAPAAARLPNGLFAANLTIEKASGGPSSHAVSFD
FT                   AIDFFFEEEHALAYASRWGRLWVDTHA"
FT   gene            complement(403424..404275)
FT                   /locus_tag="Bmul_3481"
FT   CDS_pept        complement(403424..404275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3481"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bch:Bcen2424_5177 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17165"
FT                   /protein_id="ABX17165.1"
FT                   /translation="MEETVSSYRWHRAGPTKHFCYRSAPHCTRRVGISIERKVVFTAAT
FT                   RSLPCSFKPVLSRASHSREERPLTAFDQHRRPFVVGIGGTTRAASSTERALSFALRGAQ
FT                   AAGARTRLFDGPFLHTLPHYAPEQNTLTDAQRELIDAVREADAIIIATPGYHGGVSGLV
FT                   KNALDTLEELRGDTRPYLDGRAVGLIVTAYGWQAAGTVLTSLRSIVHALRGWPTPFGAT
FT                   VNTLETRFDSADSCSDPKVVAQLETVGAQAAEFALAFASHRAATHAASVDALAPVLKIA
FT                   NQ"
FT   gene            complement(404345..405745)
FT                   /locus_tag="Bmul_3482"
FT   CDS_pept        complement(404345..405745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17166"
FT                   /protein_id="ABX17166.1"
FT                   /translation="MKPFAALLALSLSTSFATADAATPAERVAQRFALDLDGSAAYYQL
FT                   TVPQAVYAASRRDDLGDVRVFNGADEPVPYALDARAAAAPAAPPSRAPVHWFALPPSRT
FT                   ARDSAPLGVSVGPDGALRATVAAPAPAKRGGDLVDLSHADGEPDALLVHLRDDSYQGRV
FT                   AVDASDDLRTWRPLGETQLLKVGTGADLLVQERIALDGARPRYLRLNWLDGAPEIASID
FT                   VETRPSDPSAADAAAVPRQWRNAVHVQADDVRGAYRFDTDGAYPVDRVRIDLPQPNTVA
FT                   RATLQSRATPQAPWRDVATAVLFRLQRNGGEQRNPPLTFAANTDRAWRLVVDMRNGGLG
FT                   GGQPTIAVGWHPAVLTFVARGAPPFTLGVGNASLASTAATRDALLVGLAPEVRPARVGA
FT                   ALPVAEPPPAPVDIDTDATRRYVLWGALIVAVAMLGAIAWRLARGTGTGTGTGDDSRDS
FT                   GDMRNGGN"
FT   sig_peptide     complement(405686..405745)
FT                   /locus_tag="Bmul_3482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.581 at
FT                   residue 20"
FT   gene            complement(405742..408711)
FT                   /locus_tag="Bmul_3483"
FT   CDS_pept        complement(405742..408711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3483"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bch:Bcen2424_5173 membrane protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17167"
FT                   /protein_id="ABX17167.1"
FT                   /translation="MNWAFAAIGFIVGGIVALIENVSLETGALLGAAAGFYLGHLLKRR
FT                   GRDDRAAAAPEYFGAHHAQPPAATLAERVARLEATVDTLTRELTSLRAQLAGAKAGATS
FT                   AAFEDAAPAGSSAASPSEADDTTPVSPTPTISATPVTAAVQSTRAQTVAHAPASASAPT
FT                   TESSESAATPPARTAATPTPREPGLAARALQAARDWLFGGNTVVRVGIVVLFFGVAFLL
FT                   KYAADNDLLPIEFRLAGTALAATVLLALGWRLRARRAAYGLVLQGGGVGLLYLTVFAAT
FT                   KRYELLPVGAAFALMVAICALSAFLAIRQNAMSLATMGSAGGFLAPVLLSTGHGSHVAL
FT                   FGYYALLNAGIFAIAWFKAWRPLNLLGFVFTFTIGSLWGAMSYRPALFGSTEPFLVLFF
FT                   LMYVGIALLYAVRRELALRHYVDGTLVFGTPLVTTALQAALVADVPFALAWSAVALSAF
FT                   YVAVAAWLAPRRARLGLLFESMLALAVIFATLAAPLAFSGPTTSSAWALEGAALVWLAV
FT                   REKRIVRFAFGLLMQLAAAGALCVGLLVRDDAAALPVLNSVYVAMLLIALAGVFTGWWL
FT                   HGRDDARAWHAWMPAIGIAAAAWGLLWWIGGGVHEILAYAARRVDPHRDRFVVDAIVLF
FT                   AAGTASLAHIVRRRLAWPIAEWPALALAPALALLAVYAYALYEAPLSGIGALAWPIAVI
FT                   ACYVLLWRESRGTVNGDPATASAPDRIVRAQTFAIAPLHTLMFWTLCGLCTLEGFWRLR
FT                   AFVPEGAWSWSAWAYDFGALLLLVAGPGARLRWPVAAFARAYQIGGATPLAALLWLWSI
FT                   ASVTSDGDAAPLFWLPLLNPLDVAQGVAFAAVAVWLRRLTALGIAWRSRAVDYAIGATV
FT                   FLWFNALLLRTLHHWTGVRYALGPMVESMRVQASVSVYWTLCALATMIWATRRGRRPLW
FT                   FVGAALLALTVVKLFVFDLSHVTGIERIVSFIGIGVLLLLIGYFSPLPPKAAAHREDTR
FT                   "
FT   gene            408956..409306
FT                   /locus_tag="Bmul_3484"
FT   CDS_pept        408956..409306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17168"
FT                   /protein_id="ABX17168.1"
FT                   /translation="MYHSGHPRLPRRPRRARGLFARSCFYPRIRPIGREIVVKRRAGER
FT                   ASRKTSSDESCAAAHKRVRDRPSLLAQRVLHRRIRTPRRLARGPARPRAVSYLRKRLSQ
FT                   FVGRPGFFLATM"
FT   gene            409355..410524
FT                   /locus_tag="Bmul_3485"
FT   CDS_pept        409355..410524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3485"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bch:Bcen2424_5172 glycine betaine/L-proline
FT                   ABC transporter, ATPase subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   CBS domain containing protein; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17169"
FT                   /protein_id="ABX17169.1"
FT                   /translation="MDAPKVVVEGLCKVFGSNPQQALDMLAAGATKDEVLKRTGQVVGV
FT                   HNVSFDVQEGEIFVLMGLSGSGKSTLIRLVNRLVDPSAGKVLIDGLDVASARRSALTAL
FT                   RRKDMSMVFQSFALMPHRTVLSNAAFGLEVAGMARKERERRAMEVLEQVGLAPFSHKLP
FT                   SELSGGMQQRVGLARALAVNPSLMIMDEAFSALDPLKRREMQDVLLQLQKEQRRTIMFV
FT                   SHDLEEALRIGNRIAIMEGGRLVQVGTPQDIIANPADDYVRAFFDGIDTSRYLTAGDLM
FT                   QTGAVPLVSKFDAANVAASLNGSAEYAFVLDAERKIRGFVTRDAIGSTTPALRPIESIR
FT                   RDASLEHVVARVVASPNALPVVDDDGCYCGSVDRALILKAITRSRGSHV"
FT   gene            410517..411413
FT                   /locus_tag="Bmul_3486"
FT   CDS_pept        410517..411413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3486"
FT                   /product="choline ABC transporter, permease protein"
FT                   /note="TIGRFAM: choline ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; KEGG: bch:Bcen2424_5171
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17170"
FT                   /protein_id="ABX17170.1"
FT                   /translation="MSEMIPLGSWVDQSVHYLLDHDAATFDAVGRAIEGLAALIEHGLQ
FT                   AVPMWLMMAFFIGIGLWRVGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLA
FT                   LGIPLGIWAAKSKWVAAIVRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMP
FT                   PAVRLTSLGIRHVNREIVEAGQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMV
FT                   IIASMVGAGGLGNDVLASIQRLDIGLGFESGLSVVLLAIILDRITESFGRAPGAARAPL
FT                   FAGLKQLFRVKAAPAQA"
FT   gene            411523..412521
FT                   /locus_tag="Bmul_3487"
FT   CDS_pept        411523..412521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3487"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B0457 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17171"
FT                   /protein_id="ABX17171.1"
FT                   /translation="MTSAAAVAPAACVSPVSSLAHFGFLTLPNFSMIAFSSAVEVLRMA
FT                   NYVAREDHYRWSIYSLDGAPVHASNGIAVRPTQALDYTRLPDVMIVCGGIRIRDVVDDV
FT                   ARDTLAALAERGLPLGGICTGAYALMSSGLLDGYRCTVHWENLSALHTEFPQVGFADEL
FT                   FVVDRDRLTCTGGTAPLDLMLNLVGMRFGQQLAAQVSEQFILERIRSSTDTQPIPVDAR
FT                   VGFSRAELIEVVRLMEANIEEPLSLEELARLVRLSQRHLQRMFKVYLNVSPTHYYLTLR
FT                   LKRARDLLRTTDASIARVTTVCGFHSPCHFSKAYRAQFGHAPSYERRLPGR"
FT   sig_peptide     411523..411585
FT                   /locus_tag="Bmul_3487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.926 at
FT                   residue 21"
FT   gene            412622..413572
FT                   /locus_tag="Bmul_3488"
FT   CDS_pept        412622..413572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3488"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bam:Bamb_4564
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17172"
FT                   /protein_id="ABX17172.1"
FT                   /translation="MKRLLIAAACGVGIAAAPVSAVYAADPPVCKNVRFADVGWSDIAA
FT                   TTGLASTMLQGLGYNPTKTIASVPITFAGIKSKQIDVFLGYWSPTMDPIIQPFTKAGTI
FT                   KVLATPNLTGAKYTLAVPDYVYQGGLKSFQDIQKYADKLNGKIYGIEPGNDGNALIKKM
FT                   IDTNQFGLGKFKLVESSEAGMLVEVNRAIRDKQWIVFLGWEPHPMNVQMKIDYLTGGDD
FT                   VFGPNYGEAKVLTATPPDYAQRCPNVAKFVSNLQFTTSIENHVMVPIMNKEDPNKAAKE
FT                   WLKANPQSLDKWLAGVTTIDGKPGLPAVKAYLGVQ"
FT   sig_peptide     412622..412696
FT                   /locus_tag="Bmul_3488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(413706..414863)
FT                   /locus_tag="Bmul_3489"
FT   CDS_pept        complement(413706..414863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3489"
FT                   /product="glycosyl hydrolase"
FT                   /note="KEGG: bam:Bamb_4563 glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17173"
FT                   /protein_id="ABX17173.1"
FT                   /translation="MNDRLLVATRKGLFVLHADGNGRWTLGDPHFAGEPVGMTLADPRD
FT                   GTLYAALNLGHFGVKLHRRRAGAAEWEECAVPVYPPQPADAPRPNGDAHASAPTDPDGD
FT                   AASPAPPQPPWTLQQIWSLEAGGADEPGVLWAGTIPGGLFRSDDGGDSWVLNRALWDRP
FT                   ERPEWFGGGYDAPGIHSVMVDPRDSRHVTVGISCGGVWQTDDGGASWRVTADGMEADYM
FT                   PPERRGEANVQDPHRVVQCAAAPDVLWAQHHCAIFRSTDGGARWQRIEAQPSSFGFAVA
FT                   VHPHDPDTAWFVPAVKDACRIPVNGEFVVTRTRDGGRSFERLSNGLPPAPAYDLVYRHG
FT                   LAVDDSGTRLAMASTTGALWTSDDGGDRWQLVSAHLPPVYCVRFA"
FT   gene            complement(414943..415212)
FT                   /locus_tag="Bmul_3490"
FT   CDS_pept        complement(414943..415212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3490"
FT                   /product="thiamineS protein"
FT                   /note="KEGG: bam:Bamb_4562 thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17174"
FT                   /protein_id="ABX17174.1"
FT                   /translation="MAHLFFAASIQRHIETPERDVDARSLGEALDAVFREQPRLRGYIV
FT                   DDQGALRKHLAVFIDGRPIRDRQRLSDALAADSRVYVVQALSGG"
FT   gene            complement(415333..415731)
FT                   /locus_tag="Bmul_3491"
FT   CDS_pept        complement(415333..415731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17175"
FT                   /protein_id="ABX17175.1"
FT                   /translation="MASSPDSTYARQIGTYLQALERGDVAAICALFAPDAQIHSPFLGW
FT                   MAPAPFFEKVAAASGQSRITPIDICVSITGARRATGYFVYDWGLKDGSVVTFECVDVFE
FT                   FDEAGLIERMKIVYDTHPVRDAVGDKYA"
FT   gene            complement(415908..416597)
FT                   /locus_tag="Bmul_3492"
FT   CDS_pept        complement(415908..416597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3492"
FT                   /product="Aspartyl/Asparaginyl beta-hydroxylase"
FT                   /note="PFAM: Aspartyl/Asparaginyl beta-hydroxylase; KEGG:
FT                   bam:Bamb_4559 aspartyl/asparaginyl beta-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17176"
FT                   /protein_id="ABX17176.1"
FT                   /translation="MSVAYDYAAGLLRRLYDRHIDGGAVLDASAFPDADRFVRAWRAIR
FT                   AEALAVARDLPRIPRFHEIMREQHDISANDARDWRMFIMQAYGQPFPRNLSRCPTVASI
FT                   VATSPDVLSASLSFLAPGKHIPPHRGPFRGILRGYLVLSMPRRADGTPAAVLKVDGREY
FT                   RLDEGRFLLWDDTFEHEVWNDSDEVRIVLLLDIRRRDMPRMLRWLSNAVIGIVRLGIRL
FT                   RGGSIPV"
FT   gene            416828..417127
FT                   /locus_tag="Bmul_3493"
FT   CDS_pept        416828..417127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17177"
FT                   /protein_id="ABX17177.1"
FT                   /translation="MNTDGWIVALVAAGAIASGVTPARAQSPMRMQVAQLARGAGGVQS
FT                   MAPIAPMPEANGDTAIGGDAAAASEAGGPSALPSGKRPAACVGPESFCTLYFGS"
FT   sig_peptide     416828..416905
FT                   /locus_tag="Bmul_3493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            417199..417486
FT                   /locus_tag="Bmul_3494"
FT   CDS_pept        417199..417486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17178"
FT                   /protein_id="ABX17178.1"
FT                   /translation="MKTLIALLMTTAAVVVQSAFAQPTAPLTRAQVRDELMRLEAAGYD
FT                   PSRGDDGTYPADIQAAEAKLAVQAQAQAETQRRIAASADDGVGAPARMTN"
FT   sig_peptide     417199..417264
FT                   /locus_tag="Bmul_3494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(417618..418589)
FT                   /locus_tag="Bmul_3495"
FT   CDS_pept        complement(417618..418589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3495"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   bur:Bcep18194_B0473 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17179"
FT                   /protein_id="ABX17179.1"
FT                   /translation="MKVLITGGAGFLGQRLARKLLERGELTGPDGRPEKLDELVLLDVV
FT                   AGSDFGDARVSSIVGDIADRAVLERAIDAQTGAIFHLAAIVSGQAEADFDLGMRINLDA
FT                   SRTLLEVCRARGHRPRVVFTSSVAVYGGTLPDVVQDDTALNPQSSYGAQKAIAELLLCD
FT                   YARRGFVDGRVLRLPTISVRPGRPNAAASSFASGIIREPLNGEESVCPVPGSTRLWLLS
FT                   PRAAIDALVAGCELDAAQLGNKRVINLPGISVSVDEMIAALREVAGDEVVKRIRHVPDE
FT                   RVEKIVGSWPGRWDTTRAHALGLKGDASFADVIRSYIDDERR"
FT   gene            complement(418627..419403)
FT                   /locus_tag="Bmul_3496"
FT   CDS_pept        complement(418627..419403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3496"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bur:Bcep18194_B0474 hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17180"
FT                   /protein_id="ABX17180.1"
FT                   /translation="MPRFAANLSMMYNEHAFLERFAAAAYDGFKAVEYLFPYDFAAEDI
FT                   RARLDAHGLEQALFNAPPGDWAAGERGIASLPGREDEFRRSIDRALDYARVLGNKKLHV
FT                   MAGLVAPGADRARHRDTYVANLRHAAQAAAAHGITVLIEPINQRDMPGYFLSRQDDAHA
FT                   ICAEVGAPNLKVQFDCYHCQIVEGDLAMKLKRDFAGIGHIQIAGVPERHEPDLGELNYP
FT                   YLFELIDALGYDGWIGCEYRPKAGTSAGLGWLKPYL"
FT   gene            complement(419465..420790)
FT                   /locus_tag="Bmul_3497"
FT   CDS_pept        complement(419465..420790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3497"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0475 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17181"
FT                   /protein_id="ABX17181.1"
FT                   /translation="MTALDAAARRSPAAAASPAELDLTYKKVFWRIVPFLMLCYVVAYL
FT                   DRVNVGFAKLQMSQDLAFSETVFGLGAGIFFLGYFLFELPSNMLMHRIGARIWIARIMI
FT                   TWGLLSAMFAFVKTPTQFYVLRFLLGLAEAGFYPGVILYLTYWFPSHRRAKIIAVFMSA
FT                   IPVSGIFGNPLSGWIMEAFHGGSGFHGWQWMFMIEAVPAVLVGIATILYLDNNIRSAKW
FT                   LNEREKQLLEDEIAAQPQEQQKHGHSLKAVFADPRMWWMSLIYFAFVTGQYGLTFWMPT
FT                   LVKSTGITDTLQVGLLSAIPFVVAIVVMNLFGHSADKRRERRWHLIVPALMGAVGFAVA
FT                   ASYSHNTAVSIVFLSIAAGGVLTCAPLFWSLPTAFLAGSAAAAGIAIINSVGNLAGFAS
FT                   PYVIGYLKDLTHSTSSGMYVLAAMLVIGAFAVWLTPAKLVNR"
FT   gene            complement(420894..421535)
FT                   /locus_tag="Bmul_3498"
FT   CDS_pept        complement(420894..421535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3498"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bch:Bcen2424_5157 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17182"
FT                   /protein_id="ABX17182.1"
FT                   /translation="MMSIEAKLREEICVVGASLYARGHAVGSAGNISARLPDGWLITPT
FT                   DACLGRLDPNDIAKVDANGQAVSGGKPSKTLTLHRGIYARNAEANGIVHTHSTHLVALT
FT                   LAGVWRDTDVLPPITPYYVMKVGHIPLIRYRCPGDPDVAAEVAALADRVRGVLLDRLGP
FT                   VMWGPSVSHASYALEELEETARLWLMTNPKPEPLPDAALDELRAAFGARW"
FT   gene            complement(421532..422818)
FT                   /locus_tag="Bmul_3499"
FT   CDS_pept        complement(421532..422818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3499"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   bur:Bcep18194_B0477 type III effector Hrp-dependent outer
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17183"
FT                   /protein_id="ABX17183.1"
FT                   /translation="MTASASRPLLGCIADDFTGATDLANMLVKSGMRTVQTIGVPAESA
FT                   SIDADAIVVALKSRTIPAADAVAQSLAAYEWLRAQGCRQFFFKYCSTFDSTDAGNIGPV
FT                   ADALLDAAGGGFTIACPAFPENGRTIYRGHLFVGDVLLNESGMENHPLTPMKDANLVRV
FT                   LQRQTSSKVGLIRYDTIARGAADVRACIAQLRADGVRIAIADALSDRDLYVLGEACAAL
FT                   PLVTGGSGIALGLPENFRRAAELAARDNAASLPRIDGTATVLAGSASKATNAQVAAWRA
FT                   TRPSFRIDPLAAARGEPVVDQALAFARSHLPEPVLIYATATPDEVKAVQQALGVEAAGE
FT                   LVERTLAAIAHGLRALGVRKFVVAGGETSGAVVQALGVKSLQIGAQIDPGVPATATIDT
FT                   EPLGLALKSGNFGAVDFFDKALRALDGAA"
FT   gene            complement(422837..423727)
FT                   /locus_tag="Bmul_3500"
FT   CDS_pept        complement(422837..423727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3500"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: bam:Bamb_4550 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17184"
FT                   /protein_id="ABX17184.1"
FT                   /translation="MSRNVGVIGLGAMGLGVARSLLRAGFRVHACDVREAVLHAFAAEG
FT                   GIACATPAELGAQCDVVVTLVVNAAQTETVLFGEHGAVASMKPGGVVIASATVAPDFAV
FT                   SLGARIEAAGLQMLDAPVSGGAARAASGEMTMMTSGPAAAYAACEDVLAAMAGKVYRLG
FT                   DTHGVGSKVKIINQLLAGVHIAAAAEAMALGLREGVDPDALYDVITHSAGNSWMFENRV
FT                   PHILNGDYTPLSAVDIFVKDLGLVLDTARRSKFPLPLSAAAHQMFMSASSAGHGGEDDS
FT                   AVIKTFPGITLPAAR"
FT   gene            complement(423775..424479)
FT                   /locus_tag="Bmul_3501"
FT   CDS_pept        complement(423775..424479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3501"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bur:Bcep18194_B0479 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17185"
FT                   /protein_id="ABX17185.1"
FT                   /translation="MFEKIPARAMSDHVAQQLLKQIEAGSFVATGKLPTEAVLAQEFGV
FT                   SRTVIREAISRLKNEGVVEPRQGSGVYVNQHGAIRPLRIDYAEAVEASSLPHLLAVRRA
FT                   IEAEVAAEAALRHSDEDMADIDDALRKIDEAVAEGRDGVAEDVAFHRTIAAVTGNPYFL
FT                   KTLQFLNQYLEAGVKVTRRNEATREDFSRQVREEHAAIADAIRSRDPMAARNAARTHMY
FT                   NAARRLAEAGIC"
FT   gene            complement(424834..425901)
FT                   /locus_tag="Bmul_3502"
FT   CDS_pept        complement(424834..425901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3502"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bch:Bcen2424_5153 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17186"
FT                   /protein_id="ABX17186.1"
FT                   /translation="MTPDVPASPLAEPAPQRIRFGIVLLPNFTLTAFSGFVDMLRLSAD
FT                   DGDYSKPVRCAWSVIGDTLAPVRASCGIQITPWETFDAAEPFDYVVVVGGLLHSGPQAG
FT                   PETLEFIRRAAARGATIVGICTGVFTLMRAGVLDGYRTCVSWFHYWDFIERFPSADPDL
FT                   LIADRLFVIDRRRITCSGGRASIDVAAAILLRHFEHATVQKALRILLVGEMQKGNAPQP
FT                   HPPGLEPATHPKVKRAILLMEQHVGRALPLEELACKLDLSTRQLERLFKAETGKSPQAF
FT                   AKQVRLRTAAWLLTSSDRTVADIASSCGFADASHLGREFRKQFGVPPAAYRERGGDEAA
FT                   AAASVTDDALHDEVE"
FT   gene            426162..427547
FT                   /locus_tag="Bmul_3503"
FT   CDS_pept        426162..427547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3503"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bch:Bcen2424_5152 L-serine dehydratase 1;
FT                   TIGRFAM: L-serine dehydratase 1; PFAM: serine dehydratase
FT                   alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17187"
FT                   /protein_id="ABX17187.1"
FT                   /translation="MNVSVFDLFKIGIGPSSSHTVGPMIAACRFASHVEDANLLGFVRR
FT                   VRVELYGSLGATGKGHGTDKAVLLGLEGHLPDTIDPDLIEPRLAAIRAEKSLSLLGKQT
FT                   IRFDEKEHIGFYRKLMTGTSIVHPNGMRFQAFDEHGQLLVEKEYYSIGGGFVVNRDGDR
FT                   VNGVRAAAEVPYPFRTGDDLMRQCREHGLSIAELMMRNECALRPEDEVRAGLLAIWRTM
FT                   AACVERGCKVEGDLPGPMRVKRRAAELNARLRARSEESLRDPLSMLDWVNLYAMAVNEE
FT                   NAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGSNEAGIVEFLLTAAAIGIIYKETASIS
FT                   GAEVGCQGEVGVACSMAAAAHAAVMGGTPDQVENAAEIGMEHNLGMTCDPVGGLVQIPC
FT                   IERNAMGAIKALNASRMALKGNGQHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVNV
FT                   IEC"
FT   gene            427563..428807
FT                   /locus_tag="Bmul_3504"
FT   CDS_pept        427563..428807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3504"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bvi:Bcep1808_3459
FT                   sarcosine oxidase, beta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17188"
FT                   /protein_id="ABX17188.1"
FT                   /translation="MSRYSIFSLFRNGLSYHENWEKQWKSPEPKREYDVVIVGGGGHGL
FT                   ATAYYLAKEHGITNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLS
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQVKEIEPTINLN
FT                   SRYPVLGASIQRRAGVARHDAVAWGFARGADRAGVDIIQNCQVTGIRREGGAVVGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGVRLPIESHPLQALVSEPIKPVVNSVIMSNAVHAY
FT                   ISQSDKGDLVIGAGIDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIARDEPHPLNAPFSLDRFY
FT                   TGHLIDEHGAAAVAH"
FT   gene            428824..429123
FT                   /locus_tag="Bmul_3505"
FT   CDS_pept        428824..429123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3505"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: bch:Bcen2424_5150 sarcosine
FT                   oxidase, delta subunit, heterotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17189"
FT                   /protein_id="ABX17189.1"
FT                   /translation="MLLIECPWCGPRAESEFTCGGEADIVRPVANETMTDREWGEYVFM
FT                   RENKRGLHKEQWLHTQGCRRWFKVTRDTVTYEIKSYEKFGGATAGNAHEEGTSK"
FT   gene            429120..432131
FT                   /locus_tag="Bmul_3506"
FT   CDS_pept        429120..432131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3506"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Glycine cleavage T-protein barrel; KEGG:
FT                   bch:Bcen2424_5149 sarcosine oxidase, alpha subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17190"
FT                   /protein_id="ABX17190.1"
FT                   /translation="MSQKDRLGTGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGV
FT                   HFVARSFKYHRPRGIVTAGVEEPNAVVQLESGPYTVPNARATEIELYQGLVATSVNAEP
FT                   SLENDKYAINQKLSRFLPAGFYYKTFMWPRKMWPKYEEKIREAAGLGKAPDTLDADRYD
FT                   KCYAHCDVLVVGGGPSGLAAAHAAATAGARVILVDDQRELGGSLLSCRAEIDGKPALQW
FT                   VEKIEAELRKLPDVTILSRSTAFGYQDHNLVTITQRLTDHLPVSMRKGTRELLWKVRAK
FT                   RVILATGAHERPIVFGNNDLPGVMLAGAVSTYIHRFGVLPGRNAVVFTNNDRAYQTALD
FT                   LKACGAKVTVVDSRASSNGALPAAAKRQGVTVMSGTVVTAASGKWRVSSVDVASYTNGQ
FT                   TGGKLQTLPCDLLAMSGGFSPVLHLFAQSGGKACWSDEKACFLPGKPVQAEASVGAAAG
FT                   EFGLARALRLALDAGAEAAKAAGFTAAQRPVAPQVAETVEGALQPLWLVGSREAAARGP
FT                   KQFVDFQNDVSAADILLAAREGFESIEHVKRYTAMGFGTDQGKLGNINGMAILAQALGK
FT                   TIPETGTTTFRPNYTPVSFGTFAGRELGDFLDPIRKTCVHEWHVEHGAMFEDVGNWKRP
FT                   WYFPKKGEDLHAAVKRECLAVRNSVGILDASTLGKIDIQGPDAVKLLNWMYTNPWNKLE
FT                   VGKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWLERWLQTEWPDMKV
FT                   RLASVTDHWATFAVVGPKSRKVVQKVCQDIDFGNEAFPFMSYRNGTVAGVKARVMRISF
FT                   SGELAYEVNVPANAGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSV
FT                   TPYDLGMGGLVAKSKDFLGKRSLSRSDTAKEGRKQFVGLLTEDEQFVLPEGAQIVAKDT
FT                   QISTVEPTPMIGHVTSSYYSPILKRSIALAVVKGGLNKMGESVVIPLANGKRVTAKISS
FT                   PVFYDTEGVRQHVE"
FT   gene            432121..432753
FT                   /locus_tag="Bmul_3507"
FT   CDS_pept        432121..432753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3507"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   bur:Bcep18194_B0489 sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17191"
FT                   /protein_id="ABX17191.1"
FT                   /translation="MWNETRNQTPVAGTGSVRLESPFVGAADLLKTHQARASKKFTLRE
FT                   RPFLDLVNVRGELSDPAFVSAFERVVGCRPPAEPNTVARSADYDVLWLGPDEWLVRSNG
FT                   PVQAGVLEAQLAEAVHGSYAAAVDVGSGYTVVEISGERVRDVLARGCPLDLHPRVLKPG
FT                   QCAQSHYFKASIVLIPTGDESYELVVRRSFADYFVRIMLDAAAPLAS"
FT   gene            432750..433190
FT                   /locus_tag="Bmul_3508"
FT   CDS_pept        432750..433190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3508"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG:
FT                   bch:Bcen2424_5147 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17192"
FT                   /protein_id="ABX17192.1"
FT                   /translation="MKPFDEPFAAIDGPRLRGRGWSVFVDELKVPARVGIHAHEHEAPQ
FT                   PIVIDARLEYRCEPSEQGEWIDYDGYCARIASYLAHKPHTRLLETLVADIAALSFREWP
FT                   ALESLTLSVHKPKIRPGTKRVGVSLDWTRGDYLRWTGAAGQI"
FT   gene            complement(433401..434060)
FT                   /locus_tag="Bmul_3509"
FT   CDS_pept        complement(433401..434060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3509"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bam:Bamb_4539 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17193"
FT                   /protein_id="ABX17193.1"
FT                   /translation="MRRLLWLIVLSFGVAHQASAQSASAPAAPAAADVAAASNALPASD
FT                   PLAAADQPNEANRRITAYLTKKFGVAKEKAIKLADIVSATATKYSLPPALVYAIISIES
FT                   RFQEKARGQHGATGLMQVVPAAHRGLLRNVKDLTEPNANVEAGSAILSGYVKAAGGNVQ
FT                   AALKSYGGSNAYAAKVLQRVDSFRFVLEPADEAKAASDANVRMVPVSDSSPAPRKP"
FT   sig_peptide     complement(433998..434060)
FT                   /locus_tag="Bmul_3509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.875 at
FT                   residue 21"
FT   gene            complement(434234..435025)
FT                   /locus_tag="Bmul_3510"
FT   CDS_pept        complement(434234..435025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3510"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0496 ABC
FT                   proline/glycine betaine transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17194"
FT                   /protein_id="ABX17194.1"
FT                   /translation="MSARDALHGTASASRPFAARRLVAPAARAAALALLLVLLLRPAWL
FT                   HGCFAPFADNGAPVIYDRASLLDLTLAHLGTVALSSAIGTLIAVAAGIAVTRPFGADFL
FT                   PVARSIVDIGQTFPPVAVLALAVPAVGFGLKPVLIALVLYGLLPVFESTIAGLEDVPRD
FT                   VIEAARGMGMSGWQRLMSVELPLAFPVIVNGIRLAVVINLGTATIGSTVAARGLGDVII
FT                   AGLQTSNTAFVLQGGVIVGLLAVLVSDAIGAVARIAAARRA"
FT   gene            complement(435022..435960)
FT                   /locus_tag="Bmul_3511"
FT   CDS_pept        complement(435022..435960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3511"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_4537 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17195"
FT                   /protein_id="ABX17195.1"
FT                   /translation="MIEIDRVGKRFGDIVAVDDVSLTMKQGTITALVGASGSGKSTLLR
FT                   MINRLIAPTSGTIRIDGTDTAGVPPEQLRRRIGYVIQGHGLFPHWSVARNIATVPRLLG
FT                   WRPDRIRARVAELLELFHLAPAEFADKLPHELSGGQQQRVGVARALAAEPAMLLMDEPF
FT                   GALDPIIRNKAQDDLLALQRRLGITVVIVTHDIEEALKLGDTIAVMDGGRLLQVATPAD
FT                   ILGNPAAGVVEQLVAGVDRPLRLLALTPVDAVAEAGHADGAPIEAARTLRDAISELLWR
FT                   GVDALPVDDGHGRPSRRITLDAIRAHARKPA"
FT   gene            complement(435957..437135)
FT                   /locus_tag="Bmul_3512"
FT   CDS_pept        complement(435957..437135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3512"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bam:Bamb_4536
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17196"
FT                   /protein_id="ABX17196.1"
FT                   /translation="MTMRTAACARRVTPDKVGILIGVLTIVAVLGMPFVVLRPNRIAAG
FT                   TGLSVFAALPVAQGAALATLWIVGALWAMTASRPTWRLAAGCTWLATLAYALGAATSHA
FT                   VAPDDMLARVSPAAGVWVLLFAWAVLVADALARLAFGPWRRLAALVVAIAAVSVPLATG
FT                   WWDGLSVMREYAVRSDDFWREASRHLSLAGGSVAAALVAGLPLGIACARAAPVRAIVMP
FT                   VLNIVQTIPSIAMYGLMMAPLGLLAAHVPLAAALGVRGIGVAPAVLALFLYSLLPIASS
FT                   VAVGLAQVPPHVTEAARAMGMTRAQRLFRVDLVLALPVILSGVRVVLVQNIGLTAVAAL
FT                   IGGGGFGTFIFQGIGQSAADLVLLGAIPTIALALAAAVVFEAATSLAKGRSG"
FT   gene            complement(437132..438055)
FT                   /locus_tag="Bmul_3513"
FT   CDS_pept        complement(437132..438055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3513"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0499 ABC
FT                   glycine betaine/choline transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17197"
FT                   /protein_id="ABX17197.1"
FT                   /translation="MKLALPARILGLALAASVVAPGAHADAPVVVSSKIDTEGNLLGNV
FT                   IAQVLKAHGIPVTEKIALGATPIVRKALTSGEIDIYPEYTGNAAFFFNKADDPVWKNAS
FT                   QGYDTAKQLDYAANHLVWLAPAPANNTWGVAVLSSVAQARHLKTFSDFGKWVAGGGNVK
FT                   LAASAEFVNSASALPSFEKAYGFKLKPDQLVVLSGGDTAATIKAAANQTDGVNAAMVYG
FT                   TDGGIASSGLTVLDDDKHVQPVYAPAPVIREAVLKAHPQIADYLKPVFASLDLKTLQML
FT                   NARVQINGEPAAGVAKSYLKSKGFVK"
FT   sig_peptide     complement(437978..438055)
FT                   /locus_tag="Bmul_3513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            438223..439152
FT                   /locus_tag="Bmul_3514"
FT   CDS_pept        438223..439152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3514"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bch:Bcen2424_5140 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17198"
FT                   /protein_id="ABX17198.1"
FT                   /translation="MKPELLVLIALRDDAQRRIAASFEVRYAPTAELRARTIAEHGGTI
FT                   RAVLTNGSTGLAAHEIDALPQVRLVGALGAGYEQIDVAHAKARGIAVVTGAGTNDDCVA
FT                   DHAFALLLAAVRGIVRLDAATRAGVWRDALPMPPNVSGKRLGIVGLGRIGEKCARRAAG
FT                   FDIEIGYHNRAAKQVPYRYFERLDALAQWADFLIVATPGGAGTRHLIDRTVLDALGPHG
FT                   FLVNVSRGSVVDTAALADALRERRLAGAALDVYEGEPEPPRALTALDNVVLTPHLGGWS
FT                   PEALDRSVQQFLDNAARHFAGEPLLTPL"
FT   gene            439207..439689
FT                   /locus_tag="Bmul_3515"
FT   CDS_pept        439207..439689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3515"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bte:BTH_II1006
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17199"
FT                   /protein_id="ABX17199.1"
FT                   /translation="MSTYIAEVEWQAAPDDKFVDNRYSRRHEWRFDGGVTVPASSSPHV
FT                   VRVPFSDPAAVDPEEAFVAALSSCHMLWFLSIAAQRRFAVTRYRDAAEGTMAKNDAGKE
FT                   VVTRIVLKPAVTFGGERAPTDDEVAALHHAAHDACFLANSVRTTIDVEGTWEHRAQ"
FT   gene            complement(439757..442744)
FT                   /locus_tag="Bmul_3516"
FT   CDS_pept        complement(439757..442744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3516"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   thioester reductase domain protein; PFAM: AMP-dependent
FT                   synthetase and ligase; NAD-dependent epimerase/dehydratase;
FT                   phosphopantetheine-binding; Male sterility domain; KEGG:
FT                   bam:Bamb_5388 amino acid adenylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17200"
FT                   /protein_id="ABX17200.1"
FT                   /translation="MGIETVESTVLHAFAARAAEAPNRTAVLSRDASLTYGELDARSNR
FT                   VARALIARGVAPGSLVPVEAVRSADFLVALLGVLKAGAAYIPIDDAYPAERKRHIYEQS
FT                   GATVALHARANAAAEPSSAGVAPLAVASLIGDDAPDGELRTPAPHDLLYVIFTSGTTGR
FT                   PKGVEIEHHAVARLVDWHNRQFGVTAASRMPLMAGLSFDISQWEIWSALTAGATLLLPD
FT                   EEIRPDADALVAFHRDHATTHAFVPTVMVPDFVRASRGSDLALRYLFTAGEKLQPVDTD
FT                   GTTYTLIDFYGPTETTIFATMHRVPRATLGRPSSIGHPVPGATIHVLDAQLAPLPDGQV
FT                   GELCIAGPCVARGYLNDPSLTHDKFVALPHDRSQRLYRTGDLGRRLPDGTIQYLGRMDD
FT                   QLKIRGHRVELGEIASVLSTQPGIRKCAVIAVEDASNAKEIVAFVVPDAEHANGDVIGS
FT                   IRTRIRACLPHYMRPRRYVVLPELPVTLNGKVDKAALRELDDGSAARASHAGWRDDRID
FT                   TAIARTLAPILGHTDFGPADNFFDIGGHSLLIAEFVRRLGETLRMKVYVRDVYECPTGA
FT                   ALRERLEARLNERQSLLDAEPARALRDDIALPDGIASFRPFDTRRLERPAHILLTGATG
FT                   FVGVHLLADLLERTDAVVHCTVRAADGASARARIVEQAQRYRVALPDSSRWVAHAADLS
FT                   LPRLGMSDADYRTLAGCVDVIYHSASAVNFIQPYSYMRTDNVDGLKRVLAFAADGQPKA
FT                   LMLLSTISVYSWGHLHTGKTTVSEDDDIDQNLPAVMTDIGYVRSKWVMEKVADLAASRG
FT                   LPLMTFRLGYATFHRDTGLSANYQWWGRLVRTCIDQQQIPDLRNLREGLTTVDYMTHAI
FT                   AHISRNPSALGHKYNLVHTDDNNLTLRQFFERLERHFGLRFETVPFRQWLDGWQHDTAA
FT                   PLYPLLSLFRDVMYDGRSTVELYQDTYRWRCDRVQAALQGSGIEEPTFTRDELARYLTQ
FT                   SIGHRV"
FT   gene            complement(443276..443614)
FT                   /locus_tag="Bmul_3517"
FT   CDS_pept        complement(443276..443614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17201"
FT                   /protein_id="ABX17201.1"
FT                   /translation="MEAPDNDFPVQDLLRHLLADTRSSSEIARLSGVSQPTVSRLRLSK
FT                   GQRLRRSAPFNKLCSFYGLDTGPARRRYNDLLRDAIVDAWDGSDEHGRALLVVIQGLKD
FT                   LQAKADDG"
FT   gene            443694..444599
FT                   /locus_tag="Bmul_3518"
FT   CDS_pept        443694..444599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17202"
FT                   /protein_id="ABX17202.1"
FT                   /translation="MTLKHLPPTFCWTKIGTESGDELPTVVLRKEWERRLGGGRFLWGI
FT                   NQPLGSSAQVAAHRTGSLLALFSPVASRSRSGERKREDALLWNAWIDASGQVRQLPPHA
FT                   FIASRATLPSGRRREQHYALVCMSSTALTVGTQLRVFPEHLRSVSTGKPLGAAQGAAVV
FT                   DCVGRAKEQMGKSYPLALSVELEVPYFVRLAQPSVLKARDLAEVNKATRAGDFERFVEL
FT                   VARLRGRSSTDAVRGFTRDLFDVPPIETAAAYVAPAHVARLRTRPVADHARGFTGDLFD
FT                   LSPGEAAAFGALAHPRVGRA"
FT   gene            444776..445006
FT                   /locus_tag="Bmul_3519"
FT   CDS_pept        444776..445006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17203"
FT                   /protein_id="ABX17203.1"
FT                   /translation="MSTHICSREARAAQRFVEATRNVDQAFRAVRGEGDDERASTEYAA
FT                   AMSRLDRALDELARAQAFFDHVVSADAARRN"
FT   gene            446204..446983
FT                   /locus_tag="Bmul_3520"
FT   CDS_pept        446204..446983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3520"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bam:Bamb_6247 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17204"
FT                   /protein_id="ABX17204.1"
FT                   /translation="MRVLIVEDDPVHAQAAARIVASLGHDVVEAGDGEHAQQRLRAEPF
FT                   DLVILDWLLPRMSGFEVLYWIRRTLGTTPAVLFVTSKSLDDDIVLAMDAGADDYIVKPF
FT                   RVAEFASRVSALLMRSMRDATPAGAIRAGDYVLDPRERTIQLRGAPIKLTPKEFDLVEF
FT                   FFSNIGKLLSRKVVCISTWGRELDPDSRTLDTHIYRIRQKLELGPENGLRLSSVYTHGY
FT                   RLEVVSSGPVHDSAAAHRSSLQPALARPLTPAGFECE"
FT   gene            447023..449380
FT                   /locus_tag="Bmul_3521"
FT   CDS_pept        447023..449380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3521"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; CHASE2 domain protein;
FT                   KEGG: bam:Bamb_6238 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17205"
FT                   /protein_id="ABX17205.1"
FT                   /translation="MMRVDAAHGPSGFVRECIAIAAFVLLLCVSLTATGVLRRADLFFF
FT                   DIVQPLLQRPSPHKIVLIAIDAASAKALGGWPVKRADYAALIDRLTEAGVAAVGLDVAV
FT                   THPGRILPAGDAWLARAAERNGRVVLPVVAVDEDGEASAVPPLAPIAAAAFAVAHVNAV
FT                   PDADRVSRSFYLREGPPHTDYEHMSVALLRASGVPFARCGERPEHDMLRWSGACRRYVP
FT                   FASRPSYRTIAFLDALEGRVAPGLLKDAIVLIGPTTSTADTHFITPGSEPQSRAGVEFV
FT                   AQSTYALASGSLVRRASWGGQLLFSLSVLPWLCAALGMLGPRAALLASIGTAVFAGGMS
FT                   LLMLKTVHLFFFPAPAVAACLCAYAFSAWRRQEALLQYLTREAERAMADPGLPGDAPIC
FT                   PNATDPFRRRVLVMSAMIDRLRRSARLISEWMNSLPEATLVASASGAVMLANRRALALY
FT                   DTGAERRSLTRPAAGRHAAQMLREMTASDDAAQYAHRALQTLAQRSGAATASAPAAPMD
FT                   GLEIVDARQRSLLVKCAIVPAHEAGDAMVIFHVADVTPMRAAERQRDAALRFLSHDMRS
FT                   PQAAILALIEQRRQTPADLSEAQFADLVGHYARWTLTLADQFLLLARAQARASKATEVD
FT                   LVPLLGDAVDDLWAHASAKRVGIRLFAEPGMLVVADALLLRRAFANLIDNAVRFSPEGA
FT                   TVTVSADERDGRWCVSVADTGIGIPAHQLPNLFTEFFRVDARGATAGHGLGLAFVKQVV
FT                   DALGGSIHVESAVGRGSVFTVLLPRNVAQRDS"
FT   gene            450034..454497
FT                   /locus_tag="Bmul_3522"
FT   CDS_pept        450034..454497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3522"
FT                   /product="Haemagluttinin domain protein"
FT                   /note="PFAM: Haemagluttinin domain protein; Hep_Hag
FT                   repeat-containing protein; KEGG: bur:Bcep18194_C7374
FT                   YadA/haemagluttinin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17206"
FT                   /protein_id="ABX17206.1"
FT                   /translation="MARAAYRQKSMNRTYRTVWNAARGAIVAVSERDRANGKGQASAGT
FT                   TVALTSATLAVLGSMAMWSGDAAAQYVQIPGTNCTLTTTANSFYASAVGCGATASASGS
FT                   VALGSYVVASGLNSAAIGYLATATAQGAAAFGTSSSASGLNSAAIGPGAKSSGTSSAAI
FT                   GPFANASNTNTFAGGTGATASGSVAVALGSSSTASGSNAVAVGANAEASNNNTVAVGQG
FT                   AVANFTGGTAVGMTAQALSSGAVAVGNVANAAGTNAVAVGFQSTATGTNSMALMTNALA
FT                   SGTQAISIGTGSTASGTTSVALGIDTQSTGVNAISLGSFSAATADQAIAIGARSVAASI
FT                   GSVALGLYADAAAYGAVAIGNGAGSGSTTAAGNSVGVGVAAGQFVSGAQNVGLGGGIAN
FT                   VMKGAGTGVSGTRNIAVGSGDGTVSYDSVQSASAGDNVAGNDNVAIGTNAGIGVAANAT
FT                   TSIGLNALASDTMAISIGTNSTASGTSSVALGPNAQATNAAATAVGNAAKATGNTSLAL
FT                   GGQAVAIGDGTVAAGQGAGAGSTVGNTGSVAVGLATGTLVSGAQNTAIGGGIASAMRGA
FT                   GSGVTGARNVAMGVGDGTVAYDGTLSASAGNLVSGNDNVAIGTNAGIGVAADATTSIGL
FT                   NALASGTNAIAMGTGATASGVNSLSIGTGNVVSGANSGAIGDPSTITGSGSYSLGNNNT
FT                   INANNAFVVGNGVTVPAGLNGAVVLGNASTVSNAVQTPNAVIGGNTYSFAGGTPAAGDV
FT                   VSVGSAAAPRQIQNVAAGQISAASTDAINGSQLYATNLAINSLSTSTLSGITSLSTATS
FT                   SSIGSLSTGLSSTDSTVASLSTSTSSSIGSLSTGLSSTDSTVASLSTSTSSSIGSLSTG
FT                   LSSTDSAVASLSTSTSTSIGSLSTGLSSTDSTVASLSTSTSTSIGSLSTGLSSTNSNVA
FT                   SLSTGLSSTNSNVASLSTGLSSTNSNVASLSTGLSSTNSNVASLSTGLSSTNSNITSLS
FT                   TGLSSTNSNVASLSTGLSSTNSNVVSLSTGLSSTNSNVASLSTGLSSTNSNVASLSTGL
FT                   SSTSSNVASLSTGLSSTNSNVASLSTGLSSTNSNVASLSTGLSSTNSNVASLSTGLSST
FT                   TSNVASLSTSVSAITSNNNNLGNSTAGAIGGGATYDPTTGTISAPSYVTYNSDGSTTIN
FT                   NNVGSALDNINEHGIKYFHANSTAPDSQAIGLDSVAIGPNAISRVDGSIALGAGSVADR
FT                   ATVPASGIMRNGSASIPFDTTDQTLLGAVSVGDATNKTYRQITNVADGTGQQDAVTVRQ
FT                   LTGALQSFAVTGQLYFHANSTRADSLAVGAESIAVGPTTVVNGDNGVGIGNGAIVDSTA
FT                   PGGVAIGQAASSAQADAIALGSGATATGAQSVAQGANAVAVSVGSVALGSGARSTATDA
FT                   LALGAGASSTFANSVALGAGSLTTVGALTNYIAYGLSNRLPSQALWSESSQGVLDLTMA
FT                   LSMVRSLRMQATNATLGSLPAAFRRR"
FT   gene            complement(454365..455330)
FT                   /locus_tag="Bmul_3523"
FT   CDS_pept        complement(454365..455330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3523"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17207"
FT                   /protein_id="ABX17207.1"
FT                   /translation="MSAPSLVTVGIDVAKDHVDVSVLGAHLDTQRFDNDAEGHSALAVA
FT                   LQPLDVALVVMEATGGYEAEMACALQSAGLPVAVVNPRQARDFARSMGRLAKTDRIDAR
FT                   MLAQLASVLVRREDLSRLLRPVPDERQQWLAALLTRRRQLLTMLLSERQRLQITPVGLH
FT                   PSLLAIIAAVQAQLDDIDAQMVGHVREHFSELDRLLQSTHGIGPVSSACLIAELPELGK
FT                   LSRRQIAALVGVAPIACDSGSRNGRRRVQGGRFEIRRVLYMATLTATRHNPAIKTFYRR
FT                   LKAAGKLPKVALVACMRKLLTILNAMVRSNTPWDDSLHKA"
FT   gene            455345..456337
FT                   /locus_tag="Bmul_3524"
FT   CDS_pept        455345..456337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3524"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   bam:Bamb_6245 YadA C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17208"
FT                   /protein_id="ABX17208.1"
FT                   /translation="MLVHAHSAGPARVTVRVSGRPARRPCVLYSVTGSNAQARDKLHGL
FT                   VWLRSDFTVLVRLKHTSTPQSSAGEVNVGNRQITGLAAGMAGTDAVNVSQLNAVADQLT
FT                   TLIDQRTSNLGGSYTTNPDGANVPPGSTGPNSSAGGSGAVASGSNSTAVGNNALASGNG
FT                   STAIGVGASASGNNSTAIGNGSNDGGRSNVVAVGSADSARQVINVAAGTQGTDAVNVNQ
FT                   LNAGLSNTLSQANSYTDGQIAGLRNSLDSYRRDADGGTATAMAIAGLPQPSGPGKSMVA
FT                   IAGSVYRGQSGQALGISTISENNHWIYKAAVSTNTRGTYGAVVGAGYQW"
FT   gene            456355..457188
FT                   /locus_tag="Bmul_3525"
FT   CDS_pept        456355..457188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3525"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; SmpA/OmlA domain
FT                   protein; KEGG: bam:Bamb_6244 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17209"
FT                   /protein_id="ABX17209.1"
FT                   /translation="MRNIKRNNQRTMKFKQAVLLSGCVVAAAALQGCATPHTPPQFPDA
FT                   ASASPAGGTFVNVANLRNVSTGLNKDQLYDLIGPPQFHEGFVGHRVWNYLFDFRRGDQV
FT                   VSCQYQVQFDRNMRVSATYWRDPQCAEFVQPSAAPAVAPAAAAAPAPRAQFTIAGEALF
FT                   PFAKSSLDSMLPGGRAELDDAIAKIRAERGTTRIDVVGHTDRIGSDESNRALSRARAET
FT                   VKRYLVAHGLDAARIRTEGAGSSQPVSHCPPGESPAVIACLQKDRRVTITVYGQD"
FT   sig_peptide     456355..456453
FT                   /locus_tag="Bmul_3525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 33"
FT   gene            complement(457265..458149)
FT                   /locus_tag="Bmul_3526"
FT   CDS_pept        complement(457265..458149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3526"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_B4604 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17210"
FT                   /protein_id="ABX17210.1"
FT                   /translation="MREISLDRLRTLVAVAERGSFADAARALHLAPPTVSLHIAELEAR
FT                   IGAPLLSRKRGHVGPTSIGTVLVERARRLLADAEQALDDVQRQVAGLEGRVRLGASTGV
FT                   IAHLLPQALDALRAPHPAIDVQIAVLTSQETLSRLVDGTLDVGLVALPQPPVAGLVIKP
FT                   WRRDPVMAFVPAHWRCPARVTPEWLAARPLVLNDASTHLSRLTAEWFAAAGHHPVPRIQ
FT                   LNYNDAIKSLVAAGYGAALLPHEAATPLADARIVMRPLRPGLWRRLGIAHRAGHVERAT
FT                   QHVLDALWDLRLA"
FT   gene            458279..459208
FT                   /locus_tag="Bmul_3527"
FT   CDS_pept        458279..459208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3527"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: rme:Rmet_1768
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17211"
FT                   /protein_id="ABX17211.1"
FT                   /translation="MSTPVVFIDGDQGTTGLQIHDRLRGRTDIRVFTLPAAERKDPRRR
FT                   AEAINGCDIAILCLPDDAAREAVSAIVNPAVRVIDASSAHRTQPGWTYGFPEMAPAQAE
FT                   QIANARRVSNPGCYPTGAVGLLRPLVEARLIPADYPIAIHAVSGYSGRGRAGVEEHEGP
FT                   GAANARAYQVYGLALAHKHAPEIQRHATLAQRPIFVPAYGAFRQGIVLTVPIAVRLLAP
FT                   GVDGPALHACLARHYAQAAHVRVLPLEASRASTHLDPQALNGTNDMQLSVFHDAAQEQV
FT                   LLAAVFDNLGKGASGAAVQNLDLMLARQ"
FT   gene            complement(459224..460285)
FT                   /locus_tag="Bmul_3528"
FT   CDS_pept        complement(459224..460285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3528"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2085
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17212"
FT                   /protein_id="ABX17212.1"
FT                   /translation="MHCRDRVRFAPDAPHAIVDCIGRHPYGVFDYARRMSRVDLNLLTA
FT                   LDALLTERSVTGAARRLNLSVSATSRTLARLRALTGDRLLLQAGRTLVLTPYAEQLSRR
FT                   IPALAREAESVLSRAAYRFDSATLAQRFTLCAGEGFVDLLGAALTNRVRRAAPGVQLRF
FT                   VPKPDWNAQALREGLVDLEIGVVKTAAPEIRTRVLFTDRYVGLCRIGHPLLAAGEIDMQ
FT                   RWLAYDHVTISRTGEADNPIDARLESTGVPRNVPIVVPSYTGAMQLVRHSDLLAIVPHS
FT                   CLGNAFMPDYAAENGVQSFALPLPLPAFNISAIWHPRLDHDPAHRWLRDEVRAVCAAAY
FT                   PDSTPAAPSRADR"
FT   gene            460313..461026
FT                   /locus_tag="Bmul_3529"
FT   CDS_pept        460313..461026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3529"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bam:Bamb_3410 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17213"
FT                   /protein_id="ABX17213.1"
FT                   /translation="MPDTSDPRPTILLVGASRGLGHAMAAEFLKRGWDVVGTVRADRGR
FT                   TPLHALAEAYPDRLRIETLDITQPEQIRALAARLSGRVFDILFVNAGTTNPDPTQTIGE
FT                   VSTDDFVDLMITNALSPMRVVETLAGLVPRDGLIGIMSSGQGSIADNESGQRELYRGSK
FT                   AALNQFMRSFAARHAQTPLAMVLIAPGWVRTELGGPDARLSIDESVPGVVDVLLAKRGR
FT                   AGLEYLDYRGRTVRW"
FT   gene            complement(461143..462051)
FT                   /locus_tag="Bmul_3530"
FT   CDS_pept        complement(461143..462051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3530"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: bam:Bamb_4526
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17214"
FT                   /protein_id="ABX17214.1"
FT                   /translation="MRQVRRVRRSMKLMRVCWLLLLLAAAGPARAFHTRTVAIPSAAMR
FT                   ATLAATVVLPDDYLRGGAHRVERYPVVYLLHGSGGDHTDWTANTRIGELADRYRVILVM
FT                   PDGGHESWYIDSPFDSGSRYETFVGDEVVSYVDAHFRTLATRRTRAITGLSMGGFGALR
FT                   IALDRPDTFGAAGSISGAVDPRNCEDEPGIDHVFGDPVRHPSFWSRNAIVESARAFVHT
FT                   HVDLTIDCGRDDAFIGSNRTLHERLVALGVPHDYAERAGGHTWDYWAQAIRYQMRFFAT
FT                   SFERGRYAMHAHPSAGAVRRS"
FT   sig_peptide     complement(461956..462051)
FT                   /locus_tag="Bmul_3530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(462197..462628)
FT                   /locus_tag="Bmul_3531"
FT   CDS_pept        complement(462197..462628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3531"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG:
FT                   bvi:Bcep1808_3442 DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17215"
FT                   /protein_id="ABX17215.1"
FT                   /translation="MRVMVIVKATADSETGALPDTELLTAMGRFNEELVKAGVMLAGEG
FT                   LHPSSRGKRVRFAGESRTVIDGPFAETKELVAGFWLWQVKSMDEAVEWVKRCPNPMPGE
FT                   SEIEIRPIFEAKDFGAALTPELQAQEARLRDEIDARHKP"
FT   gene            462813..463043
FT                   /locus_tag="Bmul_3532"
FT   CDS_pept        462813..463043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17216"
FT                   /protein_id="ABX17216.1"
FT                   /translation="MAAKVVSKKKYLKILNKRLRAAPDAPAGASFVFYPPGAKAKHATG
FT                   VVSSEPCAAHELETMAAIQRKAAEEFIVADA"
FT   gene            complement(463344..464765)
FT                   /locus_tag="Bmul_3533"
FT   CDS_pept        complement(463344..464765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3533"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B0539
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17217"
FT                   /protein_id="ABX17217.1"
FT                   /translation="MPAATASASAAARLERLPFSGYHKRIFFIIAIAFFFDSVDLGTMT
FT                   FVLGSIRKEFGLSTAAAGVVASASFVGMVLGAAVAGLLADRFGRRPVFQWSMVLWGAAS
FT                   YLCSTAQSVDALIVYRVLLGIGMGMEFPVAQTLLSEFVPTEKRGRLIALMDGFWPLGFI
FT                   TAGIVAYFVLPQFGWRTVFALLAIPAVFVLVVRRIVPESPRWLEHAGRHEAADAVLRTI
FT                   EAKVMRSAGVATLPPPSRLAEPVAARGRGALREIWSGAYRRRTTMVWLLWFFALLGFYG
FT                   LTSWLGALLQQAGFEVTKSVFYTVLISLGGVPGFLCAAWLVERWGRKPTCIASLVGGGI
FT                   MAYAYGQSALYGGSMALLIGTGLAMQFFLFGMWAALYTYTPELYGTGARATGSGFASAI
FT                   GRIGSLIGPYVVGVVLPVFGQGGVFTLGALSFAAAALAVWTLGIETKGLALEELASGDE
FT                   GGAGGRYPATADKVS"
FT   gene            complement(464909..465679)
FT                   /locus_tag="Bmul_3534"
FT   CDS_pept        complement(464909..465679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3534"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bam:Bamb_4521
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17218"
FT                   /protein_id="ABX17218.1"
FT                   /translation="MAHMNFHAIRAIYRAEMARTRRTLMQSIIAPVISTSLYFVVFGSA
FT                   IGSRISDVNGIGYGSFIVPGLVMLSLLSQSISNASFGIYFPRFTGTIYEVLSAPVSHWE
FT                   IVTAYVGAAASKSILLGLIILATAALFVPLHILHPFWMVLFLVLTSVTFSLFGFVIGIW
FT                   ADSFEKLQLVPLLIITPLTFLGGSFYSVDMLPPAWRVITLFNPIVYLVSGFRWSFYGLA
FT                   DVHVGISLAATSLFLVILLAIVAWMFRTGYKLKN"
FT   gene            complement(465685..466629)
FT                   /locus_tag="Bmul_3535"
FT   CDS_pept        complement(465685..466629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3535"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5107 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17219"
FT                   /protein_id="ABX17219.1"
FT                   /translation="MQPILSISDLSKTYASGFQALKHVTLDIRPGEIFALLGPNGAGKT
FT                   TLIGSVCGIVTPTEGRVTVGGHDIRDAYRAARELIGLVPQELTTDAFETVWATVSFSRG
FT                   LFGKAPDPAHIEKTLKALSLWDKRNNKLITLSGGMKRRVMIAKALSHEPRILFLDEPTA
FT                   GVDVELRRDMWKLVDTLREDGVTIVLTTHYIEEAEEMADRIGIILGGELVLVEEKRELM
FT                   RKLGKKQLTVQLEHPLASVPDALAPFGLELAEGGAALVYTYDSQRDDASIATLIAALGA
FT                   AGIGFRDLHTTQSSLEDIFVSLIDNRRNGAQRA"
FT   gene            complement(467060..468760)
FT                   /locus_tag="Bmul_3536"
FT   CDS_pept        complement(467060..468760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3536"
FT                   /product="choline dehydrogenase"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bch:Bcen2424_5100 choline
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17220"
FT                   /db_xref="GOA:A9AMZ9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AMZ9"
FT                   /protein_id="ABX17220.1"
FT                   /translation="MTTREYDYIICGAGSAGNVLATRLTEDPNVTVLLLEAGGPDYRFD
FT                   FRTQMPAALAYPLQGRRYNWAYETDPEPHMDNRRMECGRGKGLGGSSLINGMCYIRGNA
FT                   LDYDNWATHQGLENWTYLDCLPYFKKAETRDIGPNDYHGGDGPVSVTTSKPGVNPLFEA
FT                   MVEAGVQAGYPRTEDLNGYQQEGFGPMDRTVTPKGRRASTARGYLDQAKTRPNLEIVTH
FT                   ALADRILFDGKRASGVTYLRGNERATAHARREVLVCSGAIASPQLLQRSGVGPGAWLKE
FT                   LDIPIVLDLPGVGQNLQDHLEMYIQYECKEPVSLYPALKWWNQPKIGLEWMLNGTGLGA
FT                   SNHFEAGGFIRTRDDDPWPNIQYHFLPVAINYNGSNAIEMHGFQAHVGSMRSPSRGRVK
FT                   LRSRDPNAHPSILFNYMAEALDWREFRDAIRATREIMRQPALDRYRGRELNPGADLKSD
FT                   KELDAFVRARAETAFHPSCSCKMGYDDMAVVDNEGRVHGLEGLRVVDASIMPIITTGNL
FT                   NAPTIMIAEKIADKIRGRKPLERANVPYFVANGAPARNVAKAVRQPETV"
FT   gene            complement(468783..470252)
FT                   /locus_tag="Bmul_3537"
FT   CDS_pept        complement(468783..470252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3537"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: bch:Bcen2424_5099 betaine
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17221"
FT                   /db_xref="GOA:A9AN00"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AN00"
FT                   /protein_id="ABX17221.1"
FT                   /translation="MSVYGLQRLYIGGGYVDATSGKTFDTFDPATGDLLAQVQQASAAD
FT                   VDRAIASAQEGQREWAAMTAMQRSRILRRAVELLRERNDELAALETRDTGKPIAETLAV
FT                   DIVTGADVIEYYAGLATAIEGLQVPLRADSFVYTRREPLGVCAGIGAWNYPIQIACWKT
FT                   APALAAGNAMVFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIA
FT                   KVSFTGGVETGKKVMSLAGASSLKEVTMELGGKSPLIVFDDADLDRAADIAVTANFFSS
FT                   GQVCTNGTRVFVHRSIKDAFTQKVLERVKRIRVGKPTDADTNFGPLVSAAQLDKVLGFI
FT                   ESGKAEGAKLLAGGTRLTEGHFANGQYVAPTVFGDCRDDMKIVREEIFGPVMSILEFES
FT                   EDEVIARANDTHYGLAAGVVTENLSRAHRTIHRLEAGICWINTWGESPAEMPVGGYKQS
FT                   GVGRENGITTLEHYTRIKSVQVELGRYNPVF"
FT   gene            complement(470283..470867)
FT                   /locus_tag="Bmul_3538"
FT   CDS_pept        complement(470283..470867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3538"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="TIGRFAM: transcriptional repressor BetI; PFAM:
FT                   regulatory protein TetR; KEGG: bch:Bcen2424_5098
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17222"
FT                   /db_xref="GOA:A9AN01"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AN01"
FT                   /protein_id="ABX17222.1"
FT                   /translation="MPKVGMREIRRAQLIDATLRSIDEAGLPGTTLASVAQRANISTGI
FT                   VSHYFGDKDGLLEATMRHVLRDLWSATTRRRTAARKDPRSRLRAIVAANFDDTQIAAPV
FT                   MKTWLAFWSQSMHDPMLKRLQHVNTRRLHSNLCAEFAKALPRAKAREAASGLAALIDGL
FT                   WLRGALAGGPIDTRAALKLAHDYIDLLLASD"
FT   gene            471184..472380
FT                   /locus_tag="Bmul_3539"
FT   CDS_pept        471184..472380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3539"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-independent"
FT                   /note="TIGRFAM: formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KEGG: bch:Bcen2424_5090 alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17223"
FT                   /protein_id="ABX17223.1"
FT                   /translation="MSSNRGVVYLGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAPVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMC
FT                   KETHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIR
FT                   DLTCLSDILPTGYHGAVSAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAE
FT                   RLAHAKAMGFETVDLSKDATLGEQIAQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPA
FT                   TVLNSLMEITRPAGAIGIPGLYVTDDPGAQDKAAQHGSLSIRFGLGWAKSHSFFTGQTP
FT                   VLKYNRNLMQAILYDRLPIAKIVNVTVISLDDAPEGYKKFDGGAPRKFVIDPHGLLAA"
FT   gene            472560..473492
FT                   /locus_tag="Bmul_3540"
FT   CDS_pept        472560..473492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pap:PSPA7_4195 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17224"
FT                   /protein_id="ABX17224.1"
FT                   /translation="MAKSIPLAALHTFVEVARCGSMKQAADLLCLSPGAVSQHVRHLED
FT                   RLAVRLFERNGRELELTGTGRALFDALAGGFREIESAWANLHGANRRVVRLTVTTTASF
FT                   ANTWLVQRLGAFNAHYPEIEITIDTRPQLVDLRRDYVDVAIRHGLGQYPGHASFRIWTP
FT                   ELWPVCSPQLLDPARPIAQPADCLAYPLLQDADRADWVLWLRAQGIEDPRAQRGASFSD
FT                   DALLIKAAVASQGIALVRDIYARDEIAAGRLVRVLARPWPTELSYYVVCNEARRDEWKI
FT                   VAFRDWLAREIGDGAGEPAGRDTRDTLAP"
FT   gene            complement(473481..474368)
FT                   /locus_tag="Bmul_3541"
FT   CDS_pept        complement(473481..474368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3541"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; Protein of unknown function DUF250; KEGG:
FT                   bam:Bamb_1102 protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17225"
FT                   /protein_id="ABX17225.1"
FT                   /translation="MNALQLVTLAAIWGASFLFMRMGAPEFGVIPLIALRVAIAAVLLS
FT                   PVLRDASARHEFRTHAWPLFVVGVANSALPFCLLTYAALFVTAGTDSILNATTPLWTAL
FT                   VAYVWLRTPLTKPQTLGLAVGFAGVVVLAGSAVGAGAAGTPGAIAAAMLATLSYGFAAH
FT                   YSKRKLANVRPFVSAFGSQLFAAVVLAPLAAPLWPRGDVHASAWMAVVLLGTVCTAIAY
FT                   LLYFRLIRNAGAQYAASVTFLIPVFGVVWGAVFLHETITAQTLAGCAIILLGTALATGK
FT                   LSGFATAAARASRR"
FT   sig_peptide     complement(474297..474368)
FT                   /locus_tag="Bmul_3541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.602 at
FT                   residue 24"
FT   gene            complement(474548..475423)
FT                   /locus_tag="Bmul_3542"
FT   CDS_pept        complement(474548..475423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17226"
FT                   /protein_id="ABX17226.1"
FT                   /translation="MRILPNRTLHARDTLRGVTHARAAGRRNVVCRCRQCGFVAFHPLQ
FT                   RCPACGRESWPFEPLHARANANANANAGANAYEAVEAAPSCRVERWAARIAAALRAAAF
FT                   RRPRASTAPLLSILTLVLLVGGYVLSDRMCKADPACRAPDARNTGARATHVLAQASDDA
FT                   TAAAEPALPVLPVPVYPFHTGDATQLASDPRRGARSIDAGVQSSPPATAQVAQTVAPNR
FT                   ASGGMRACTSRSASGCARTAPPSVRTAVWHGGRDSAHRARAVRRVSTHVRHVRRAAATE
FT                   EQMALLYRGH"
FT   gene            complement(475431..476870)
FT                   /locus_tag="Bmul_3543"
FT   CDS_pept        complement(475431..476870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3543"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B0568 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17227"
FT                   /protein_id="ABX17227.1"
FT                   /translation="MHRSEGMKRYAALAQTIADSIRRGDLAPGERIPTVRAACRAYRVS
FT                   PSTVFRAYYQLESEGLIVARPRSGYFVANLDASRLRSTLDPLRKPAAAPHVAETALCRL
FT                   LDSLKHGDVVPLGSAFANYSLFPMSSLWRYVQSATRNMDRVTMLSGLPPGEDGLRRQIA
FT                   LRYLTAGAALPMDEIIVTTGALDALMLSLQALTRPGEVVAIERPAFPAALQAVQRLHLK
FT                   AVEIPVDPHTGLDLDALAEALDTHPVRACWFMTSLHNPTGATLSDERKRALIELLAAHR
FT                   VPLIEDDVYGELQFGPAPVRPAKVYDDSGLVLHCGSFSKCLAPGFRIGWVAAGRYARQI
FT                   RQANCMGTPSADVPAQLAISSYLGHGGYDRFLRKLRRNLAAHQAQMVAAVHAYFPQGTE
FT                   VFAPGGGYFLWIELPKRVDALRLFGAALENGISIAPGPIFSATGGFRRYVRLNYGRPWT
FT                   PAVENAMQTIGTLAARQRHPE"
FT   gene            477118..478533
FT                   /locus_tag="Bmul_3544"
FT   CDS_pept        477118..478533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3544"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   WD40 domain protein beta Propeller; KEGG: bch:Bcen2424_5087
FT                   coagulation factor 5/8 type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17228"
FT                   /protein_id="ABX17228.1"
FT                   /translation="MKLKTLAAGIAAAALVHLFSVGTADAACISNPPAQSSASFPSALT
FT                   GKLVYHSYVKYGDGTSQLFLYDFSAHTLTQLSKSTWGITDPMNGVFSPDGKWLAFMGIR
FT                   NGAWNVFMLQLGAGTPPVDMTHSTGATRNEDPKFSPDGKTLVFKQNGDVKQGTLSFTSA
FT                   GPVFTSVVSLTNAPSGAEYSMPYLSPDATAVYYATGAGANMGLMKRTIATGATATFDHP
FT                   AGLQTYYPMVRADGMVFYARWKDSGGLDQIYAKSADPSSTPSALSINDCVSNNSDPAPV
FT                   NGTNYLFFSSTTAGGYQLYVGDVTTGKRWSLSPFGVNADSTKAKLGANYYGGPAAAQPT
FT                   LLSQGRPAAASASYNAQMTPDKAFDGNTTSTRWDSPEGTGVDPQWISVDLGAVKTINSV
FT                   DLYWDAGALVYQIQTSNDNVNWTTIYSTNNGVSYQHVTLPNLNGRGRYVRMLGTKRATQ
FT                   WGYSLYQMQVWGS"
FT   sig_peptide     477118..477189
FT                   /locus_tag="Bmul_3544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.548 at
FT                   residue 24"
FT   gene            complement(478619..479644)
FT                   /locus_tag="Bmul_3545"
FT   CDS_pept        complement(478619..479644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B0570 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17229"
FT                   /protein_id="ABX17229.1"
FT                   /translation="MSPDRTASLSHFAFMPLPNFTMIAFTNAIEVLRMANYLSGQPLYR
FT                   WSVISPDGGPVTASNGLTVDTGPAECAGQPDIVFVCGGVDVQRATTPAHLSALRRFARA
FT                   GIPLGSLCTGTYALAKSGLLAGYACAIHWENMSALKEEFPDTRFLKELFVIDRDRITCT
FT                   GGVAPLDMMLNLIAARVGTARVTQIAEQFIVEHVRDTSAQQRMPLVARLGSANKSLFEV
FT                   ISLMENNIEEPLSREELARLANMSQRQLQRLFREHLGMTPTHYYLTLRLRRARELLLQT
FT                   DMSIMHITMACGFQSACHFSKSYRDAFGVAPTRERRKQVAPLAQGTPPGGPALPTLAIH
FT                   A"
FT   gene            480092..481366
FT                   /locus_tag="Bmul_3546"
FT   CDS_pept        480092..481366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3546"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   bam:Bamb_4497 glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17230"
FT                   /protein_id="ABX17230.1"
FT                   /translation="MSNTQSFFSQPLAERDAPVRSAILKELERQQSQVELIASENIVSR
FT                   AVLEAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIDRVKKIFNAGYANVQPHSGAQ
FT                   ANGSVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNAVQYGVNRDTMRIDYDQV
FT                   EELAQQHKPSLIIAGFSAYPRALDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPV
FT                   EHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGE
FT                   VLQPDFKTYIDNVLANAQALGEVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQAL
FT                   ERAGITCNKNGIPFDTEKPTITSGIRLGTPAGTTRGFGVAEFREIGRLILEVFDALRAN
FT                   PEGDAATEQRVRREIFALCERFPIY"
FT   gene            481401..482372
FT                   /locus_tag="Bmul_3547"
FT   CDS_pept        481401..482372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3547"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   bvi:Bcep1808_3422 membrane dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17231"
FT                   /protein_id="ABX17231.1"
FT                   /translation="MSTLHDDSIIIDGLNISKFEKPVFEDMRKGGITAANCTVSVWENF
FT                   AKTVDNIGVMKKKIRDNSELLTLVRTTDDIFRAKKEGKTGIILGFQNAHAFEDNIGYIE
FT                   AFADMGVRVVQLCYNTQNLVGTGCYERDGGLSDFGREVITEMNRVGIMVDLSHVGANTS
FT                   SEAIAFSKKPVCYSHCLPSGLKEHPRNKSDAQLKEIADAGGFVGVTMFAPFLKRGIEAN
FT                   IDDYIEAIDYVVNLIGEDAVGIGTDFTQDYAKEFFDMLTHDKGRYRQLTNFGKVINPEG
FT                   IRTIGEFPNLTAAMERHGWKESRIRKIMGENWVRVFKDVWGA"
FT   gene            482513..483046
FT                   /locus_tag="Bmul_3548"
FT   CDS_pept        482513..483046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3548"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="PFAM: 4-vinyl reductase 4VR; KEGG: bch:Bcen2424_5083
FT                   4-vinyl reductase, 4VR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17232"
FT                   /protein_id="ABX17232.1"
FT                   /translation="MQPQLPIDVDPVTGVWTTDALPMLYVPRHFFTNNHVAVEEALGVD
FT                   AYAEILYKAGYKSAYHWCDKEAKQHGIAGMAVFEHYLKRLSQRGWGLFSIVEADPATAR
FT                   AKIELRHSSFVLQQPGKEGKLCYMFAGWFAGAMDWVNDTTPEGKGAPRAHSKEVQCAAE
FT                   HHDRCIFEVSPLAH"
FT   gene            483107..485170
FT                   /locus_tag="Bmul_3549"
FT   CDS_pept        483107..485170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3549"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG:
FT                   bvi:Bcep1808_3420 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17233"
FT                   /protein_id="ABX17233.1"
FT                   /translation="MRYPHLFKPMQLNQLTLRNRIVSTAHAEVYAEPGGLPGDRYIRYY
FT                   EEKAKGGVGLAICGGSSPVSIDSPQGWWKSVNLSNDKIIDPLTRLADAMHKHGAKIMIQ
FT                   ATHMGRRSSFHGEHWPHLMSPSGVREPVHRGNAKIIEIEEIRRIIGDFAAAAKRVQAAG
FT                   MDGIEISAAHQHLIDQFWSPRSNHRTDEWGGSLQNRLRFGIEVLTAVREAVGKDFCVGL
FT                   RMCGDEFHEDGLDHEALKEIAQAMAETGLIDYLSVVGSGGDTHNTIANCMPPMALPPEP
FT                   FVHLAAGIKSVVKIPVMHAQSIRDAGQAERLLANGMIDLVGMTRAQIADPHMVIKIRDG
FT                   REDEIKQCVGANYCIDRQYNGLDVLCIQNAATSREATMPHIIEKSRGPKRKVVVVGAGP
FT                   AGLEAARVARLRGHDVVLFEKNAEVGGQVMIAAKAPQREQMSGIIRWFDMETKRIGVDR
FT                   RLGVTADEKMIMAEKPDIVVLATGGSSFTWQVPAWGVAEGLAVSSWDILTGKVEPKQNV
FT                   LLFDGVSTHAGAGVADFMASRGSKVEVVTPDVKVADDCGGTTFPIFYRRLYALGVIQTP
FT                   NTMLDRVYEEDGKKIAVLRNEYTEELEERAVDQVVIENGSSPNDELYWKLKPESVNRGQ
FT                   IDPHTLFAAEPQPCLSEELGNGRFLLFRVGDCISMHNVHGAIYDSLRLVKDF"
FT   gene            485173..487098
FT                   /locus_tag="Bmul_3550"
FT   CDS_pept        485173..487098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3550"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG:
FT                   bch:Bcen2424_5081 protein of unknown function DUF224,
FT                   cysteine-rich region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17234"
FT                   /protein_id="ABX17234.1"
FT                   /translation="MNPAFLITALLWLSVAGLAFAVAKRSSYWRLGRATAPGAFGVANL
FT                   FAIPKRYFVDLHHVVARDPYIAKTHVATAGGAIAALALVFVNYGLAIYSPWLDKLIFLA
FT                   ALAMLVGAVFVWRRRAAKNVPARLSRGPWNTLPWLLGSFALGLVLFMLVPTGAMSGAFA
FT                   VLCALLIGVGAFAMTVGAAKGGPMKHAIAGLLHLAFHPRQERFAASRESFTGNGTATPP
FT                   TALKLPDIEHEEYGVAKPVEFRWNQLLSFDACVQCGKCEAACPAFASGQPLNPKKLIQD
FT                   LVVGMAGGTDAAYAGSPTPGLPVGQHRGEPNGPIVSALIEEQTLWSCTTCRACVQECPM
FT                   LIEHVDAIVDMRRNRTLVHGTVPGKGQEVLANLRETGTMGGYDTAARYDWSVDLNAPVA
FT                   RPGKPVDVLFVAGEGAFDMRYQRTLRAFVKVLNKAGVDYAVLGPDETDTGDVARRLGDE
FT                   ATFQQMAKRLIGTLGELSYKQIVTADPHVMHSLRNEYRALGLRVTVKHHTTYLAELADS
FT                   GKIAPKAVEALREKRTTYHDPCYLGRYNGEIEAPRKLLKTIGIQVVEMERNGMRGRCCG
FT                   GGGGAPLTDIPGKQRIPDIRIADARTVGAEVVAVACPNCTAMLEGVVGPRPDVLDVAEL
FT                   VAASLE"
FT   sig_peptide     485173..485238
FT                   /locus_tag="Bmul_3550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.953 at
FT                   residue 22"
FT   gene            487103..488272
FT                   /locus_tag="Bmul_3551"
FT   CDS_pept        487103..488272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3551"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein alpha subunit;
FT                   KEGG: bch:Bcen2424_5080 electron transfer flavoprotein,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17235"
FT                   /protein_id="ABX17235.1"
FT                   /translation="MNKIKRIDPRRPFIITAAGLKRITLGEEGSADASAAQWPAHGHAA
FT                   AAAKPRRAVQDPKHVMLVVAHAERGSLDDLSRQAIAAAALLADAQTEVALLAFGELKDD
FT                   IAELGVDKLVELAGFDRRAFAPESELQALQACVAALAPKHVFVPDNATGDGDLGRRYAA
FT                   VAGASVATNVIEIDAKHVGTYVHAKRAFATRALPDVILLAPNAVEAKLPFVGAGERLAA
FT                   DFIRPAADAAQPYRDLGLEEIDAAQVALEEADFIVSAGNGVTDIAAFERLAGAFGAAIG
FT                   ASRVAVDNGHFTRDKQVGATGKTVEASVYIAFGISGAVQHLQGIKDCRHVIAVNLDGSA
FT                   PIAKRANLTVVGDAQATIAALIEQVQAARAARGQSPTAVGAREPEGVAA"
FT   gene            488269..489054
FT                   /locus_tag="Bmul_3552"
FT   CDS_pept        488269..489054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3552"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: bam:Bamb_4491 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17236"
FT                   /protein_id="ABX17236.1"
FT                   /translation="MNAPRQLQRIAVLVSVGRHPVSGTARYSRNDAAALELGRELAERH
FT                   RAQLDVIHAGDPANPALAEYLALGARTVDVLVCDDGEDVARALAGRVDGYDLVLTGTRA
FT                   EGAFDSGMLPYRVAAALGYPLVGSAVDVSVDGGRATVRQFLPKGLRRRVDAALPAVVAV
FT                   HPLANAQPRYAYARLRAGTIRPARTVTGADAEAAAWEVGPIERKPVKLAAAEKRSGHAR
FT                   MLSATTTESRGGNVVIEGSSVEKAQVILAYLREHQLIDY"
FT   gene            489100..490341
FT                   /locus_tag="Bmul_3553"
FT   CDS_pept        489100..490341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3553"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bam:Bamb_4490 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17237"
FT                   /protein_id="ABX17237.1"
FT                   /translation="MKVSADIRALIERRKEGHSLEAPFYTSEEIFALDMEAIFRQHWIQ
FT                   VAVEPDIPEPGDYVTVELGSDSILIVRDDDMEIRAFHNVCRHRGARLCNEDKGSVGNIV
FT                   CPYHSWTYNLTGQLMFAEHMGEKFDRCKHSLKPVHVENLAGLIFICLAEEPPADFAQMR
FT                   AAMEPYLLPHDLPNTKIAAQIDIIEEGNWKLTMENNRECYHCVANHPELTISLYEYGFG
FT                   YQRSEANAEGMDAFAETCIRRGKEWAEMGLPSVEIEKLLDVTGFRTQRLPLDRSGESQT
FT                   LDAKVASKKLLGEFRQADLGGLSFWTQPNSWHHFMSDHIVTFSVIPLSAGKTLVRTKWL
FT                   VHKDAKEGIDYDVKNLTAVWNATNDQDRALVEFSQRGANSSAYEPGPYSPFTEGLVEKF
FT                   SAWYIGRLAEKTGA"
FT   gene            490371..491519
FT                   /locus_tag="Bmul_3554"
FT   CDS_pept        490371..491519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3554"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bvi:Bcep1808_3415 oxidoreductase FAD-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17238"
FT                   /protein_id="ABX17238.1"
FT                   /translation="MMRDAANFEPTDSRVTRPAFWNALAERWTSDVEETLVCCHVRQET
FT                   HDVKSFFFRSPQGRTFSFEPGQFITLELDIDGETINRCYTISSSPTRPHTISITVKRVP
FT                   GGKVSNWLHDNLQPGASVRVLGPAGEFTCARHPARKYLFLSAGSGVTPLMSMSRAHHDL
FT                   AEDRDIVFVHSARTPDDIIFARELDLIASNHTNFRTSFVVERVGTRTNWPGVTGFLTLP
FT                   LLKLIAPDFMEREIFTCGPAPYMKAVRDLLDEAGFDRERYHEESFSFETLAQTASDELL
FT                   AELAPVADEAEVATKQFTVSFAKSNREVSCGADQHVLDAARRSGVRLPASCTQGMCGTC
FT                   KVKLVSGQVDMKHNGGIRQREIDQGMVLLCCSKPLSDLVIDK"
FT   gene            491697..492689
FT                   /locus_tag="Bmul_3555"
FT   CDS_pept        491697..492689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3555"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17239"
FT                   /protein_id="ABX17239.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   gene            492865..493728
FT                   /locus_tag="Bmul_3556"
FT   CDS_pept        492865..493728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3556"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bam:Bamb_4488
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17240"
FT                   /protein_id="ABX17240.1"
FT                   /translation="MKLLGKLLWTGALSAMVALSASALADTKPTLKIGYVEGWDDSVAT
FT                   SNVAARVIEKKLGYQVQLVPVAAGIMWQGVARGDLDATLSAWLPVTHGSYWSEYKSKVV
FT                   DVGANFPDAKIGLIVPDYVKAKSIEDLNAEKSSFGGRIVGIDAGAGVMRKTDEAIKNYG
FT                   LSYTLMPSSGSAMTAELSRSVSANKPVIVTGWAPHWMFAKWKLRFLEDPKKVFGGAEHV
FT                   DSVVNPQLETKAKPVVAFLKKFQWKPGEIDSVMLAIQNGAKPEAAADAWIAAHADRVNA
FT                   WTEGAQ"
FT   sig_peptide     492865..492942
FT                   /locus_tag="Bmul_3556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            493907..495562
FT                   /locus_tag="Bmul_3557"
FT   CDS_pept        493907..495562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3557"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0581 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17241"
FT                   /protein_id="ABX17241.1"
FT                   /translation="MSQAGLRASRTSDVEATISHDSTGHTLHRGLTWKDAFWVTSGVPA
FT                   GVLFTIGGVCATIGQPAWAIWIAAITMGLIQSATYAEISGLFPHKSGGASVYGAIGWVR
FT                   YSKLIAPVSVWCNWLAWSPMLALGCGLAASYALTSLFPADAAVLHWQFKVADLGFIKPG
FT                   LSLRINATFIIATILLLITFKLQHSGASKAARTQRILGIASLTPLLIVGIVPFVTGDVP
FT                   MSNLLPLLPLGHDAHGNLTAATFGTWNGQGVVMALGAMFMAGWASYGFETAVCYTREFR
FT                   DPRRDTAKAIFWSGALCLVVMTLVPMAFQGALGTQAMLDPAIGDGTGVAAAMARIVGGG
FT                   AWVANAVVVMLMLSILLIVMTSMMGSSRTLYQASVDGWLPKFLSHVNEHGAPTRAMWTD
FT                   LGFNLVLLMMSDYMTVLSISNVCYMLFVFLNLQSGWIHRMDRGSWDRPFRCPTWLLVAG
FT                   SICGYANLVYVGAGANLQGEGTLRNGLIAMLLIVPVFVYRHYWQDRGRFPAQMQRDMEL
FT                   EVPKRSVWLNLAPYAALVGAALTIGLSYYFAWVK"
FT   gene            complement(495671..496735)
FT                   /locus_tag="Bmul_3558"
FT   CDS_pept        complement(495671..496735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3558"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; KEGG: atc:AGR_L_273
FT                   fructose transport system repressor FruR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17242"
FT                   /protein_id="ABX17242.1"
FT                   /translation="MARHTTGRKSTIYDIAKTTGASTSTVSMVLNGTWARYRIKEETAN
FT                   RILACAEALGYNVNLSARGLRLSRSGLAGMIIPHYRNRFFAGLAETFEDEARRRGLCPI
FT                   VVGTQRDPAVESSVTQTLLAQRVEWLFVAGVRDPAPLNALCDKAGVPSINLDLPGPGAP
FT                   SIVSDNRGGARALADRLIDKMLARGESPAELILLGGFAGEYATEMRIAGFRDAFEARRL
FT                   TPPAADAIECCGYSPDAARQALARRYAALGRLPAGMLMNSITAFEGLVRFASGLPWDIW
FT                   QRTAVGCFDWDPFAARLPFDVTMLRQDVQKMIAEAFALLDAPDTTPHPTVMVPTRFMDT
FT                   LDDDTTAPDDARAD"
FT   gene            496943..497935
FT                   /locus_tag="Bmul_3559"
FT   CDS_pept        496943..497935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3559"
FT                   /product="putative substrate binding component of ABC
FT                   transporter"
FT                   /note="KEGG: rle:pRL120191 putative substrate binding
FT                   component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17243"
FT                   /protein_id="ABX17243.1"
FT                   /translation="MSGNFVRALCAGLTAFVLSMGSAVASPDKPVIGVVVKIGGIPWFN
FT                   AMDAGIRKRAEQLGVKAFMVGPTSADPALQVRAIEDLIAQRVDVIGVVPNDAKVLEPVL
FT                   QRARAAGIKVVTHESPNQQNVDWNFELASAKGFGEAYAKSLASAVGGKGEYAVFVGSLT
FT                   VPLHNAWADAAIAYLKANAPDMKLVGDRYGVAEDVDASRKTALDLMRAHPNLKAILAFG
FT                   SQGPIGAARAVAERQAKGKVVVLGPFSPGQGRRLVHEGVLTGGYMWNPEQAGEVFVTLG
FT                   TMLAKGQPVKDGATIPGLGVVHPEGHNLIVNQLVELNEKTVDTLAKQGL"
FT   sig_peptide     496943..497020
FT                   /locus_tag="Bmul_3559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            497988..499550
FT                   /locus_tag="Bmul_3560"
FT   CDS_pept        497988..499550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3560"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMb20485 putative sugar ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17244"
FT                   /protein_id="ABX17244.1"
FT                   /translation="MMSVHSGGRAAVARSMSPPAADAAHAPALLELERVSKVFGGVHAL
FT                   QNVRFDVQPGEVLCLAGENGCGKSTLIKIVNGVYRPEPGASIRFDGQPVAELNPARARE
FT                   LGIQVIWQDLALFTEMTVAENIAFEQNLGARPRLVDYRRMKAAARQILARLGVTLDLDR
FT                   PVRRLSIAQRQVVAIARALVADARLVFMDEPTASLSHAETEALLAIVRRLSADGIAVVF
FT                   VSHRLAEVLDVCSRVTVMRDGRYVGTFPTAGMTQMWLAELMTGRTFDYAVRTTDLSAAP
FT                   IVLRVDGLSRRGEYDGVSLTVRRGEILGITGRLGAGRTELALSLFGMSRPHAGTIELDG
FT                   QRLTCRSNRDAIRAGIAYVSEDRLQLGLVQPQSIGDNTVITVLDELLGAARLISPRRRD
FT                   ALIRDWIDRLAIKIGRPDDAVSTLSGGNQQRVVLAKWLATRPKLLILDAPTVGVDVGAR
FT                   AGIFAIIRELAAAGMAIILISDEIPEVYFNADRILHMRGGRIVADYVPGRTSIGEIERD
FT                   VHA"
FT   gene            499543..500556
FT                   /locus_tag="Bmul_3561"
FT   CDS_pept        499543..500556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3561"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rle:pRL120193 putative permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17245"
FT                   /protein_id="ABX17245.1"
FT                   /translation="MRNLHTLGIGSIEALLLAVIAAMAIGLGLSTSTFLTLPNLFDLLN
FT                   QSSVNLIFAVGLLVVLVAGGIDISFAVGASVVQYLTALAMLRLGGGNWALGVAAAAGFG
FT                   FLLGAVNATIIYRFRVVSIVATIATFNVFFGGLMFATGGVSIYDLPDWWMNRISLLHVD
FT                   TPSGAADLALPVAAMLVAVGATWFLLQRTTLGRQLYAAGDNAEAARRVGISLGTMHYVA
FT                   YGWLGMMAGIAGLMQAHYVQEVVPNALYGRELDVLAAVVLGGARLGGGRGTVLGAILGI
FT                   VLVSIAANGLNLLGVSPYAFKMIVGAVILIAITLSSDRVARLIGSRFPSSTARAPS"
FT   sig_peptide     499543..499650
FT                   /locus_tag="Bmul_3561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.219 at
FT                   residue 36"
FT   gene            500553..501605
FT                   /locus_tag="Bmul_3562"
FT   CDS_pept        500553..501605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3562"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sme:SMb20487 putative sugar ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17246"
FT                   /protein_id="ABX17246.1"
FT                   /translation="MTTRFHRPAAALPIPADVAGLLGFLVFVVAAMSVASDRFLTAGTF
FT                   VSIAFQLPELGLFTLAMLMPLISGGFNLAVTFTANIAGLAMAWVIQSHGGVDAGIGTIA
FT                   FGMLAALATGAAAGWLIGAVIAHTGASPILVSLSAMIFLRGLGEFLTRGGDISGFPPLV
FT                   RAMGNGLWLGVPVPLWIFAVCALGWHVLMTYSRLGFVTRMIGSNVEATRYSGIATARAI
FT                   TRVYMLSGLMCGVAGIVMLSRFNSVRVGHGEAFLLISVLACFLGRVDPFGGFGRVVPVV
FT                   IALVILQVIASGLNLLGASQHLATALWGAFLLAVMLIRWAWAYGVDASVRRLRAGFRAR
FT                   RPGTPSTKGE"
FT   sig_peptide     500553..500660
FT                   /locus_tag="Bmul_3562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.346 at
FT                   residue 36"
FT   gene            501606..502499
FT                   /locus_tag="Bmul_3563"
FT   CDS_pept        501606..502499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3563"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mlo:mll3595 similar to D-tagatose 3-epimerase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17247"
FT                   /protein_id="ABX17247.1"
FT                   /translation="MNKLGVHALVWEAGWSRDECARAIARTAETGFDFIEVPALDPASI
FT                   DAEFTRRELERHGLGVTFSLGLDAQTDISSGDPARAARGKAKLDDVLRVARDCGATHVC
FT                   GILYSAFQKNAVPTTRAGVAMAADILGQVADTAAQYGITLGLEVVNRYESNVLNTASQG
FT                   VELCERIGRPNVKVHLDTYHMNIEESDIMSAIRDTGDRLGYFHIGDSHRGYLGSGNVDF
FT                   TAVFRALVFSCYTGPITFESFSSRVVGQPLEGILAIWRNLWEDSSDLASHALAYTRVQL
FT                   KSAQEALKQAERSRLP"
FT   gene            502496..503149
FT                   /locus_tag="Bmul_3564"
FT   CDS_pept        502496..503149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17248"
FT                   /protein_id="ABX17248.1"
FT                   /translation="MSDAIAAAQPVAFAALVDHLHRTQRATRRVVAIAGPPGAGKSTFA
FT                   ERLRAELDARVPNSAAVVAMDGFHFDDRVLNARGERARKGAPHTFDVDGLAALLGRLRA
FT                   DDGRDIAVPVFDRDLEIARAGAAIVPASTRLVLVEGNYLLLETPPWCALRSLFDVTIML
FT                   DLPRAVLAERLTRRWQRYGMDADAVREKLDGNDLVNVDTVLSHSAPADFRVRNG"
FT   gene            complement(503207..504091)
FT                   /locus_tag="Bmul_3565"
FT   CDS_pept        complement(503207..504091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3565"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: bam:Bamb_4486 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17249"
FT                   /protein_id="ABX17249.1"
FT                   /translation="MTADSRPDQFVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDD
FT                   DLSNHFFVRCVFHPTDETLQIDALRQEFGPIAASLAGGAGDTQWAIHDVNARPKVLIMV
FT                   SKLEHCLADLLFRWRMGELKMDIVGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEA
FT                   QWLDFFETSGAELVILARYMQVLSQETSAKLANRAINIHHSFLPGFKGAKPYHQAHARG
FT                   VKLIGATAHFVTDDLDEGPIIEQVVERVDHALRPEQLLAVGRDVECITLARAVKAFIER
FT                   RVFLNGDRTVVFS"
FT   gene            504733..505641
FT                   /locus_tag="Bmul_3566"
FT   CDS_pept        504733..505641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3566"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sth:STH2664 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17250"
FT                   /protein_id="ABX17250.1"
FT                   /translation="MNEKALRGPERGTIVVDVVGVTRIYRTRRHEGPLWRQLLRPTFDT
FT                   YTALDDVNLQIRAGECLGLVGPNGAGKSTMIKLLTGLLKPSSGRISVLGHEPGRLSSQF
FT                   LTQIAAVFGHKTSLWWDLPVRHSFDAIRRIYQVPVDAFREDVALFADMLHIDKLMDRTV
FT                   RQLSLGERIKCEVVLALAHRPRVLLLDEPTIGVDMESKQQLRTLINRVVEERHVATLLT
FT                   THDVTDLTACCTHIAFIQGGNVFQIETMDELLRQFGVSRDNGGLLESRLIETFRARGMS
FT                   PDEGRTLCNTAPVDSMGDEDV"
FT   gene            505634..506440
FT                   /locus_tag="Bmul_3567"
FT   CDS_pept        505634..506440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3567"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   gtn:GTNG_0485 daunorubicin resistance transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17251"
FT                   /protein_id="ABX17251.1"
FT                   /translation="MFDRLRPFAVNGLRVLLVDRGVLFVDFFIATGVAFLIQFFVWTAV
FT                   YGAHEELHGFTLEKLLYYCAFTIYLSRLNNCYDLVQEISDEIIEGRIETQLARPVGYIA
FT                   QKFAAYLGGGALYAIPVLILCVVYWVNNTERLPQSFGELVCYGLLIVGFLVAGTVLSFC
FT                   IGTVLGILTFWFMQSDFVLACLTTITAFLGGAIIPPSYWPVFIRPLMAFNPFQYYIAAP
FT                   ATLIIGGDLRAGAAELCVAMLYILMFVLVIRTMWRHAVNTYTGGGG"
FT   gene            506442..507200
FT                   /locus_tag="Bmul_3568"
FT   CDS_pept        506442..507200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17252"
FT                   /protein_id="ABX17252.1"
FT                   /translation="MLVLVQKAFAKQIHYLGNYVSYIAIQAVTQLLTLFYLHSVFTYTE
FT                   TLNGWTREQAIFVFYLATMVTLTAECFICSIHQYYQRLVRGLLDPVLVMPVRRRALQLL
FT                   RWSEPGFLVPVVALLCCWPLIDPQPQRSLEAWIAGLAILMVGVLSIIVVFAMISLTALV
FT                   TQRLAPADFMVSELSRMVFLPPSVMPRGAWQIALGIGLPLLFSANAAGAILIADDYRVA
FT                   VVLTVGTSVLAVLHYVVESHMMRSFSLPGA"
FT   gene            complement(507345..508277)
FT                   /locus_tag="Bmul_3569"
FT   CDS_pept        complement(507345..508277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3569"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0586
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17253"
FT                   /protein_id="ABX17253.1"
FT                   /translation="MSKPEPLPSMQALRAFESAARLASFTAAARELGSTQPAVSQQVFQ
FT                   LEAELGVPLFERSPRGVTLTADGECLYEAVRLSLDTLRGATATLRARREHGTLTIVTDF
FT                   GFATYWLMPRLAGLKRVMPDVDVRVVTSQDYDAQRDHADIAILFGDGHWPSCTAARLFA
FT                   ESVTPVCSPAFRDAHPHVSRPEHLAALPLLHVQPTRPERWLSWAGWFDAHGLDAQAAAR
FT                   GVTFNSYALVIHAALLGEGVALGWSPLVDELVAAGQLVKLVDAPVVTSRGYFLVRPPQR
FT                   PEPDATHVFRRWLLDACACAGAGGGQASG"
FT   gene            508506..510041
FT                   /locus_tag="Bmul_3570"
FT   CDS_pept        508506..510041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3570"
FT                   /product="choline-sulfatase"
FT                   /note="TIGRFAM: choline-sulfatase; PFAM: sulfatase; KEGG:
FT                   bam:Bamb_4484 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17254"
FT                   /protein_id="ABX17254.1"
FT                   /translation="MTNPTPNILILMADQLTPFALPAYGNRVARTPTLDRLAAQGVVFD
FT                   AAYCASPLCAPSRFSLLTGKLPSGIGAYDNAAELPAQTLTFAHYLRAAGYRTMLSGKMH
FT                   FCGPDQLHGFEERLTTDIYPADFGWVPDWDRPTERPSWYHNMSSVLDAGPCVRTNQLDF
FT                   DDEVTFAAKQKLYDVARERAAGRDERPFCMVVSLTHPHDPYAITREYWDLYSDDEIDMP
FT                   AVQLGASDSDPHSQRLRFVCENDRTPPSDAQIRAARRAYYGATSYVDAQFGSVLAALEQ
FT                   CGFADDTIVIVTSDHGDMLGERGLWYKMTFFEGGCRVPLIVHAPQRFDAARVRGPVSHL
FT                   DLLPTLVELASATPEGGWPDAVDGASLVPHLRGTAAHDVALGEYLAEGAIAPIVMIRRG
FT                   DWKYVHCPADPEQLYNLSDDPRELTNLAGAPEAADVLAAFRAEAARRWNLPELDRQVRA
FT                   SQRRRRFHYAATTQGRIQPWDWQPFTDASQRYMRNHIELDTLEAMARFPRVGH"
FT   gene            510087..511049
FT                   /locus_tag="Bmul_3571"
FT   CDS_pept        510087..511049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3571"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bur:Bcep18194_B0588
FT                   ABC proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17255"
FT                   /protein_id="ABX17255.1"
FT                   /translation="MKRQRQCNAAIRIGAALAAAASMTAAHAAEPQTCRDVRMAAPGWT
FT                   DIDATNAMAGVVLKALGYRQDVANLSVPITYQGLKKGQVDVFLGNWMPAQAPLVKPFVD
FT                   EKSIDVLHANLSGAKFTLAVPDYVAAAGVHTFADLARYADRFGDKIYGIEPGAPANQNI
FT                   KRMLSDHALGSANWSLVESSETGMLTQVERAVRDKRWIVFLAWEPHLMNTKFKLTYLSG
FT                   GDAYFGPNYGGATVNTVARAGFADQCTNLARLFRQMTFSVDVENRMIADMLEKKTSPAL
FT                   AAQHALKADPSLVAGWLDGVTTATGAPGLPAVRAALDGH"
FT   sig_peptide     510087..510173
FT                   /locus_tag="Bmul_3571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            511314..512453
FT                   /locus_tag="Bmul_3572"
FT   CDS_pept        511314..512453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3572"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bvi:Bcep1808_3408 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17256"
FT                   /protein_id="ABX17256.1"
FT                   /translation="MKQSKVAVAVALACAACVPAIGHAQSSVTLYGIIDAGVTYVNNTG
FT                   GSHVFKFDDGVAYGNRFGLKGTEDLGGGLKAVFALESGFHLGNGQLGFGGAEFGRQAYV
FT                   GLQNNWGTLSFGNQLDITNELVSIYNISAWGSGYAIHQGDFDRFNGDRLPNSVKFLSND
FT                   LSGFKFGAMYSFGNVAGNFHRNSAWSAGASFTKGDFSIGAAYTRLNNPNGIYAFDPYAM
FT                   IGTHTFLGQQTVTVDPATGQRTDLFANTAMNVDSQGTFGVGASYTIGKLTLDANYSYTT
FT                   IKGFGQSSHMQVYEGGGLYQFTPALSFIAGYQHTRFEGHHWNQGTAGLHYLLSKRTDVY
FT                   ISGDYLRASQGVDAVIGYSFTPSTTQTQADVRIGMRHSF"
FT   sig_peptide     511314..511388
FT                   /locus_tag="Bmul_3572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.854 at
FT                   residue 25"
FT   gene            512655..513905
FT                   /locus_tag="Bmul_3573"
FT   CDS_pept        512655..513905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3573"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5069
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17257"
FT                   /protein_id="ABX17257.1"
FT                   /translation="MTAPLPDARTASELPANLFRHAPFRRFWGTRVMSSLAFQILSVAI
FT                   GWYVYALTHSAFALGLVGLAQFVPMFALTLVVGQVADRFDRRRIATICQSVEALASGVF
FT                   LLGAAQGWLAAPGVYALAAIVGTARAFESPSVSSLLPAVVPRAELPRATALSTSANQAA
FT                   QILGPAFGGLLYGLGAPVAFGTSVAAFAIAALLSGTIPLRSAPPAREPVTLRSVFSGIA
FT                   FIRREPAILGALSLDLFAVLFGGATALLPIYARDILQVGPWGLGALRAAPAVGALAGTL
FT                   WLTRFPLKARPGRAMFGGVIAFGIATIVFGLSRHVALSLVALAALGASDVISVVVRLSL
FT                   VQLRTPDDMLGRVSAVNALFIGTSNQLGEFESGVTAAWWGAPAAIVVGGAATIAVALAW
FT                   MRLFPTLRNMTSLERDR"
FT   gene            514476..516680
FT                   /locus_tag="Bmul_3574"
FT   CDS_pept        514476..516680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3574"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bam:Bamb_4480 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17258"
FT                   /protein_id="ABX17258.1"
FT                   /translation="MPNRTPFASALALAFALPIASPAVAQSARVDASPAAAAPGDSAPA
FT                   ASSAVRDALPTISVSGQAVQQDFQAERSTVGAKTPTALRDIPQSVTVINKALIESQGLT
FT                   SFQDALRNAPGITIGGAEGGQIGNNINLRGFTAQNDIYLDGFRDRNQYYRDTFDLDAVE
FT                   VLYGPSSMLFGRGSTGGVINQVSKKANLKPSAEVSTTIGTDDRYRTSVDLNRPLGATSA
FT                   LRINAFGQSLGSTRDVMKNKDYGIAPELRFGIGTPTEITLSALIQHNYDMPDYGVLAVN
FT                   GHPAPVSKHTFYGLTDDRTIQDVQTVSARIDHRVNDALTISNRTSFSHSMTDARETAAN
FT                   AVLTGPLSSSTALTNGNYTSLPMSALYVRLASHDRVIENHSIDNDTMAHFKFDTGFVKH
FT                   DLIAGVEVGHDSYTNQAYTRSGLPILSLIDPAYLSSSAANATQTPANHAESGATTLAAY
FT                   LNDTVSIGRDWKLVGGLRWDRFRAHLANTISAPGYASQTNNFTSVRAGVIYQPTESQSY
FT                   YFSYGTSFNPSLETLTVTNNTQNLSPEHTKSYEVGGKWDLLNDNLSVTSALFQQEKSNA
FT                   RTQTSTGEYLLEGDIRVRGFQASVTGHITPKWQVFGSYTYMNGTILSARDGTQGKTLAN
FT                   TPRNTFTLWTTYAFTPHWEIGGGPTYMSGRYAANTNYVQVGGYTRWDATAAYHAKRWDL
FT                   RLNVLNLTDKFYYDALIQSDGGRAVPGIGRTFLATLDYRF"
FT   sig_peptide     514476..514553
FT                   /locus_tag="Bmul_3574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 26"
FT   gene            516726..517409
FT                   /locus_tag="Bmul_3575"
FT   CDS_pept        516726..517409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3575"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: bam:Bamb_4479 2OG-Fe(II)
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17259"
FT                   /protein_id="ABX17259.1"
FT                   /translation="MLVHIPNVLTPEQVRMIRDRLDQAGDAWVDGRATAGYTGAPVKRN
FT                   QQIAEHSPIARELGDVILAAIERHPLFISAALPNQVYPPLFNRYEGGMTFGSHVDGAVR
FT                   VLPNGVKLRTDVSVTLFLSAPDEYDGGELVIEDAYGVQQVKLPAGDMIVYPATSLHQVT
FT                   PVTRGVRVASFFWVQSLVRSDAQRALLFDMDTAIQRLNAGGADPQACRSLVGCYHNLLR
FT                   IWSEM"
FT   gene            517406..518107
FT                   /locus_tag="Bmul_3576"
FT   CDS_pept        517406..518107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3576"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bam:Bamb_4478 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17260"
FT                   /protein_id="ABX17260.1"
FT                   /translation="MSVIDSVEIAATPVSRTAPGARTGSARSRRGTFLQWLRKIHGWVG
FT                   LWGAALGLLFGTTGFLLNHRAPPLRIQTGAPRVDTLRLAVPVPAPASPRELAKWLHAQP
FT                   DLHLPARMGRVQQEPAHPVAWGDRETVQPEHWQLVFASPRENVAVDYWVGSDAITLKRT
FT                   GNGTLAWLTNLHKGVGMSIGWVLLVDTLAGALILLSLTGVLLWTGLNKRKTVGALLVIG
FT                   SIVAIVCTASV"
FT   gene            complement(518141..518509)
FT                   /locus_tag="Bmul_3577"
FT   CDS_pept        complement(518141..518509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3577"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   bvi:Bcep1808_3406 protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17261"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AN40"
FT                   /protein_id="ABX17261.1"
FT                   /translation="MTDAPRSPDALSPDRVTTAFDLPGHTTVRALGVAQGIVVRSRSIV
FT                   GTFGASLQTLFGGNITLYTSLCEKARQHAFDKMLDDARRLGANAVVAMRYDSTEIGSGV
FT                   TEVICYGTAVQVAPDAGR"
FT   gene            complement(518616..519560)
FT                   /locus_tag="Bmul_3578"
FT   CDS_pept        complement(518616..519560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3578"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bch:Bcen2424_5064 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17262"
FT                   /protein_id="ABX17262.1"
FT                   /translation="MPEDFHFLLLPGFSALGFMSAVEPLRVANRFRTELYRWHVLSIDG
FT                   APVRASNGIPVAAEAACADVERVDTVFVVAGFEPLACYTRALGDWLRQQHRHGATLGGI
FT                   DTGSFVLAEAGLFDASQPLTVHWEALAAFRERYPRLKATQELFEIDARRITCAGGTASI
FT                   DMMLDLIGRRHGAELAAVISEQFVVSRIRQRSDSQRLEIAARYGVHNRKLIQVIGTMQR
FT                   HMENPLGSDALAQEVSITRRQLERLFSATLNDTPTRFYQNLRLDRARELLQQTDMSITS
FT                   VCVACGFESPSHFSRAYRARFGMSPRNDRCATR"
FT   gene            complement(519643..520602)
FT                   /locus_tag="Bmul_3579"
FT   CDS_pept        complement(519643..520602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3579"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_4473 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17263"
FT                   /protein_id="ABX17263.1"
FT                   /translation="MVFHQTFDDADRHAEALRGWNQRYDQIGSGAYRSAVKHLALAGLE
FT                   LFQETANVRITQRGWLPAGHTVFGMPLTGAGAFAFGGARIERGTIVLARGGAPFELHSP
FT                   DDMSLIGVLVDAALMAQIEDAAELRIDERTLRRGVIDLPMAARMRAGVQLATLLERALA
FT                   APEALRDARVQCELRGEVGNVLVDLLTYWMPDASSGLTQACRADIVRRVHDYVIAHPEA
FT                   PVDILSLCAHLRVSRRTMQNSFQSVVQTSPLNYVRSLRLAQVRRMLLDTRQSDLSIADA
FT                   AAHWGFIHLGHFANAYKAQFGELPSTTQRRSARGAKSH"
FT   gene            520848..522005
FT                   /locus_tag="Bmul_3580"
FT   CDS_pept        520848..522005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3580"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="PFAM: methylamine dehydrogenase heavy subunit; KEGG:
FT                   bur:Bcep18194_B0601 amine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17264"
FT                   /protein_id="ABX17264.1"
FT                   /translation="MRTTRRAAALAATLALAATSAGGAHAAEKPEELVVQKMPPWHPHE
FT                   IYIVDISMPSMTDGRIYVYDADAKKLLGQIDAGFAPGLAISPDHKTSYVATTYFSRGSH
FT                   GARTDVVELTDNTTLDHAGEIAIPAKHAQHVPSPYNTAFSADGKRLYVANITPAASVTV
FT                   IDAVSKKVLSEIDTAACVLAYPSANDRFTALCESGKALTITLDANGHEAKRTMSDAFID
FT                   VDRDPAFVNASLYRGGYLFTTFGGNVRRADFAGDQPSFGRPWSLLSDADRAQGWRPGGM
FT                   QQTAVHARLDRYYVLMHQGDAHSHKDPGTQVWVYDLKTKQRIARWDLAQQKVEPLVSIQ
FT                   VSDDDAPLLYGLTATSDLVVMDARSGKLQHVEKQIGNTSTLLVNP"
FT   sig_peptide     520848..520928
FT                   /locus_tag="Bmul_3580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            522013..522594
FT                   /locus_tag="Bmul_3581"
FT   CDS_pept        522013..522594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3581"
FT                   /product="methylamine utilisation MauE"
FT                   /note="PFAM: methylamine utilisation MauE; KEGG:
FT                   bch:Bcen2424_5061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17265"
FT                   /protein_id="ABX17265.1"
FT                   /translation="MTIDPVLATSAQAGAAAVVLLGAVAKLRAPVAFRDALAGYRLLPD
FT                   ALVAPAALAIPLAEALGAAALLFPDTRTAAAIGLIALLLAFAAALAANILRGRTDIDCG
FT                   CTGFAGVRAAPGDAASGDGTPRRIGWLHVARVLLLVALVATALLAPDTRAVVWFDYLTL
FT                   FFSVPLIVCALLTVDVLLANVPRLTAMRNS"
FT   gene            522591..523226
FT                   /locus_tag="Bmul_3582"
FT   CDS_pept        522591..523226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3582"
FT                   /product="methylamine dehydrogenase accessory protein MauD"
FT                   /note="TIGRFAM: methylamine dehydrogenase accessory protein
FT                   MauD; PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bam:Bamb_4470 methylamine dehydrogenase accessory protein
FT                   MauD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17266"
FT                   /protein_id="ABX17266.1"
FT                   /translation="MMQTALAVSTALLWVTVVALGAICLALVRQIGILYERIMPAGALM
FT                   IDKGPAVGAIAPTFELTDIRGTRVKVGGIDTAGRSTLLFFLSPTCPVCKKLLPLLPSLQ
FT                   ASETTPVDIVLASDGDRDEHARFAQKHDLARFPYVLSQELGLAYQIGKLPYAVLLDETG
FT                   TVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDRDRHGHEEHAQHA"
FT   sig_peptide     522591..522656
FT                   /locus_tag="Bmul_3582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.596 at
FT                   residue 22"
FT   gene            523266..523811
FT                   /locus_tag="Bmul_3583"
FT   CDS_pept        523266..523811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3583"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="PFAM: methylamine dehydrogenase light chain domain
FT                   protein; KEGG: bam:Bamb_4469 amine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17267"
FT                   /protein_id="ABX17267.1"
FT                   /translation="MGLFDSWFERSARGVAQHSSRRSAMAKLGKVLVGSAMLPLLPVDR
FT                   TAYAADAASGASSAGGAAASGASDDPTSCDYWKYCAIDGWLCSCCGGTSSSCPPGTTPS
FT                   PITWIGTCRNPHDGSDYIVSYNDCCGKTSCGKCFCNRNEREKPLYKLSLNNDINWCMAN
FT                   GNANYHCSVSVLLGAAKQ"
FT   gene            523808..524308
FT                   /locus_tag="Bmul_3584"
FT   CDS_pept        523808..524308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3584"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG:
FT                   bur:Bcep18194_B0605 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17268"
FT                   /protein_id="ABX17268.1"
FT                   /translation="MKAIDAIKWGAACMAAAAAFAWPGAAGAQQTVHYPAGKSLFDAQC
FT                   AVCHQAGGKGQDGLAPPLTDYPGKYATVEQGRAQLVATLLHGMFGEIAVRDKHYNFKMP
FT                   SFASASDDDIAHVLNYIVFDLGAQHGDAKPFTAAEIRAGRAKEMDGAAVHAQRAAVTKG
FT                   LGL"
FT   sig_peptide     523808..523894
FT                   /locus_tag="Bmul_3584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 29"
FT   gene            524476..524817
FT                   /locus_tag="Bmul_3585"
FT   CDS_pept        524476..524817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3585"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: bch:Bcen2424_5057 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17269"
FT                   /protein_id="ABX17269.1"
FT                   /translation="MGCHTATGGGIPGKVPPLANSLGYFTHVPAGREYVMRVPGASNSA
FT                   LSDQELADVLNWVLTTLNRDALPRDFKPYTADEVAAHRRPALSDVATVRAGLVRALHER
FT                   GIDGVADRY"
FT   gene            524855..526360
FT                   /locus_tag="Bmul_3586"
FT   CDS_pept        524855..526360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3586"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0607 aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17270"
FT                   /protein_id="ABX17270.1"
FT                   /translation="METNDNFALLDATRAFLAKPKRMLIGGEWSDAASGRTIEVVNPAD
FT                   GSTIACVPEADEHDVQRAVAAARRAFDTGPWRAAKTTDRERLLLTLADLIDANARELAE
FT                   IESLDNGKSVSVAQGLDVAMAAQCFRYMAGWATKIEGSVVDAGMPYLPGSETFTYTRKE
FT                   PIGVVGAIIPWNFPLLMAAWKLAPALATGCTVVLKPAEDTPLTALRLGELIGDAGFPDG
FT                   VVNIVTGYGHTAGAALSRDPRIDKIAFTGSTQTGKAIGHAALDNMTRMSLELGGKSPVI
FT                   VLPDVDVDKAAEGIANAIFFNQGQVCTAGSRAYVHTKVFDRVMERVAQIAAGLKIGPGM
FT                   DPATQIGPLVSAKQRARVCDYIASGFEDGARAIAGGRARDGAGFFVEPTVLVDTTHAMR
FT                   VVREEIFGPVLVAMPFDDIDTAVQLANDTPYGLGASIWSNDLSAVHKLVPRIAAGTVWV
FT                   NCHSLLDNAMPFGGMKQSGFGRELGRAVIDQYTETKSVMMNYA"
FT   gene            526478..527695
FT                   /locus_tag="Bmul_3587"
FT   CDS_pept        526478..527695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3587"
FT                   /product="outer membrane porin OpcP"
FT                   /note="KEGG: bte:BTH_II1532 outer membrane porin OpcP"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17271"
FT                   /protein_id="ABX17271.1"
FT                   /translation="MNSLTTPRRIAAAVAALAVAQGVQASSSVTLYGDVDAGITYTNDQ
FT                   QTTSADGSVRGGRAVQIGGGNLAPSRVGLTGSEDIGGGTSVTFKLENSFWTGSGSLLQA
FT                   GTLFNQNAWVGLTNERYGTLTVGRQFDAYTTTLAPYASSIPWATLYGSHIGDVDNLNAA
FT                   LNLNSAIQYASPTFAGFSFSGTFSFGGVAGDFSRQRGWALAASYNRAPFSFGVGVLDLN
FT                   RPLDAALGGASGYIGDFACSNPAAMYCTLQNARSLTAIGAGGAYTIGPLTLGLVYTHTT
FT                   LDDSRYFADAAHPHGADARFDIVEVNAAFAVSPALTLGAAYIYNAMKTDASGSPTFHQV
FT                   NLGATYNLSKRTALYAVGFFQQAAGHGIGRDPATGAPANYAQIPNLPNANGNRQLALTM
FT                   GVRHNF"
FT   sig_peptide     526478..526555
FT                   /locus_tag="Bmul_3587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            527999..528952
FT                   /locus_tag="Bmul_3588"
FT   CDS_pept        527999..528952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3588"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bur:Bcep18194_B0611
FT                   ABC proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17272"
FT                   /protein_id="ABX17272.1"
FT                   /translation="MKSTKIAALAAAMLTTGAFMQAAHADADAASCRNVRFADIGWTDI
FT                   TSTTALASTVFEALGYKPTTTISSVPISFAGLKSKQLDVSLGYWWPVQQKQLQPFLDSK
FT                   SINVIEPPNLSGAKATLAVPSYEYQAGLKTFDDIAKHRAELDGKIYGIEPGSSANATIQ
FT                   KMIDTNQYGLGGFKLVESSEAGMLVTVERAIREKKWVVFLGWEPHPMNIQISMNYLSGG
FT                   DAAFGPNYGEARVYTLTAPDFLTRCPNAGKLVTNLRFTTQLENQLMQAVMNKTKPADAA
FT                   KAYLKKNPQVLDPWLAGVKTFDGKDGLPAVKAYLGL"
FT   sig_peptide     527999..528076
FT                   /locus_tag="Bmul_3588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            529026..529955
FT                   /locus_tag="Bmul_3589"
FT   CDS_pept        529026..529955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3589"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bch:Bcen2424_5051 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17273"
FT                   /protein_id="ABX17273.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVGKHPAIPVTPKEIAAAAIEAAKAGATV
FT                   AHCHVRDPQTGRGSRDPNLYREVVDRIRSADVDVIINLTAGMGGDLEIGPGEDPMRFGK
FT                   GTDLVGGLTRLVHVEELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGAKRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDDPPLFQLCLGIPWGAPADTGTMKAMVDNLPPGAHWA
FT                   GFGIGRMQMPMVAQAMLLGGHVRVGLEDNLWLDRGVHASNGTLVERAREIVERLGGRVL
FT                   TPAEGRRKLGLPPRGERPLERRAIAEFA"
FT   gene            530041..531006
FT                   /locus_tag="Bmul_3590"
FT   CDS_pept        530041..531006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3590"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bch:Bcen2424_5050 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17274"
FT                   /protein_id="ABX17274.1"
FT                   /translation="MAVITDIKTFAAIGTGVIGSGWIARALAHGLDVVVWDPAPGAEAR
FT                   LRANVANAWPALERVGLAAGADPARLRFESTIEACVADADFIQESAPEREALKLELHEQ
FT                   ISRAAKPDAIIASSTSGLLPTDFYARATHPERCVVGHPFNPVYLLPLVEVLGGARTSPE
FT                   AVEAAMAIYRKLGMRPLHVRKEVPGFIADRLLEALWREALHLVNEGVATTGEIDDAIRF
FT                   GAGIRWSFMGTFLTYTLAGGDAGMRHFMQQFGPALELPWTKLVAPTLTDELIDRVVDGT
FT                   SEQQGKRSIKELERYRDECITEVLKAIAAVKARHGMRFED"
FT   sig_peptide     530041..530127
FT                   /locus_tag="Bmul_3590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.692 at
FT                   residue 29"
FT   gene            531013..531501
FT                   /locus_tag="Bmul_3591"
FT   CDS_pept        531013..531501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3591"
FT                   /product="thioesterase-like protein"
FT                   /note="KEGG: bam:Bamb_4457 thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17275"
FT                   /protein_id="ABX17275.1"
FT                   /translation="MTGDTPLTLYRDVVRPEWVDYNGHLRDAFYLLIFSFASDALLDRI
FT                   GLDDAARRERGRSIYTLEAHVNYLQEIKEGTRVRVDARVLAHDAKRLHLYLELFADGHD
FT                   GAVSASEQMLLHVDTRGGAKSAPFDDDVAARVAELHALQRDCAAPAYAGRVIALPPRR"
FT   gene            531519..532499
FT                   /locus_tag="Bmul_3592"
FT   CDS_pept        531519..532499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3592"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bam:Bamb_4456 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17276"
FT                   /protein_id="ABX17276.1"
FT                   /translation="MLEPEIAAFVAAVDAWYPPGAAACAPDEQRRLYDRFAAAWTPATL
FT                   PAGIARQDAVWQAPHGQPIALRRYAPTHGAPRGTVLFFHGGGFVVGSLDSHQLITAQLA
FT                   ADTGLAVIAVDYRLAPEHRAPAALEDCAAVARAARDARLPFGPCAAPLTLAGDSAGGNL
FT                   AAAVATVLRDADARGVEGIDGVALVYPMLGFEPQSPARETEAHAPMLTLDDVHRYRAWY
FT                   WGEGEATARSGDRASHADPLLRASLPLEAARFDGLPPVLAIGAEHDPLRDDARVYVERI
FT                   RAAGGRARYWMGEGLVHGCWRALATSPQAARLHRMVGAFLLAPDT"
FT   gene            complement(532690..532989)
FT                   /locus_tag="Bmul_3593"
FT   CDS_pept        complement(532690..532989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17277"
FT                   /protein_id="ABX17277.1"
FT                   /translation="MKSLVIAVAAAAALSASFSTFAQSTVTRAQVRNELVQLEKAGYKP
FT                   GLASPYYPNDIQAAEARVHGADASGYGAQPAPVVHSGAPAAATSNARDSIFFGQ"
FT   sig_peptide     complement(532921..532989)
FT                   /locus_tag="Bmul_3593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(533246..533536)
FT                   /locus_tag="Bmul_3594"
FT   CDS_pept        complement(533246..533536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17278"
FT                   /protein_id="ABX17278.1"
FT                   /translation="MKASKSLPALDPADVHVEILEQSDTLLVVRWVEPGRCHYGEQRWR
FT                   RRFAQRTGTCALSRQVIHRGDEVFRPAERPAPANAGAMISAAEVLGLSSGK"
FT   gene            534209..534973
FT                   /locus_tag="Bmul_3595"
FT   CDS_pept        534209..534973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3595"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bam:Bamb_4451 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17279"
FT                   /protein_id="ABX17279.1"
FT                   /translation="MRLQGKRALVTAAGQGIGRATALRFAREGADVLATDIDEAALARL
FT                   AADADAAGTRVTTRRLDVTDATAITALAAAEPAFDVLFNCAGYVHHGSILDCDDAAWTF
FT                   SWQLNVTSMYRLARALLPAMIAAGGASIVNMASAASSVKGVPNRFVYGTTKAAVIGLTK
FT                   SIAADFVEQRIRCNAICPGTIESPSLEQRIAEQARARQVPVDTVRQAFVARQPMGRIGS
FT                   PDEVAALALYLASDESSFTTGAIHLIDGGWSN"
FT   gene            535006..535848
FT                   /locus_tag="Bmul_3596"
FT   CDS_pept        535006..535848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3596"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bch:Bcen2424_5042 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17280"
FT                   /protein_id="ABX17280.1"
FT                   /translation="MKLLRFGDKHREKPGLLDAHGQIRDLSGVVDDIAGDVLLPESLVR
FT                   LRDIPPSSLPLVEGTPRIGACVGRVGKFICIGLNYSDHAAESGMEVPKEPVVFGKWTSA
FT                   ISGPNDDVEIPRGSEKTDWEVELGVVIGRGGRYIAEADALSHVAGYCVVNDVSEREYQL
FT                   ERGGTWDKGKGNDTFGPIGPWLVTADEVPDPHALRLWLEVDGHRYQNGTTATMVFRVPY
FT                   LISYLSRFMSLQPGDVISTGTPPGVGLGQKPPVYLRAGQVMTLGIDGLGEQRQRTVQA"
FT   gene            535871..537148
FT                   /locus_tag="Bmul_3597"
FT   CDS_pept        535871..537148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3597"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bur:Bcep18194_B0622 mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17281"
FT                   /protein_id="ABX17281.1"
FT                   /translation="MTLIRSIRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDRDG
FT                   LEGHGLTFTIGRGNEICCAAIAAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPD
FT                   KGAIHLATGAVVNAVWDLWAKVEGKPLWRLVADMSPEQLVRAIDFRYLTDCLTPDEALD
FT                   LLRRQAPGKADRIAVLEREGYPCYTTSAGWLGYSDDKLQRLCREAVDAGFDHVKLKVGA
FT                   NLDDDIRRVSIARDVIGPDRKLMIDANQVWEVGEAIDWVRALAFARPWFIEEPTSPDDV
FT                   EGHRKIREAIAPVQVATGEMCQNRVLFKQFIERRAIDVVQIDACRLGGVNEILAVMLMA
FT                   AKYGLPVCPHAGGVGLCEYVQHLSMIDYVCIAGTKEGRVTEYVDHLHEHFVEPCIVRDA
FT                   AYLPPSAPGFSIEMKPASLEQYRFRG"
FT   gene            537207..537983
FT                   /locus_tag="Bmul_3598"
FT   CDS_pept        537207..537983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3598"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_B0623 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17282"
FT                   /protein_id="ABX17282.1"
FT                   /translation="MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGA
FT                   FLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRD
FT                   AFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLAL
FT                   TREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPD
FT                   EIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV"
FT   gene            538002..539540
FT                   /locus_tag="Bmul_3599"
FT   CDS_pept        538002..539540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3599"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_4447 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17283"
FT                   /protein_id="ABX17283.1"
FT                   /translation="MQADPNAEAAAPLIALRGICKRFPGVQALDDCRFELYAGEVHALM
FT                   GENGAGKSTLMKILAGVYPKDAGEILMDGRDVDIADPRTAQAHGIAIIHQELNLMNHLS
FT                   VAQNIFIGREPRGRLRVFVDEDKLNRDAAAIFARMRLDLDPRTPVGRLTVAKQQMVEIA
FT                   KALSFDSRVLIMDEPTAALNDAEIAELFRIIRELRAHGVGIVYISHKMDELRQIADRVT
FT                   VMRDGKYVATVPMAQTSTDAIIAMMVGRQLDSAFRTPPDTSANAVALDVRGLTRGRAIR
FT                   DVGFTVRRGEILGFAGLMGAGRTEVARAVFGADPVDAGEIRVHGKRVTIRTPADAVAHG
FT                   IGYLSEDRKHFGLALGMDVQNNIALSSLRRFVRRGLFVDARALRDTAHAYVRQLAIRTP
FT                   SVAQPVRLLSGGNQQKIVIAKWLLRDCDILFFDEPTRGIDVGAKSEIYKLLDALAADGK
FT                   AIVMISSELPEVLRMSHRILVMCEGRVTGELSAADATQEKIMQLATQRESTVLS"
FT   gene            539562..540599
FT                   /locus_tag="Bmul_3600"
FT   CDS_pept        539562..540599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3600"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bvi:Bcep1808_3381 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17284"
FT                   /protein_id="ABX17284.1"
FT                   /translation="MSNDTHPVPPLASGDAPAAASGLRARLFNPATRQRLLAFASLVLL
FT                   IVFFGAASPNFLEVDNLVAILQATAVNGVLAVACTYVIITSGIDLSVGTLMTFCAVMAG
FT                   VVLTNWGMPLPLGIAAALGFGALSGCVSGFVIAKMKVPPFIATLGMMMLLKGLSLVISG
FT                   TRPIYFNDTPGFTAIAQDSLIGHLVPALPIPNAVLILFVVAVGASIVLNRTIFGRYTFA
FT                   LGSNEEALRLSGVNVDAWKIAVYTFSGAVCGIAGLLIASRLNSAQPALGQGYELDAIAA
FT                   VVIGGTSLSGGAGSIVGTIIGAFIMSVLTNGLRIMSVAQEWQTVVTGVIIILAVYVDIL
FT                   RRRRR"
FT   gene            540668..541609
FT                   /locus_tag="Bmul_3601"
FT   CDS_pept        540668..541609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3601"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bvi:Bcep1808_3380
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17285"
FT                   /protein_id="ABX17285.1"
FT                   /translation="MIRSKVLNAIVGLTFAAGIATGAHAQESYIPLISKGFQHQFWQAV
FT                   KSGAMQAANDYHVRVTFEGPETEAMVDKQIDMLSAAIAKKPAAVGFAALDSKAALPLLK
FT                   KAQAEKIPVIAFDSGVDSDIPVTTATTNNKAAAALAADKLAALIGDEGQVAVVAHDQTS
FT                   RTGIDRRDGFLDRMKAAHPKVQVVTVQYGEGDQLKSTEVTKSILQAYPKLKGLFGTNEG
FT                   SAIGVVNGVREMKRKVVIVGYDSGKQQKDAIRSGLMAGAITQNPIGIGYKTVEAAVKAI
FT                   KGEKLPKVIDTGFYWYDKTNIDDPKIKAVLYD"
FT   sig_peptide     540668..540745
FT                   /locus_tag="Bmul_3601"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            541681..542571
FT                   /locus_tag="Bmul_3602"
FT   CDS_pept        541681..542571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3602"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bam:Bamb_4444
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17286"
FT                   /protein_id="ABX17286.1"
FT                   /translation="MGALRIDSHQHFWRYRAADYPWIGAGMGVLARDYLPDALHPLMHA
FT                   QALGASIAVQARAGRDETAFLLELACDEARIAAVVGWEDLRAPQLAERVAEWRGTKLRG
FT                   FRHQLQDEADVRAFVDDADFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDAHWLV
FT                   LDHAGKPALAEFDRDDTALARWRAALRELAALPHVVCKLSGLVTEADWRRGLRASDLRH
FT                   IEQCLDAALDAFGPQRLMFGSDWPVCLLAASYDEVASLVERWAESRLSAAERSALWGGT
FT                   AARCYALPEPADARL"
FT   gene            542640..543401
FT                   /locus_tag="Bmul_3603"
FT   CDS_pept        542640..543401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3603"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bch:Bcen2424_5035 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17287"
FT                   /protein_id="ABX17287.1"
FT                   /translation="MSIQPIQNRRLYQQIADRLTAMIESGDFPPGSYLPPERELAEQFG
FT                   VSRTSVREALIALEVGGRVSVRVGDGVKVRHPEAATAPAPAAAAKAAPLAVVEIDPELG
FT                   IALDLDTEIPPFALLQARRLIEPEAASLAAKHASDAQIEAIGAAFERNQADNRSGSVTH
FT                   PGDRLFHIRIAEASDNAAYALMVKQLLAHKYDPMFQRLQSLYMPHDMPHRSELEHRAIL
FT                   DAIRARDPEAARRAMAEHLDEVIRIFGRALD"
FT   gene            complement(543433..544674)
FT                   /locus_tag="Bmul_3604"
FT   CDS_pept        complement(543433..544674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3604"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0629 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17288"
FT                   /protein_id="ABX17288.1"
FT                   /translation="MDFDVIVLGAGIVGVSAALHLQDRGRKVALVDRSAPGEGTSFGNA
FT                   GLIERSSVEPYPFPRSPFTLMRYALNRSTDLYWHSASLPAFAPWLARFWWESAPQRHAA
FT                   AARDMLPLIERCIVEHDALIARAGAGELVRASGWMEAFRTPAAFERGAAEAQLTARRHG
FT                   LGVTPLDAAALLAQEPSLAPGFCGALHWRDPKSVVDPSALVKAYARLFEQGGGTLLSGD
FT                   AASLSARSPGWEVATEHGTVAAPAVVVALGPWSDTVFAKFGYRIPLREKRGYHMHYAPS
FT                   ARGVPSAPIVDREYGYVIAPMRRGLRLTTGVEIARRRVPPTGVQLERAERIARPVFGFG
FT                   ERLDPQPWLGFRPCTPDMRPVIGPAPAHRGMWFAFGHNHHGLTLGPVTGRLLAEMMTGD
FT                   TPFTDPAPYRADRF"
FT   gene            complement(545182..546564)
FT                   /locus_tag="Bmul_3605"
FT   CDS_pept        complement(545182..546564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3605"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bur:Bcep18194_B0632 hydroxydechloroatrazine
FT                   ethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17289"
FT                   /protein_id="ABX17289.1"
FT                   /translation="MSLPSASLLIRRPLAIMSGRTGAAARLGRADLRVRDGRIEAIAPD
FT                   LAPQSGERVIDARDCVVYPGWVNTHHHLFQNLLKAVPAGINADLQAWLAAVPYPRVARF
FT                   TPTLARIAARLGFAELLLSGVTTCADHHYLYHAGGTTETGDLLFDEAAGFGMRFVLCRG
FT                   GALQTAGDHPGFAGTALQPETLDQMLADIERLKARYHDAGDASMRRVVVAPTTPTFSLP
FT                   PDLLPEVARAARGMGLRLHSHLSETTRYVDFCRERYGQLPVEFVAEREWLGPDVWFAHL
FT                   VHLEPTEIALLADTGTGCAHCPVSNARLGSGIAPAPRMAAAGVPMSLGVDGVASNESGS
FT                   MTHEANFAWLVHRAAHGASATTVEQVLHWGTQGGARVLGLDAVGTLDVGQAADLVLYDV
FT                   SGPRFAGFHDPAVAPVTAGEPAPVKYSIVNGRVVVDDGEIPGLDLHALRRDAIDAVRQL
FT                   ID"
FT   gene            complement(546665..548038)
FT                   /locus_tag="Bmul_3606"
FT   CDS_pept        complement(546665..548038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3606"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bur:Bcep18194_B0633 xanthine/uracil transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17290"
FT                   /protein_id="ABX17290.1"
FT                   /translation="MHSASHPVDRILPRRQMLTLGLQHMLVAYIGAIAVPLIVASALKM
FT                   SPADTTVLISTALFCSGISTILQTVGIWKLGVRLPILQGVAFSSVGPVIAIGLTPGVGF
FT                   AGVCGAVIGAGIVTTLAAPLIGRLRRLFPPVVTGCIVTVIGLQLFPVAYQWAGGGDAAK
FT                   LQFGELSFLAVALVVAVSILAINRFANAFLRNLSVLIGLVAGSLLAYALGMGNFTNVAA
FT                   APWFTVPIPFHFGAPVFAVVPVLTMVVVMIVQMVESMGLFVAIGDIVEKHVSEDDVVRG
FT                   LRANGVASAIAGTFAAFPFIAFMENVGLVILTGVRSRWIVAVSGVLMCVVALVPKIGAV
FT                   VASTPSAALGGAGIAMFGVVVAAGVQTLAKVDFENNRYNVLIVGFTIATALIPVMAPKV
FT                   FAHMPDWTQPFLHSGVVIACIVSVVLNALLNGVQAADPAPVHVAADAAHGGPMARECD"
FT   gene            complement(548099..549226)
FT                   /locus_tag="Bmul_3607"
FT   CDS_pept        complement(548099..549226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3607"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bur:Bcep18194_B0634
FT                   cobalamin synthesis protein/P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17291"
FT                   /protein_id="ABX17291.1"
FT                   /translation="MTHIHTTHSDVEKIPVTVLTGFLGAGKTTLLNYILREKHGRKIAV
FT                   IENEFGEIGIDGGLVLESTEEIYEMTNGCVCCVGAVREDLVRIVRMLVARPDRLDHIIV
FT                   ETSGLADPYPVAQTFFLDDPIAKEVALDAVVTMVDAKHIRAHLDDLVLDGRDNQAVDQI
FT                   VCADRIVINKVDLVDAADVESLSARLRELNATAEIVTSSYAQVDLDRILGVGANEFAQI
FT                   LVESDGLHADTDAHVDNHADEHATHDAHGGHDTHAHGDHPSHDDHDDHEHDASVSSVGI
FT                   EVDADVDLDALEAWLAELRDADTANLFRMKGILAVHGRAQRYVLQGVHGVIELRAAQAW
FT                   GTEPRASRIVFIGRDLDRAALTDRFHACLAAPVAA"
FT   gene            complement(549223..549825)
FT                   /locus_tag="Bmul_3608"
FT   CDS_pept        complement(549223..549825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3608"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG:
FT                   bur:Bcep18194_B0635 phenylacrylic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17292"
FT                   /protein_id="ABX17292.1"
FT                   /translation="MSARRLVVGISGASGFVYGMRLLALLRALDIETHVVVSRAAALTM
FT                   AHETDCKLADVAALAGVLYRSDDIAAPIASGSFRTLGMIVAPCSMKTLAEIASGLTSGL
FT                   ISRAADVALKERRRLVLLARETPYTLTHLRNMAAVTEMGAIVAPPVPAFYARPASLDQM
FT                   IDHTLGRVLDLFDIDSRTVHRWKDNDSLPHRLNGDAS"
FT   gene            complement(549822..551216)
FT                   /locus_tag="Bmul_3609"
FT   CDS_pept        complement(549822..551216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3609"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: bur:Bcep18194_B0636
FT                   carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17293"
FT                   /protein_id="ABX17293.1"
FT                   /translation="MASSPFAEQQDFHHFANAYRAHYPDDVLAIAQPLSADQDVTAVVA
FT                   SLAARGRHDMLVCERVDGLAVPLVTNVFASRTRIARLFGVDAHDLFDAWQRRANAPIAP
FT                   VVVPHGPVLDHVLEGDAVDLAQLPMIRHFETDRGPYVTNAVIVAEDPETGIANLSYHRS
FT                   MRAARNALATSLHSRGHLWRMLHAAKSRGDTLKVAMVIGAHPLFMLAAAARVPFGVDER
FT                   AIAGGLFGAPLQLVRTPRYGIGVPAAAEFVLEGTIDPDAHAEEGPFGEFTGYSSDRSTN
FT                   NVLRVDTMMRRRDAWLVDVVGGPYAEHLTLARLPREAEMSEKLKARFPAVTAIHYPNSG
FT                   THFHCYVALKQTRDGEARQIMLALLGWDPYLKNVVAVDSDVDITDDAQVLWAIATHFQP
FT                   HRDLFVVDGLPGSPLDPSSSADGTTSRMGLDATRGARFDGVRARVGDAAMQRVAQLVAQ
FT                   LDGAAR"
FT   gene            complement(551294..552199)
FT                   /locus_tag="Bmul_3610"
FT   CDS_pept        complement(551294..552199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3610"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bur:Bcep18194_B0637
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17294"
FT                   /protein_id="ABX17294.1"
FT                   /translation="MIIDTHLHPTNLVDEAWRHTGEPFTGERLLKMMDGPYIINGKPRR
FT                   IDMGFIQPPPGNTGYRDGNRRGREGIRDYMAYIAELTQKYPDRFIGNFTYNPRWGPENG
FT                   AAELEFHIKEYGFKMVKLHANMHGYRPDRALDWLRPAMKVCAKYNTVVLIHTGDGPYTI
FT                   PTQFYPIIREFPMVNFIIGHFGIQTGGNYSFEAFWMAMDTPNVYCESGWCYQSRIVEFA
FT                   RQLPRHKIVFGTDSPPNEPGMWLRELEMLCGPAPQGMDLDEDGLEDYMGNNIARLVGIE
FT                   PTKPPKDLAEAEKRLKATYV"
FT   gene            complement(552234..553136)
FT                   /locus_tag="Bmul_3611"
FT   CDS_pept        complement(552234..553136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3611"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bur:Bcep18194_B0638
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17295"
FT                   /protein_id="ABX17295.1"
FT                   /translation="MIIDTSCYPTNLVDLAWRHDGEPFTGERLIDTMNGPFLINGKPRR
FT                   IDKAFIQPPQGNTIYTYTDGKKSGTESIDAYMAYTVEMVRKYPDRFIGCFVYNPRCGVE
FT                   NGVNAIDHYVRKLGFKMVQFQANMHAYRPDRALDWLRPALKKCAELGVLVKLHTGDGPY
FT                   SIPTEWVPMIKEFPTVNFIMAHFGVQTGGVYCFEPFQLAMDLPNVYCESGWCLQSRIVE
FT                   FAKVLPTHKILFGSDTPPNEPGMWLRLLEVLCFDPPQGMNLDEDTLEDYLGNNTARMIG
FT                   LEPTPAPRTVDEAKALLAA"
FT   gene            553379..554269
FT                   /locus_tag="Bmul_3612"
FT   CDS_pept        553379..554269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3612"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0639
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17296"
FT                   /protein_id="ABX17296.1"
FT                   /translation="MDMRVLRYFAVLADELHFGRAAARLHISQPPLSQQIRLLEEQLGT
FT                   ALFVRSQHRVELTEAGKTLKEQVPLIVAQFDRAIDLTRCAGRGEKGRVAVGIISSAMVA
FT                   PIPRALRVFAERHPHVQWSLHEMTPAAQIDALKEKRLDVCFFRLFQDDPAIRSEVVVRE
FT                   TAVAALPLDHRLASRDAIALGELANEHFVSFGLRHSQLARFLQQCCVDARFTPRIEHEV
FT                   VEVHTLLSLVREGLGVALLPASARQISTGGVSFVPLLAPELEVSLQARYRADDTSAVLG
FT                   AFLDTVREVAAEYRA"
FT   gene            complement(554271..555164)
FT                   /locus_tag="Bmul_3613"
FT   CDS_pept        complement(554271..555164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3613"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0640
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17297"
FT                   /protein_id="ABX17297.1"
FT                   /translation="MLKRYPSIQSMQAFLQAARVGSFSSAARQLALTHSAISQQIRSLE
FT                   EFIGQPLFVRTGGRVSLTDAGTLLANQLSDGLEQIDRALSSVKGRASAPSLRLDVDPEL
FT                   MQGWLPARMPALMRALGGTTLTVLSAPRHDRDAFDRVDVALRYGYGEWEGVDSALVCPD
FT                   RLTAMASPALLERYGLRAPLAPASVLTLPLLGYTKRSWIPWLEAAGLAPVEPDTIAVFD
FT                   NAAGLVAALASGLGAGLARGLLAADARRDGRLVELCSIAIPTHYNLHAIWPRERHARVK
FT                   PLLDAIGALVAQTLAR"
FT   gene            555288..555782
FT                   /locus_tag="Bmul_3614"
FT   CDS_pept        555288..555782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3614"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bur:Bcep18194_B0641 iron sulfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17298"
FT                   /protein_id="ABX17298.1"
FT                   /translation="MIDIVVNDTRHSLDQVPDDMPLLWVLRDRLKLTGTKFGCGKGLCG
FT                   ACTVHVDGQAVRSCVMPAVAVQGRKVTTIEGLSPDGRHPLQLAWVAEDVPQCGYCQPGQ
FT                   VMQAAALLNGGRPVDDAAIVSAMSGNVCRCGTYAGIHRAIKRAASGDPALDAVAGDAKE
FT                   A"
FT   gene            555784..558033
FT                   /locus_tag="Bmul_3615"
FT   CDS_pept        555784..558033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3615"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bur:Bcep18194_B0642 aldehyde
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17299"
FT                   /protein_id="ABX17299.1"
FT                   /translation="MRHDRTAPMPPIDDAPRRRFLKQSAALLTAGVAVGFRLADATAAG
FT                   PRASGDPHPAAGEFEPNAWVRVLPDDTIKLVVHKHDSGTGTRTALAALVAEELDVDPFR
FT                   VEVITPEDPFFADYIHPLWKVFSTGGSTSVAMEYDRLREAGATARAMLVAAAARQWNVR
FT                   ASTCTTADGAVQHAASGRRATYGSLASAAARLPAPQRVALKDPAQFRYIGKLRRKRGAA
FT                   QKADGSFPYSIDVSLPGMLVAVVTRAPVIDARVRSVDAKAALAMPGVRDVLQIPPRPDV
FT                   LGGNQAGVAVLADDYWSAHRAQAALKIEWEDSLFETFDSSTLAARQAAWVDDPAARVVP
FT                   TIRDGDPANASLAGARTVDATYAMPYKAANPLEPINVTVWARDGGIEYWGGLQVPSTAM
FT                   EAAQVIGGIPAHRVTLHERVSGGSFGARESKYWLFEATWLAVKTGKPVKLMNSREDEMR
FT                   ALFYHAASCHRARAVLDARGNLASLWLRGVMPASPQQWEPGYLERADRMDFSTTEALTK
FT                   WEFAYAAPHRDIGWIRLETGVPTGWYRAVSYIPNVFAVESLMDEAAHAAARDPVEFRLA
FT                   HMRDRPRHAAVLREAATRAGWGQPLPAGVALGIATNQAYDSYVAVVARVVRDAEGAVRV
FT                   AKLTCVADCGIAVSPAGVEEQLYGGLMWGLGHATSDRIDIRNGRVQQSNFDTYRVMRMN
FT                   DMPETDIHIVQGDRAKPGGVGELSSPAVTPAIANAVFRLSGKRLRETPFDLSAVS"
FT   gene            558328..559038
FT                   /locus_tag="Bmul_3616"
FT   CDS_pept        558328..559038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17300"
FT                   /protein_id="ABX17300.1"
FT                   /translation="MVATVCAPAADCPTAPAPTSAAATAARTTFGRCGRAASLRHVLLA
FT                   LACALGAVPAALAGFAAYAGAPDEAARIAAAPPASAAEAEAALPPHDAAVRRVVLGIVS
FT                   FTRWPTQPARLRLCIVGRPDYAGGLIDTLQAGTTPLDVQRIRFDERALGSACDVVYLGM
FT                   LSDDERAQVRHAVAGHPVLTIAEHDPSCIAGGMFCLNVDGEPVTFDINLDAVARSGVRV
FT                   HPNVLNLARRPVTP"
FT   gene            559035..560303
FT                   /locus_tag="Bmul_3617"
FT   CDS_pept        559035..560303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3617"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bur:Bcep18194_B0644 diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17301"
FT                   /protein_id="ABX17301.1"
FT                   /translation="MTRSAPPVSSSRVPRPTLQSVLRRAHLRLAFVAVAMAAVSLIVVA
FT                   VIALRAYAGNNLNLLARSLAYTVEAALVFRDRVAAAEAIALIAADEDVAQVVVTDTDGR
FT                   PFATWQLRAPSRLARVERAVADFALPGPASVAVLHDGIVVGHVVVRGRGQQFFGFLLGG
FT                   IGGILGCLIVSVLGAYVSSKRLMRNIVAPLRALADVAHAVRRERAFGRRVEPVAIDELN
FT                   QLGADFNALLDEFEQWQDTLRHENASLAHKAMHDALTGLPNRVQFESRLARALGEAGAT
FT                   GQRVAILYLDCDGFKEINDCFGHEAGDAVLIGIAARLRAQLRDADLIARLGGDEFAVML
FT                   ETVREAGSVGRIADAILSGMAPSIELSDGRMVATMMSVGIALYPDHASDATGLLRAADA
FT                   AMYRAKRTRPGSWQSAGGAAGSA"
FT   sig_peptide     559035..559196
FT                   /locus_tag="Bmul_3617"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.805 at
FT                   residue 54"
FT   gene            560303..560860
FT                   /locus_tag="Bmul_3618"
FT   CDS_pept        560303..560860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3618"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bch:Bcen2424_5026 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17302"
FT                   /protein_id="ABX17302.1"
FT                   /translation="MSMASRAYSCGKGAMMGHSLPVRRGRMWVGGATLLGVLLSAGCHT
FT                   APPHRGLTETQVTTLKSAGFKETEQGFEFGAAGPILFDFDRYNLKPDVRRIVERIGRTL
FT                   HSAGIDGVRVYGYTDDEGTDGYDLELSRRRAEVVAIELVDVGLDARRIAIVGRGKHDPV
FT                   GDNRMPVGRAQNRRAAIVVSPR"
FT   gene            561318..562235
FT                   /locus_tag="Bmul_3619"
FT   CDS_pept        561318..562235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17303"
FT                   /protein_id="ABX17303.1"
FT                   /translation="MAFDGLSWYRLNRPVSEDEHASRLAIGERASDTPKDDRSVFSMTE
FT                   NCLEVRNGTYSEKGWGVFAFMLPGVGSLAAVAFVLWLMTHLPPIYEQRGQQGLMYGALS
FT                   FFLFIGLCFSGLGIWALTRDCFNYISKPVRFDRRNRMIHAFKHNGPGGVISVPWDSAFL
FT                   YIERKPRQGLARTAPRMVRCLVLDDKGLVKDTFSVGTRVVLAFDESSVGGREVMKILYQ
FT                   DFEFYRRFMEEGPASLPPVTEYLPRGASLRNALKVNFAGWSDMVNSRNPMVWLVIAIGV
FT                   LPSFLHLFADAMVRAIDLPSTGVA"
FT   gene            562287..562571
FT                   /locus_tag="Bmul_3620"
FT   CDS_pept        562287..562571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17304"
FT                   /protein_id="ABX17304.1"
FT                   /translation="MNRRFILRGDKTDRNGVVVDGIANTSFQGQPVAYLGAAVQCPACG
FT                   TTGVIISDGTPRLMTMMGKQVALEDDLCQCRCEPLPKLIASQTLGSITI"
FT   gene            complement(562679..563806)
FT                   /locus_tag="Bmul_3621"
FT   CDS_pept        complement(562679..563806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3621"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   bvi:Bcep1808_3397 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17305"
FT                   /protein_id="ABX17305.1"
FT                   /translation="MPGLLPDVDRDGLLEYSVVYTDRSINHMSQRFQHVMRDISDQLKK
FT                   VYHAKSVAIVPGSGTFGMEAVARQFATNRKCLVIRNGWFSYRWSQIFEMGSIPSESIVL
FT                   KARPVESGRQAAYAPAPIDEVVAAIREHKPDLVFAPHVETASGMLLPDAYLRAVADAVH
FT                   EVGGMFVLDCIASGTIWVDMEASGVDVLISAPQKGWSASPGCALVMLSPLARERIDGTT
FT                   STSFACDLRKWLQIMEAYEGGGFAYHATMPTDSLATLRDVIKETDAYGFDKVRDEQLEL
FT                   GTRIRALLAEKGFRSVAAEGFQAPGVVVCYTDDDDIRSGKKFADVGVQIAAGVPLQCDE
FT                   PADFKTFRIGLFGLDKLHDVDGAVARFADALERAL"
FT   gene            complement(563958..564539)
FT                   /locus_tag="Bmul_3622"
FT   CDS_pept        complement(563958..564539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17306"
FT                   /protein_id="ABX17306.1"
FT                   /translation="MSAATVCALAAPVSAAPASDALADRSAVTNVFRVERHAAHDSDAA
FT                   RGSTRYARPAARSPFETEDTRPLQIDGDRLTPQPSNARPADSAWADTRVAPGRRTAGRL
FT                   LPEAERRSADWDAYLRANGSLSADGLPSARPYAPMRSFDPARGVPGAPNPFDPSIPHPE
FT                   TRTFYDDGAGSRCTATGGAGTSRSSCRLDW"
FT   sig_peptide     complement(564468..564539)
FT                   /locus_tag="Bmul_3622"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.560 at
FT                   residue 24"
FT   gene            565361..566479
FT                   /locus_tag="Bmul_3623"
FT   CDS_pept        565361..566479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3623"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bch:Bcen2424_5019 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17307"
FT                   /protein_id="ABX17307.1"
FT                   /translation="MTLSRLTSISVAAVLFAAGAAAAQAETVKIAIAGPMSGSVAQYGD
FT                   MVKAGALTAIEQINAAGGAGGNKFEVVMMDDACEPKQAVAVANKIVSQKIKYVIGHVCS
FT                   GSTIPASDIYENEGIVMVTPSATAPQLTEGKKRHFIFRTIGRDDQQGPAAAQYIINHVK
FT                   PKKVAVLHDKQSYGQGIASSVKKDLEAAKIPVVLFEGINAGDSDYSAIITKLKSQGVDF
FT                   VYFGGYHPEMGLLLRQAREQGVKATFMGPEGVGNKDVTAIAGPASEGMLVTLPADFSAD
FT                   PANAALVKAFADKKRDPNGPFQMPAYAAVKIIADSIAGAKTTDPTKVAAYMHKTTFDTP
FT                   IGKVAYDAQGDLKAFKFVVYTWHKDATKTAAK"
FT   sig_peptide     565361..565438
FT                   /locus_tag="Bmul_3623"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.681 at
FT                   residue 26"
FT   gene            566664..567590
FT                   /locus_tag="Bmul_3624"
FT   CDS_pept        566664..567590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3624"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bvi:Bcep1808_3372 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17308"
FT                   /protein_id="ABX17308.1"
FT                   /translation="MTDFFPQFAQQLVNGLTLGAIYALIAIGYSMVYGIIGMINFAHGE
FT                   IYMIGAYVGLVTLTAIGVSAGYPLPLVLGAALIVSVIVTGAYGFAVERVAYRPLRGGPR
FT                   LVPLISAIGMSIFLQNYVQIGQGARDVSVPVLISGAFDIHLGGDFDVTVPYARLLIVGV
FT                   TIVLMIALTLFISHSRMGRACRACAEDMKMANLLGIDTNRVISFTFVLGAMLAAVGGVL
FT                   IGLTIGKLNPYIGFVAGIKAFTAAVLGGIGSIPGAMLGGVLLGLAETFAAGYMPAEYKD
FT                   VVAFGLLVLILLFRPTGLLGKSDIEKV"
FT   gene            567602..568873
FT                   /locus_tag="Bmul_3625"
FT   CDS_pept        567602..568873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3625"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_5017 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17309"
FT                   /protein_id="ABX17309.1"
FT                   /translation="MSQVISVRRPAADASFGQALKNAVAAAILTAILTVPVLGLQLKLD
FT                   GYQVVLERHWRPVWIAVAAVFLFQLFKPWLLRAKSAVKLPAVPAMGARQQRAIIWVLLA
FT                   VGLVWPFVGSRGAVDVATLALIYVILGLGLNIVVGFAGLLDLGYVGFYAVGGYTYAMLN
FT                   QYFGLTFWECLPIAAIASATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLLANNLTSLT
FT                   GGPDGISGIPKPTVFGFEMARSASVEGAKTFHELIGLEYSGEHMVIFLYLLALLLVGFT
FT                   LFVTSRLIRMPMGRAWEALRDDEIACRSLGLNPTRIKLSAFTLGAAFAGIGGAFFAARQ
FT                   GLVNPESFTFIESALILAIVVLGGMGSQLGVILAAILLTVLPEVARGFAEYRMLIFGLV
FT                   MVLMMMWRPQGLLPASRPHVELPQ"
FT   gene            568870..569643
FT                   /locus_tag="Bmul_3626"
FT   CDS_pept        568870..569643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3626"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5016 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17310"
FT                   /protein_id="ABX17310.1"
FT                   /translation="MSANAELLKVAGLQMRFGGLLAVDGIDFDVRRDEVFAIIGPNGAG
FT                   KTTVFNCVGGFYRPTAGEVVLDGHRIAGLPSHKIALKGLVRTFQNIRLFKSLTVVENLL
FT                   VAQHRKVKSGLLHGLFATPAYRRAEKEALERAAVWLDRMGLTAVANRPAGTLSYGHQRR
FT                   LEIARCMITEPRLLMLDEPAAGLNPQEKIELQHLIDKLRREFGVSVLLIEHDMSLVMGV
FT                   SDRILVMEHGRPIVIGTPEAVRNDPRVIKAYLGEE"
FT   gene            569643..570344
FT                   /locus_tag="Bmul_3627"
FT   CDS_pept        569643..570344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3627"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_5015 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17311"
FT                   /protein_id="ABX17311.1"
FT                   /translation="MLKLEQVHTHYGAVEALAGVSIEVNKGEIVTLIGSNGAGKTTLMM
FT                   TVCGTPRASSGRVLFEGKDITAMSTHQIMRQGLAISPEGRRVFPSLTVLENLKMGGFFA
FT                   SRHEIDDGIEHVFKLFPRLKERATQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPTLG
FT                   LAPLVIAQIFDIIRTIRDEGVTVFLVEQNANKALQVADRGYVLETGRVVLADTGANLLA
FT                   NDRIKQAYLGG"
FT   gene            complement(570435..571286)
FT                   /locus_tag="Bmul_3628"
FT   CDS_pept        complement(570435..571286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3628"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4427 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17312"
FT                   /protein_id="ABX17312.1"
FT                   /translation="MPRTLDVDLLRTFHAVAKLGRFKDAAVHVNRSPSSVTAQIQKLEE
FT                   MVAQRLFTRNNQAVELTQFGHKLLSDTTEFLQSHDRLVESLSPQMLTGKLRLGIPDSYA
FT                   AHFMAEFLPRFAADRPLLELTVEARSSEELLMLFSRGQLDITIAVVPKALPHAELLGKT
FT                   HPVWVAARTFKFNPDAPLPIAVQLQGCPYRDTALRALKKAKIAHRLLLESASSPAVEAC
FT                   IANGLAVGLIEHDRVSGNLTSRVAGIVLPDLPPHLITVLTDESNRAALHLRDVLKSTFR
FT                   IG"
FT   gene            571418..572398
FT                   /locus_tag="Bmul_3629"
FT   CDS_pept        571418..572398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17313"
FT                   /protein_id="ABX17313.1"
FT                   /translation="MSINDFVVDALVRDKKLKADAVWTVENHEKYSTLHRTGDDARRRE
FT                   AGREVLSLMRKLNELGVRSPALCADRDGNGSLREAIGALSERLATLSRGRHVHYIELGP
FT                   EPVKTTELMKAVSGGGPKHLRYTAVDINESSEDAMRHAIMPFLKTPGCFNYIADDYRNV
FT                   QWNHIDLGQDVTFITMLGFQEGNELPVTIGRLIRNLGGKSTYVVSEMQLLVEGREEPIY
FT                   NFYLNENMVRFSEIVSRQQGFEPLGTHHVSIVRLNLLGDQFHVAVTLQPVTKAGADGHL
FT                   ITNVCLKYTPEQFRHVRLSHGNCRVIDELHSGDGSVVYQIAQFKG"
FT   gene            572428..573414
FT                   /locus_tag="Bmul_3630"
FT   CDS_pept        572428..573414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17314"
FT                   /protein_id="ABX17314.1"
FT                   /translation="MNKVNALPVFARGFGRVKVALQTSLSGGANVGGALDASTEPMRWT
FT                   GACLRDGYEVRYRRNLDDLGYRDVPMRGTRSDALNAVCHLRGLFSDEAVDALRAIGRAL
FT                   ERSASSSNWIISKRVRAVTNRSLFIDDMMHDRAFLLRMSRLAGVPLIPYPMANARSQFN
FT                   YYYPTGQRDGKAQIGMWHTDGTSFVLNIVLSDRAEYEGGNFLFYESTAETFDRHDRERR
FT                   HVKTANLDTAGDALLIYGSKLFHGVEPVEAGRRMSLVLSFHCPYTREDDNGFWHLASDD
FT                   GIPRTVVNWLALRRALRDDAELQYHRLGLEPIRPEDLGEQRLSPVTF"
FT   gene            573428..574351
FT                   /locus_tag="Bmul_3631"
FT   CDS_pept        573428..574351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3631"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bch:Bcen2424_5011 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17315"
FT                   /protein_id="ABX17315.1"
FT                   /translation="MQLLLLQLVFVLSWSSGFIGAKLGAETAGAFNLLFWRFLLVTLCL
FT                   AIVLNRQLGRLTLEKIRYHAVIGFLSQFLYLACVYVAIQHGLPPGIAAIVAALQPLITA
FT                   AMTSFEGSERSGARQWAGLVVGFIGVGIVIGGQYALPTASVGIVMYLLPLVSAFGLSIA
FT                   TIYQRRRALTAARSNEDGLFLPLFVQGGVSLVLFAACGIVTGDLRVPTQPNVWVSVVWL
FT                   TVFSTFIAYLSLWALLKRMPATRVATLVYLEPPVTLMWAAWMFGDRIEVTTYIGIVVVV
FT                   VGVWLARNRGTGAGRPRCVDMETAGR"
FT   gene            574417..574767
FT                   /locus_tag="Bmul_3632"
FT   CDS_pept        574417..574767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3632"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bch:Bcen2424_5010
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17316"
FT                   /protein_id="ABX17316.1"
FT                   /translation="MKVKRIVANIDTQSIDDAKRFYRDVFGLDVLMDHGWIATYGNAEQ
FT                   MTVQISVASQGGSGTPTPDLSIEVDDLDEALARVRAAGIAVEYGPADEPWGVRRFYVRD
FT                   PFGKLVNVLAHR"
FT   gene            complement(574811..575218)
FT                   /locus_tag="Bmul_3633"
FT   CDS_pept        complement(574811..575218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3633"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17317"
FT                   /protein_id="ABX17317.1"
FT                   /translation="MFDTKVALIVRDDLAAWQKLNVVAFLATGVAAEAPEALGEPYEDA
FT                   AGRRYARMLGQPILVFAADLHGLRAAHRQALSRELTIVPYVHAMFSTGHDAANREVFRA
FT                   EDAENLDLVGLALHGPKKAVDKAVKGLALHA"
FT   gene            complement(575263..576165)
FT                   /locus_tag="Bmul_3634"
FT   CDS_pept        complement(575263..576165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3634"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bch:Bcen2424_5008 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17318"
FT                   /protein_id="ABX17318.1"
FT                   /translation="MRTLSGRQRHVATRAMTTTAHDIGRSDHWLDARRDPETGIESLRA
FT                   HFSGHAYDPHDHDDMLIGYTEQGVQRFQCHRSLHTSVPGRAILIEPGALHDGHAPEPGG
FT                   FTYAMLYLPQSWVERAARRLELPGLAGVEAAFGHTLVDDRGLVDAIRHAFAALHGNEGK
FT                   LARDQTLDRVLMHLRGQLREPFVHEAGAVPPAIARVRDLLHARMDANLGLDELAELAGI
FT                   DRFRLTRLFQRAFGTSPHAYLVRVRLRTARRLLAAGRTPAEAAADVGFADQSHLGRWFR
FT                   RAYRITPAAYRRMCTNVPD"
FT   gene            576797..578236
FT                   /locus_tag="Bmul_3635"
FT   CDS_pept        576797..578236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3635"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: azo:azo0348
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17319"
FT                   /protein_id="ABX17319.1"
FT                   /translation="MRETKTLPLVVDLDGTLTVSDTLMESVIAVVRKKPACVLRLPFWL
FT                   AEGRAAFKARIAEQADFRAETLPYRQPLVDYLRHERQGGRTIVLATAAHASIADRVSAH
FT                   LGLFDRVIATCDGTNLKGAAKLDRIREQIGDDFVYAGDSKADLSVWAGAKGAVLAGASR
FT                   DVAANVRGSVPVEREFADARASLATWFGALRVHQWLKNLLLFVPLLTAFAFFDIDKVAT
FT                   LALAFVSMSLGASATYIGNDLWDLDNDRRHPRKCKRPFASGALSITEGLGCAALLLTAA
FT                   FALAFAVSPAFAGMFALYLVLTTAYSWRLKSIVLLDVVILSLLYTYRIVAGAVAAEIVV
FT                   SRWLLAFSVFAFLSLALVKRCSELVSLRQSDKRAAAGRDYRVGDLEVLWPFGIGSSLAA
FT                   VVVFGLFINAPETAGRYAMPQLLWLVQIGLIYLFGRLWIATVRGAMHDDPIVHLLENRG
FT                   SFGMLCAMVATVLAAHFLPAL"
FT   gene            578251..579438
FT                   /locus_tag="Bmul_3636"
FT   CDS_pept        578251..579438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17320"
FT                   /protein_id="ABX17320.1"
FT                   /translation="MTEKNRNRVLAFCRFSIVYVLLFVCAGNITNSVLLKWGFRDAQAD
FT                   DLRNTFSLIGMMDGGAPKPFVYRSSFPKAAKWLAERIEPDTQQKLYRSITRHDSLRNAY
FT                   FSDLPKQYWTPVVAITYHLTYIAIVLSALFALLLVYKLARLHGLSFGQSVGFLAGFSFL
FT                   YPLTFQQGAYYYDFFEILGALGACYFLLRQRMIACTATIAIFSLNKETFFLVPLALFFL
FT                   HDRDVPLSKRVGWLAVQLAICGATRHFIMSGYAHNAGDFVAFQLWGNLKFWVNPASYLS
FT                   FYNLIGKGIFTPSLENPLMLVPLAVFFRAAWRNTPTHYRRYFLAAFLPVLPLFMLFGCR
FT                   DEARNFSVVFPAVVLIALHGATRFDAIFGKRADVAEGAGHAPRRAEVERAAEAVL"
FT   gene            579435..579773
FT                   /locus_tag="Bmul_3637"
FT   CDS_pept        579435..579773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3637"
FT                   /product="small multidrug resistance protein"
FT                   /note="KEGG: pin:Ping_0451 small multidrug resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17321"
FT                   /protein_id="ABX17321.1"
FT                   /translation="MNGLIVVASGVFGGAAGVLLRVAALKGAALGESSLLPWIARASAV
FT                   AAYGIGFVLYALALRKTTLAVAYPTMVAMSMIVVLSFTALHEQVLRPMQAMGAVVILVG
FT                   VWMVTRHA"
FT   gene            complement(580003..580087)
FT                   /locus_tag="Bmul_R0077"
FT                   /note="tRNA-Leu7"
FT   tRNA            complement(580003..580087)
FT                   /locus_tag="Bmul_R0077"
FT                   /product="tRNA-Leu"
FT   gene            580162..581544
FT                   /locus_tag="Bmul_3638"
FT   CDS_pept        580162..581544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3638"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; leucine-rich repeat-containing protein
FT                   typical subtype; KEGG: bvi:Bcep1808_3359 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17322"
FT                   /protein_id="ABX17322.1"
FT                   /translation="MPVECTRSLVRAPQPLSVFIVIATLEQLRAGRLAGARQLKLACGL
FT                   TEFPREIFELADTLEVLDLSGNALSSLPDDLSRLHRLRILFASDNRFTALPDALGACPQ
FT                   LEMIGFKANRIRTVPGTALPRVLRWLILTDNAIDALPPEIGDCSRLQKLMLAGNRLQSL
FT                   PDEMAACRALELVRLAANRLDALPDWLLRLPRLAWLAVAGNPLGAASEAAASADTGVTD
FT                   IDWASLACEQKLGEGASGVIYRARWRADMGDRPVAVKLFKGAVTSDGLPDCEMAACLHA
FT                   GRHPNMIPVIGRVHGHPDGVHGLVMELVDPALTNLAGPPDFATCTRDVYADDVRFEPAA
FT                   ALRIARGIASVARHLHARGIMHGDLYAHNILHGDDESALLGDFGAASLYDVRDAQRAAL
FT                   FERLEVRAFGYLLGELLERCEPRGWAGAPALDALTAACLNEDVDARPSFAEIVDALTVY
FT                   AA"
FT   gene            complement(581618..582112)
FT                   /locus_tag="Bmul_3639"
FT   CDS_pept        complement(581618..582112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17323"
FT                   /protein_id="ABX17323.1"
FT                   /translation="MTQSPDRIEKQVQLAAPLERVWEAVSNAGEFGTWFGVAFDGPFVA
FT                   GQTLFGRISPTRVDDDVAKAQEPYAGSVFEFVVDRIEPKRLFSFRWHPFAVDPAFDYAS
FT                   EPMTLVTFTLAEQAGGTLLTVVESGFDAIAAARREKAYEMNDEGWAMQMKLMEKYLARS
FT                   A"
FT   gene            complement(582204..582521)
FT                   /locus_tag="Bmul_3640"
FT   CDS_pept        complement(582204..582521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3640"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: bvi:Bcep1808_3353
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17324"
FT                   /protein_id="ABX17324.1"
FT                   /translation="MPALPMTDSDRPPLVRIEPLGASFDAPDSLTLLEAAAFAHVSLPR
FT                   SCRNGTCRSCLCRIVSGSVRYTIEWPGLSREEKADGYTLPCVAVATSDLVLDVPDAALI
FT                   G"
FT   gene            complement(582584..584659)
FT                   /locus_tag="Bmul_3641"
FT   CDS_pept        complement(582584..584659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3641"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: bur:Bcep18194_B0698 sigma54
FT                   specific transcriptional regulator with GAF sensor, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17325"
FT                   /protein_id="ABX17325.1"
FT                   /translation="MMANTRARASMCAPRAGNHEAPVWVKALGGGRVVRGAPVSAKALT
FT                   GADRRQAMPQSSMLPATAGRVDLLAQAHARSAAVGLRAHERPDFSPLSQIALRELLDTN
FT                   HALFAHARPVMENLHAQIADTQSLVLLTDAAGVILHSIGDDDFIEKANRVALCTGVSWA
FT                   ERARGTNAIGTALASGQAIAVHGAEHFLRANHILTCSCAPIVDPFGRTLGALDVSGDPR
FT                   GFSPHTLALVRMSAQLIENHLFANQCAEALRVRFHAHEDCVDSLFAGLVAFGADGGLIA
FT                   ANRSAQFQLGAPFDALQHQGCDALFGMRFGELAQQAARAPGAVLRLTLASGVRVLARCE
FT                   FADAQKTAVAVTPPAPATHVRAPDPEAITFATLDTGDARMAAVLERVAKIRGRDLPLLI
FT                   LGQTGTGKEWLARALHHASPRADGPFVAVNCAALPDTLIEAELFGYEDGAFTGARKRGS
FT                   PGKIVQADGGTLFLDEIGDMPLAQQVRLMRVLQERAVMPLGGARAVPVDVRIVCATHRD
FT                   LRAMIAAGTFREDLFYRINGLAVTLPPLAARTDLPVLVERILARLARSEPMPHRIAPDV
FT                   LDAFTRHRWPGNLRQLTNVLRTAGMLAEDEDEIALAHLPDDFWLDCDGAPAAASAASVA
FT                   AAPSTIPPAPRGTTTLQDHQAAVIDAAVARHGGNVSAAARELGLARNTVYRYLRRH"
FT   gene            584808..584999
FT                   /locus_tag="Bmul_3642"
FT   CDS_pept        584808..584999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17326"
FT                   /protein_id="ABX17326.1"
FT                   /translation="MVRTELRVVLAAIATFIMLGGIAVAIHGLLFDVADAVRYGAAAIT
FT                   IGVTTAAIALNVWPTDPH"
FT   sig_peptide     584808..584885
FT                   /locus_tag="Bmul_3642"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.780) with cleavage site probability 0.581 at
FT                   residue 26"
FT   gene            585244..585552
FT                   /locus_tag="Bmul_3643"
FT   CDS_pept        585244..585552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17327"
FT                   /protein_id="ABX17327.1"
FT                   /translation="MQIHFTNEAPEYSGRDLMLAFTALVNGERVQCQITAEAMEDHFGA
FT                   ASPRFEDMVGAFDQHRERIEAAARRLLSETRAQCVTLRSGYVRFYEANGALNRPAGQ"
FT   gene            complement(585691..586992)
FT                   /locus_tag="Bmul_3644"
FT   CDS_pept        complement(585691..586992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3644"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bam:Bamb_4396 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17328"
FT                   /protein_id="ABX17328.1"
FT                   /translation="MESIKRYFGFAEAGTDFRTEILAGVTTFLTMAYIIFVNPAILGDA
FT                   GMPKESVFVATCLVAALASLIMGLYANYPIACAPGMGLNAYFAYTVVKGMGFTWQAALG
FT                   AVFISGCLFLLVTLFRVREAIVNGIPKSLRISITAGIGLFLGIISLKTSGVIVGNPATL
FT                   VTLGDLHKHDTILAIIGFFTIVTLDHLRVRGAILIGILGVTVLSFFFGDNQFHGVFSAP
FT                   PSIDATLFKLDIGAALSTGIINVILVFFLVELFDATGTLMGVANRAGLLVEGKMHRLNK
FT                   ALLADSTAIVAGSVLGTSSTTAYIESASGVQAGGRTGVTAITVAVLFLACLFIAPLAGV
FT                   VPAYATAPALLYVSCLMLREMVDVPWDDATEAVPAALTALLMPFTYSIANGVAFGFIAY
FT                   GGLKLLTGQARTVKPIVWIIAAVFLFRFFYLGSE"
FT   gene            587949..588230
FT                   /locus_tag="Bmul_3645"
FT   CDS_pept        587949..588230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17329"
FT                   /protein_id="ABX17329.1"
FT                   /translation="MLNWISRWAMRHAPTPEKTAASMLVTARMELFAAEQRVIDAKLQA
FT                   DYWRTRVSFLEEVQKQGIDPWVTSQSAMQKPELDSTPRSTGPRLAAST"
FT   gene            complement(588394..588789)
FT                   /locus_tag="Bmul_3646"
FT   CDS_pept        complement(588394..588789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3646"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17330"
FT                   /protein_id="ABX17330.1"
FT                   /translation="MEKTMDQASSLFVRPDRRRPDAIALPTVVIRFAVAPRTTLSWRAP
FT                   RDAEVRAHGAPLWITRPPSVDDYWVQPGDVLRVARGERIWLSADDDRPAEVSITIAYVP
FT                   GGDRLRRALALTRRLLVGRWRTREARE"
FT   gene            complement(589043..589324)
FT                   /locus_tag="Bmul_3647"
FT   CDS_pept        complement(589043..589324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17331"
FT                   /protein_id="ABX17331.1"
FT                   /translation="MKKTDLEKNKALKLTHAMKQSSSARFGKGAEEAAKLDRRAQRKLD
FT                   QELGLVPFACKLNAELVEQLKARAATHPNGMTGLLSELLVNALAQRDA"
FT   gene            complement(589399..590304)
FT                   /locus_tag="Bmul_3648"
FT   CDS_pept        complement(589399..590304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3648"
FT                   /product="metal-dependent hydrolase"
FT                   /note="KEGG: bch:Bcen2424_4970 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17332"
FT                   /protein_id="ABX17332.1"
FT                   /translation="MTDTAKYHKIKARHVKFDFSNTPITWVPGDPGSTHIINTLNLLFP
FT                   EGELWFCRVYNKALPLITDARLRDEAEGFLRQEAVHSRSHGGVLKHYYEQHGIDTKPFT
FT                   QKLNRLFTRVLGEQPLGLKIGHTRFWLRQQLAVIASLEHFFGYLGNWVLNAHGLDAGKA
FT                   DPTMVDLLRWHGAEEVEHRTVAFDIYRHMGGSYPERCVHMAFVIVLLLYYITTGAKFMY
FT                   RRDPDAGRYPGFVLSWRQGARRGHLPSFWKVIGAALRYFRPGYTPHAEGSTEQALEYLA
FT                   RSPAAQAAAHGGNWQAPTRG"
FT   gene            complement(590335..592122)
FT                   /locus_tag="Bmul_3649"
FT   CDS_pept        complement(590335..592122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3649"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: alpha/beta hydrolase fold; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: bur:Bcep18194_B0709
FT                   short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17333"
FT                   /protein_id="ABX17333.1"
FT                   /translation="MQPLADEAPLALFESLHNETAIASGDLTLAVRTWGDPARSPVVLV
FT                   HGYPDDSSVWQQVAPLLARKHYVIAYDVRGAGLSSAPKRTADYRLAKLTDDFVAVIDAL
FT                   CPGRAVHLVAHDWGSIQGWEFVTEPRLAGRIASYTSCSGPCLDHVGFWLRERLLHPTPA
FT                   SLGKLGGQLVRSWYVYLFHLPFIPELGWRLWLGRAWPRLLRRIEKTPVAPRATQADDGA
FT                   RGVRLYRANFIRCLFTPRQRYAHAPVQTVVPLGDKYVSPALSEHLSRWVPQYYRREVAA
FT                   GHWLPLADPARFAGLAEQLIDAVESGDEPPALANARRRATSGRFSGKVAVVTGAGSGIG
FT                   RCAALAFAREGATVVAVDIDLASTERTALLIGLIGAQAHAKRVDVGSADEMEALATWVG
FT                   SALGGADVVINNAGIGMAGGILDTSTQHWQRILHVNLWGVIHGSRLFAQQMAARGTGGH
FT                   IVNTASAAAFGPSRDLPAYATTKAAVLMLSECMRAELAEQGIGVTAVCPGFAETGIMAS
FT                   TQYAGANAQDEARLRKRATKLYRMRGLKPETVAQAMVDSVLRNRPVVAVGGEAHALRFV
FT                   GRFMPWLGRMIARVSMASH"
FT   gene            complement(592166..593062)
FT                   /locus_tag="Bmul_3650"
FT   CDS_pept        complement(592166..593062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17334"
FT                   /protein_id="ABX17334.1"
FT                   /translation="MSAHPLPEVHLDELPQFRAVQQLAYRCVETVGGMLYPGITEKEAA
FT                   RLLTEWLQDNGVHDWLHKPFAWFGDRTAFEGFSGLKHMGGFNLAFFPSNRQLETDMPVI
FT                   LDVAPVLDGIVADVGYAHCLGRNPILEQLQDDLMDHRDMIVRLVKARRSMAEVAQEVDA
FT                   LCRRQGVEPRHKAYPFKVLAHRVAKIHKLSKPRFVARFGLNATRNLLIDQGRAAKHQGW
FT                   SPLWSIDRRSEHAPVPGLWAVEPHLGFAGVGAKFEELLVITEDDAYWLDDDLPHVRRWQ
FT                   RRLAERAQTVATVSAAA"
FT   gene            593298..593546
FT                   /locus_tag="Bmul_3651"
FT   CDS_pept        593298..593546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3651"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17335"
FT                   /protein_id="ABX17335.1"
FT                   /translation="MRLANGRPESILVSVAVVGQRVEIDVFDDGHMEVSRFVGNEDIEG
FT                   GVELIGSIVASARSRCEADADKTAGNKKRTLARPFAV"
FT   gene            complement(593595..594671)
FT                   /locus_tag="Bmul_3652"
FT   CDS_pept        complement(593595..594671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3652"
FT                   /product="Abi family protein"
FT                   /note="PFAM: Abi family protein; KEGG: lpp:plpp0049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17336"
FT                   /protein_id="ABX17336.1"
FT                   /translation="MKGTAGSELDVYIEIHAWRYGSTMGKNRIRKTAPATPTRTYGKVA
FT                   LSAEETLHRLWQRGLRIDDRPTNLRVLRSIGHFRLLVYMRRFQNPATKQFWPRTRFSDI
FT                   AELYAFDRRLRSITMDAVERIEVALRAALSNPLAIDYGSHWYIERERFVDLRQYARVLD
FT                   QIASECETRKAAALAHYYRTYARPDLPPIWLVCERLSLGALSRLFNALSIRDRKTAGRH
FT                   MWPDIPDTVLTSWLQSLTDLRNACAHHARLWGMKLTVSPPAKPAARNLARYAAEMTRPE
FT                   TFYARATMVKALLDPLGHGEEWRETLRTVLAGCEHVAPSAHLGFTTDWHLTPAWQQAPA
FT                   RPDGECNTMHFDIPTKVR"
FT   gene            complement(594739..595512)
FT                   /locus_tag="Bmul_3653"
FT   CDS_pept        complement(594739..595512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3653"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: bur:Bcep18194_B0711
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17337"
FT                   /protein_id="ABX17337.1"
FT                   /translation="MIGYTFGFGSVLIVFVAVLIASSIRIFREYERGVVFMLGRFWKVK
FT                   GPGLVLIIPIVQQVVRIDLRTVVFDVPAQDVITRDNVSVKVNAVVYFRVVDPEKAVIQV
FT                   ARFFEATSQLAQTTLRAVLGKHELDALLAEREQLNADIQKTLDAQTDAWGIKVSTVEIK
FT                   HVDLNETMVRAIARQAEAERERRAKVIHAEGELQASEKLLQAAQRLAQQPQAMQLRYLQ
FT                   TLTTIAADKNSTIVFPLPVDLLGVLLERWGGRREE"
FT   gene            complement(595509..597083)
FT                   /locus_tag="Bmul_3654"
FT   CDS_pept        complement(595509..597083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3654"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bam:Bamb_4387 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17338"
FT                   /protein_id="ABX17338.1"
FT                   /translation="MHAPRHGPPHAARGGRPRHPLSARVARAALFAVLLVVCAAVAAPP
FT                   PAPTPSLAPAGPAPVIVIPLNGAIGPASADFVVRSLKRAAREHAPLAILQLDTPGGLDT
FT                   SMRQIIKAILGSPVPVAAFVAPGGARAASAGTYIVYASHIAAMAPGTNLGAASPVQLGV
FT                   GGGTPAAPPQAPTSRGAGPSSASGTPAALPADTQSTEIRKATQDAAAYLRGLAQLRGRN
FT                   AEWAERAVREAVSLSANEARAQHVVDLIAQDPADLARQLDGRSVTTAAGTLRLATAHAP
FT                   LVVVEPDWRSRFLSIVADPNVALILLTIGIYGLFFEFANPGFVLPGVAGTICLLVGLFA
FT                   MQLLPVSYAGLALVLLGLGCLVAEAFLPTFGVLGFGGIVAFVIGALMLIDTDVPGYGIP
FT                   WPVIASLALGGALLVAGVSSVALRARRRPVVTGGEAIVGSIGEVLDDGLHADQPHGPNG
FT                   AAPPSAAGWARVHGERWRVACSAPLAAGCRVRVTGRQGLTLTVAPLYDAVPAPRAPLAS
FT                   PPQGDAR"
FT   sig_peptide     complement(596955..597083)
FT                   /locus_tag="Bmul_3654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.850 at
FT                   residue 43"
FT   gene            complement(597199..598287)
FT                   /locus_tag="Bmul_3655"
FT   CDS_pept        complement(597199..598287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3655"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B0713 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17339"
FT                   /protein_id="ABX17339.1"
FT                   /translation="MLAPLIYTERFCHTGTGMKQEDKGTVAIGLVAYSVALAVRRGVAA
FT                   APLLAQAGIAPALLEQPRARVSAQQYGALWNAIARALDDEFFGQDSHPMRSGSFVAMSQ
FT                   AALSAADGLHAMARAVNFMHCVLDDLHAELDANPQRVRLRFVHRNSGATPAMFTYATYF
FT                   IIVYGLTCWLIGRRIPLLHASFRCDTPPADHEYPSMFCDDMRFNQPDSYVDFDPEFATL
FT                   PVVQNAKTLKTFLRNAPASFIVKYRNPNALAPRVRAVLRGMPPAAWPGAAGMAARLYVA
FT                   EATLRRKLHQEGHAYQSIKDTLRRDLAFEALADPTRTIADVAAAAGFAEPSAFYRAFRK
FT                   WSGRSPAEYRDEVLARAGNARP"
FT   gene            598373..599506
FT                   /locus_tag="Bmul_3656"
FT   CDS_pept        598373..599506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3656"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bch:Bcen2424_4963 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17340"
FT                   /protein_id="ABX17340.1"
FT                   /translation="MDALYTEDQRMIRDAARAFATEVLAPNAAQWDRDAQLPDAVVAQL
FT                   GELGLLGMIVPQELGGSYTDYVAYALAMEEIAAGDAACATMMSVHNSVGCGPILGFGTP
FT                   EQKARWLGDMAAGRVIGAFCLTEPQAGSEANNLRTRAELRDGKWVLNGAKQFVTNGQRA
FT                   GVAIVFAMTDPDAGKRGISAFLVPTDTPGFIIGKPEKKMGIRASDTCPITLENCAIPEE
FT                   NLLGNRGEGLKIALSNLEGGRIGIAAQALGIARAAFDKARRYAGERVQFGKPLAEHQAI
FT                   QQKLADMAVQINAARLLVHHAAKLRTAGLPCLSEASQAKLYASEMAERVCSDAIQIHGG
FT                   YGYLVDYEVERHYRDARITQIYEGTSEVQRMVIARQL"
FT   gene            599681..601387
FT                   /locus_tag="Bmul_3657"
FT   CDS_pept        599681..601387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3657"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bch:Bcen2424_4962 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17341"
FT                   /protein_id="ABX17341.1"
FT                   /translation="MTVQAFLDARDFLLRHRTDYETAYRDFAWPVLDTFNWALDYFDPM
FT                   ARGNDRPALWIVDGATGTGEPYSFAQMSERSSRIANWLRGIGVGRGDRILLMLPNRVEL
FT                   WDAMLAAMKLGAIVLPATTQLSADDVRDRVQIGGAKYAIVDENETAKFEQPGLGLAQRI
FT                   VAGAPRDGWLAMNDGYAASGAFEPDAVTHANDPMLLYFTSGTTSKPKLVEHTHRTYPVG
FT                   HLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFYAPWNAQACVFAFNYARFEAKAVLDAL
FT                   VKYRVTTLCAPPTVWRMLVQQPLASFDVALREIVGAGEPLNPEIIERVKKAWGITIRDG
FT                   YGQTETTCLIGNSPGQPVVAGSMGRPLPGYRIALLDPDGAPVSEGEVALPLDADGARPV
FT                   GLMTGYANNRDATAHAMRDGHYRTSDIAMRRDDGYYVYIGRADDVFKSSDYRLSPFELE
FT                   SVLIEHPAIAEAAVVPSPDPVRLSVPKTYITLRQGYEESAALALEIFRFSRDKLAPYKR
FT                   IRRLQFAELPKTISGKIRRVELRRREIERGDDATARMPGEYWEDDFSAELK"
FT   gene            601486..603015
FT                   /locus_tag="Bmul_3658"
FT   CDS_pept        601486..603015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3658"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: bch:Bcen2424_4961
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17342"
FT                   /protein_id="ABX17342.1"
FT                   /translation="MNANPTPRTGQDVPTVKLLIDGAFVESATNEWRDIVNPATQQVLA
FT                   RVPFATVAEVDAAVQAAHAAYATWKNTPIAARMRIMLKFQDLVRANQQRIAKTLTAEQG
FT                   KTLPDAEGDIFRGLEVVEHACSIGTLQLGEFAENVAGGVDTYTLRQPLGVCAGITPFNF
FT                   PAMIPLWMFPMAIVCGNTFVLKPSEQDPMTTMELVELALEAGIPKGVLNVVHGGKEVVD
FT                   AICSHPLVKAISFVGSTAVGTHVYQLGSQHGKRVQSMMGAKNHAVVLPDANREQAINAL
FT                   VGAAFGAAGQRCMATSVAVLVGAARDWLPDIVEKAKALKVNAGHEPGTDVGPVVSRGAK
FT                   ARILSLIEAGVKEGAKLVLDGRDVKVPGYENGNFIGPTIFSGVTPDMSIYTHEIFGPVL
FT                   VVMEADTLDDAIALVNANPFGNGVGLFTQSGAAARKFQSEIDIGQVGINIPIPVPVPFF
FT                   SFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDDTTAGPVNTTIRLH"
FT   gene            603089..603988
FT                   /locus_tag="Bmul_3659"
FT   CDS_pept        603089..603988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3659"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: bch:Bcen2424_4960 3-hydroxyisobutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17343"
FT                   /protein_id="ABX17343.1"
FT                   /translation="MKIGFIGLGHMGAPMALNLLKAGHDVRAFDLSADALRALQDAGAQ
FT                   VATSPRDAAGGAAFVITMLPAAPHVRSVLTGEHGVLAGLESGATVIDSSTIDPASAQAF
FT                   GALVREHGGAFVDAPVSGGTGGAAAGTLTFMVGGSDADFERVKPVLAGMGKNIVHCGAT
FT                   GMGQVAKVCNNLVLGISMAAVSEAMALGVALGIDPKVLAGIINTSTGRCWSSDTYNPYP
FT                   GVIETAPSSRGYTGGFGTDLMLKDLGLANDAAKQARQPVYLGALAQQLYQTMSSRGDGQ
FT                   LDFSAVIRLYQPATKKDA"
FT   gene            603988..604779
FT                   /locus_tag="Bmul_3660"
FT   CDS_pept        603988..604779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3660"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bam:Bamb_4381 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17344"
FT                   /protein_id="ABX17344.1"
FT                   /translation="MIELDYVDDGAIACATLKRPPANAFTADGLRQLQAYVAELNANAR
FT                   VRALVITGDGPKFFSAGADLNTFADGDRAVAREMAARFGAAFEALHDARFVTIAAINGY
FT                   AMGGGLECALACDLRIAEAHAQMALPEPSVGLLPCGLGTQTLPWLVGEGWAKKIILTGT
FT                   RVDAPTALRIGLVEEVVDTGTSRDAALALARNVARQSPRAVASSKELIGLARRGVPRSA
FT                   ALAVERERFVDLFDTNDPREGVAAFLGKRAPQWQPEGEQSR"
FT   gene            604776..605915
FT                   /locus_tag="Bmul_3661"
FT   CDS_pept        604776..605915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3661"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bam:Bamb_4380 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17345"
FT                   /protein_id="ABX17345.1"
FT                   /translation="MSTPATNQDAFTDPAQDVLFRVVNRVALITLNRPSALNALSYEMV
FT                   RALAALFERCRNDDRIVAVVLRGAGDKGFCAGGDVRQLHRMVAQRETWLPFFVDEYRLD
FT                   HAIHTFPKPVVALMDGVTMGGGMGLAQGAALRVATERSKIAMPETRIGLVPDVGATHFL
FT                   ARMPVELELYVGLTGATLSGADALSAKLADLCVPSSWLDTFETRIERVNWDGDALPALR
FT                   KVFEPPCNVVPHAALDTQLPWIVRHFDKRSPVERIVATLKQDLARDELSREQRQWLQST
FT                   LDALMGHSPTMLAVTREALLRGRQMTLAESFRMELGIVARAIEEGDFCEGVRAHLIDKD
FT                   RKPRWAPATLVELRAERVRHFLTSPWKLFAHPLADLGAA"
FT   gene            complement(605968..606888)
FT                   /locus_tag="Bmul_3662"
FT   CDS_pept        complement(605968..606888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3662"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_4957 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17346"
FT                   /protein_id="ABX17346.1"
FT                   /translation="MTDKLDGVTTFVQVVESGSFALAAERLGMTRSAVGKAIARLEKRL
FT                   GARLLQRTTRSQSLTDDGQAYYDRCVRALAELEAAEADLDCGRNEPRGKLRLSVPLAFG
FT                   HHCVTPIVLDLARTYPHLRIDVSITDRFVDLIEEGIDLAVRIGPLEDSTSLAVRRLGTQ
FT                   YGSLGAAPSYLARYGMPQSLDDLKNHRTVAYSRSGVVQPWYLRAPDGSTVHIDMPHQLS
FT                   FDDVQAIAAAGASGFGIAWLPSWLLDQYVKRGEMVVVLDRCFVCEGDIHAIWPKTRYLP
FT                   RKTRCVIDALVEAVPPMIERAPANA"
FT   gene            607067..608605
FT                   /locus_tag="Bmul_3663"
FT   CDS_pept        607067..608605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3663"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_4956 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17347"
FT                   /protein_id="ABX17347.1"
FT                   /translation="MTLSESRWNAVALAAVCLTSLMFGLEISSVPVILPTLEHVLHGDF
FT                   NGMQWIMNAYTIACTTVLMAAGTLADRFGRKRVYVIGTALFGATSLLCGLAPNVPVLVA
FT                   GRLLQGASGGAMLICQIAVLSHQFREGRERGRAFGIWGIVFGIGLGFGPIVGGAIVAVA
FT                   SWPWVFLVHAPLAAVALALIGGAVQESRDPHAGTLDVAGIVTLSLAVLGLAFYITQSAA
FT                   LGLTSAAGLGVLGATVLAVGAFVVVERRSARPMFDFSVFRIRAFTGAIFGSMGMNFSFW
FT                   PFMIYLPIWFQVALGYDSVTAGLALLAYTLPTLVAPPFGERLALRYGPGVVIPGGLFTI
FT                   AAGFALMRIGSAAEHASWLTMLPGCVIAGIGLGLANTPVTNTTTGAVPSARAGMASGID
FT                   MSARMISLALNIAMMGFVLVAGIVANLKGGVAAAIGDASLRALAQEIAAGRTEDLRAIA
FT                   PALTQADPTGAALHAALVHGFGWVMVYGAAGVAVLATASAIAFAPTRRSVAVCE"
FT   sig_peptide     607067..607153
FT                   /locus_tag="Bmul_3663"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.456 at
FT                   residue 29"
FT   gene            complement(608667..609278)
FT                   /locus_tag="Bmul_3664"
FT   CDS_pept        complement(608667..609278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3664"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="KEGG: bam:Bamb_4377 metal-dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17348"
FT                   /protein_id="ABX17348.1"
FT                   /translation="MNPDTIRARLDFLREAERLKDVLRSGRTSSGRRESTAEHSWRLCL
FT                   MALVFADALPGIDTLKLLKLCVVHDLGEALHGDIPATEQAAHPDKNMHERDDLLTLTAA
FT                   LDPVLRNELVALWDEYDAAASPEARAAKALDKLETILQHTQGANPPDFDYAFNLGYGRR
FT                   YTDAAPLFSAIRAIVDADTQRRIDAQARTSSQTQTHTHRP"
FT   gene            complement(609413..609970)
FT                   /locus_tag="Bmul_3665"
FT   CDS_pept        complement(609413..609970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3665"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bur:Bcep18194_B0729 transcriptional regulator,
FT                   XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17349"
FT                   /protein_id="ABX17349.1"
FT                   /translation="MPDSPLHTPPLGPQLKRWRLLHRVKQSHAAALFRVAQSTLSRWEA
FT                   GVQQMSPDERATAERLLAARLDSAGDHALARLVAASAGRMHLVCDLTHRLLACSPSRAA
FT                   EFSQPLPMLLGTSLWRYATEEIVRMETALDTLGWHDCAGPPSVEFDTGTNASRVVPIHR
FT                   SRCRWTRIMLSDGSAARLVETL"
FT   gene            610482..611885
FT                   /locus_tag="Bmul_3666"
FT   CDS_pept        610482..611885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3666"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17350"
FT                   /protein_id="ABX17350.1"
FT                   /translation="MVRLVLLLLGIEYLRTRWRGLRALGWLWVVAGVGIFVDALDGALH
FT                   FPIEFFAWLFLIEGLATLAVAGSGVGGQRILRYVKGIAAVTAATLVFAGHHHGHFLLSM
FT                   IFGTLFLVDGLLQCTAAWMVRYRRWHVAFAWGAVEILLAVFFYQPYPTHYVGTVPYCLG
FT                   LLLMFGGMHLLSLAARVRRLTRNPAFATSPAPSVAPDLDDTRAVPSFTQTEWDGPPADD
FT                   ERALTVHVWTPTGSSKAEAHRYPVIDRYIAAVDVNGVISTGHAALESPEGIYISLYPAV
FT                   EIDRSPDEFTRLLRATRENDVPGLFQPDYATESKAWCPSTVRVRIRNYDPAKLAAFWST
FT                   YRQNTTYNLTHRNCSSSVSNALEAALDGAVWRLKGARAGWGAFVRLLLTPELWVAAQIR
FT                   KRAVTMAWTPGLTLDYARALSVLADPRPFAWWKVTRSAVTAIIALRRGWREQDNEALAG
FT                   GGSGTASVK"
FT   gene            612224..612955
FT                   /locus_tag="Bmul_3667"
FT   CDS_pept        612224..612955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3667"
FT                   /product="ribonuclease T2"
FT                   /note="PFAM: ribonuclease T2; KEGG: bur:Bcep18194_B0733
FT                   ribonuclease T2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17351"
FT                   /protein_id="ABX17351.1"
FT                   /translation="MLKTLARAAVAFAVASASLHAAAQTSYDYLLLAASWEPGFCASHD
FT                   TPECTNLAGSYAATSLSLHGLWPNNYDGNQPFYCGVPQSDVDLDNAHQWCSMDAYPISA
FT                   TTRNTLSTYMPGVASCLDKHEWFKHGTCSNSASPDAYWNQATGMISRLGNTSFNTYLQA
FT                   NAGKTVTRNQLLSAFEGAFGSNTRSAVSLKCTKINGVSYFTEAWIAVKTNATAQFPSAA
FT                   SLVTDGNTQGTCPTSGVYIAK"
FT   sig_peptide     612224..612289
FT                   /locus_tag="Bmul_3667"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.701 at
FT                   residue 22"
FT   gene            complement(613131..613862)
FT                   /locus_tag="Bmul_3668"
FT   CDS_pept        complement(613131..613862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3668"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   bch:Bcen2424_4947 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17352"
FT                   /protein_id="ABX17352.1"
FT                   /translation="MHDTPCAYAGRSIHFAGTNSAIRIRSPGRSSVTHPGNASDTVPAT
FT                   GNASGQHEASPLPAITPARTALLVMHYQTDILRLFPSVAPTLLANTRALCDAARASGVA
FT                   VYFANLRFSPGYPEVSPLNKNGQGIKQLGLFIDDAPSPELARRDDEPLIVAHRASVFFG
FT                   TDLQARLAAQHIDTLIMVGIASTGVVLSSVAYASDADFRLYTVKDCCYDPDPVVHEHLF
FT                   ATAFETRTTVLSLDDALRMLA"
FT   gene            complement(613898..614914)
FT                   /locus_tag="Bmul_3669"
FT   CDS_pept        complement(613898..614914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3669"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reu:Reut_B5154 helix-turn-helix, AraC
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17353"
FT                   /protein_id="ABX17353.1"
FT                   /translation="MDPLLRASGLRGYPALMRDMGCDPVPLLRRYHITEAALERDDTLI
FT                   SLRSATHLLEASAEVTGCGDFGLRLSSYQSIDVLGPLSVVLRNAPTIRDALNDVMRYLF
FT                   VHSPGIVVSVNERSRLVENTVAVSVELHLSGPVVTRQNSDLCLADAHNFLRLFAGDRYA
FT                   LQAVSIPHEPVVGRAVYERFFGARLLEEPVGATLYLARDTFAANVQGANASFHQIAEDY
FT                   IFRNFGAAQGSTSDRVRQVLRQTLGTSSADKAGVAAVLALHPRTLQRRLCAEGTSFEIL
FT                   RDDVRKQLAVHYLRNTRLSIGQISLMLGFPAQSALSRACRQWFDLTPSEIRVGNRPT"
FT   gene            615013..616527
FT                   /locus_tag="Bmul_3670"
FT   CDS_pept        615013..616527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3670"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_B5155 flavin-containing monooxygenase FMO:FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17354"
FT                   /protein_id="ABX17354.1"
FT                   /translation="MKTDFDVLIIGAGISGIGMACHLARECPDKRVGILERRRAIGGTW
FT                   DLFRYPGIRSDSDMFSFGYQFRPWHEYKVLADGPSIRQYVADTAREHGVDRLIRFGVRI
FT                   DGASWSTERCRWTVSARQEDTGEALTFTCAYLIPCTGYYNHDQGYLPDFPGQERFKGLR
FT                   IHPQHWPEELDYRGKRVVVIGSGATAVTLVPAMAGRAAHVTMLQRSPSYIFSVPAYDKI
FT                   SAALDRVLPTRWVYGLARWRNIRLQRLIYKAAKRWPRPVRSWLLSHVEKRVGGGVDMRH
FT                   FTPKYNPWDERLCAVPDGDLFKVLREGKASVVTDHIETFTESGILLKSGKTLEADIIVT
FT                   ATGLQLQSLGGMSLHVDGRQVEVGKTMTYKGVLMQDVPNFAYLFGYTNAPWTLKIDMAA
FT                   NYVCRLLKHMDAEGFQTVTAHAPGGEMLDESILGSLQSGYVQRGQDVLPRQGRALPWRV
FT                   LHSFEADRDMLLKDGIVDSALVFRRAASGADAAAVAGLAGGQPASA"
FT   gene            616540..617484
FT                   /locus_tag="Bmul_3671"
FT   CDS_pept        616540..617484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3671"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; peptidase S15;
FT                   KEGG: rme:Rmet_5227 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17355"
FT                   /protein_id="ABX17355.1"
FT                   /translation="MLSFDSRFPSEGEDCAGTLMLPDGNGRPPVIVMAHGFGAIRAAGL
FT                   YAFARRFVAHGYAVYLFDYRNFGDSGGMPRHWVSPRRHLADWAAAVAHVRTLPGIDRER
FT                   IVLWGTSFSGGHVIRTAANDRRIHAVIAQVPHVSGIASVRQVPLHVLARLSMAALLDHG
FT                   GRLFGRPYYRPIVGRPGDVAALTSAECREGYERLLPAGANWENKTLARVFLEVPFYSPI
FT                   RSARRVTAPTLIVAGRRDTVTPASAAWRAAVRIPQCEFHLLDGNHFELHLEDEAVCMQS
FT                   IELQLGFLDRHVGLGEPVRTEVGVPRVPASPLA"
FT   gene            617552..618613
FT                   /locus_tag="Bmul_3672"
FT   CDS_pept        617552..618613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3672"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: pfl:PFL_3454
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17356"
FT                   /protein_id="ABX17356.1"
FT                   /translation="MIYGAYGYTGELVVREAVRQGMRPIIAGRDGRKLKPLADAFGLEA
FT                   RAFEVANAKANLEDVAVVLNCAGPFSTTAVAFVEACIDSHVHYVDITGEIPVFQFCHAQ
FT                   HVRAAAAGIVLCPGAGFDIVPTDSLAAALKERMPDATRIDLAFSFGTKPSIGTVKTILE
FT                   SAASGGLVRRNHRLVSVPNAWRIRRIPFPGGARWGVSIPWGDVFTAGVSTGVPDGLVYC
FT                   ALPLALGLTMRLTNFMRGLFAVPAVSRMLDRLARRFFAGGPDAGARDIQRTAFWAEAIN
FT                   ARGETVTMTMSAPNVYAMTADTSLAIANRCLAGPVPAGYRTPSMLMGSAFFLERPGFDV
FT                   SYPGGAGVGRSQV"
FT   gene            complement(620442..621245)
FT                   /locus_tag="Bmul_3673"
FT   CDS_pept        complement(620442..621245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3673"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein GntR HTH; regulatory
FT                   protein DeoR; Helix-turn-helix type 11 domain protein;
FT                   KEGG: bvi:Bcep1808_0858 transcriptional regulator, DeoR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17357"
FT                   /protein_id="ABX17357.1"
FT                   /translation="MVSCSFVQYQDISCRSMLTTQRKKLILDRLARDGQVHAGELSVEF
FT                   GISEDTVRRDLRELASEGLLQRVHGGALPVSPALAPFELRRDIESDAKQRIARQAASMI
FT                   APGQTAIIDGGTTSAWLAKALPADLCATIVTHSPTVATALAGHPSVEIILIGGRLYKHS
FT                   IVAVGAAAMEGISRIHADWYFMGVTGVHPTAGLSTGDFEEAAIKRALAARAAETVVLAS
FT                   SSKLNAASPFVIGEITLAQTIVVEKSADRELLKQIETAGVTVVRA"
FT   gene            621276..621875
FT                   /locus_tag="Bmul_3674"
FT   CDS_pept        621276..621875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3674"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bur:Bcep18194_A4044
FT                   nucleoside diphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17358"
FT                   /protein_id="ABX17358.1"
FT                   /translation="MRATRDRVRIVESTVLSDNWYTLTKVTFDFLRRDGTWQRQSRETY
FT                   DRGNGATILLYCRHTGNVVLTRQFRMPVFVNGHDGMLIEAAAGLLDNATPEERIRQEAE
FT                   EETGYRVNNIRKVFEAYMSPGSVTEKLYFYLGDYDASMRVNDGGGIEDEGEDLEVLEMP
FT                   LRTALRLVRSGEIVDGKTIMLLQHLALSEIMEGRQA"
FT   gene            621872..622258
FT                   /locus_tag="Bmul_3675"
FT   CDS_pept        621872..622258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3675"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17359"
FT                   /protein_id="ABX17359.1"
FT                   /translation="MRPQLILIAGPYRSGTNGDPARIADNLVRLERAALAVYQRGHMPM
FT                   IGEWVSLPLARMAGSIQTGDAISEAFLYPVAHRMIQQCDSILRIDGESKGADADVNVAR
FT                   KLGLPVYYRVDDIPAASAGEHSVE"
FT   gene            complement(622394..623308)
FT                   /locus_tag="Bmul_3676"
FT   CDS_pept        complement(622394..623308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3676"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: bvi:Bcep1808_3320
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17360"
FT                   /protein_id="ABX17360.1"
FT                   /translation="MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTL
FT                   DGNVYTVGDAQERFSIQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESER
FT                   GKPRNPFINAGALVVTDVLCRRFVKAETALVEFVRRLIGANDIDYDSRVALSELQHAER
FT                   NRAMAHFMASFGNMQMPPETVVDAYCRQCAITMNCVELARAALFLANGGVAPATGERIV
FT                   DPSSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDA
FT                   NGNSLAGTLALEWLTTYSGRSIF"
FT   gene            623455..624243
FT                   /locus_tag="Bmul_3677"
FT   CDS_pept        623455..624243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3677"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bch:Bcen2424_4939 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17361"
FT                   /protein_id="ABX17361.1"
FT                   /translation="MRYVSAAGRPRAPSAPPRFPRTNSPLPMSFRILLVEDDVRLSTLI
FT                   AGYLRKNDYEVDTVLHGDAAVPAILSTRPDLVILDVNLPGKDGFEICRDARQHYDGVII
FT                   MVTARDEPFDELLGLEIGADDYVHKPVEPRILLARIKAQLRRAPARVAEGAPQPERYTF
FT                   GKFSIDRTDRSVVLPDGSTPDLTSAEFDLLWVLVCRAGEVVSRDDLMLQLRGVEFDGLD
FT                   RTIDGRISKLRRKLRDDASNPQRIKTIRSKGYQFSKHAWE"
FT   gene            624314..625444
FT                   /locus_tag="Bmul_3678"
FT   CDS_pept        624314..625444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3678"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bam:Bamb_4368 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17362"
FT                   /protein_id="ABX17362.1"
FT                   /translation="MIHKSRSQPNAPRLSPLRYIKWRWLHFRRAWTDTRSDRIPSWSRL
FT                   YLRTYLHLLGLVLLTALVPALALCIVLSPEVVWHSFDALPGDIWIVLAFVFVAPALAAY
FT                   RWMRPVWSDLVMVRERAIDFTGGRFNTRARESRSVIIGPLARTLNALAMRMERLIAAQR
FT                   DLTNGISHELRTPLARVRFALEMLREPGSEAEYRSALDSIAQDVTELDELIDMSLTYAR
FT                   LEYSSLQSNLEMTALVAWFEHQVSDAQLLYPERTIESRIAIESDLRVRMDRRLMSYAMR
FT                   NLLRNASKYAASRIIVGIALRHGNIAVFVEDDGPGVPENERERIFDAFVRLDRRTGGYG
FT                   LGLAISRQVLHAHNGRIAVVDPLELGGARFEISWPI"
FT   gene            complement(625490..627112)
FT                   /locus_tag="Bmul_3679"
FT   CDS_pept        complement(625490..627112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3679"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rsq:Rsph17025_0241 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17363"
FT                   /protein_id="ABX17363.1"
FT                   /translation="MSQSQPLAAPAVGNPRVTRVIFGIVVVLLGALLVGFGKSAFIFCL
FT                   LIGLLLTGMPVSIALGLTVLTYLFTMTAVPIESVALKLFTGIENFEIMAIPFFILAGGF
FT                   LTHGGVARRMIAFATSIVGHMHGGLGLAGVLACAMFAAISGSSPATVMAIGSILLPAMV
FT                   RQGFPNRFGAGVIATSGSLGILIPPSIVMVLYSVSTNTSVGDLFLAGVVPGILLALLLG
FT                   FVTWFIARRNGYPRFREFDGHGPLAATGHALWGLLLCVAFSVVPPAVLIGLLYLLLRAA
FT                   APGLAAGIGLIGVAVALAWLYVAYRVGRRFTHPTLLRAEAQRVWTTYWESVWGLLLIVV
FT                   VMGGIYSGVFTPTEAAAMSAVYAFLVSTCVYGDLPLRRVPKVLLDSASMSAMLLYIITN
FT                   AVLFSFLMTSENIPQQMASWILDQGLGPIGFLLVVNVLLLMAGNVMEPSSIVLIMAPIL
FT                   FPVARQLGIDPIHFGILMVVNMEVGMCHPPVGLNLYVASGITRMGITELTVAVAPWLAA
FT                   MLGFLLLVTYVPAISLWLPGLMR"
FT   gene            complement(627109..627687)
FT                   /locus_tag="Bmul_3680"
FT   CDS_pept        complement(627109..627687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3680"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bra:BRADO5526 TRAP-type
FT                   C4-dicarboxylate transport system, small permease component
FT                   (DctQ subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17364"
FT                   /protein_id="ABX17364.1"
FT                   /translation="MKLLDRLEEWLIATLMGVATLVIFVAVMHRYASGIAIPYLQDWLL
FT                   ALDLSWAQELCIYLFVWMAKFGAAYGVRTGIHVGVDVMINRLQPPARRVCIVFGLLAGA
FT                   LFTGVVGTLGARFVWALAQTDQVSPDLELPRWIVFLCVPLGSYLMCFRFLQVALHFLRS
FT                   GELPKHDHAQVDGLDAPAPSTPVPQGVQS"
FT   gene            complement(627708..628703)
FT                   /locus_tag="Bmul_3681"
FT   CDS_pept        complement(627708..628703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3681"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: gur:Gura_2784 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17365"
FT                   /protein_id="ABX17365.1"
FT                   /translation="MNLRRVVTGLCLSAFALTAAAQQPIVIKFSHVVAADTPKGKAADY
FT                   FKKLAETRTNGRVKVEVYPNSQLYKDKEELEALQLGSVQMLAPSLAKFGPLGAKEFELF
FT                   DLPYLFDSYDALHKVTDGPVGKRLMAKLESKGITGLAYWDNGFKVMSANRPLREPADFR
FT                   GLKMRIQSSKVLDAQFRALNAIPQVMAFSEVYQGLQTGVVDGTENTPSNLYTQRMNEVQ
FT                   KYVTVSNHGYIGYAVIVNRKFWSGLPDDVRTALEGAMRDATRYANEIAKRENDDALAKI
FT                   KATGKTELISLTPAQTADWKKALSKVHRDQEQRIGADLVRDVYRATGQSM"
FT   sig_peptide     complement(628638..628703)
FT                   /locus_tag="Bmul_3681"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            628772..630829
FT                   /locus_tag="Bmul_3682"
FT   CDS_pept        628772..630829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3682"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mms:mma_0468 signal transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17366"
FT                   /protein_id="ABX17366.1"
FT                   /translation="MSDNTYFPHSEAAHATGMSNGAGAPGRFVQQRWRVLLPFAAIGLI
FT                   VAGAFAAPLLAMRFERAQRHEQLISDTLWAQQSLGFEAQRLAEAMQIVGTDLAADPAPD
FT                   LFMRRAAELLQRSPEVVVLCRLERALAAMQCFPGGREGAAISHDAAAAEWRETAERARR
FT                   LGRPVASLADAREGTPRVALLVVPTPGGAGRAMAALVSIERLLTATLPWWFAHENAITL
FT                   TDPRGDLIAVHDPRVEGRGVYTHRIEVGFADQTFYLEANSTRGPPYLVPNLLSGAVAAL
FT                   SLLLAWSVWRLWRDLVRRARAEYALREQQALRQAMEDSLVSGLRTRDLDGRITYVNAAF
FT                   CEMVGYRADELIGCAPPMPYWAPEFSERSSQRHAQLLSGTLPRHAYESVFLRRDGERLT
FT                   VLINEAPLRDGTGRQVGWTASIVDISEQKRTQELQRTQNEQLHHMSRVMTMGEMASALA
FT                   HELNQPLAAANSYCTAALNLMTGDAPLDDAGGPRELLAKGRHQVERAGQIIRRVQQFVR
FT                   KTTPSLGPVAPDAVITGLLPLVQLQTSRSGERVDTVLEPALPPVLADRVLLEQVLLNLT
FT                   RNAFDAMAHLPASERIVLIRAERIAASEGDPAVVRIGVRDRGRGLPDEARDALERPFFT
FT                   TKPDGMGMGIAVCRSALETMHSRLRYAPSSDGACFYFDLRITEESCGTST"
FT   gene            630811..631428
FT                   /locus_tag="Bmul_3683"
FT   CDS_pept        630811..631428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3683"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: mag:amb0897
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17367"
FT                   /protein_id="ABX17367.1"
FT                   /translation="MRNLYLIDDDDVIRDALDALFRSRGLAARAFGDARAFLDAWREDA
FT                   FARAPACLLIDVRMPGMSGFELFAQLRDAGLGAHHAVVFLTGHGDIPMAVDALRAGAYD
FT                   FLEKPFSDNRLVDRVVAGLDHAYAHAAPPEATPDERFANLTPRERAIAERIVAGCTNRE
FT                   IADVLRISVRTVEVHRARVFEKLDVKNAIGLARLCTRAARPA"
FT   gene            complement(631489..633930)
FT                   /locus_tag="Bmul_3684"
FT   CDS_pept        complement(631489..633930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3684"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; surface antigen variable number
FT                   repeat protein; KEGG: bch:Bcen2424_4937 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17368"
FT                   /protein_id="ABX17368.1"
FT                   /translation="MTMTATASFRRPGVRHLCTMLVALWCATAAAQPLPAAGTAATDSG
FT                   SASASAASAASAASAVSAASAPADDATSHVCVADGGPSGRPSIGLALSGGGARGYAHLG
FT                   VLKVLEDNRIPIDCIAGTSMGAVVGGLYASGMPAEDMQKRLSQIDLADIAFDVTERADL
FT                   PQSRREDERYYINGLTLGFGAKGVKAPAGLVQGNRLQALLADWTAAVPTNQPFDRLPIP
FT                   YRAVATDLQTGQMVVLDHGSLPLAIRASMAMPGLFAPAEINGRALVDGGLVSNLPVDTA
FT                   RRMGADVVIAVDIGSPLRPLDALASPADVMQQMVGILIRQNVTSQRKQLHAQDVLLTPD
FT                   LGTIAFTDFQSANQAIAAGAAAATAALPRLKRFALSPADYAAYRSAHAQPLPPPIRITR
FT                   IDIKTSGGVPKRVVSDALHVKRGDIYDPKQVSQDLLALTTGGNFESVTQQIVSRGDDNV
FT                   LEINAREKYWGPNFLLFGLGMSSSSTDEGGFRLHVGYRRPWLTESGLEFRADTTIGSDL
FT                   QSARVELRQPLPGAYGLYISPYAEYQRRYVNLYDDSGEVKLNQYLMQTTRTGLDFGLPI
FT                   ARLGDFRMGIGYVTGHGSPNYNLPIDDTSGSLFWPTFSSQALTARARLVIDQLDDPMFP
FT                   RRGYFTELRVERSLWSHNSQSTQEFGDGISNTPYTEIYGKAMIAQQFGRHSVSATIEGG
FT                   KSIGGTNLINAFNFTLGGFQHLAAYAADQLTGNELAYGNVTYMNQLMTFNASPIKALSV
FT                   GASAEVGNVWSSGVQVGGGVLKQSYTFFTSLSTAFGPLYMGVALAPGGRRNIYLQLGRT
FT                   Y"
FT   sig_peptide     complement(633835..633930)
FT                   /locus_tag="Bmul_3684"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.967 at
FT                   residue 32"
FT   gene            634181..635215
FT                   /locus_tag="Bmul_3685"
FT   CDS_pept        634181..635215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3685"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: bam:Bamb_4366 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17369"
FT                   /protein_id="ABX17369.1"
FT                   /translation="MSTPLFGKLFAQPVAIDPGTASTRIYTHDRGVVLNQPSVVCFRKA
FT                   GGAASRSTLAAVGELAKALLGREPAHIEAVRPMQHGVIADAHAAGQMIRRFIDMSDTRS
FT                   RFGRRIEVTLCVPSDATAVERRALREAAFAAGVSEVALIDEALAAALGAGLPVTEPVGS
FT                   MVVDIGGGTTEVAVISLGGIVYREAIRVGGDQFDEAIINHVRGLHGVLLGEQTAEHVKK
FT                   TIGSATRAVPRRTAPAIGRGVEDGLPRAIELSNHDVADALAAPLKQVIGTVKSVLENAP
FT                   AELVTDIAHRGIVLTGGGALLADLERLLRDETGLDARIADDPATCAVRGAGEARGRLAV
FT                   RALG"
FT   gene            635394..637616
FT                   /locus_tag="Bmul_3686"
FT   CDS_pept        635394..637616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3686"
FT                   /product="Amylo-alpha-16-glucosidase"
FT                   /note="PFAM: Amylo-alpha-16-glucosidase; KEGG:
FT                   bch:Bcen2424_4932 amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17370"
FT                   /protein_id="ABX17370.1"
FT                   /translation="MANHDEATTTQAPQVAPVPPAQASGPVFIAPEADAQAPARNNQYV
FT                   LKSGDAFVVSDALGDIGGRDDGLFVDDMRVLSTWRLTFGGRAPSLLSGATSADNASFTA
FT                   HLTNRPLPPLGGRETPEGVIHIERMRVLEGDVLYEALTLTNYGATEAEVPLSLSFAADF
FT                   KDMFEVRGTPRPKRGTIAEPCVAEGAVRLRYDGLDGVERNVTVHFSPAPDALSVDRADY
FT                   TLTIAAQACVSIYLTVAATVGERPSEAPGCGRVALRTALVGVHRAMRARRETMARVRTG
FT                   NPLFDAWLDRSLADLGLLTTQLDTGPYPYAGIPWFSTPFGRDAIITSLQMLWLQPSLAR
FT                   GVLRFLAAHQAHETSAFRDAEPGKIMHEFRRSEMAATGEVPFALYYGGVDTTPLFIVLA
FT                   GAYAERTGDDALIDELWPALESAARWVIDKCDRNPYGLLDYQRTSERGLANQGWKDSHD
FT                   SVFHADGRFPDGPIALVEVQAYACAALDAMAACSRRRGHSADATRYALRAKTLREQVEA
FT                   LFWMPESGFYGIALDGHGDLCRVLASNAGHLLAFGLPEHARGAAVAGVLGSTLFQTGWG
FT                   VRTLAAGQPRFNPMAYHNGSVWPHDNALIARGLARYGDKTAAVNLLGALFEAAVSFEMR
FT                   LPELFCGFPRRRGEPPTAYPVACLPQAWAAGAPFMMLQACLGVSIDAARLEVRVERPAL
FT                   PEGVSWLRIDDLRVGDESVSLTFRRVDGQVVAAASEPGRVNVVAVL"
FT   gene            637712..637963
FT                   /locus_tag="Bmul_3687"
FT   CDS_pept        637712..637963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3687"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17371"
FT                   /protein_id="ABX17371.1"
FT                   /translation="MATDNRPNDGEHKLENLEAAVDHLHKSIESQSIAVGAAKGILFSL
FT                   IETLGALIGDPDLPEHARSGYEALRDKANELRGGLERH"
FT   gene            complement(638433..639335)
FT                   /locus_tag="Bmul_3688"
FT   CDS_pept        complement(638433..639335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3688"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4361 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17372"
FT                   /protein_id="ABX17372.1"
FT                   /translation="MAKLRPHLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRA
FT                   LEERLGCALFTRLPRGLDLTDEGRALLPVLSDAFSRIETVLQQFDGGRLRQVLTLGVVG
FT                   TFALGWLMPRLKRFRDTHPFVELRLRTHNNVVDLAAEGLDFAIRFGQGNWPATRNERLF
FT                   DAPLTALCAPEIARRLTQPADLAHETLLRSYRTDEWLGWFDAAQLEPWTVNGPVFDSSR
FT                   LMVEAAMQGMGIALAPACMFERELQLGLLARPLDIDVHAGGYWLTSLKSKSLTPAMTLF
FT                   RDWITAEASAAASAAADAD"
FT   gene            639463..640371
FT                   /locus_tag="Bmul_3689"
FT   CDS_pept        639463..640371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3689"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   beta-lactamase; KEGG: bvi:Bcep1808_5453 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17373"
FT                   /protein_id="ABX17373.1"
FT                   /translation="MTHSSQRRILLLAAATAPLALSLGACAARDATVSDAASPVGAAPA
FT                   SFAALERAAGGRLGVCAIDTATGRRALHRADERFPFCSTFKAMLGAAVLAQSVAHPGLL
FT                   QQRVTYGRSDLVNYSPVTERHVDTGMTVAELCAATIQYSDNTAANELMKRIGGPAAVTA
FT                   YARSIGDDTFRLDRWETELNTALPGDLRDTTTPAAMAANLRVLVLGDALPPAQRAQLIE
FT                   WLRGNKVGDKRIRAGVPTGWRVGDKTGTGDYGTTNDVGVLWPPSRAPIVLAVYYTQTRA
FT                   DAKAKDDVIAAATRIASATLA"
FT   sig_peptide     639463..639546
FT                   /locus_tag="Bmul_3689"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.811 at
FT                   residue 28"
FT   gene            complement(640985..642355)
FT                   /locus_tag="Bmul_3690"
FT   CDS_pept        complement(640985..642355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3690"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bam:Bamb_4357 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17374"
FT                   /protein_id="ABX17374.1"
FT                   /translation="MTRLQRAIARWRGVSLRRRLLIWLLPAACVIGLAASAGTYWGALR
FT                   ELDDLLDDQMRSMSKQIVVGPNGELSFRNRGDDKHAFKADDPDAVLLQVWRNGTLVYTT
FT                   DRDVALPPPAHAGTASVDVDGQPWRTYVTQRGGTTIRLAQARHARWEAIAGIAVHLLWP
FT                   LFSMLPVLAIGLWFGIGAGLRPLRTIAAGLRRRNAGNLEPVDVAAMPNEVRPLAEAIND
FT                   LLARLDRSFTLQRHFIADAAHELRTPIMGLSIQSQLLRRAATADERERILAQIHAGTTR
FT                   LGHLAEQLLTLARVEPDAQTAAFAPVDLAALCRSVVADRARVADAHRIDLGAIVSSPVI
FT                   AAGHADTLRVLLNNLVDNAIRYAGDGARVDVCARNDGTTPVLEVADDGPGIPEAERAHV
FT                   WERFYRGEGAQAATSSGSGLGLSIVKRIAEQHRATVALATTRGGRGLTVSVRFPDPS"
FT   sig_peptide     complement(642242..642355)
FT                   /locus_tag="Bmul_3690"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 38"
FT   gene            complement(642352..643014)
FT                   /locus_tag="Bmul_3691"
FT   CDS_pept        complement(642352..643014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3691"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bch:Bcen2424_4924 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17375"
FT                   /protein_id="ABX17375.1"
FT                   /translation="MRVLLVEDDPLIGSGLEQGLKQEGFAVDWVKDGDAASLALRSTGY
FT                   GLLLLDLGLPNRDGLAVLASLRRRDETLPAIIITARDGVPDRIAGLDSGADDYLVKPFA
FT                   LEELLARIRAVNRRHAGRAQTTLAIGPLRLDPVKHQVWLHDDEVPLSPKEFVLLHELMR
FT                   EPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDMIRTVRGVGYRIGDGT"
FT   gene            643250..643603
FT                   /locus_tag="Bmul_3692"
FT   CDS_pept        643250..643603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3692"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bam:Bamb_4355 conserved hypothetical protein 156"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17376"
FT                   /protein_id="ABX17376.1"
FT                   /translation="MKHLAAILTVALAALPAVGHAQYTGPSALAPTTVKQLLANGRDDQ
FT                   HVQLQGRIVKHLGGEDYEFADATGSIVVEIDDKLWIGNPPVGDKSEVKIVGEFERKWSG
FT                   RVKVDADRVDVLR"
FT   sig_peptide     643250..643309
FT                   /locus_tag="Bmul_3692"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.545 at
FT                   residue 20"
FT   gene            643657..644517
FT                   /locus_tag="Bmul_3693"
FT   CDS_pept        643657..644517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3693"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bur:Bcep18194_B0770 transcriptional regulator,
FT                   RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17377"
FT                   /protein_id="ABX17377.1"
FT                   /translation="MADNFDELASRIRAQFSELSPQFQAGAAFLLDHPEEVAMSSMRKV
FT                   AQRAQVQPASLVRLAQQFGFPGWNELRDLCVARVRTRPEPLTQRARSLVRPDAQASLAH
FT                   DLLAAQQQNLVATAAHNEHALADAAKLIRKASHVHVAGFRSCYPVAFGFVYGYRLFRPS
FT                   VSLLNGVAGSLEMELRAIGKHSATVIVSFAPYSAEATRVAQAAKAQGSRVVAITDSAVS
FT                   PIALHADAQLIFTHDSPSFFPSLVAAHAVAEALVAQLLALEGGGAIAQLERAEAELHAK
FT                   GAYVV"
FT   gene            644634..645494
FT                   /locus_tag="Bmul_3694"
FT   CDS_pept        644634..645494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3694"
FT                   /product="PEP phosphonomutase"
FT                   /note="KEGG: bur:Bcep18194_B0773 PEP phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17378"
FT                   /protein_id="ABX17378.1"
FT                   /translation="MPYAAHQTRHAETFRALHARAGAFVIPNPWDAGTARLLAMAGFPA
FT                   LATTSAGYAYSRGLPDNAIGRDAMLEHIAVIAAAGELPVSADLENGFGDAPEIVAETIR
FT                   LAAEAGAVGGSIEDATGRADAPIYPLDAAVERISAAAAAARALPFPFTLTARCENYLHG
FT                   RRDLADTIARLVAYRDAGADVLYAPGLTDPADIEAVTRSVQAPVNVVMGLQGAALSVDA
FT                   LAALGVKRISVGSALARAALGAFVRAIGEITHAGTFEFAAHAVPSRDLDRWFAASGNPP
FT                   VGFER"
FT   gene            645772..646038
FT                   /locus_tag="Bmul_3695"
FT   CDS_pept        645772..646038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17379"
FT                   /protein_id="ABX17379.1"
FT                   /translation="MTIRENHRSRFRIGDVVTLKTGGPRMTVTYAGPVVFDDADWLICQ
FT                   WFDEAGHFRQEMFHHETVVAEPRAISAGRARMRMYASRCRSAA"
FT   gene            646138..647316
FT                   /locus_tag="Bmul_3696"
FT   CDS_pept        646138..647316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3696"
FT                   /product="cytochrome P450-like protein"
FT                   /note="KEGG: bch:Bcen2424_4916 cytochrome P450-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17380"
FT                   /protein_id="ABX17380.1"
FT                   /translation="MNPTDPIAAVTHRDPYPYYAALLDGPPLAYDASLGLWVATRAASV
FT                   AAVLGHPACRVRPLDLPVPPALRGTSAGALFGELVRMNDGALRHQLPKQALHAALAQID
FT                   VQALRGRAATLAAAQRPALDDPDALNAWCIATPVRAVADLLGFDEPQLDDIAASVVDFV
FT                   AALSPLSDAASLARASDAARQLLERMTVRVAQSHARDGTLVAAVKDAAAQAGWHASGAL
FT                   VANLVGLLSQTCEATAAWLANTIVAWHRQSAESASSADVPDDATLDAFVAEVARFDTPV
FT                   QNTRRFVAARTTLEGVTLDAGAAILVVLAAANRDPAVHRDPHRFEPARTPGPDFGFGTG
FT                   PHQCPGARIARAVTVGAFGALLRAGGWPPREALKWDYRASANIRMPKFDAAR"
FT   gene            complement(647329..647655)
FT                   /locus_tag="Bmul_3697"
FT   CDS_pept        complement(647329..647655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3697"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17381"
FT                   /protein_id="ABX17381.1"
FT                   /translation="MQNEVLIQVAGSVVAIALYFLPAIVADRRGRHDKLIVAVFNALFG
FT                   WTGIGWLITLYWASQPNPQVDVAQTILAKRRGISMRTFSTGLVERVQRRVAAQERWAEK
FT                   QGCR"
FT   gene            complement(647740..648165)
FT                   /locus_tag="Bmul_3698"
FT   CDS_pept        complement(647740..648165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3698"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bam:Bamb_4349
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17382"
FT                   /protein_id="ABX17382.1"
FT                   /translation="MSFVTDVPAADSAAALAHFDASLRFETDCWDVHDALASGTPDFVL
FT                   LDVRSPELFAAGHVPGALNLPHRKIVEGKLAGYPRDTLFVVYCAGPHCNGAARAASRLA
FT                   RLGRPVKLMIGGITGWRDEGFALSNDTRSETADAPRP"
FT   gene            648276..649250
FT                   /locus_tag="Bmul_3699"
FT   CDS_pept        648276..649250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3699"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B0778 transcriptional activator FtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17383"
FT                   /protein_id="ABX17383.1"
FT                   /translation="MKNHLVVALAYDRLCTFEFGCVVELFALDRPELGVDWYRFAVCAS
FT                   EPGPVRAAGGITVAAPYRLATLDRADTIVIPGWRDADELPPEPLLKKLRAAHRRGARLC
FT                   SICSGVFVLAAAGVLDGLTVTTHWRYAEKLQARYPALRVNPDALYVDEGQIITSAGSAA
FT                   GLDMLLHLVRRDHGGAIANRVAQRLVLPPHRDGGQAQFVPRPVAPGGTDRLAKLIDWMR
FT                   AHAAQPHTLASLAAQAAMSPRTLQRQFADATGMSPLAWLIRERVNVAKDLLETHPALSL
FT                   AQVAARAGFGSEESLRRHFRRVAATSPAAYRREMDHGVRSGSA"
FT   gene            649346..650086
FT                   /locus_tag="Bmul_3700"
FT   CDS_pept        649346..650086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3700"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17384"
FT                   /protein_id="ABX17384.1"
FT                   /translation="MGLLGKLFRKKPRDAAAASASTSTVDAADEAGEAAGQRAPDIAPE
FT                   LASALAAFQAGRHESAIAAAAPHAARLADAARLCALAYSAMQRYPEAFPYWLALFDKEP
FT                   SAHNAVQLATTSVMCGEVARGEAWMQKAAEINHDTHEQSDVAARVNFISALMQSGRLRE
FT                   ALPHLAWVRDVYGHVRITDSTFLYMRGIPFFSSFLERSLEILKATQPADAIVPWYGELT
FT                   GKLDEEGEAQLAAWIGQLPGQPAA"
FT   sig_peptide     649346..649429
FT                   /locus_tag="Bmul_3700"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.819 at
FT                   residue 28"
FT   gene            complement(650171..652513)
FT                   /locus_tag="Bmul_3701"
FT   CDS_pept        complement(650171..652513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3701"
FT                   /product="Lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bam:Bamb_4345 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17385"
FT                   /protein_id="ABX17385.1"
FT                   /translation="MTASLTQPAFRRLGMKALLVQHDIDARTATARAATALADELRARL
FT                   VDLVIATSADDARAVVDADPAIQCLLLNWELGDDPQHTPAQAVLDAMRARNATVPVFLL
FT                   ASRASASAIPVDAMRKADDFIWLLEDTTAFIGGRIVAAIERYRETVLPPMFRALAQFSR
FT                   VYEYSWHTPGHTGGTAFLKSPVGRAYFEFFGESLFRSDLSISVGELGSLLDHSGPIGDS
FT                   ERYAARVFGAHRTYHVTNGSSMSNRVILMASVTRNQVALCDRNCHKSAEHAITMSGAIP
FT                   TYLIPSRNHYGIIGPIMPERLTAAAVRLAIDANALVRGRDGIDATPVHALITNSTYDGL
FT                   CYNVARVEALLGQSVDRLHFDEAWYGYARFNPIYRDRHAMHGDPAQHDASKPTVFATQS
FT                   THKLLAALSQASFIHVRDGRNPIEHARFNEAYMMHASTSPNYAIIASNDVSAAMMDGPG
FT                   GEALTTDAIREAVAFRQMLGRLHAECAENDDWFFNGWQPDTVVDRKTGRRMRFHEADET
FT                   LLATDPSCWVLHPGDAWHGFGDIEDDYCMLDPIKVSIVTPGIAPHGGLMPVGIPASVVT
FT                   AYLDRHGIVVEKTTDFTILFLFSLGVTKGKWGTLVNTLLDFKRDYDANVSLEQALPDLV
FT                   ARYPDRYRKLGLRDLCDLMFAAMSDLKTTEMMSRGFSTLPKPDFSPAEAFEHLVHNDIE
FT                   MLELSEMAGRTVATGVVPYPPGIPLLMPGENAGPADGPLLGYLKALEQYDLRFPGFTHD
FT                   THGVDVEDGVYRIACIKLPKRDGGNTR"
FT   gene            complement(652517..654046)
FT                   /locus_tag="Bmul_3702"
FT   CDS_pept        complement(652517..654046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3702"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0780 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17386"
FT                   /protein_id="ABX17386.1"
FT                   /translation="MSDASSSSSQPSTSSAAAAPKIGVIPATLMVAGNMMGSGVFMLPA
FT                   NLAATGGIAVFGWLITVVGAVSLALVFAKLAAIDPAAGGPYAYARKAFGPYMGYQTNLI
FT                   YWLANVLGNVGLAVAGLGYLTHFFPMLRDPLVFALAQIFVIWLFTYANILGPNVVGRVQ
FT                   SVTTIFALVPILAMAVFGWFWFSKDVYLAGWNVSGTGSFRAIGATLNFTLWAFIGVESA
FT                   SVSAGVVENPARNVPIATVGGVVLAAVCYVLSSTVIMGMIPNKALLASSAPFADAARLA
FT                   LGDTAANAVALCAALGCLGSLAGWTLLVGQTAKAAADDGLFASVFARVNSKNVPSAGLA
FT                   IVATIMSVQVLATMSPSASEQFGKIASIAVIMTLLPYIYSCIAIKVLGYGKMPSHQFTF
FT                   YTIVGLIGAVYALWAMVGSDGQQTRWSLIFVVATIVFYELSINRQREIEETHVHPGGRS
FT                   PRWVRYLALAVTIAALAATFWISVGRHRADILHARSPAVAAGAPATQHTGE"
FT   gene            654512..655966
FT                   /locus_tag="Bmul_3703"
FT   CDS_pept        654512..655966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3703"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bch:Bcen2424_4911 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17387"
FT                   /protein_id="ABX17387.1"
FT                   /translation="MTSVDTTPVLDHDKLVTFIERKWNDEILHALTDYIAIPAKSPAFD
FT                   PDWAKRGYLERVVTDAAQWAERQPVKGLKLEIVRLPGRTPVIFFETPATRSGSTDTILL
FT                   YGHLDKQPEFDGWRADLGPWTPKFENGKLYGRGGADDGYAIYASLAALGALDEQGVERP
FT                   RCVGLIETCEESGSYDLLPYVDALRDRLGQVSLVVCLDSGAGNYDQMWLTTSLRGLVSG
FT                   DLQVEVLEEGIHSGVYGGIAPSSFRVMRQLFERLEDAKNGNLLPRVFHCEIPASRLREA
FT                   DAAAAILGDAVWKGLPWACGADGKPVLPTTTDPREALLNSTWRPSLSVTGAAGLPALAD
FT                   AGNVLRPRTAFKLSLRLPPLVDAAQAVQQLKELLEVDPPYNAKVTFKPDAGAATGWSAP
FT                   DLAPWLASSLDAASRRHFGADCAYMGLGGTIPLMNVLQEGFPSAQFMVCGVLGPKSNAH
FT                   GPNEFLHVPYAKKLTAAVADVIASAR"
FT   gene            656055..657164
FT                   /locus_tag="Bmul_3704"
FT   CDS_pept        656055..657164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3704"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0783 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17388"
FT                   /protein_id="ABX17388.1"
FT                   /translation="MTVPPTADTDLLRMGADPLHAFVAALWERAGSHAREARLVTDHLV
FT                   GANLAGHDSHGIGMIPNYVAAWREGGLRLNGHASIVRDGGAVLTIDGGRGFGQVVAFEA
FT                   MVEGIERARRIGICAIGLRDVHHLGRIGHWAEQCARAGLVSFHFVNVPGDLLVAPLHGT
FT                   DARFGTNPFCAAYPRAGKPPLLLDFATSAIAYGKTRVAYNQGRRVPAGSLIDHRGQPTD
FT                   DPAVMHVPPFGALLPFGLHKGYALAAMCELFGGALVGGHTTYADTVQKTSAIVNGMLSV
FT                   LIDPNAFDAADAAREADAFVEWAKASPPAGDEPVRMPGEPEEASRAARTAGGIPVDRAT
FT                   WRQIRDSAAAVGFEEAELDAWTQRCCVGA"
FT   gene            657178..657579
FT                   /locus_tag="Bmul_3705"
FT   CDS_pept        657178..657579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3705"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: bur:Bcep18194_B0784
FT                   TfoX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17389"
FT                   /protein_id="ABX17389.1"
FT                   /translation="MSWQAEKARGDEIAYQLSGFGAVTVTRLFGGAALRLDGVMFGFVA
FT                   RGSLFLRVDDVNRPAFVAAGMGPFSYAGRTRTVALDGYYETPADVLEDAGALFDWCRSA
FT                   YRAALLAGPPKGRTRAAPKAKRVTARKRA"
FT   gene            657865..658443
FT                   /locus_tag="Bmul_3706"
FT   CDS_pept        657865..658443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3706"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: bch:Bcen2424_4908
FT                   NnrU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17390"
FT                   /protein_id="ABX17390.1"
FT                   /translation="MLVLIAGLAIFLGVHSIRIVAEGWRAAMVARFGANGWRARFSVVS
FT                   IVGFALIIRGYGLARENAALLWVSPVGVRHLTGMLTAIAFVLLAAAYVPRNRIKTLVGH
FT                   PMAAGVMVWAIAHLLANGTLHAVVLFGAFFVWSLVDFVVLRARDRRDGVRYPAGGLAGD
FT                   VGTVVAGLVAWAVFASFLHGWLIGVRPFG"
FT   gene            complement(658510..659247)
FT                   /locus_tag="Bmul_3707"
FT   CDS_pept        complement(658510..659247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3707"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bam:Bamb_4338 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17391"
FT                   /protein_id="ABX17391.1"
FT                   /translation="MLALVILAGLWAGLQNALAGGGSFVTLPALIVFGMSPLAANITST
FT                   VALFPAQVATGWASRHMVRGAGKLPFRALFAISVVGGALGGLLLLKTPSSIFSRLVPWL
FT                   VLFATVLFAWGSFFRRPAGEAAHIGPVAAAISQFLIAIYGGYFGGGIGFLMMAALTMAG
FT                   LSPRHATSTKNALAGVMNASAVVLFVTSPQLHWGAALALGGGAVVGGLLGTWALHRVNE
FT                   RMLRIAIVCIGAALTVALFVKPI"
FT   sig_peptide     complement(659188..659247)
FT                   /locus_tag="Bmul_3707"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.945 at
FT                   residue 20"
FT   gene            660099..660347
FT                   /locus_tag="Bmul_3708"
FT   CDS_pept        660099..660347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17392"
FT                   /protein_id="ABX17392.1"
FT                   /translation="MRRNKSLLKSALLVIRDNSRYKYGEGVEMHIQYQTSIRRVANIRC
FT                   IGAGEPGYAGDSNRGVNAGPIRKAHGIHDGPDFFLSP"
FT   gene            660547..668661
FT                   /locus_tag="Bmul_3709"
FT   CDS_pept        660547..668661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3709"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   rso:RS05070 putative hemagglutinin/hemolysin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17393"
FT                   /protein_id="ABX17393.1"
FT                   /translation="MVSSSVLSNHVDVPVAAGAQSASSPGGPANFLLSAHKEDVANYAR
FT                   SGNDLIVEFKDGRTLRVQAFFENGADYHNLVFVQDDGRLLVQFGPALQASGDGIVESAV
FT                   AYAPIGDGLSTGALLGILGGVAAAGGIAAAAASGGGGDGGGGSGVGGLGGGSAPGRLTI
FT                   ESVAEQSIGGNASVVTRHGTPTITGSGAQPNAKVTIFIDGQPVGTVTADAGGRWSYTPG
FT                   TLPDGSHQISVTQTDANGNSSAPAAVGVVIDTVVPGVPAITAVSDDAQHPIVSGGATND
FT                   TTPTLSGTAEAGSTVNVYDGTTLIGTTTADASGHWTFTPAAALGEGVHAITVTATDIAG
FT                   NVSAPSAAFGLTVDTTAPVAPTVNPTDGTSLSGTAEAGATIQIDTNGDGVPDATVTADP
FT                   SGTWTYTPSTPLPVGTQIGVTASDAAGNTSPAASVTVTGDVTAPAAPVIAGVTDDVGSV
FT                   LGAIVSGGNTDDTTPTLAGTAEAGSTINIYDGTTLLGTTTADASGSWSFTPTTGLGEGT
FT                   HSLTVTATDSSGNVSVPSAAFDLTVDTTAPSAPTVNPTDGTSLSGTAEAGATIQIDTNG
FT                   DGTPDATVTADPSGAWTYTPSAPLPLGTQIGVTASDAAGNTSPSASVTVTGDVTAPAAP
FT                   IIVSVADDAGSIVGALTSGGSTDDTTPTLSGTAEAGSTINVFDGTTLLGTTTADASGNW
FT                   SFTPASALGEGAHSLTVTATDSSGNVSTPSTAFDLTIDTTAPSVPTVNPTDGTSLSGTA
FT                   EAGATIQIDTNGDGTPDATVTADPSGAWTYTPSTPLPVGTQISVTATDAAGNTSPSASV
FT                   TVTGDVTAPAAPVIAGVTDDVGSVTGAIVSGSSTDDTTPTLTGTAEVGSTISVYDGTTL
FT                   LGTTTADASGNWSFTPATALGEGAHSLTVTATDSSGNVSTPSTPFDLTVDTTAPVTPTV
FT                   NPTDGTSLSGTAEAGATIQIDTNGDGTPDATVTADPSGAWTYTPSTPLPVGTQIGVTAS
FT                   DAAGNTSPSATVTVTGDVTAPAAPIIVSVADDAGSIVGALTSGASTDDTTPTLTGTAEG
FT                   GSTISIYDGTTLLGTTTADASGSWTFTPAAGLGEGAHSLTVTATDSSGNVSTPSTAFDL
FT                   TVDTTAPAAPAVNATDGTSLSGAAEAGATIQIDTNGDGTPDATVTADASGTWTYTPSTP
FT                   LPVGTQVTVTASDAAGNTSLPTSVTVTGDVTAPAAPVIAGVTDDVGSVTGAIVSGGSTD
FT                   DTTPTLSGTAEAGSTINVYDGTTLLGSTTADASGNWTFTPATALGEGAHSLTVTATDSS
FT                   GNVSVPSAAFDLTVDTTAPSTPTVNPTDGTSLSGTAEAGATIQIETNGDGTPDATVTAD
FT                   PSGAWTYTPSTPLPLGTQIGVTASDAAGNTSPSATVTVTGDVTAPAAPVIAGVTDDVGS
FT                   VTGALASGGSTDDTTPTLSGTAEAGSTINVFDGTTLLGTTTADASGNWTFTPATALGEG
FT                   AHSLTVTAADSSGNVSVPSAAFELTADTTAPSAPTVNPTDGTSLSGTAEAGATIQIDTN
FT                   GDGTPDATVTADPTGAWTYTPSTPLPVGTQIGVTASDAAGNTSPPASVTVTGDVTAPAA
FT                   PIIAGVTDDVGSVTGALVSGGSTDDTTPTLSGTAEAGSTISVFDGTTLLGTTTADASGN
FT                   WTFTPATALGEGAHSLTVTAADSSGNVSVPSAAFDLTVDTTAPSAPTVNPTDGTSLSGT
FT                   AEAGATIQIDTNGDGAPDATVTADPSGAWTYTPSTPLPVGTQIGVTASDAAGNTSPSAS
FT                   VTVTGDVTAPAAPVIAGVTDDVGSVTGALVSGGSTDDTTPTLSGTAEAGSTISVFDGTT
FT                   LLGTTTADASGNWTFTPAAGLGEGTHAITVTATDASGNVSLPSAAFDLTVDTTAPATPT
FT                   VNPTDGTSLSGTAEAGATIQIDTNGDGTPDATVTADPTGAWTYAPTTPLPVGTQIGVTA
FT                   SDAAGNKSPAASVTVTGDVTAPAAPIIVSVADDVGSITGALTSGASTDDTTPTLTGTAE
FT                   AGSTISVYDGTTLLGTTTADASGSWTFTPTAGLGEGAHSLTVTATDSSGNVSTPSTAFD
FT                   LTVDTTAPSTPTVNPTDGTSLSGTAEAGATIQIDTNGDGTPDATVTADPSGAWTYTPTT
FT                   PLPAGTQIGVTASDAAGNKSPAASVTVTGDVTAPAAPVIASVTDDVGSIVGALTNGAST
FT                   DDTKPTLTGTAEGGSTINVYDGTTLLGSTTADASGNWTFTPTTGLADGAHALTVTATDA
FT                   SGNVSTPSAAFSINVDTVAPTATATLTTLTDNTGAPNDWVTGDTTPILGGTLSGALGAG
FT                   EVVQVSLDGGAHWSAATVNGTNWTWYTDGVLAAADYTATVRVVDAAGNIGGSTQQTFTI
FT                   DPNVAPVVSAQASGNLLGIVGANLLNLIDLSTQQAFGASDYNNNIDHVTLHYGGLLGLG
FT                   ALHFGANQALANELGLHFDIVNNNGILGVIGPSSDMTITAADGGAIDNLKLNEFLGSIT
FT                   LTGGVISISALDSVTISATDKTGLSASATAGQLLNANLLGSSQSTSIIEGTQNGDTVNG
FT                   TSGNDRLYGYNGDDVLNGGDGNDLLRGGAGNDTLNGGNGNDILIGGAGDDTLTGGAGTD
FT                   VFLWEVVTPADNTGGNGHDVITDFQLATGPTDTGGDKIDLSKLLVGYTADADGPAHYVD
FT                   GVPTIDSGDTIGQYLNVTNVGSDTVISIDRDGAGTAFGSETLVTLNNVTTNLETLLANH
FT                   QIIV"
FT   gene            668800..670494
FT                   /locus_tag="Bmul_3710"
FT   CDS_pept        668800..670494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3710"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   rso:RS05071 putative outer membrane efflux transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17394"
FT                   /protein_id="ABX17394.1"
FT                   /translation="MMHKTTARFRFVRCRAERAAHTVSLSGHLLFAAAWLGIAPAVSAA
FT                   PPLPAGGLSVPATTAARSNASVVPLPSALPLAAPHRFDAPPLPRAMPADPMRRIVLSNL
FT                   SRAFASSDELPPVRPSRDGVTTITPDPDPIDSALDAPIDTPPVTDAVGASDDTLRIALD
FT                   DLSLRDAVGIAIARHPDIGRANAEVAQSTSEVEVAKAAWYPKIDYGVRPGYGGSFGSNG
FT                   NRTGTRASIGVSQLLYDFGRTSSRISAADSTLSQRRFQLADTIETVAYQTASTFIELAA
FT                   SQDVIAAAQRQVAALTETRAKILDRVRAGLSVSSDRNLVELAILHAQAEVLKAHTRFDV
FT                   AAAKLTELIGARPRRVAGLGGTVGFVGGLGSIGGNVEHTPSVLAAEAAVDAADARVRLA
FT                   EAERFPSIGIGASRAISSGRPNASNDTWIGLAVSGNYSLGGLAKHQIAAAEAELRANRE
FT                   SLENQRLVTRSALKAAQIEVSGAAARRASYEKVIALSRASRDLYWQEYILNKRTLTDVV
FT                   NPERDIFESEVEWINALADGSIARVKAYVAVGKFVELLREHEGSRHE"
FT   sig_peptide     668800..668934
FT                   /locus_tag="Bmul_3710"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.949 at
FT                   residue 45"
FT   gene            670487..672715
FT                   /locus_tag="Bmul_3711"
FT   CDS_pept        670487..672715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3711"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rso:RS05072 putative composite ATP-binding
FT                   transmembrane ABC transporter protein; TIGRFAM: type I
FT                   secretion system ATPase; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17395"
FT                   /protein_id="ABX17395.1"
FT                   /translation="MNDAFRPARDSGADLARWVDPLLFAARHLGLTVSPEQVRGTAAWA
FT                   VGSAPETAIVDIAAAAGLAAQFVELPVAKLTATMLPALAMIDDAHVGVIVSIAAGRAIV
FT                   QFAIDGQPVERAIDVNAPAPTWPARVLLVQRRVPMRDARVDDYLSAKPDTWLNDLFAAQ
FT                   WKVLLDLGAGSLFGNLLAIATSLFAMQVWDRVVPARATHTLWVLASGVALALVLELVLR
FT                   TVRVSIADHFGKQADLTLSAMFFARVLDIRNDARPRSPGTLVAQLRDLEQLRELLTSST
FT                   MGVLIDIPFVVTFLFIIWMLGGPLAFVPLAAIPLLILPGVFAQIPLAKLSNQGLAESAM
FT                   RNAILMESIYRAEDIKALQAEPRFRQLWDHTNRVNADIGLRQRRIAGLLVNLAQTVQQL
FT                   AYVGVLIAGVYGILDSSLSFGAVLACSILTSRTIAPLGQIPAVLSRIQNVRAGKKGLDN
FT                   LLALPVDHDPAVDAYHRPSLVGRYRFEDVTYSFDPQEKTVLNVPKLSIEPGERIAILGR
FT                   VGAGKSTLLRLLGGLATPVQGRILFNDTPLPLIDVADVRRDVGMLLQESSLFYGTLREN
FT                   LLIANPLATDDAILAAMKVACADQLLLRQPHGLDLKLRESGIGLSGGQKQALMLARVIL
FT                   RAPNVLLLDEPTASLDDATERAIVERLRQWLGNRTLIVATHRYPVLSIVDRIIVIDGGR
FT                   IVRDGPKDEVLQALRGHATTAAQAGAATARAAAGDGGALPPAIAEEAR"
FT   gene            672712..673884
FT                   /locus_tag="Bmul_3712"
FT   CDS_pept        672712..673884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3712"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rso:RS05073 putative hemolysin-type secretion
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17396"
FT                   /protein_id="ABX17396.1"
FT                   /translation="MSDFTWSRRGAREAAHARPVLWLIVAALSVFLVWSVFAGLDEVAV
FT                   GEGKVTPASKGQIIQSLEGGILSELVVREGDVVDAGQTLATLDPVLARSSMEETLERIT
FT                   ALQGRAARLHAEMNDLPSVAFPAELANEKAVTERERQLFVANRRAFRENVANLREQLRL
FT                   AEDELRIALPLLKTGATNEVEVLRLRQKAAEFSTKLAATQSEYYVALKADYSKTMADLE
FT                   PLLKVREGRADQLRRTVIRSPARGIVKDIRVSTVGGVVQPGGVLMEIVPLDDQLLIEAR
FT                   LSPRDIAFIHPGQEATVKITAFEPSIYGSLPAKVERISPDTIEDQVDRRVYYYRVYVLT
FT                   QHAYLETRDGKRHPILPGMVATAEIRTGRRTVFEYLVKPLNRAAEALRER"
FT   gene            complement(673944..674501)
FT                   /locus_tag="Bmul_3713"
FT   CDS_pept        complement(673944..674501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3713"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   bur:Bcep18194_B0793 protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17397"
FT                   /protein_id="ABX17397.1"
FT                   /translation="MRLPYYTIGHSNRPLDEFIAMLADAQVALLVDVRKMTRSRANPQF
FT                   NEATLPDALADAGIAYAHIAALGGLRGKSHDVPGDVNGFWTNASFHRYADYALSDTFRA
FT                   GLDELIALGRRQRCAIMCSEAVWWRCHRRIVSDYLIAHGETVLHIMARGRIEPARLTAG
FT                   ADVQPDGTVVYPRAEGAASSQA"
FT   gene            complement(674498..674725)
FT                   /locus_tag="Bmul_3714"
FT   CDS_pept        complement(674498..674725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3714"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17398"
FT                   /protein_id="ABX17398.1"
FT                   /translation="MTTRFRIGDHVRWNSEAGYVTGTIVAIHTEDFDYKGHRHRASPDD
FT                   PQYEIRSDRTDHIAAHRGRVLERISGKGDT"
FT   gene            674916..676607
FT                   /locus_tag="Bmul_3715"
FT   CDS_pept        674916..676607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3715"
FT                   /product="Parallel beta-helix repeat"
FT                   /note="SMART: Parallel beta-helix repeat; KEGG:
FT                   bur:Bcep18194_B0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17399"
FT                   /protein_id="ABX17399.1"
FT                   /translation="MSDGTNRQVWGQADHPATLGNAGPIDRFDRGTQCRRRRDRAVFTG
FT                   TTQRAPAGERAIAYRPPRAAMRHCRCAAISAEQARLEVRSFRACAMRRSTVSMRGPPAA
FT                   VCRPLPAAARKRHAMKNMLHARGPAPAAVLLCAGCWAAWPAVAESPASGSLTRFDAWHT
FT                   RVSDRDARAPRAAGALPVATIQPSANGGDQADALQAAFDALQPGQRLVLAPGRYEVGRS
FT                   LTVSKADVVISGYGATLIATTAGDQTLTMSGSGSTLVGVTLIGTGTTRLATRESTKVQV
FT                   TGRGVQVLGVTIRGGASAGIFVYGGRQVAIVGNTVSATLADGIHVTNGSTDVRVQRNTV
FT                   TGTGDDLIAVVSYQSDGRLSGNVLIDGNSVSGNPWGRGISVVGGRSVTISNNTVAGVQK
FT                   AAGILVAQEDSWHTYGVTDVRIENNVVDAIQDGTNANNGLPPTNQAAIELDTWSGAVSY
FT                   GVVKGNRVSRSGFAGFRAYGNVCQFAVIDNAFTSIADAPVSLLANACPASAIVVYGNTL
FT                   SGVALPPSIGASTSGTIPAGGAVTTSLPTVRTQLMQTSGTRMPKHR"
FT   gene            complement(676675..677304)
FT                   /locus_tag="Bmul_3716"
FT   CDS_pept        complement(676675..677304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3716"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bur:Bcep18194_C7667 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17400"
FT                   /protein_id="ABX17400.1"
FT                   /translation="MKILIVDDHPVLRDGVEALLRRNDAALAVVQAASADDAMQMLDQH
FT                   ADIDAIVLDLKMRGTSGVDAIAALARARPALQIIVLSSSEDPRDVRAAFAHGALGYVPK
FT                   SASPHTLLSAIVMVLNGERYVPPLLLDDGAPYTIEPPRHAAGAPLTPRQIEVLRYLAEG
FT                   VPNKVIADRLGLSEKTVKAHITAIFRTLHVLNRTQAAAAGRKAGLI"
FT   gene            complement(677632..679623)
FT                   /locus_tag="Bmul_3717"
FT   CDS_pept        complement(677632..679623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3717"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bvi:Bcep1808_3360 integral membrane sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17401"
FT                   /protein_id="ABX17401.1"
FT                   /translation="MRIGAADRRLHIDVSSSFRTPYGARQSRAQARRISYESARRRLFC
FT                   LKDRLSAHIVRHPPRPRATNVRSPMRPHRLFSIDSTDIAHDAATASIAATTLLAVALAS
FT                   ALHRLGSLDATVGTVWVSYVAGSSAGLAIVAHRDRRSAMRAGNRTVSSAWRVAFGAAAG
FT                   IGWGSAGLHATAVADAHTQIAVAMATLAVVAAAAPHFSPSTPALLAFVLPATAPGVVAA
FT                   ALSPHAAPRAIAPTLFGIAALAGIVALLAHRTFIRHARLQSDAERRADALQRDRDAAVQ
FT                   RAVDLRRQKLRAEAANLAKSRLLAAASHDLRQPSHALGVLVGALRGVPMPDDGQRLLQQ
FT                   IELSTRALDTLFGALLDVSRLDAGIVEVHRRPFAIDTVLARVCNEYLLDASAKGLRLSR
FT                   VPCRAIVDSDPVLIERVVRNLVSNAVRYTDAGRIVVGCRYRGAHIAIEIRDTGRGIARD
FT                   QLELVFREYYRVDGAASDHDGGFGLGLAIVRRLVALLGCRLSVRSEPGRGSCFVVSVPR
FT                   ARPAGGVRRHAARAAAFVVVVDDTRAVRDAIARRLARWGYDTLSARSADEAIDRLSRCT
FT                   TRPSVFVSALRLHGTETGIDVIDRLRAEYNLAIPALLIGDASDTAPLADANGCLLLHRP
FT                   IENGQLRAAIARLVATGAPAGAVEAIDD"
FT   gene            680208..680609
FT                   /locus_tag="Bmul_3718"
FT   CDS_pept        680208..680609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3718"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17402"
FT                   /protein_id="ABX17402.1"
FT                   /translation="MASRLAASAMARSVVLASFVFVASAHAEPVVTGPLNVDGSLVVLG
FT                   PVTVDGPLTVAGDISARGPITAASIERHPPDGQALRKGGGNNTFHGPLTVHGPLIVYGD
FT                   LEVRGPITVGGPLHAAGAVDAEGPVTERR"
FT   sig_peptide     680208..680291
FT                   /locus_tag="Bmul_3718"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 28"
FT   gene            681009..682298
FT                   /locus_tag="Bmul_3719"
FT   CDS_pept        681009..682298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3719"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bch:Bcen2424_4903 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17403"
FT                   /protein_id="ABX17403.1"
FT                   /translation="MFVQSDRHVASYYAGTYPAPIPRRPALDEHVRADVLVVGAGFSGL
FT                   HTALRLALAGLRVVVLEASRVAWAASGRNGGQALLGWSCDMPPLEAALGRDGARLLWDS
FT                   MRWAAAEVRELPARHGFDVDYRPGSLWAAVRPRRVAMLAQARDEAAERWGYDRLRVIER
FT                   HALRDWIGSTRYQAALYDPEAGHLNPLKLALGVAHALERAGGRIFEQSRVLDYRETDSG
FT                   YVARTETGEVQADCLVLACNAYVDTLDRELSRRLLPVGTYQIATAPLAPDVARTLLPQN
FT                   SCVIDNQFVPDYFRLSPDGRLLFGGGCTYLGGIPADIAAATRPHVERVFPQLRGVPIDY
FT                   AWGGHIDISMRRTPDIGRVGQRFWLQGFSGHGVLPTLAGARAVADAVLGDDRLLAQYRR
FT                   IRNRRFPGGDRLAAPLEAIGKAWYRLRDTV"
FT   gene            682271..682873
FT                   /locus_tag="Bmul_3720"
FT   CDS_pept        682271..682873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3720"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: bur:Bcep18194_B0803
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17404"
FT                   /protein_id="ABX17404.1"
FT                   /translation="MVPSARHRLTASEFIMNEQEEIESLAILIRDLRKHRKVTLSELAE
FT                   RIGRSVGFLSQVERGLSRPTVADLTAIGEALGVPTTYFYSLSKPRSIPWVTRPDERRTV
FT                   YYADGITDVLVSPTMRARFSILESHLAPGASSGERPVDDSDEQGGFVLEGELTIWVDGD
FT                   DTPVTLGPNDAFQLPAHKRFRYANLTDRPTRVIWVFT"
FT   gene            682950..684296
FT                   /locus_tag="Bmul_3721"
FT   CDS_pept        682950..684296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3721"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   bvi:Bcep1808_5375 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17405"
FT                   /protein_id="ABX17405.1"
FT                   /translation="MADVVPALVDEVRAFRRAHPEIRYVDLISVDLPGHFYGKRYPIDA
FT                   LEKVAAGALLKLPQNCILLGTQGGLYRIGDYCFNDGDPDAPRRLIPGTLKPVRWERRPL
FT                   AQMLISSDGTASPIEFEPREVLARVLRRFAARGIRPVVAFELEFYLFAAQLEDGMPQYP
FT                   RDRLSDDRDDQPNMHIERLSRFSDVLHEMVDAAREQGIDATVITAELGPGQFEINFGHT
FT                   DDALRAADWSALFCRSTRGVALRHGYRASFMGKPYLHAPGSGMHVHVSLYDADGRNLLA
FT                   EDAQRPLRHAVAGCLALLPHCMPIFAPNHNAFRRYGSMVNAASRASWGFEDRDACLRIP
FT                   ESDARNLRIEHRLASADANPYLVLAAILTGIEHGLDAGVEPIAPLNDDRGSGIDFPKEM
FT                   LSAVAAMQSHAAVRDGLGSEFVMVYCEHKRQEELDFRNEIGAREYRWFL"
FT   gene            complement(684333..684791)
FT                   /locus_tag="Bmul_3722"
FT   CDS_pept        complement(684333..684791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3722"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17406"
FT                   /protein_id="ABX17406.1"
FT                   /translation="MRISVSRIVGVDRRRLFTWSQDYARRLVWDSFLADAYLLDETTAD
FT                   VGVDAFCRSQSGATMVSRYVSYRPPQVAAIEMVDGPSVLERFSASWHFTERAPGSTEVK
FT                   FTYSFRAQPAWLRWAIEPLIAAFYLVHTRRRLDSFKRWAEAEALPSRP"
FT   gene            complement(684932..686494)
FT                   /locus_tag="Bmul_3723"
FT   CDS_pept        complement(684932..686494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3723"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_4265 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17407"
FT                   /protein_id="ABX17407.1"
FT                   /translation="MRVSYTAIQFRQTVLDNRPYSSTPTMTRSVPNPAAPAASRTRVET
FT                   VMDTLRARISSRTLMPGARVPSIRMMADSLRVSKSTVVDAYERLASEGVLVARRGSGFY
FT                   VSGHAPPLALADLGPRLDRELDPLWLTRQSLESAPSAMKPGCGWLPSSWLPDESLRRAL
FT                   RAASRDESDALTDYATPAGLPALRQQLAWRLAQHGVHAEPAQIMLADSGTQALDFVCRL
FT                   LLEPGDTVVLDDPCYFNFQALLRAHRARIVSVPYTPNGPDLARFEQTLVEHRPRLYITN
FT                   AALHNPTGATLSPPVAHRLLTLAADHGLLIVEDDIFADFESTPAPRLAAFDGLQRVVSI
FT                   GSFSKTLSAAIRCGYVAARPEWIDALVDLKLATSFGHAQIGANVVHRLLVDGTYRRHLD
FT                   ALRARLADAMGETIRRLARAGLAVWTEPRGGLFVWAQLPDALDAARVARHALDDDVVLA
FT                   PGNVFSVSHGATSYLRFNVSRCKEPAVFDALARAMDAARVSTAGVRTAERRGTLACDRH
FT                   DTA"
FT   gene            686546..687433
FT                   /locus_tag="Bmul_3724"
FT   CDS_pept        686546..687433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3724"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bch:Bcen2424_4884 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17408"
FT                   /protein_id="ABX17408.1"
FT                   /translation="MQKTTDGWLSGLLGVIIFSGSLPATRVAVQGLDPLFLTFARATIA
FT                   GALGLLLLAALKQKRPTRGEVASLLVVALGVVIGFPLLTALALRHVTSAHAIVFVGLLP
FT                   LATALFGVWRGGERPRAPFWAFSLLGSGAVAAFALRNGGQASALGDALMLAAIVACGLG
FT                   YAEGARLSRDLGGWQVISWALVLSLPLMLPLAWITRPATFDGIDTAALWGLAYVSLFSM
FT                   LIGFVFWYRGLALGGIAGVGQLQLLQPFFGFVLAAGVLHETVPPSMVAVTAIVVGCVAG
FT                   AKYFSKAVPVQRAG"
FT   gene            complement(687537..688775)
FT                   /locus_tag="Bmul_3725"
FT   CDS_pept        complement(687537..688775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3725"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: bch:Bcen2424_4883
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17409"
FT                   /protein_id="ABX17409.1"
FT                   /translation="MSLDSRQLAALAQQYGTPLWVYDADVIRDRIAQLRQFDVIRYAQK
FT                   ANSNVHILKLMRDEGACVDAVSLGEIERSLAAGFSPAGEPEGVVFTADLVDRPTLAAVL
FT                   KHGVTVNAGSLDMLERVGQHAPGHRVWLRVNPGFGHGHSNKTNTGGPQSKHGIWIDDVP
FT                   RAIALVRQYGLKLVGIHMHIGSGVDYGHLSQVCDAMVDLVASLGHDIDAISAGGGLSIP
FT                   YRDGEPRVDVDHYFRQWDAARKRIERHLGHAVRIEIEPGRFLVAEAGTLVTEVQAVNRR
FT                   PKHDFVLIDAGFNDLMRPAMYGSYHAVSVHAHDGALPEGRPQVDIAIAGPLCESGDVFT
FT                   QDAGGVVTHRKLPQPQIGDLLFLHDAGAYGASMSSNYNSRPLAPEVLVDRGTPRLIRRR
FT                   QTIGELLALETFE"
FT   gene            688878..689825
FT                   /locus_tag="Bmul_3726"
FT   CDS_pept        688878..689825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3726"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_4882 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17410"
FT                   /protein_id="ABX17410.1"
FT                   /translation="MASLTHRHIEVFRALMLSGSTTRAAEMLYTSQPTISRELARMEQI
FT                   VGFALFERAHGRLRPTMAALTLFDDVRLAYVGLERVAATAARLREFRDGQLSVIALPAF
FT                   AHAILPGACRRFRDAHAGVSVSVATQESPVLEEWLTAQRYDIGLTEHDVAPPGTLLTPL
FT                   LEVDEVCVLPDGHPLLAREAIDLADLADRPFVSLSLNDPYRVMIDDAFAQLGVAPRSVV
FT                   ETPSAVSVCAFVRQGLGAAIVNPLTALDFVGRDLHVRPLTRSFPYRVSVIVPEHRPKSL
FT                   LVDAFADALRGEATAIRERLAAHLGTRAVHAPRA"
FT   gene            689915..690514
FT                   /locus_tag="Bmul_3727"
FT   CDS_pept        689915..690514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3727"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bch:Bcen2424_4881 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17411"
FT                   /protein_id="ABX17411.1"
FT                   /translation="MTDASSLLEQPTLTGPRVELRPLATADRDALLDAAADGALWNLKV
FT                   TVVPDAQTIDAYLATALDGRAAGTVLPYTIVDRGSGRVVGSTRFWKIDRRNRKLEIGHT
FT                   WLSASMQRTHVNTEAKWLLLAYAFDTLRCVRVQFTTDELNERSRAAILRLGAKEEGIVR
FT                   HERIMPDGRKRNSVRFSIIDDEWPEVDARLRAKLGT"
FT   gene            complement(690575..691459)
FT                   /locus_tag="Bmul_3728"
FT   CDS_pept        complement(690575..691459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3728"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17412"
FT                   /protein_id="ABX17412.1"
FT                   /translation="MLHAQSWPRIAHRARKNFRCAMRAGTRYRHIVDTNRAVLPSVTEA
FT                   TARLHLRHARPPRIGRAGDRFDRRRGRAAAEAGPGACPVSRTASDHAIRRSTRAPMKGG
FT                   PMNRFSPVSRLALSAVGLLLVAATATAQTAQPAASAPAAATTRIHEADQAFITDGTKTV
FT                   STQHDAARIADARTSDSQVKAFAQRVSTDDEKIIQAMRAASPRGVDVPANDPDTTVLNS
FT                   IKSLRGAEFDKAYIEQVALAGQQKTISAFQAEIASGRDAKLKEVARQALPILQAHYADA
FT                   QKLAQRHHLASAQ"
FT   gene            complement(691526..692269)
FT                   /locus_tag="Bmul_3729"
FT   CDS_pept        complement(691526..692269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3729"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bch:Bcen2424_4879 haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17413"
FT                   /protein_id="ABX17413.1"
FT                   /translation="MPCRPRSTPPHTHAPTPRPFRRASARISHARNPPTGWLHAMTYRL
FT                   VAFDFDGTLADSLDCFLAALSEASRLHGFRDADPAMRATLRTMSARDIVRALDVPVWKV
FT                   PRVTIDMRRLIRARIAHVALFPCVETTFDALAARGIRIAIATSNAEDVVRDRLGAHAAA
FT                   RVDHFACGIPLFGKARRLRALADEAGVRADQMLYVGDEIRDADAARRARIAFQGVAWGY
FT                   TAPHALQPHCATPLLPHLGALLDRV"
FT   gene            692377..692820
FT                   /locus_tag="Bmul_3730"
FT   CDS_pept        692377..692820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3730"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_4241 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17414"
FT                   /protein_id="ABX17414.1"
FT                   /translation="MPAAADATLRFSTDKRELDVDAIFDFLHRDAYWSKGIPRDVVERA
FT                   IDGSLCFGAYVGDRFVGFARLVTDHATFAYLCDVFVLPAERGRGYGRALIDHVFAQPML
FT                   AQLRRIMLATSDAHALYRPVGFEAVAHPERMMEIRRPDIYTKR"
FT   gene            692878..693096
FT                   /locus_tag="Bmul_3731"
FT   CDS_pept        692878..693096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3731"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   bam:Bamb_4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17415"
FT                   /protein_id="ABX17415.1"
FT                   /translation="MTEQEAEQLATHRHYKGGLYRVIGVARHSETEESLVVYEHLWPHA
FT                   RGLWVRPETMFNETLPDGTPRFRKLRD"
FT   gene            complement(693121..694521)
FT                   /locus_tag="Bmul_3732"
FT   CDS_pept        complement(693121..694521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3732"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   bam:Bamb_4239 protein of unknown function DUF1006"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17416"
FT                   /protein_id="ABX17416.1"
FT                   /translation="MHLSSIVRCVSATPRAVRRDRSGARSGVAAAAPTVRYRNVRHTTR
FT                   RQTPLTMYALPTPLPIASMSTLSLAAARALHLAAQGLLTPPRRKATKADVLDTIRRMAQ
FT                   LQIDTIHVVARSPYLVLFSRLGAFRPQWLDEHLAEARLFEYWSHEACFLPVEQFGLMRY
FT                   KMLDPSGMGWKYAADWHAQHRDEIARLLDRIRSQGPVRSADFVRADGTKGNGWWDRKPE
FT                   KRHLEVLFTTGDLMVAERRNFQRIYDVRERVLPDWDDARDLPPREAVLPTLLDYTCRAL
FT                   GIVRADWVADYYRLPRRSYRAELEQLAQAGELIPVQVADWTEPAFVHRSLEALLPAAAA
FT                   DTLRSTVTTLLSPFDPVVWDRRRAATLFDFDYTIECYTPAHKRRYGYFCLPVLHRGRLI
FT                   GRVDAKAHRALGTFELKSVHLEPGVRVGSGLAADVAKAVRKLAAWHGTPQITVAHAPPE
FT                   LAHALRDA"
FT   gene            complement(694780..696204)
FT                   /locus_tag="Bmul_3733"
FT   CDS_pept        complement(694780..696204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3733"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_4867 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17417"
FT                   /protein_id="ABX17417.1"
FT                   /translation="MGIMTPLPRAQPMSPVFLAPLIVACALFMESVDANIIVTALPAMA
FT                   RDFGHNPVTLNIAITAYVVGLGVFIPICGWLADRFSARAVFRTAIGIFVAGSLLCAASN
FT                   SLGLLTFARFVQGVGGAMMVPVGRIIIFRAVPRSDLVRAMNYLAIPALFGPTVGPLVGG
FT                   FITTYLHWRMIFFINVPIGLYGIYLATRHIANTHEPDPGPLDWFGFLLSASGAALLLMG
FT                   LTLIDGALTTRTNALAMCATGAVLLALYVPYARRKERPVLDLSFLKIPTYHASVVGGSL
FT                   FRIGLGAVPFLLPLALQEGLGMSAFHSGLITCASALGGAVSRSTATHTLRRFGFRTVLI
FT                   YNAAFAGLAIAAYGVFHPGMPTWAIWVIVLVGGIFPALQFTSLNSMIYADISPRDAGRA
FT                   TSLGSVVQQMSLGLGVTVAGLVLHLSHWLQGHQAMVWSDFWPAFVVVGLCSFASIPITR
FT                   RLPPGAGDEVARGKRQ"
FT   gene            696465..698192
FT                   /locus_tag="Bmul_3734"
FT   CDS_pept        696465..698192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3734"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="PFAM: glycoside hydrolase family 37; KEGG:
FT                   bam:Bamb_4237 alpha,alpha-trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17418"
FT                   /protein_id="ABX17418.1"
FT                   /translation="MTSRRAESIVSAAPTASHCAAAAPAAPAAPRVRWAAALAVAYLAV
FT                   AGCAAQADSANHAATQLAASSAATVPNATAATLLPPPSQLYGDLFVAVQTAQLYPDQKT
FT                   FVDATPDTDPATIMQLYQQQKSQPGFSLKAFVDQHFTPPAQGGVTPPPNQTLREHIDWL
FT                   WPQLTRTTPTAPPYSSLIPMPKPYVVPGGRFREGYYWDTYFTMLGLQVSGREDLVDDML
FT                   DNFAHLIDTVGHIPNGNRTYYASRSQPPFFAYMVTLAAQAEGDKVYQKYLPALRKEYAY
FT                   WMQGESTTPRGQAARHVVAMPDGAVLNRYWDASDTPRDESYLEDVTTAKAASGRAANDV
FT                   YRDLRAGAESGWDYSSRWLGDGKTLATIRTTSIVPVDLNSLMFHLERTIVKGCTVTHDV
FT                   GCVIDFSGRAARRALAINRWLWNRGGYYGDYDWQLRKPRDGVTAAALYPLFAGVAWPER
FT                   AKATAREVRKTLLQPGGLATTTETTGQQWDAPNGWAPLQWIAIEGLRRYGEPALAKDIG
FT                   TRFLADVKHVYATEGKLVEKYVVEGAGQGGGGGGEYPLQDGFGWTNGVTLKLLQMYGE"
FT   sig_peptide     696465..696533
FT                   /locus_tag="Bmul_3734"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            698889..699026
FT                   /locus_tag="Bmul_3735"
FT   CDS_pept        698889..699026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17419"
FT                   /protein_id="ABX17419.1"
FT                   /translation="MNFGLLLSTFPRVEESRPHYDAMLALDARPRPLARLLNRLASLIR
FT                   "
FT   gene            699093..700790
FT                   /locus_tag="Bmul_3736"
FT   CDS_pept        699093..700790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3736"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: bch:Bcen2424_4859 natural
FT                   resistance-associated macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17420"
FT                   /protein_id="ABX17420.1"
FT                   /translation="MPRSHAHRITLSRTEVIMSTPSNVSSPIAAERSAVLDEAHLGDIR
FT                   GALGTIAHHDTGARGTWWARLRTLLAIIGPGLIVMVGDNDAGAFGTYTQAGQNYGTTLL
FT                   WTLLLLVPVLYVNQEMVLRLGAVTGVGHARLIFERFGKFWGAFSVIDLFLLNALTIVTE
FT                   FIGITFVLAFFGLPKVAGVCVAAALTMAAVSTGDFRRFERFAVGLCVLSLLLVPVLVSI
FT                   HPPVSQMTRDFFVPNWPAHAKLSDVMLLVIGIVGTTVAPWQLFFQQSYVIDKRITPRFM
FT                   KYEKVDLWIGIAFVLIGAVAMIGFSAALFHGHPEAGGFTDAGGVIAGLEKYAGRTSATL
FT                   FAIALLDACIIGAAAVSLSTAYAIGDVFKIRHSLHRGVSDAKGFYLVYFAIVAAAATLV
FT                   LIPGSPLGLLTEAVQTLAGVLLPSATVFLLVLCNDRQVLGPWVNSTKLNVFTGAVVWVL
FT                   VLLSIILTASVMYPDISGEAIVDVLVGGTVLAIAGYLATVLFRRNRRVVEPGIDRAARA
FT                   TWRMPPLDTLEPQHMTLATRIWMGVLRGYLVVAVGLVIVKVVQMTLLK"
FT   gene            complement(700871..701767)
FT                   /locus_tag="Bmul_3737"
FT   CDS_pept        complement(700871..701767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3737"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   bch:Bcen2424_4858 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17421"
FT                   /protein_id="ABX17421.1"
FT                   /translation="MSDIALHEEAVASTLAGRPHARVSARRERPVQVVWCDDVRRGDVA
FT                   QPNAPKLGVADTLAHAQSTAERNRIVTSLLHLTGFSTFAYFALEFAHERVESLYLHEAF
FT                   TPSTYRGDYVRHNHHDVDPRTLGARVCNMPIVWDLQQLRRDHQPRDDDASDAPAALDGF
FT                   LQTMQDDGMCSGIMYSMAVPGTRLHAFMSFTAPRRTREWITPATVEQALSIGLSVHKFA
FT                   SPQLIATSRERAVNGLTPFEQELLIGIAEGASDKEIGRRLDTSAHNVDYHLRKLRKRFG
FT                   VANRIQLTYLTSKLELI"
FT   gene            702065..702898
FT                   /locus_tag="Bmul_3738"
FT   CDS_pept        702065..702898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3738"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: bam:Bamb_4231
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17422"
FT                   /protein_id="ABX17422.1"
FT                   /translation="MTHADGAPRVEWFTHADIAAAAAYSNAIPAIERDVFTGIQFGSGK
FT                   SDLSAIDFSPYHARLRQIGFSTLGYGAYEMIGRRILCAHLLRDLAPPSFMQPYIEGALY
FT                   ESDPRFAQVRQSGFPVAWRLDEIEAAAQRGGDRKVLALAGHLRAHAMNSGVIFSLSAPR
FT                   LDLRVAVNLTSETHGTDWIDDRVIGGALAVSLAVHRVALPFLEARVARMRGFALGDEQQ
FT                   QVLERLVHGLSDQEIASALRTSLHKVGHHIRSLEKLFNVQNRAQLAYLAARRLSS"
FT   gene            703172..705361
FT                   /locus_tag="Bmul_3739"
FT   CDS_pept        703172..705361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3739"
FT                   /product="type III secretion FHIPEP protein"
FT                   /note="PFAM: type III secretion FHIPEP protein; KEGG:
FT                   bch:Bcen2424_4856 type III secretion FHIPEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17423"
FT                   /protein_id="ABX17423.1"
FT                   /translation="MAEPKALPRDWQRMFSVGRGVSGHRRIGASPRADLFLAAFIVAVV
FT                   ALFILPLPQAALDGMISLNLAASVVLLTVSTYVPSAVSFSSFPALLLFTTLFRLALNIA
FT                   SCKLILLHANAGHVIDAFGRLVVGNNVVVGGVVFLVIAVVQFIVIAKGSERVAEVGARF
FT                   SLDAMPGKQMSIDADLRAGIISADEARERREKLEQESQMHGAMDGAMKFVKGDAIAGLV
FT                   IAFINIVAGIAVGTLMHGMDIGTALQRYAILTVGDGMASQIPSLLVSIAAGIVTTRVAT
FT                   RDARQRQLGEQLGEQLGAHPRALLIAALVLAGFLVVPGFPKWSFALIAVALGAFALTQL
FT                   KRKTTAPSFNLIHVAGRVGAADDGQPAKVSHAAGVTSLIAVSLADDLRSALNLAQLQAA
FT                   LSNAKARVDADIGTVFPRITLNDDERAPAGTYRIYLQDVLAAHGALKPGWLLWDGVAPL
FT                   PERAERQPAEAFGPFATALWVKPDGAPPDGKWLTSEAALAAHVEQIVREHADELLGIQE
FT                   TQALVHLVRRDHPELVGELTRLVPLQRVTEVLRRLLAEQVPIRNLRVIFESLITWAPNE
FT                   PDDVIALVELVRVDLRRMITDRHAGAARQLRVVLFEQNLQERIENAVMRTKQGNFLALS
FT                   SAVKQDIGEQVRAIVQSAHASGAHGAARLAVMVALGARRYVKTILQPMLPDLPVLSYQE
FT                   IEEDVQLHTVGWVKNPPDDGTVGAGADVRTPGVAQ"
FT   gene            705358..705636
FT                   /locus_tag="Bmul_3740"
FT   CDS_pept        705358..705636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3740"
FT                   /product="type III secretion protein, HrpO family"
FT                   /note="TIGRFAM: type III secretion protein, HrpO family;
FT                   PFAM: export protein FliQ family 3; KEGG: bam:Bamb_4229
FT                   type III secretion protein, HrpO family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17424"
FT                   /protein_id="ABX17424.1"
FT                   /translation="MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQ
FT                   DANIGIAVRLIAVMVALVLLSGWLGSEVLRFAQQALERMFVSSTGVF"
FT   sig_peptide     705358..705480
FT                   /locus_tag="Bmul_3740"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.362 at
FT                   residue 41"
FT   gene            705636..707672
FT                   /locus_tag="Bmul_3741"
FT   CDS_pept        705636..707672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3741"
FT                   /product="type III secretion outer membrane pore, YscC/HrcC
FT                   family"
FT                   /note="TIGRFAM: type III secretion outer membrane pore,
FT                   YscC/HrcC family; PFAM: type II and III secretion system
FT                   protein; NolW domain protein; KEGG: bvi:Bcep1808_5342 type
FT                   III secretion outer membrane pore, YscC/HrcC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17425"
FT                   /protein_id="ABX17425.1"
FT                   /translation="MRRRVVPIRFQPRSLPRAALAMCASALLAASLCMTIAQPARAADL
FT                   RWRNKPFTIVANGKKIGDFIRELASSQGVTAVVDPKVDGVISGRFSGTPQQTLDTICST
FT                   YGLTWYYDGSFLYVDPADQSQTQMIPIPPNAGGEIGRALQAMQIPDKRYTLVINDRANS
FT                   VYVAGPRRYVELVRQAIGSVGDPSANGQHADIRAFRLKYAWASDFTINRSGKEVTVPGV
FT                   ATILRRLFGKGGGTGPMPTSAPLGQAARQVKLGSGLTIAVPRLEFPDLSGGPRSGGYGG
FT                   ESAAGSTFSPFASGGDTLPQIEADPAINAVIVRDLPENMYRYQSLIAQLDERPRIVEIN
FT                   VTIIDINEDSLDSLGIDWRLHTTHGDVQIGNGANPLNGNTQYNGAGNPPLTFGIGASES
FT                   GQTGTFMPTGIALTASIGGSLRNYLLTRVNALAQKGQAQLHSKPKVLALDNTEAILENL
FT                   TQFYVQVQGYQDSSLYSVTTGTSIKVTPMIVDDAIRNAAAVSGRPESVMMSIDIQDGNI
FT                   VPGQAVSNVPVIQQRNIVTKTMIDEGKSLLIAGFNDDEVRLNKSGVPWLSDIPLIGNLF
FT                   KYTDKSGNHMERFYLLTPRVVSSASMYAPDGSPVNPGVDAPADPNGVSMYRPPDNDIAV
FT                   PLTPRPLPGTKFGPPALPPPAQDAASQPMATTAGASAHVDEHH"
FT   sig_peptide     705636..705764
FT                   /locus_tag="Bmul_3741"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 43"
FT   gene            707736..709343
FT                   /locus_tag="Bmul_3742"
FT   CDS_pept        707736..709343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3742"
FT                   /product="LigA"
FT                   /note="KEGG: ade:Adeh_0244 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17426"
FT                   /protein_id="ABX17426.1"
FT                   /translation="MESLLSERPDVRPHDVARARCELGRHRGRLRSDPARSRDRREAGV
FT                   PAGRRARGHRAEPRRRHGRAGAAQRRTARRRPPVADAAGRRDGRLDPLRYRAARAGERR
FT                   GARRHGRARDRARRTVARLVDGRPAPAGQPPARHRAGRALGRRAARRARLRFRRLVGAA
FT                   AMAARVGARAHAPLAAAAARVSGTRRRAARRRRDRIGLRRRCGRARTPCADRVGRRQRG
FT                   ARHRLRGQRSRRDRADLFQRHGAHRRVSRARPHRADRHGAARAARAAHPQLHEGRAAGA
FT                   RSRRPRARRASRRAAHDDDARRFGRHSGDHDGVRRRRRSALYRDRRRQPLFRGRAAEGR
FT                   ADGRVDRAGRSRVRAQRPAHHDAARRHVGRCAGPRAGAARAAARKRRGGRHRAADAGTD
FT                   AAARRAAGVGRYERRGALASRQIMRAVRRARRGHDAARRSGAAGRVGRGGMGPPPDEGE
FT                   LHVKERSMGASAAGGVTNTNDVQKQADDLTKTQLELTKINFQVQQSTATFETSNAVTAQ
FT                   EGTANAQVAQHLSSAGRA"
FT   gene            709483..709956
FT                   /locus_tag="Bmul_3743"
FT   CDS_pept        709483..709956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3743"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17427"
FT                   /protein_id="ABX17427.1"
FT                   /translation="MSVTGVGAAPPGAAALAGAAQQSGAAADPAQVREFDALMQPRAAS
FT                   ADTAPPAAAMSPATHDAVPAVQMTPAQANASSLVERLRAYGNDLDARYANIDKHRTEML
FT                   TSMADNRSDPLMTMVQAMDFQWTATTTISEYQLSLSVAQAANGFTHTVLKTQE"
FT   sig_peptide     709483..709560
FT                   /locus_tag="Bmul_3743"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.529 at
FT                   residue 26"
FT   gene            710011..710892
FT                   /locus_tag="Bmul_3744"
FT   CDS_pept        710011..710892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3744"
FT                   /product="type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family"
FT                   /note="TIGRFAM: type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family; PFAM: secretory protein YscJ/FliF family
FT                   protein; KEGG: bam:Bamb_4225 type III secretion apparatus
FT                   lipoprotein, YscJ/HrcJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17428"
FT                   /protein_id="ABX17428.1"
FT                   /translation="MTTIDSTPRAGAWRSRAARALLAGALALLAGCQKELYSGLSEHDA
FT                   NQMIAVLGDAGISASKDNDARDASDRNAWQVSVADGDMQSALTVLQANGLPKPSYASLG
FT                   ELFQKQGLVSTPAEERVRYLYGVSQDLSRTLQDIEGVIVARVQVVIPENDPLADKIKPS
FT                   SAAVYIRYRPGVDLRAMAPMVKDLVAHSIEGLQYDNVSLFLQPAAARAPRVDGIGSAVS
FT                   DIVRLRSPLGWLVFALILLTCAVIALSAARRGMFGARLAALLGAQRGGNGASNASPDAG
FT                   ALRTPDGARDGA"
FT   gene            710917..711648
FT                   /locus_tag="Bmul_3745"
FT   CDS_pept        710917..711648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3745"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17429"
FT                   /protein_id="ABX17429.1"
FT                   /translation="MNDARVPPPDAADPLPWLQPLAPPPAARRAAFHALVCEFNLRPDR
FT                   YLHVTRVPDDWPARYRSPDAFGAAGRKLLARHLLAVHGVAGRHDFDVANACARVALLPG
FT                   AALEQLAAYAGLLLHRGWLRDALTVRRIRAEVAAKLGGDALTLALERAPEFGALADTLE
FT                   PWRAEPAMLPGVIRARGGRLLADFIGAAGDAVARRVRLKFNRAIDDEAPYWLNRAQRDQ
FT                   FGELLFLFLIPERLASWDWLF"
FT   gene            711630..712259
FT                   /locus_tag="Bmul_3746"
FT   CDS_pept        711630..712259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3746"
FT                   /product="type III secretion apparatus protein, HrpE/YscL
FT                   family"
FT                   /note="TIGRFAM: type III secretion apparatus protein,
FT                   HrpE/YscL family; KEGG: bam:Bamb_4223 type III secretion
FT                   apparatus protein, HrpE/YscL family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17430"
FT                   /protein_id="ABX17430.1"
FT                   /translation="MGLAFLITSDNLQLLSERKVLKEREYAALLDASAVIATARDEAQR
FT                   IVADAQREFERRHAAGYEEGMRRAQREQAAQTYAQALAAARTMESMKDSMAEIVVKAVR
FT                   AIVGEMSTQKLYEAALARIAPLVRDEAFVTVRVAPGRSDEMRDALERAFVAQTSRQKIR
FT                   IVEDAQLARDACAVETPSGRIDASLDLQIDALRQAIRRDASLGAAR"
FT   gene            712256..713644
FT                   /locus_tag="Bmul_3747"
FT   CDS_pept        712256..713644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3747"
FT                   /product="type III secretion apparatus H+-transporting
FT                   two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: bam:Bamb_4222 type III secretion apparatus
FT                   H+-transporting two-sector ATPase; TIGRFAM: ATPase,
FT                   FliI/YscN family; type III secretion apparatus
FT                   H+-transporting two-sector ATPase; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3747"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17431"
FT                   /protein_id="ABX17431.1"
FT                   /translation="MNAPHDDTPPPGDDAADAADAPFDRGRLVGDLDAALAFFSPVSVQ
FT                   GRVNHAVGQILNATGIRAKLGEICELRTPNQPTLLAEVVGFSRQTTLLTPLGDVAGLSP
FT                   ETTVVPSGREHVFPVGEALFGRVLDGLGRPLDDRGPVTGATWVSTQQDPPNPLARRMID
FT                   TPFPTGVRVIDGLMTLGVGQRVGIFAPSGVGKSTLLGMIARGAQADVNVIALVGERGRE
FT                   VREFIEHALSPEVRARSIVVVSTSDRPAMERVKSALVATAIAEHFRDAGKRVLLLVDSL
FT                   TRFARAQREVGLASGEPPTRRSFPPSTFAVLPRLLERAGQGATGSITALYTVLVEGDEE
FT                   SDPIAEEVRSILDGHIVLSRKIALANRYPAIDVLASLSRVMPLVASRAHQQAAARVREL
FT                   IAKYQEIELLVQIGEYREGSDRLGDLALRAREAIGAFCAQAQHEDVRFDALLAKLTKLA
FT                   NDHV"
FT   gene            713637..714353
FT                   /locus_tag="Bmul_3748"
FT   CDS_pept        713637..714353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3748"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3748"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17432"
FT                   /protein_id="ABX17432.1"
FT                   /translation="MSEADDRRVLATLARLKRVREMRSQIARVAAARQQRVAAQSRHAL
FT                   DAAHAQLARQLAAKAAIQTRLADDARDARTLQNAAADTRTFDRHIGAANASVNEAAHVH
FT                   RGHEATLAELQRAARKAKAAEDKLERAGEKARHARAARVERDADEIADAYAVRRFATPG
FT                   VWAADAGRHPDARRDTHADAAAFDAAMTAQKPADAQAGTQGAAAKPSDAVQAGTTDAAA
FT                   QPAAAAAAAAAAERRC"
FT   gene            714347..715159
FT                   /locus_tag="Bmul_3749"
FT   CDS_pept        714347..715159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3749"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="TIGRFAM: type III secretion protein SpaR/YscT/HrcT;
FT                   PFAM: type III secretion system inner membrane R protein;
FT                   KEGG: bch:Bcen2424_4845 type III secretion protein
FT                   SpaR/YscT/HrcT"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17433"
FT                   /protein_id="ABX17433.1"
FT                   /translation="MLDHASGFNDLAGTLRPLLYVMPRLLPIMFVVPVFNEQIVTGLVR
FT                   NGLAVVIAAFVAPAIDAAQIASLPFVTWCVLVAKEAMVGMLLAGAFSAVLFAIQGVGYL
FT                   IDFQTGSGSAAFFDPMGGHEGGPTSGFLNFVAIALFVTAGGLQVLVQLFAQSYAWWPIG
FT                   SLGPDFSSMLQTFVVRQTDTIFEWMVKLAAPVIIVLVLVELGIGLVGRAVPQLNVFVFS
FT                   QPLKSALAVLMMVLFLPVVYASLHALLSPDSGLVALLRALFAAHGGGA"
FT   gene            715185..716216
FT                   /locus_tag="Bmul_3750"
FT   CDS_pept        715185..716216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3750"
FT                   /product="type III secretion exporter"
FT                   /note="PFAM: type III secretion exporter; KEGG:
FT                   bch:Bcen2424_4844 type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3750"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17434"
FT                   /protein_id="ABX17434.1"
FT                   /translation="MSEKNQQPTAKRLREAREKGDVPKSAETISSAFFVGVCVALAVGV
FT                   GTLFARLQALFRLVFDAAGAADPSARIATLIDAAARDWATLSAQIVAAGLLLGVLAGFV
FT                   QVGGVMAWSRLVPQLSRLNPAEGLKNLWSLRNLVNLAKMLLKTALLVATLGWVIVESLD
FT                   PSVQSGFTRPMSTLALIVKLLMLLFGWAALIYVVMALIDIVHQRHEFNRKMKMSIDEVR
FT                   REHKEDEGDPHIAAKRRQLAREVQFASLPDRIGFASVVVYSPRVAVALYYGGIGTLPWV
FT                   LARGEGDAAERIVRLARDALRPTLANVGLAQALYDTTPENGTIQPQHFREVAQLLKWAT
FT                   GAP"
FT   gene            716430..718397
FT                   /locus_tag="Bmul_3751"
FT   CDS_pept        716430..718397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3751"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: bch:Bcen2424_4843 asparagine synthase
FT                   (glutamine-hydrolyzing); TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3751"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17435"
FT                   /protein_id="ABX17435.1"
FT                   /translation="MCGIDGFLNSVAFDEETARGTLARMTASLAHRGPDAQGLWVDPAA
FT                   GIALGHRRLAIVDLSVHGRQPMASACGRYVMVFNGEIYNHRELRAQLERVGRAPAWRGH
FT                   SDTEVLLAAFAAWGVDATLRRATGMFALALWNRESRVLTLARDRIGEKPLYYGRIGDAL
FT                   VFASELKALRAYPGFDGEIDRDALCLYLRHSAVPAPHTIYRGIRKLPPGSWIQFEHAQD
FT                   TPRIRTYWALEHAIDAGHHEPFAGTAAEAVDRLDTVLRQAVARQMEADVPLGAFLSGGV
FT                   DSSTIVALMQAQSAAPVDTFTIGFHEAGYDEAGYAKAVARHLGTRHTELYVTADHALDV
FT                   VPKLPAIYDEPFSDASQIPTFLVAELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWRK
FT                   LHRVPAAVRTRIAGALHALRPDHADQLAAVAQGAWGGGELRESATRIGDRLHKLGHVMT
FT                   ADSRIGLYRLLMSSVHHPERIALAGHEPPTPLDTVSAWPAHLSFAEQAMAIDTLTYLPT
FT                   DILTKVDRAAMAVSLETRMPFLDHHVVEFAWRLPASLRLPEGQSKALLRRLLDRYVPTE
FT                   LIDRPKQGFCAPIDHWLRGALRDWADALLQPSRLRDEGFFDAAAVERLWRQHQTGRMNW
FT                   QHQLWTVLMFQAWLDAQRAA"
FT   gene            complement(718445..732040)
FT                   /locus_tag="Bmul_3752"
FT   CDS_pept        complement(718445..732040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3752"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   bvi:Bcep1808_5330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17436"
FT                   /protein_id="ABX17436.1"
FT                   /translation="MLLIDGLGLGVNWQRFLSETLNPVVAPPPPPPPPPKKDDPAAGPA
FT                   NPAVTPPIPVDASLATDPSKPTNAEIKSATSLIQSMAAQYTAPPPDITVENDKTKAVQK
FT                   AIQDAQTKYDNASQALQGAQNVLHLVNRDPESTADDRKSAQADYAKARTAADTAQRELN
FT                   VTTDAGYMILYGEQAKADMPAGMKFDDSGKVTDPGDAQHAADQKFNALLAAFPDHPNDP
FT                   KWVPQPRDCKNPLQIRLYNDWQTASAKAAVGASKYYADVTNSNLAYAQFQSYLADPDYK
FT                   AALDAGVGRLNDALQSQGLQVTMPDAPDSPDAAQQAVTAAAKDAIYANAAYGAANDSLT
FT                   LANAQQQYDSVTGREGPTVIATSVSDAKTALARAQTAANTSGGYLQMLSAQRQVDTLQA
FT                   DYTKKQDASNAWHKNNPHAMIKDPQVDLDLGDAYAKLYQARQQADIAHDGFVAAYGASL
FT                   AQQYDDQASQIKSQVSAQSLFTRPPLQSPLLTPSLSTANGLSGVPTSTLSTALPAANGT
FT                   PSLSASPLLDHPFLLPQSTGTPAAPTGPTMLDVKRIQVVAGAIRAADARLSNQVNERAT
FT                   NAALDQARVQQTQAKSTLESVQKDYDDWAAANPPPMRFRVVAGDDMIPAPSMPLPNPKQ
FT                   ALLDKAKADVTEANNTVQRLQLLSETSHQQVLMDGFDAGLDERLRYAAPGSDAENDYKK
FT                   ALHDFYEAHRGELSNSLLDAASASTNNGDAIPFGTLTANEQRNLIGVALGIQPDVQNAA
FT                   SSGDGSDPVSPMKDDVARFTDKEKLSTIDKVRDKLLSIGGGESTQVNVLPMVYASKQDG
FT                   MTTSAIFKVTGKDGTQYVDETASTYNDINDYIDNNELSSDGTVDIATGYNADGTLQLVS
FT                   KAAHHESGFDSFLNTLTSTGLNIGMMIGGMALEGLGTLLDGTGVGAIVGVPLNILGATM
FT                   TYTAIGATMTSAGLDLANRAEHGRSLNPFTDAGARADFVNLVPMGAAGAAKLAGSKLFT
FT                   RAVTALTRTPKVASVLATGAKATAVVTGVGGAVEAFGEAGVDYWNGNTKQAGEELKSGL
FT                   TNVALMAVGGLKERAVTTVANRTGRPFVARTTNGKTVTVDGQMIGRLLNKDGDASLAAG
FT                   RHRVTFDGERVTVSADGTLMVGDKVLTYEDKPIRVLDRASRKALPPGESVVLGEDGKLS
FT                   VVSASDKNWTNGTRIDSLTDTGERLSFGPDGGMSTTPKIVARTRLDLLDSTLQQARDAY
FT                   AAARDAEPATRELARTAAQDETASAATNARSARRTSEERARVDQQHEQSDADHATNAAS
FT                   NRRSADARAMRYRPLDIETPAGAGKRDVPAAARPRVDVKVVDLAEQAPGARPATFDPAG
FT                   IAVPNGPRAEPMQIGDRTVTIVRDGAASHAPTLDGMRPQDFEDPIIVVAGERDALLAPE
FT                   LANRWERPVYAAAPDAFGPDGRLRTDARVLRFDPAPETEAATGAVAGAAAADEAPHANA
FT                   PRPHADDTVIVLAGKRGPNEGAVPQPATTRQPVNALDGRFSAPNRVLVLVRPERADAPE
FT                   RAPARDRTAPEEHHASPAARADGAKPPRRASANDAAAPPDTDLVAAHPETTEPAAADRP
FT                   APSPGWFTRMQVRFGGAPLPEAAQALAMQSATLATQLRMLGDAGWRVKVGKRGGGSHVD
FT                   PRKRVMTIDGALEDAGSITYTLASEARRAVEATAGVLNVDYGNRGRFTRKALEAEARAQ
FT                   INAFEARYEIALASGVDIAEHASLPEPIAREGVDWQGPSHDYAGTVERLADSFADAPVS
FT                   GHDGKTYREFYDDVWARQKRRGGIAHRMPAPQMLDEGDGAAPSGRAHLDERTAWSHAHA
FT                   VLASPFGDGRQAPDAAELNARRAGHTAQLPEHGMVVLHADTLPDGTLLVDGKPVGMHEY
FT                   VIANAPWRLVKDAEAIVLAAKHGGNEAAARLANVLRRSVYAPPERAIGNDAALLDTRVF
FT                   HRFDPAPAAPHALGELAADAKGVHLDGDPGARIDVEHHLGELLGAGARKTGFALGDDAA
FT                   LVTVDHSPPPFDPSQAPATIDARRAADEQIVIDEHRTLQVLEELGIRTVQLHGPFRSLG
FT                   GVVSALVRPLGVLHSDEFATGALPPVVSRDGIRNIMKLHEVLEAHKIGFDLQGIFTSTG
FT                   DFLVCDPGPIRHNEIAYSMSRQRLDAIQRGVLSWIELHAPELLQPPRDDAVPADAVPAD
FT                   TLPADAFVQKPSLITRVRMRVGGAPLPDEVGALALQSSTLATQLRMLDSNGWRVRVGKP
FT                   GSGSRIDAKRKRVTIDGAVAGPEAMTYVLAHEALHAVEAIQGSLGLDYSSRGRFTRTAL
FT                   EAEARAQLNAFEARYEIRLASGIDIAAKVRLPDALQREADAWRPEANDAATVARLADAF
FT                   ADAPVSGAGGKTYTAFYGDAYDRGRTGGTRAMPAPEMRAAQHDESGAPRSMREIQAQRA
FT                   AWSQANVEHDASPFGAGGPPPVDTLSFLRDGRVLIDPGSRLAIVPAETLPDGTLLGPDR
FT                   QPVDPHAFTLFNPPPSDTGYTTILSARHANEGAAAQLANLWQRPVYTAHPDAVGAAGAP
FT                   ADLSGMSRYAPAAYRQPSLGELSVDRVHGDLYVDGDPARRADPADFLGPVLGSGAYKTV
FT                   FDGGTGQAIGVFRDESISGLVDAYEAVQLEQGGLAMLRDVYKLPTSTTNGPFTVANRVA
FT                   VVLKPSAQISSVDVEFDVGLPSVVSRGGLADLAKIRRVTQEHHLLYDFQVLFGRNGDVM
FT                   LHDPGEVLPGADPEGSVLGRIDEVAAKIHSGIATGRIRLAHPAMTERGAYAPRRGTIER
FT                   VVTLFRGAVLRMRAHALASRSPTLVAQMRLAKSDGWKVKLGARGEGQYVDAERRVIVLD
FT                   GNTRHAGTLVFALAHEVQHSVDIATDTLGLDRSSPEAYVRSLLLAEARAQVNADRVRDE
FT                   ILAAGGGDIAAHVHLPDALARAARHAYESGDAAALHALAERFGDTRTSLPGNPTYRVLY
FT                   AEQARALTGDARLPKLAAPGSGNRPAAAPGSNARASTRMERARAWLDERGLRTLKRIEG
FT                   AHSPALRDLTRETGRNAHVLIARADPPPSAGSPPKFIAEAEVDANGAITITRRDRSLSY
FT                   GERRALGNALSRAADANTPDAAAAARRGFDFYRSPVTAAELRDMGGPSRIEPAHDGDTI
FT                   ELSPTGNVDGALASAIDALGSVKHYSNANKAIAGARNADTIYAVDRKTGDILGHAKRDP
FT                   NSGVWYYEEKSPIDGAKVKERSLDDAFQRRVNARVRRGGTRHRIPLSRARQRGVAFIAT
FT                   EIGPDMMARIGRFDPIRAPKKDTTYRLPSRLRPRYMSHALIARSADATHRVALLTRART
FT                   AALLRRQNASGALPAGTSAANAPAGATTATSATATTTAATQPARRAAAGRPALHDALVA
FT                   AHLLPASAAHALDFSGHNAVHLLALAERGALSPDTHRVYVYRTTDPIAHRLASPDGVLV
FT                   PDAQGNLFWHDDWRDTGGAGVPLDASPIGRGPYGANVHLLLAELQADGIDTYAPGTRLD
FT                   ALNSRVERLEKLQNASHRTWADKLRDWASREKASAIHERDTMQAQLERERQAARNNQAP
FT                   LPEHPVLEIKPYQPALVSSTQIEWKQRYGDGGRPDPLTHVTRLKKFVEREDDTRAGPLE
FT                   LQDRPADAPPPAVMADAQAWRWFGKWLRVARDYTAGGARFAPVPKWKNLHRRLSAAVAV
FT                   DKQIIKSFFASSRDVQYRVVPMSRAYRLSDDPRQFLEQIRRNGAANAAVTIVLDPHTLA
FT                   AAQGKKHEQEFVNDVKQLGDQTRAKMDYATATITGENGHVVHLDELTEAHLHAWLDAAA
FT                   EGGFLLRLETASGRALVSPVDERYQAGTNDQYHDYVRLASLLEKWAVKHPDQAAPHVMV
FT                   TFHGWDAVPESVPGAGHVELVNQLLDRPTLKWVHVGLSYATHGSDFIANQELTTALAKM
FT                   LVDRVRGRGYDASTFERIHGADALTRVFERIDPDTLVEQHQMLLAEIDRIGRENGMKPA
FT                   QIDALVDRLYEGNTTKLLNRARYAVADYATRAWRNDPDRAPARESAARSFTEDWQRDIG
FT                   SKLKNPQQTKLPRAQRLQAKLPAWTDIVQKPELVVDDAKPLSDSRLVSAQSSRTGSSGP
FT                   QVPITPEQAAHAELNALRLQQADRLRTWFTRQNLLSMAIGLGVGFGTHHFGLTSPAFKQ
FT                   TSNALFVGARTGRLVQALHQDSVRALQGGDPRLFRRVLDRFVRGLESQLDAHEMDKDLR
FT                   GASLQLLANEARVKVDGLLALHESKKISAEDAVAYTKMIANDMIAQMQGVLGGTSIQQM
FT                   HHGNPRRLFGKVGRSAALAGYVGLGEIAVHNFMASHAVAPLLGGIGAVVGLGYTAAIHL
FT                   GATRNLSLDRRSRVVRAIDATSDIVSIAAGYASAASATSLPIALSGAASATLLALARVD
FT                   THMPNLTKAVTSRIPTAIVLVPFGIYVGNWLYTYFNGSSPPPQKSNVAPPTNSASPSPS
FT                   PSASPSPSPSAATPAPSATAPSPGTSASPSTGASPPASTQPPSGTPSPTPYLVVQGDSL
FT                   WVIAHQHRDSLLDAAHVSAAERRKMSDREQDNVAFREILQLNPSAAANASHLSIGTPIN
FT                   VG"
FT   gene            complement(732299..733102)
FT                   /locus_tag="Bmul_3753"
FT   CDS_pept        complement(732299..733102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3753"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bam:Bamb_4216 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17437"
FT                   /protein_id="ABX17437.1"
FT                   /translation="MNARRLHSAAAALCATVALVALTFACVPPRVAHARASSGSGGFAQ
FT                   LARACAPNVDPDTLAALVRTESGFNPYAIGVVGGHLTRQPASLDEARATVRALAARGFS
FT                   YSVGLAQVNERNFAKYGLDEATMFEPCRNLQAGGAILTECFARSSGTGRPAQAALRAAL
FT                   SCYYSGNFTTGFSSGYVSRVVASAQRNAREGGVEPIPVVRDVPLPARQRRMDAAATTPP
FT                   EHARRLASPAASADAPSCHARPVVMMCRGLPASQAKRLCVRCLDQ"
FT   sig_peptide     complement(732998..733102)
FT                   /locus_tag="Bmul_3753"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 35"
FT   gene            complement(733099..733773)
FT                   /locus_tag="Bmul_3754"
FT   CDS_pept        complement(733099..733773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3754"
FT                   /product="Yop virulence translocation R"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: bch:Bcen2424_4840 Yop virulence translocation
FT                   R; TIGRFAM: Yop virulence translocation R; PFAM: type III
FT                   secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17438"
FT                   /protein_id="ABX17438.1"
FT                   /translation="MGNLPNPVALIAVIAALGIAPFAALMVTSYTKLVVVLGLLRSALG
FT                   VQQVPPNLVLNGIALILSLFIMAPVGMSIRDALQARHFDASGQLSTADVGALADAALPP
FT                   IKDFLVSHTRQRDREFFVRTATSVWPKNRADGIKDDDLLVLVPSFTLAELTKAFQIGFV
FT                   IYIVFIVVDLLVANILLALGMQMISPTTISVPFKLLLFVALDGWSLLVHGLVLSYRVAG
FT                   AG"
FT   sig_peptide     complement(733702..733773)
FT                   /locus_tag="Bmul_3754"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.373 at
FT                   residue 24"
FT   gene            complement(733777..735108)
FT                   /locus_tag="Bmul_3755"
FT   CDS_pept        complement(733777..735108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3755"
FT                   /product="type III secretion system apparatus protein
FT                   YscQ/HrcQ"
FT                   /note="TIGRFAM: type III secretion system apparatus protein
FT                   YscQ/HrcQ; PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: bch:Bcen2424_4839 type III secretion system
FT                   apparatus protein YscQ/HrcQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3755"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17439"
FT                   /protein_id="ABX17439.1"
FT                   /translation="MAPRKSAPTARRHDAHDYGFRRRTRTAASLQSTQQPRATCATGHN
FT                   NPSNSRRIRSDPAVPALFLTNADDAADRAAPSAATTRATPPAAVLPLDASPALPRLSAA
FT                   AARGLSHAYGATAAVPIALGNEAYAVRWRVDAEPAADAHAYRFVVGPATGTLWLDPLAE
FT                   TEWLGDAADPAVPAVIRAALLADLGAPLAATLQAATRQRVELLPPAEPAPAWHGSPSAL
FT                   RFELRRADGAWRCHGAVLFDAPDALAVFFASAPAARPDAHAAYANLPVPLVFEIGRTEL
FT                   TMAELADVVGGDIIAIERWHAHEQNLLCVGRVPAAPAWEITGRPSGSRLTVERIREMPL
FT                   EPTRTDTPPATGAAHDASPADAPRALDGLAVDLRFELPPTSMPLGELSALQPGAVIELQ
FT                   QGINQSVIHLVANGMLIGTGHLIAVGQKLGVRVVTLTQPAPRER"
FT   gene            complement(735283..735681)
FT                   /locus_tag="Bmul_3756"
FT   CDS_pept        complement(735283..735681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3756"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bam:Bamb_4213 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3756"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17440"
FT                   /protein_id="ABX17440.1"
FT                   /translation="MDCKYLYIDNIKINFVRRTIEIDEKPVDVTPREFDVVEFLLDNMN
FT                   KIVPRQAIQEAVWGRELAVSSRTLDTHISRIRSKLQLDHDKNLRIIPIYAVGYRLVLFG
FT                   AAMTHVERHDAAPLARPAQQAAISADYL"
FT   gene            complement(736272..738488)
FT                   /locus_tag="Bmul_3757"
FT   CDS_pept        complement(736272..738488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3757"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bam:Bamb_4211 aldehyde oxidase
FT                   and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3757"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17441"
FT                   /protein_id="ABX17441.1"
FT                   /translation="MTIELDTRDSVRPSRRTFLKAAGAAAAVSLTIGFEWAGLGRRALA
FT                   ATTAPEAGAFAPNAFLRVTPDGAVTVIAKHVELGQGAYTGIATIVAEELDADWSRVRVE
FT                   SAPADAKRYANLAFGTMQGTGGSSAMSNSWQQLREAGGKARAMLVSAAAARWNVPASEL
FT                   TTANGVVTHAKSGKTAAYGTLVADASKLPVPDKVVLKQPADFKLIGHRIPRVDASAKSN
FT                   GTAHFTLDTTFPGMRVALLQRPPRFGATVKSFDATAAKAVPGVVSVVQVPAGIAVVATG
FT                   FWAAKQGRDALKVEWDETHAEKRGSDEIMREYRQLAAKPGASARKDGDADAAIAGAARK
FT                   ISASYEFPYLAHAPMEPLDAVVKLTKDSCEIWAGDQFQTVDQGNAAKVAGLKPEQVQIH
FT                   TLYAGGSFGRRANAWSDYVVEAVSIAKALGADGKPVKLQWTREDDIQGGFYRPMYFHKL
FT                   DAGLTADGRLVGWRHRIVGQSILAGTPFEAFMVKNGIDATSVEGAANLPYAVPNVSVEL
FT                   TTTKVGLPVLWWRVVGSSHTAYAVEAFIDEAAHAAGKDPYLFRRDLLAKEPRMRAVLGL
FT                   AAQKAGWDPAKPLPKGRGRGIAVAEAFKSYVAQVAEVSVDADGKVKVERVVCAVDCGIA
FT                   INPDIVAAQMEGGIGFGLGAAMHSAITLKDGRVEQRNFDGYQVLRMAEMPKVEVHIVPS
FT                   AEAPTGVGEPGVAPIGPAVANAIFAATGKRHYVLPFDSGTNASA"
FT   sig_peptide     complement(738351..738488)
FT                   /locus_tag="Bmul_3757"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.450 at
FT                   residue 46"
FT   gene            complement(738491..738952)
FT                   /locus_tag="Bmul_3758"
FT   CDS_pept        complement(738491..738952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3758"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bam:Bamb_4210 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17442"
FT                   /protein_id="ABX17442.1"
FT                   /translation="MATTFVLNGKSVTLDADPSMPVLWAIREHAGLTGTKFGCGMAQCG
FT                   ACTIHLEGQPVRSCVLPLAGIADKHVTTIEGLQSKPAQAVQAAWVKLQVPQCGYCQSGQ
FT                   IMSATALLEQNPKPTDADIDAAMNGNLCRCATYARIRAAIHDAAATLGA"
FT   gene            739095..740057
FT                   /locus_tag="Bmul_3759"
FT   CDS_pept        739095..740057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3759"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bch:Bcen2424_4835 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17443"
FT                   /protein_id="ABX17443.1"
FT                   /translation="MLARQGNRFEDLVMDMTDIAASRAAGQRELASLIGRFAPVDGSHA
FT                   TAVPGLMLHKHVRPVDLGCAVSRAALVIAAQGAKRVIVAGHAYEYDAQNCLITSIDLPI
FT                   LSRVTRASADAPYLCLSLTLDPQRIVELAAEMRLPEPESGPEGEGIALAELTTPLLDAA
FT                   LRLVRLLDTPADIPVLAPLIEKEMLYRLLTSAQGTRLRHMAVAGSQTHRIARAIEWIRA
FT                   HFAEPMRVETLANAVNMSVSSLHHHFKHVTTLSPLQYQKQLRLHEARRLLLQQGGDVGS
FT                   VAASVGYESASQFSREYSRLFGAPPMRDVAHLRRRELLG"
FT   gene            complement(740079..740375)
FT                   /locus_tag="Bmul_3760"
FT   CDS_pept        complement(740079..740375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3760"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: aav:Aave_3941 YCII-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3760"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17444"
FT                   /protein_id="ABX17444.1"
FT                   /translation="MPFLIETFDKPDHAHVRARERDAHLAFLARHRALLLACGAKLDDD
FT                   GAAASGGIYIVDLDTREAAERFIAADPFALAGLFERIAIVRWRKVYVNGVCHL"
FT   gene            complement(740434..741762)
FT                   /locus_tag="Bmul_3761"
FT   CDS_pept        complement(740434..741762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3761"
FT                   /product="short chain fatty acid transporter"
FT                   /note="PFAM: short chain fatty acid transporter; KEGG:
FT                   reh:H16_B1586 short chain fatty acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17445"
FT                   /protein_id="ABX17445.1"
FT                   /translation="MQRLTAFFTELMRRYLPDPFVFAIGLTLLTMVLAVVVQGQAVTAL
FT                   ASSWGKGFWTLLAFTTQMAVILAMGYVLATAPLVDRFLDRIVSHVNSPRMAIVVATLVG
FT                   GIGSWLNWGFGLVVGGIVARKLALRVRGVHHPLIIASAYSGFTLYGLGLSASIPVLIST
FT                   KGHPLEAQMGVIPLSETIFSPAMLMTSLVTIVTLPLLNAWLHPKAGQPVKEIDRTREAA
FT                   PTAAAPALDLDDGDTLANRLNHSRVLSYVIGAIGMGYVALHFVQGGSIDLNLINFFILF
FT                   LGILLLGTPIRYVEKLNEGIRTIGGIILQYPFYAGIMAIMASSGLVETLSAAFVKIATP
FT                   DTLPFWGLVSSFVINFFAPSAGGHWVIQGPFMIEAAKTIGASVGHTSTAVMLGNAWNDL
FT                   VQPFWILPALALSKLKLKDIMGYTVIMMFWVGIVYSVAILAWR"
FT   sig_peptide     complement(741643..741762)
FT                   /locus_tag="Bmul_3761"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.541 at
FT                   residue 40"
FT   gene            complement(741820..742827)
FT                   /locus_tag="Bmul_3762"
FT   CDS_pept        complement(741820..742827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3762"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   mes:Meso_2655 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17446"
FT                   /protein_id="ABX17446.1"
FT                   /translation="MPPVDRREAGSRHPRAGQPSAIGRAGIVGAGSIGVAFALVFARAG
FT                   WRVRLFDPDPARRAAAPAEIAARLADLAHFALLDESADYIAARIELVESIEAAAADADL
FT                   VQECAPERVELKRALFAQLDRAAPAHAILASASSFLCASAFVDETVTGRARCLVAHPGN
FT                   PPYLIPVIEIVPAPFTAEHTTARAIVLYEAAGLKPVRVKKEIAGFIFNRLQGAVLREAY
FT                   CLVRDGVASVDDIDTVMRDGLAPRWSVTGPFETVDLNTRGGIASHAQKMGPSYERLGAE
FT                   RGQSDPWTPELVAHVTAARRAALPLDQWDARVAWRDRRLMQLARHRRLAAPDDD"
FT   gene            complement(742830..743531)
FT                   /locus_tag="Bmul_3763"
FT   CDS_pept        complement(742830..743531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3763"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   aav:Aave_3940 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17447"
FT                   /protein_id="ABX17447.1"
FT                   /translation="MIKERVLITGGHAGIGAACAARCEADGYEAIVIDRDGDGIVADLS
FT                   DTRATADALERALAGGPITRLINNVGVVCPADAEHQTLDELEYAWALNVRCAQQCMQAL
FT                   LPGMKAAGFGRIVNMSSRAALGKELRTAYSATKAALIGMTRVWALELGRFGVTANAIGP
FT                   GPIRTALFDRANPPDAPRTRAIIDAVPVKRVGTPDDIAHAASYLLDARSGFITGQVLYV
FT                   CGGMTVGVAGI"
FT   gene            complement(743582..744634)
FT                   /locus_tag="Bmul_3764"
FT   CDS_pept        complement(743582..744634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3764"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17448"
FT                   /protein_id="ABX17448.1"
FT                   /translation="MRWKNRPEGSNWGDFGPDDQLGRPNLIGAEQVLKGAREIRAGLSF
FT                   TLSLPLDFPGDSKLNARRHPPVLRPTMRDGLPYVNFPFARNVPGATDVVSDDQVLLSLQ
FT                   YSTQWDSLAHVGARFDADGDGVAESVYYNGYRAEHDIVGPIRYRAESGFAPHACGGEHS
FT                   RATALGIENLAVKGMQGRGVLIDFVAHFGREYRTIGYDDLMRVMQADNIVVEPGDMLVL
FT                   RTGFAEMVLEMNRQPDEAVLATHCSALDGRDARLLQWITDSGIAALAADNYAVERYPAR
FT                   EPDTPGEHPLLPLHHHCLFKLGLPLGELWYLRELATWLREHGRSRFMLTAPPLRLPGAM
FT                   GSPVTPVATV"
FT   gene            complement(744746..745564)
FT                   /locus_tag="Bmul_3765"
FT   CDS_pept        complement(744746..745564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3765"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bch:Bcen2424_1669 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17449"
FT                   /protein_id="ABX17449.1"
FT                   /translation="MRPPSGRCLRVSVLSEHYRYVDNVLMDVKTAVRVFDVINLFAEVR
FT                   QPMIYSEIARRTEIPLSSCHALLQTMVAKGYLYAPGVKAGYYPTQRLLHVARDICSEDP
FT                   LTLMFQPLLCALRDATGETAALATLAGNRVVYLDVVESRQKIRYSDEPGGFMSVASAAG
FT                   KALLGALAPAARRRLLDSCEPLTVAPGGSFVNRETFERDIEQGVIDGWHRSTGESVEDV
FT                   AGLARGFLIHGEAFALVIGAPKARLLKHEQQAVKALLDVYAQIPPSLLAA"
FT   gene            complement(745585..748227)
FT                   /locus_tag="Bmul_3766"
FT   CDS_pept        complement(745585..748227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3766"
FT                   /product="glycosyltransferase probably involved in cell
FT                   wall biogenesis-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0865 glycosyltransferase
FT                   probably involved in cell wall biogenesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17450"
FT                   /protein_id="ABX17450.1"
FT                   /translation="MEKLVASLAGGAASEASDAEAGRTESAETDVPLVVPLMDSGTRTI
FT                   FHLLALCWVAALAIFWRWWLRDEHYVDAFRFGVNCFILFWTTFIPGYFIFIIRSAVVPN
FT                   PALDVPRGWRVAMVVTKAPSEPFEVVRTTLLAMLDQTYPHDTWLADEDPTPATLDWCRR
FT                   HGVRVSTRRGVADYHRASWPRRTKCKEGNLAYFYDTYGYDNYDFVSQLDADHVPTRTYL
FT                   EEMLRPFVDPAVGYVSAPSICDSNAALSWSARGRVNVEGPLHGTMQAGYAGGLAPLCIG
FT                   SHYAVRCRALREIGGLGPELAEDHSTTMIFNAHGWRGMHALNAIANGEGPRTFADLATQ
FT                   EFQWSKSVMIIMLRYTRRYFGGLPLKLKAQFLFCQLWYPLCALAMASGVAIPVAALLTG
FT                   RVWAHVDYVTYLAYAVPLGVLILCVVTWCTHATQSCRPLNTRLLSWEGLSFVFARWPWV
FT                   VLGCLSAIVDCIRGKEFAFKVTPKGGTIEQDAPLRVVAPYLLISLCCSLPVVAVENPHN
FT                   AGGFYLFSTLTSILYFVIAAVVAVNHGKEQGLAASAPAQMFFSRLPARNALFVFALAML
FT                   AAGIALRAPKGWQAVTWRSGLPAVLAPAPGQPVKQPALGVYDPDRVFAADANLAFDHVF
FT                   VSWNAPDLDTQIDDAYRTAHARNRALMVTVEPWALPRSRTGALLDDIAHGRYDARIAAT
FT                   CSALAALHAPVFVRWGHEMETDTGRYPWASGDASGYIDAYRRVVDACRAMTDQLRFVWS
FT                   PAGNRNLDDYFPGSGYADAVGLSVFDCPRCAVWPAGGRASAESILRTKYARVADYGLPV
FT                   MVTELGVDGSDARKRDALDEFQRSLWRYPLLKAVVYFNAVDTPGAWPARYVPDWRIAPS
FT                   FLRAEVVAK"
FT   sig_peptide     complement(748168..748227)
FT                   /locus_tag="Bmul_3766"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.776 at
FT                   residue 20"
FT   gene            complement(748259..749680)
FT                   /locus_tag="Bmul_3767"
FT   CDS_pept        complement(748259..749680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3767"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: bur:Bcep18194_B0866 UDP-glucose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17451"
FT                   /protein_id="ABX17451.1"
FT                   /translation="MNVRIAIVGTGYVGLVSGACLAELGHDVVCIDNNRGKIDALNQGC
FT                   MPIYEPGLDAFVARNVGRGTLRFSSDLAASVRDRDAVFIAVGTPTLPGTDRADLQYVEA
FT                   AARDIASNLNGFTVVVTKSTVPVGTNRRVQDIVERHAPPGIDTAIASNPEFLREGSAID
FT                   DFMHPDRVVFGAEHPRAIEIMNAIYAPLAAAGHLVLATEIETAELVKYAANAFLAVKIS
FT                   YINEISDLCEAVGADVELVANGMGLDRRIGAAFLKAGPGWGGSCFPKDTRALKATASEH
FT                   AVPLRIVSAAIESNALRKAQILQRIENACGGSIKGKRIAVLGLTFKGQTDDVRESPSID
FT                   VIQLLVGAGAHIRAYDPARPHEASRLLPQVFMESSAVDAVRSADAVVVMTEWKAFETLD
FT                   LADLADHMADPVMLDMRNLFDERRAADCGFRRYERVGRSCTARTPADAARGRVPVADDT
FT                   TAASQPASKLMIDSN"
FT   sig_peptide     complement(749612..749680)
FT                   /locus_tag="Bmul_3767"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.871 at
FT                   residue 23"
FT   gene            complement(749716..750705)
FT                   /locus_tag="Bmul_3768"
FT   CDS_pept        complement(749716..750705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3768"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: bur:Bcep18194_B0867 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17452"
FT                   /protein_id="ABX17452.1"
FT                   /translation="MKVFVTGGAGYIGSHTCKALAEAGHAPVAYDDLSTGHRDAVRWGP
FT                   LVVGSILDHDALGRALAAHRPDIVIHFAALAYVGESVLAPDRYYATNVTGTCTLLNAMR
FT                   AAGVGRIVLSSSCATYGIPDALPICEHTPQHPINPYGFTKYAMERMAADFERAYGMQWV
FT                   ALRYFNAAGADPDGLLGENHEPETHALPLAIRAALGTGRPFTVMGTDYPTPDGSAVRDY
FT                   VHVSDLADAHVKATAYLCRGGHSVALNLGTGTGTSVLELVRAVETVTGSRVPTVMAARR
FT                   PGDPPALYADATKAALVLGWRPRFAGIEPMVEHAARWFRQDLPLVSNK"
FT   gene            complement(750702..751709)
FT                   /locus_tag="Bmul_3769"
FT   CDS_pept        complement(750702..751709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3769"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: bur:Bcep18194_B0868 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17453"
FT                   /protein_id="ABX17453.1"
FT                   /translation="MNDRVAIETRVGQRVLVTGGAGFLGSYVCERLVVEGAHVVCVDSL
FT                   LTGRKLNVADLKASGRFEFVKADVTLGLPQLQVDEIWNLACAASPPTYQHDPVHTMMTN
FT                   VLGMNHCLALARKTGARVFQASTSEIYGDPSVHPQMETYRGNVNTIGPRACYDEGKRAA
FT                   EALCYDYYRTYGVDVRVARIFNTYGPRMSPRDGRVVSNFIVGALNGEPLEIYGDGLQTR
FT                   SFCFVSDLIDGFFCLMGAERNVGMPVNIGNPVEFTMIELAQKVLALTGSHSEIVFRPLP
FT                   IDDPHQRRPDISVAATELGWRPCIDLDEGLHRTVDYFARELWIAPMLQMTGAAA"
FT   gene            752464..752841
FT                   /locus_tag="Bmul_3770"
FT   CDS_pept        752464..752841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17454"
FT                   /protein_id="ABX17454.1"
FT                   /translation="MSQSIFSIRSRRVFTIESNTCAVARCACVVRAPRPAARRFAVRPS
FT                   ASGFPSSARKHDVARALQPVRLPRAAYRASDADVRISSLKHLFRRPRARVAPADFSAFS
FT                   RHCFAALDDRGGHATVIAIHS"
FT   gene            752825..753337
FT                   /locus_tag="Bmul_3771"
FT   CDS_pept        752825..753337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3771"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17455"
FT                   /protein_id="ABX17455.1"
FT                   /translation="MRYIPETKSAIPDGARAHRGERPRAAPDAATHGTRFAVWNAPASG
FT                   RRDATKMWGDQLVNKPVGETAMKTNSSSLIRAIHAQQWGSRKNRGIARGAVPASRVSAR
FT                   RFDGIRVLRFLERLPLAAALERIRCRAPFRSLRSAGPFIPNGPIPFRIRPCRAIPIAPP
FT                   ACRRRPD"
FT   gene            753839..754165
FT                   /locus_tag="Bmul_3772"
FT   CDS_pept        753839..754165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3772"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17456"
FT                   /protein_id="ABX17456.1"
FT                   /translation="MKKLLIAAAVLAVSGAAFAGGGTVSSSSSSSVGGTSAGVVGFGHF
FT                   TATDSGSALGAAGATAGYGGSSSISYTNHTNTSTVGGYGFGGAQAGGQSGANAGSIGWT
FT                   TFHH"
FT   sig_peptide     753839..753898
FT                   /locus_tag="Bmul_3772"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            754276..754863
FT                   /locus_tag="Bmul_3773"
FT   CDS_pept        754276..754863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3773"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17457"
FT                   /protein_id="ABX17457.1"
FT                   /translation="MKANVILATALTAISSVVWAAGSTTNQTQSVAAGVSGSVLVGSGS
FT                   YTSNSNSVAGANAGSTVTPAGSAGTASAFHNSTSTASGSGTNGGAFAAGGGIGAAGSYG
FT                   GNSSTNVNANALSGGVTATIVLGANHYTATGANDQGNANGWAGAVSGPGGSGTIAGSNH
FT                   FNSSTVWSTGPAGSPSASGGSQAGSGANAGSH"
FT   sig_peptide     754276..754338
FT                   /locus_tag="Bmul_3773"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            754986..755225
FT                   /locus_tag="Bmul_3774"
FT   CDS_pept        754986..755225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3774"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17458"
FT                   /protein_id="ABX17458.1"
FT                   /translation="MTAYGADRAAEDVQSNMQTSNDLAQTTKPSEQQTLSAGGAIGGPN
FT                   PQQWQGMADGSWSQLGSGWKQFGEAGKAEVIQGN"
FT   gene            755270..756766
FT                   /locus_tag="Bmul_3775"
FT   CDS_pept        755270..756766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3775"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bch:Bcen2424_4829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17459"
FT                   /protein_id="ABX17459.1"
FT                   /translation="MNSNKIKVACAALFAMTTIGTHAQTADSNSGSQSSSTATAVSLGG
FT                   GSSISTNNNTNNNTTTSTSRGGNATSTSGVRGSGNSNVQVNVTMPSASSGGLNQPQGVN
FT                   TLASAGAPGTSPYNTQTTENVNYSGTQTIKTNPAIQAPGLTTTLSDTCMGSVSVGVSFP
FT                   GFGATGGTTLVDQACVRRLDAREFRAMGLTDVALALLCQSDANRRAVEATGHLCPGTTA
FT                   PLARSNVAPSAEATVADDIKYHDPLVRSRLGLPPLDAAVPAAAATRPIVTSAVQSAPLS
FT                   MPMPAPAPAVAKAAQAAAAIPAAVAPAAAAVPSAAQSAASALPAAAVVAAPAVVEKAAP
FT                   VAETKAPEPVPAATEKAAQAAAAPAVDTKAPEAAQAAADTTPAAAVVAAPAAQAAASAV
FT                   DTKADAAAQPAAEPAAAPQASAAAPAEPMPEAAQQPAAADTSVAAEPAAEPAAAPAPQA
FT                   ADVPALAEPAKDAVPAAIDQAAPAAPAAPMPTVVSTSTSS"
FT   sig_peptide     755270..755341
FT                   /locus_tag="Bmul_3775"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.838 at
FT                   residue 24"
FT   gene            756914..757498
FT                   /locus_tag="Bmul_3776"
FT   CDS_pept        756914..757498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3776"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17460"
FT                   /protein_id="ABX17460.1"
FT                   /translation="MRIFLVALLLYSVQAAAQAVFQNPAVFVILSEQTLANAASVQQAL
FT                   TTLGRPDNTACVPMMMVGDPQVVYMVPEAGHAPSWQSPSYERGVPFDAQRGPVPTGKTV
FT                   GAMQHAQDMQTQPWEDSSALTQKIAGDASVTASSTVSEWQSSKLNTIETARASDVIVNG
FT                   KTYRAYRDDLNRTAPPVVEPQIYTQRVVFCR"
FT   sig_peptide     756914..756967
FT                   /locus_tag="Bmul_3776"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.654 at
FT                   residue 18"
FT   gene            757602..759023
FT                   /locus_tag="Bmul_3777"
FT   CDS_pept        757602..759023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3777"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B0877 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17461"
FT                   /protein_id="ABX17461.1"
FT                   /translation="MNNRCPISFSASQHSEPLVCPPSFAALRRNRVLPARPLVYLSPHP
FT                   DAALVDCLASNGWDVWHAKTVADALNCLRGNRLYAGIVDFDGFAALDVAAFEAVLRDPR
FT                   VGWVALAGDARLKDVALCRLIRQCCFDYVRNASAYTTIGYLVGHAYGMLKLAEADPDRQ
FT                   TDAPGGTMIGACDAMRRLFATIRKVANTDAAVFVAGESGTGKELTAAAIHQQSARAHGP
FT                   FVPVNCAAIPPTLLQAELFGYERGAFTGAHQRKIGRIEAAHGGTLFLDEIGDMPFESQA
FT                   SLLRFLQQGTIERLGGHASIPVDVRIVSATHVDLEAAMQDGRFRADLYYRLCVMRIDEP
FT                   PLRARGRDIMLLAEHMLQRFRGDCAHRIRGFAPCAVEAIYNYGWPGNVRELINRIRFAI
FT                   VMTNGATITAADLELGAYTSQRPPTLAEARRQAERRAIEETLMRHRHQHADVAAELGVS
FT                   RATLYRLMTAHGLHA"
FT   gene            complement(759096..759629)
FT                   /locus_tag="Bmul_3778"
FT   CDS_pept        complement(759096..759629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3778"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17462"
FT                   /protein_id="ABX17462.1"
FT                   /translation="MRRSPAPPPVHAARLMTDSDLPTDDTRIHDDGLWRDNGWTARIIK
FT                   NEDDDGWAVEMIKDGEAEPALVGPWTMGRDKKNPKPMDAAAFRTLVKTATEVLMRHEQQ
FT                   RRAMLHKQVTVWAGDSEVSVTLDIVPDELEPYAELKAFDPYGELLADAKVSAAFQLNKA
FT                   SATRWVESGYARPA"
FT   gene            759953..760657
FT                   /locus_tag="Bmul_3779"
FT   CDS_pept        759953..760657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3779"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   bur:Bcep18194_B0880 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17463"
FT                   /protein_id="ABX17463.1"
FT                   /translation="MRKFSVRTVFAYDWPLALVGMEHVVAAGCAIELVAAYPTAAELVA
FT                   AFDTVDCHVLLVDYSLRGDGRIEGLALLERLTRVRPEVGVVALVRNESPVILRSILAHG
FT                   ATSIVSKGDDVGHIVTAVHSAYSGGRYLSPLVRRALDASGSEPAPAKLSSREVEVIRLY
FT                   LSGIPIKAIAQRLNKGKQTVSAQKISAMKKLGAHNDVELIRYAAGLGLGGATLDATVPR
FT                   APRVRGTARVDD"
FT   gene            complement(760770..762323)
FT                   /locus_tag="Bmul_3780"
FT   CDS_pept        complement(760770..762323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3780"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bam:Bamb_4204 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17464"
FT                   /protein_id="ABX17464.1"
FT                   /translation="MRTLTLNQKLASMIVILWLGLLVIAGLGAWQTRASMIDDRREQLA
FT                   SLVAQATSVADHYYKLSQQNAMPEADAKQKALEAIAAMRYGSDGYISINDSKPVIVMHP
FT                   IKTELNGKDVSNFADPNGKHLFVEIVKVGNAAGGKGFVEYLWPKPGADKPQDKTSAVQR
FT                   FAPWDWYLVTGMYMDDVRSAVLASIGRWFGMTAVLGAIATTVMVLVLRSVRANLGGELE
FT                   LAVDTARRIAQGDLTAHVDVKRDDRGSLLHALHTMQSGLIDMVSRVRAGTENINVGASE
FT                   IASGNTDLSQRTEEQAAALVQTASSMDQMTANVKQNAESAAQAASLADQAAQVATRGSA
FT                   VVDDVVRTMNEITDRSHKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAA
FT                   EVRSLAQRSATAAKEIKSLIVSSNETVEQGATLVTHAGETMAEIVQSVRRVNEILDEIS
FT                   HASREQSAGIEQVNRAVGEMDQVTQQNAALVEQAAAAAHSLRDQAEALRDAVTRFALPA
FT                   "
FT   sig_peptide     complement(762237..762323)
FT                   /locus_tag="Bmul_3780"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.393 at
FT                   residue 29"
FT   gene            762568..763506
FT                   /locus_tag="Bmul_3781"
FT   CDS_pept        762568..763506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3781"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bam:Bamb_4203 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17465"
FT                   /protein_id="ABX17465.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLAAAGRDVTFLVRDGRAAALARDGLVI
FT                   RSPRGDLTLRDVQTVRAGDGAAPFDLVLLSCKAYSLDDAIASFAPFVGPSTLILPMLNG
FT                   MRHLDVLRERFGAARVLGGLCVIAATLDREQHIMHLNDTHGLSFGEPGGGDSPRMQALA
FT                   DVLGNAGFDATLSDDIVARMWDKWVFLATLAASTSLFRGSVGDILSAPDGRRLLETMLD
FT                   ECSAIAAHNGYRPEPPAIARMQQMVLTPSPLTASMLRDIENRARVEADHVIGDLLARRD
FT                   PDAGDALSLLRIAYNHLKTYEARVARERAAA"
FT   sig_peptide     762568..762630
FT                   /locus_tag="Bmul_3781"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.444 at
FT                   residue 21"
FT   gene            763767..764726
FT                   /locus_tag="Bmul_3782"
FT   CDS_pept        763767..764726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3782"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_4202 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17466"
FT                   /protein_id="ABX17466.1"
FT                   /translation="MMHPDLEVVDVRRDESFKVWSHGYPYRTIRWHFHPEFELHLIVAT
FT                   RGKYFVGDHIGSFEPGHLVLLGPNLPHNWVSDMAEGETVERRNLVIQFDQSFVDRCIDA
FT                   FPECRDAQTLLDEARRGVGFDEATSAAIAPLFDELLGARGMRRIALFMTILERLCAAAE
FT                   RTLLASPAYDQTHVTPTRLSHALSYIGKNLASDLRESDLAQLTGQSVSAFSRAFHRHTG
FT                   MPFVQYVNRLRIEAACQMLLDDRANITDICFRAGFNNVSNFNRQFRAVKGMAPSEFRAL
FT                   QRLNARSRELALHAAPTGNPMPPRVVTPGAPGFAAHPG"
FT   gene            764904..765845
FT                   /locus_tag="Bmul_3783"
FT   CDS_pept        764904..765845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3783"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bam:Bamb_4201 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17467"
FT                   /protein_id="ABX17467.1"
FT                   /translation="MMQPSFASPFGRTVRVAAVAALAVAAVLPAAAQAAPLRIGMTFQE
FT                   LNNPYFVTMQKALNEAAASIGAQVVVTDAHHDVTKQVSDVEDMLQKKIDILLVNPTDST
FT                   GIQSAITQAKKAGAVVVAVDANANGPVDSFVGSKNYDAGVMSCDYLAKAIGGSGEVAIL
FT                   DGIPVVPILERVRGCKAGLAKYPNVKLVDTQNGKQERATALSVTENMISAHPKLKGIFS
FT                   VNDGGSMGALAAIESSGKDIKLTSVDGAPEAIAAIQKPNSKFIETTAQFPADQVRIALG
FT                   IAIARKWGATVPKAIPVDVKVVDRGNAKGFSW"
FT   sig_peptide     764904..765008
FT                   /locus_tag="Bmul_3783"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 35"
FT   gene            765896..767416
FT                   /locus_tag="Bmul_3784"
FT   CDS_pept        765896..767416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3784"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_4200 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17468"
FT                   /protein_id="ABX17468.1"
FT                   /translation="MDTILRLSQITKSFPGVKALSGIDLQIARGEIHALLGENGAGKST
FT                   LMKILCGIHQPDAGTIEIDGVERHFANYHDAVAAGVGIVFQEFSLIPHLDAVDNLFLGR
FT                   ELRGRWGVRDRARMRRTAAGIFARLGVSIDLDAPIRTLSVAQQQFVEIGKALSLDARIL
FT                   ILDEPTATLTPAEAEHLFAIMRELKRQGVAMIFISHHLDEIFAVCDRITVLRDGQYVAT
FT                   TEVAHTDVEQLVRMMVGRRIESSFPPKPARRADAPAVLEVDALQLERGGPVNRFALHAG
FT                   EILGFAGLVGSGRTETALAVIGATRAYRKTVRVHGAPAKLADPADALRAGIGILPESRK
FT                   TEGLVTSFSIRDNISLNNLGKYRSMRWLIDRRGEARSTEDVMRRVGVKAPSIHAEVATL
FT                   SGGNQQKVVIARWLNHHATVLIFDEPTRGIDVGAKAEIYGLMRELTARGYAIIMISSEL
FT                   PEIVGMCDRVAVFRQGRIEATLEGDEIDPDTVMTYATAGTRGATHEPA"
FT   gene            767403..768416
FT                   /locus_tag="Bmul_3785"
FT   CDS_pept        767403..768416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3785"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bch:Bcen2424_4818 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17469"
FT                   /protein_id="ABX17469.1"
FT                   /translation="MNLPDSSSSTPSTTLAGTAADALPPPRAKWAQLRRSTLFYPLVGL
FT                   VVVCIAMMIASPSFLSAANLENVLRQVSINAIIAVGMTCVILTGGIDLSVGSVMALSGT
FT                   LAAGLMVAGVNAVAALAIGIAIGFGFGFLNGVFVAFAGMPPIIVTLATMGIARGLALIY
FT                   TGGYPIDGLPDWVAFFGSGKVFGIQAPVLIMLVVYAIAWLLLERMPFGRYVYAIGGNEQ
FT                   ATRLTGVRVARVKLIVYTLAGVTSALAAIVLTGRLMSGQPNAGVGFELDAIAAVVMGGT
FT                   SISGGRGAILGTLVGALLLGVLNNGLNMIGVNPYVQNVIKGGIILLAIYISRERSR"
FT   sig_peptide     767403..767471
FT                   /locus_tag="Bmul_3785"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.557 at
FT                   residue 23"
FT   gene            768451..769560
FT                   /locus_tag="Bmul_3786"
FT   CDS_pept        768451..769560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3786"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bch:Bcen2424_4817 alcohol dehydrogenase GroES domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17470"
FT                   /protein_id="ABX17470.1"
FT                   /translation="MTETRQLMTTPEAQPRMTAVVCHGPEDYRVEQVAKPRAGANELVI
FT                   RIAACGICASDCKCYTGAKMFWGGPNPWVKAPVIPGHEFFGYVEALGEGAAEHFGVALG
FT                   DRVIAEQIVPCGKCRYCKSGQYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHRIPL
FT                   GVSLEDAAIIEPLSCAIHTVNRGDIQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVID
FT                   LIDERLELARQYGADVTINPQRDDAREIVRALTDGYGCDVYIETTGAPVGVNQGLELIR
FT                   KLGRFVEFSVFGEDATVDWSIIGDRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVT
FT                   HGFALEDWDEAIRVAKSPESIKVLLKPAR"
FT   gene            769575..771137
FT                   /locus_tag="Bmul_3787"
FT   CDS_pept        769575..771137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3787"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bam:Bamb_4197
FT                   xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17471"
FT                   /protein_id="ABX17471.1"
FT                   /translation="MTGGIMEYVIGVDIGTQSTKALLVDRHGTIVAQRAAGYRPDTPKP
FT                   LWAEQWPQVWFDAVLDCIAGCVEEARTRGVPADAIRAVCVSSLYGGSGIPVDRDMRPIH
FT                   PCLIWMDRRATAEVERVNADVDVERLRAITGNGIDSYYGFTKMLWLREQRPEVWANVRY
FT                   FLPPNAYVIYLLTGEIAVDHSSAGNIGGVYDIARREWSDEALDMLGIPATMMPERLVES
FT                   TEIVGGLLSQWTERLGLRAGTPLVAGGVDAAVATFAAGATRAGQHVAMIGTSMCWGYVT
FT                   QHADARHGLVSMPHVFDGQRDLYVFGGAITAGASVAWFRDQFCHAECEAARALPHGDPH
FT                   VLLEEAAARVPAGADGVLFLPYLMGERSPVWDAKASGAFVGLSLAHTRAHLYRAVLEGV
FT                   AFALRHNIDAGRRGAAALDDKLIVVGGAAHSALWMQIVADVTGFPVWTIEQDVEAAMGA
FT                   ALLAAFGVGIVSHDDAQGGWVSLVERARPDPARAAAYAARFALYTALYPALKPIMHALQ
FT                   SGS"
FT   gene            771134..771880
FT                   /locus_tag="Bmul_3788"
FT   CDS_pept        771134..771880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3788"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bur:Bcep18194_B0889 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17472"
FT                   /protein_id="ABX17472.1"
FT                   /translation="MNMQFDFSGARVLVTGASSGIGRACAVALAQAGAQVVAAARDMAA
FT                   LETLAGETGCDTVRLDVGGDEQAIDAVLARYAAFDGLVNCAGVASLESALDVGAASFDR
FT                   VMTVNARGAALVARAVARGMIERGGARGGSIVNVSSQAALVGLPAHLSYCASKAAMDAI
FT                   TRVLCIELGPHGIRVNSVNPTVTLTPMAQFAWSDPAKSAPMLAAIPLGRFAQPDEVVAP
FT                   VLFLLSGAASMISGVSLAIDGGYTAR"
FT   sig_peptide     771134..771226
FT                   /locus_tag="Bmul_3788"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.454 at
FT                   residue 31"
FT   gene            complement(771997..772353)
FT                   /locus_tag="Bmul_3789"
FT   CDS_pept        complement(771997..772353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3789"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17473"
FT                   /protein_id="ABX17473.1"
FT                   /translation="MPCRTARIPACTGHRPRDRTTTRHDAARGTRHAPTVRRIALQTRA
FT                   RLPITKNEDEARPPRRRRYESHERAMTDHTTPMPEPPADPNRDPEDDPLSPPSPGHHHD
FT                   NPQQPDGPPSKDPV"
FT   gene            complement(772376..772960)
FT                   /locus_tag="Bmul_3790"
FT   CDS_pept        complement(772376..772960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3790"
FT                   /product="uncharacterized MobA-related protein"
FT                   /note="KEGG: bvi:Bcep1808_5308 uncharacterized MobA-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17474"
FT                   /protein_id="ABX17474.1"
FT                   /translation="MSYASLATGVLLAGGLGQRFDPSGLQSKLLAQLPDGTPVAVAAAR
FT                   RLAAATADVVAVVRPGAEQLAMLLNDAGCQVVYAPDALRGMGASLAAGVRACADAPGWL
FT                   VALGDMPWIAASTYEALTRALDADDASIVAPAHRGVRGHPVGFAAHHYDALAALDGDTG
FT                   ARALFKTAPVRLLDVDDPGVLRDVDTPADLR"
FT   gene            complement(773297..773692)
FT                   /locus_tag="Bmul_3791"
FT   CDS_pept        complement(773297..773692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3791"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bam:Bamb_4194 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17475"
FT                   /protein_id="ABX17475.1"
FT                   /translation="MIVLDTHALVWWVAGDPSLSKKARSAIDRARSEGTLAASAISAWE
FT                   IAMLVRNDRLALTMDVDAWLTTVAQIDGMRFVPVDADIAAKSTALPGTFHKDPADRMIV
FT                   ATARRLGAPLVTRDEKIRAYAHVKTLW"
FT   gene            complement(773689..773928)
FT                   /locus_tag="Bmul_3792"
FT   CDS_pept        complement(773689..773928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3792"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17476"
FT                   /protein_id="ABX17476.1"
FT                   /translation="MMPHAPVSKSEFKARALEYFRLVEASGESLIVTDHGKPTLEIRPY
FT                   RSSESQPLDILRGSVMRYDNPIDPIAEDDWEASR"
FT   gene            complement(774332..775015)
FT                   /locus_tag="Bmul_3793"
FT   CDS_pept        complement(774332..775015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3793"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: bch:Bcen2424_4810
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17477"
FT                   /protein_id="ABX17477.1"
FT                   /translation="MMLHVPGVLTQAQVARCREMLDAAEWIDGNATSGAQSALAKRNRQ
FT                   LPEGSPAARAVGDAIQDALARHPLFFSAALPLKVFPPLFNRYAGGETFGTHVDNAIRLL
FT                   RGTDFRVRSDLSATLFLAEPDTYDGGELCVEDTYGVHRAKLPAGDLVLYPASSLHHVTP
FT                   VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQTLTAEKGAKDPVVISLTGIYHNLLR
FT                   KWADA"
FT   gene            complement(775012..775767)
FT                   /locus_tag="Bmul_3794"
FT   CDS_pept        complement(775012..775767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3794"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bch:Bcen2424_4809 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17478"
FT                   /protein_id="ABX17478.1"
FT                   /translation="MEAVSLKALASVSPREFAEILAGPPERAAAWVAAAADNGIVEAQA
FT                   VYGQYLLDGRGVPRDPAAAFRWFAHAARAGHPMAMNMLGRCYEFGWGTVACAPVAVYWY
FT                   RLAAQAGLDWGMYNYATALALGNGIDENRAEALDWFRRAAALGHAKSINLIGGFYEDGW
FT                   VVDVDRDAAFDHYRRAAEAGDFRGQFNYARLLAERGRIDEALAWLARVPATATPAFVAK
FT                   MRAYLASSPLDAFRTAAMQLPSHDMESAT"
FT   gene            complement(775771..778017)
FT                   /locus_tag="Bmul_3795"
FT   CDS_pept        complement(775771..778017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3795"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bch:Bcen2424_4808 TonB-dependent siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17479"
FT                   /protein_id="ABX17479.1"
FT                   /translation="MKSRSDESKLGKFTTLCSVLAAGPAFAADGAPPPAPADAEGHLAP
FT                   IEIKGRAEHSYKADFSASAKFTAPLVDTPKSVTVIPQELIQTSGASTLTEALRTVPGIT
FT                   FGAGEGGNPLGDRPFIRGYDTQGSMFVDGMRDTGATTREIFNTERVEITKGSDGAYGGR
FT                   GGAGGSINLITKAPHLGTTAAASAGLGTDRYRRFTADGNWQFADHAAFRLNLMSHNNDV
FT                   AGRDAVNNERWGVAPSIAFGLGTPTRVTASYYHLSTDDLPDGGIPYFYTTTNKPANVDT
FT                   IYPAPVDRHNFYGLIDRDFRKTTSDISTLRIEHDITPALTVRNTTRYTESTQDYIWTQP
FT                   DDSQGNVINGKVWRRNNNRNSSINSIANQTELFGEFRTGPFKHSFTTGIELSREWGKRD
FT                   TYTVATGTGAICNNGIGAPSGYNCTSLWSPNPADPWAGSISRNNDYAHARTTTKSIYGF
FT                   DTIELTPRWQLNAGVRVDDYSTRFTDTKANGGKTYTRDDTLFNWQLGAVFKPAQNGSIY
FT                   ASYATSSTPAGMLLGEGSETQSLTPGRGGVGSNADQLSPEKNRSIEVGTKWNVLNDKLS
FT                   LTAALFQIDTTNARVTLPNNQYAMVGNKRVQGLELGVAGQLTKQWQVFGGYTYMKSELR
FT                   DNGKDTANNGHRFPNTPKHSFTMWTNYDVTPKFTVGGGAFYMSEVFGDPANLRAVPSYW
FT                   RFDAMAQYRINKKLDLQLNVNNLFNRTYFDQAYPAHYASIAPGRSAFVTLNARY"
FT   sig_peptide     complement(777934..778017)
FT                   /locus_tag="Bmul_3795"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            778322..778561
FT                   /locus_tag="Bmul_3796"
FT   CDS_pept        778322..778561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3796"
FT                   /product="Arc domain protein DNA binding domain protein"
FT                   /note="PFAM: Arc domain protein DNA binding domain protein;
FT                   KEGG: bur:Bcep18194_B0895 plasmid stability protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17480"
FT                   /protein_id="ABX17480.1"
FT                   /translation="MPVITVRNLPDEVHRALRVRAALHGRSTEAEVRDILEQAVLSEGR
FT                   VKLGTLLAEIGREAGGVDLDIQRDKTPTDPMSFE"
FT   gene            778558..779013
FT                   /locus_tag="Bmul_3797"
FT   CDS_pept        778558..779013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3797"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bur:Bcep18194_B0896 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17481"
FT                   /protein_id="ABX17481.1"
FT                   /translation="MILVDTNVISEPLRRKPSAAVIEWLDAQNVETLFLAAISLAEMRF
FT                   AVAALPEGRRRDWLAQSIEHRVVPVFRGRILPFDDAASKAYARIRAHARAGGTAIAPAD
FT                   GYIAATAEANGLIVATRDVAPFEAAGLRVIDPWASQGAPVRQGIASK"
FT   gene            complement(779111..780406)
FT                   /locus_tag="Bmul_3798"
FT   CDS_pept        complement(779111..780406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3798"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: bch:Bcen2424_4807 aspartate
FT                   carbamoyltransferase; TIGRFAM: aspartate
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17482"
FT                   /protein_id="ABX17482.1"
FT                   /translation="MPVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQE
FT                   SRGMPEIVERFVSEIVERAAPEGEIYTQRVDNHGLAKQFLFEGKPQLLSVDQFSRESVE
FT                   ALFRVADVMQPIARRHKISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGF
FT                   TFSSMAKGESIYDTSRVMAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQ
FT                   ALLDLYTIQREFSRLGKIVDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTL
FT                   EMPAYIIDQIATNGHVIEQTNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQ
FT                   ALVDTVCKPDTLIMHPLPRDSRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLL
FT                   GVENLVQHSMRDATWRPPAYLGPEDAVFHGID"
FT   gene            780639..780773
FT                   /locus_tag="Bmul_3799"
FT   CDS_pept        780639..780773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3799"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: bur:Bcep18194_B0898
FT                   entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17483"
FT                   /protein_id="ABX17483.1"
FT                   /translation="MTRTIAAMLLVMTAALAGCNTVAGVGEDISKGGQAISNTAEKAK"
FT   sig_peptide     780639..780710
FT                   /locus_tag="Bmul_3799"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 24"
FT   gene            complement(780867..781442)
FT                   /locus_tag="Bmul_3800"
FT   CDS_pept        complement(780867..781442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3800"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17484"
FT                   /protein_id="ABX17484.1"
FT                   /translation="MNKKEAKAKIAALLAAGTRKAEVLANLSGQGLKDRVLARLIASRP
FT                   DPERCRRNKVHVRILIGIAVVQLLISLDIAYSLFELAGRLGSARGSGQGVTLLFIALTV
FT                   PLALLFIWGFATNRVGAYHAFIALSLLQLPKTIADLTHDPSDALPTLAITAVLVGYVWF
FT                   VRNRMFPDYGWFTPRKIDGRYAFVDRAS"
FT   gene            complement(781707..782666)
FT                   /locus_tag="Bmul_3801"
FT   CDS_pept        complement(781707..782666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3801"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; UAA transporter; KEGG: bur:Bcep18194_B0900
FT                   protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17485"
FT                   /protein_id="ABX17485.1"
FT                   /translation="MRRMKTRLIGYLYLAAAMAGVGSTVIASRVAAGGLPPFAATALRF
FT                   LIATPLLLALMRMRRLRWTRPSTRDAVLLVIQAAAGGVGYTVLLIYGTKLASPIDAGVM
FT                   LGTLPAMSTLIAAVVLRERQTRRDWVAAALATSGVLFVTFAPGHAMPSMRALVGDALVL
FT                   AAVACEAVFILLNRRLTVPLPPLTLSAAMSALGFVLALIPAAFEWRAVVSGWTFGAVSA
FT                   IAYYALVPTVLGYVCWYAGSARTSGTEAALFTAIAPVSAVLFAVVLFGDALTATRIAGI
FT                   ALVVAGVLVGATRRRDSSTKADAQCHADPARPAQAAAE"
FT   sig_peptide     complement(782568..782666)
FT                   /locus_tag="Bmul_3801"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.716 at
FT                   residue 33"
FT   gene            complement(783287..784081)
FT                   /locus_tag="Bmul_3802"
FT   CDS_pept        complement(783287..784081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3802"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bch:Bcen2424_4803 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17486"
FT                   /protein_id="ABX17486.1"
FT                   /translation="MHRVTHYRRSDDGIEAISLDSDRTFPRHAHDEFGVGVIVSGAHRS
FT                   WSGRGQVDALAGDAIMVNPGEMHDGMPIGTRAARRWRMLYLAPSLVAGIAAEEGLGGIE
FT                   LAHPAVRDARLAAAVVQLHAHIVESADAPLARDEALVTVVAHLLARHANRTLPSAGVAP
FT                   AVRAARERLDAAPAEPVSLAELATLSGVSRFQLLRGFARELGITPHAYLLQSRTRLARA
FT                   LLASGRPIAEAAAEAGFADQSHLTRAFGRQFGITPGRFAQAV"
FT   gene            784250..785080
FT                   /locus_tag="Bmul_3803"
FT   CDS_pept        784250..785080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3803"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17487"
FT                   /protein_id="ABX17487.1"
FT                   /translation="MERQDPVFIQVGALADGFAPEANILAPVDALDGRTLTLDTADGES
FT                   RVYAFEPGVVRWRDAASGDGGREPCRVTRLRDGLLFVDYVDSRARATSVSLVIDLDRGV
FT                   WTSVVGTLPTEADTRVDAFTRVMLGRPLTGVDVAFRHGTIAGHAQPGPLHAPTRELIGK
FT                   RTMYRYSPTECYEHIYLNEHFYAWQCLQGVESGLADVDRCHYFRIAEALYLFVWREKVV
FT                   PTLGVVLIDLAQHKTDGKIFGYAQDDFGTLSNFPVGAHAQVLNETVHPLDGVQR"
FT   gene            785077..785886
FT                   /locus_tag="Bmul_3804"
FT   CDS_pept        785077..785886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3804"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bur:Bcep18194_B0903 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17488"
FT                   /protein_id="ABX17488.1"
FT                   /translation="MTAALGSGRVRADFTGRVVLVTGAAHGIGAAIARRFAESDAFVAL
FT                   ADLDEAAAVAQADAIARAGGAARAYRVDAGSRDELCALVSDVERDGGRLDVVVHNAAYF
FT                   PLTPFVDIDVQTLERTLSVNLSALFWLAQAALPAFERAEGGRLLVTSSVTGPRVAFPGL
FT                   AHYAASKAGVNGFIRAAALELARRNVTVNGVEPGMIRTSAAGNLGDASVAERIARDIPL
FT                   ARMGEPDDIANAMLYLASADAAYVTGQTIVVDGGATLPESGAALDAI"
FT   gene            786603..787316
FT                   /locus_tag="Bmul_3805"
FT   CDS_pept        786603..787316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3805"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bvi:Bcep1808_5301 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17489"
FT                   /protein_id="ABX17489.1"
FT                   /translation="MEQHINGKVVAITGGFGHLGIATAAWLGARGARVALIGRGAAPDS
FT                   NALPDVPATALRLGGIDLVDPQAAVHALDAVHRQFGGVDALLNIAGAFVWQTIADGDVD
FT                   TWDRMYALNVKTALNASKAALPYLLQSAAGRIVNIGAGAASKAGTGMGAYAAAKAGVAR
FT                   LTEALAAELLDRGITVNAVLPSIIDTPSNRADMPDADFTRWVQPQQIAATIGFLLSPEA
FT                   QAISGASIPVSGRVA"
FT   gene            complement(787365..787667)
FT                   /locus_tag="Bmul_3806"
FT   CDS_pept        complement(787365..787667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3806"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bch:Bcen2424_6922 histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17490"
FT                   /protein_id="ABX17490.1"
FT                   /translation="MPTKNYRDLKEQLAKLQKEAEAARIAEMEAVIAEIREKVAEYGIT
FT                   SEQIFGRQRAGRSKAATPSAPKYRNPKTGETWTGRGRAPGWIKDVKNRDRFLIQE"
FT   gene            788212..788409
FT                   /locus_tag="Bmul_3807"
FT   CDS_pept        788212..788409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3807"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17491"
FT                   /protein_id="ABX17491.1"
FT                   /translation="MSNAVSPDSSTDDPRPTPPRQPELEECCNSGCSPCIFDLYYEAMD
FT                   EYRAALAAWEARHAKPESHR"
FT   gene            complement(788435..789898)
FT                   /locus_tag="Bmul_3808"
FT   CDS_pept        complement(788435..789898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3808"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_4177 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17492"
FT                   /protein_id="ABX17492.1"
FT                   /translation="MTDNLLARCAPAGAAPAATPHNRHGWALVVLLVGAILPPLDYFIV
FT                   NLALPAIRDGIGARPAELQLVVSAYACANAVAQITGGRLGDLYGRKRMFMLGMAGFVVA
FT                   STLCGLADSGAVLVGGRVLQGLFAAILAPQVLATIRSVFTPQEQVRVMGFYGFVFGLAA
FT                   VIGQLGGGALIDLHPFGLGWRAIFLVNLPIGVLALLGSWRFIPENRPPRGQRIDVPGTV
FT                   LLSLFLLMLVYPLTHGRDAGWPAWMVACAIGALPVLAALLAVEARQLAAGRDPLLDLRL
FT                   FRHPVVALGLALAFLFYMLSAFFLSYGIYLQGCLHWSPLASGAAILPLGIGFLSSPLLM
FT                   PRLVGRFGGYRVLTLGFAMLAAGVAAAAALAGSGAPGIGFYAGIAAIGIGQGLVLPSVV
FT                   RIVLAEVDASRAGVASGMVTAALQIGAAVGAATLGGMFFAQLGAAPGPLDYVRGFRTSM
FT                   FALSAILAVCVVLSAALGPIHRRLHAAAA"
FT   gene            790025..790900
FT                   /locus_tag="Bmul_3809"
FT   CDS_pept        790025..790900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3809"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B0919
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17493"
FT                   /protein_id="ABX17493.1"
FT                   /translation="MRGFDLDQLRTFAAVADAGSLTAAAPLLHLSQSTVSEQVRKLESR
FT                   AGVPLFVRSKRGVEPTPAGARLLHHARRIVALNEAAFDELRGQAIKGELRVAITDYYRT
FT                   HEVAGMLARLRECYPQLSLHVSAMKSADIEAAYAKGQIDLGVVMHLSSGPFRPASADTR
FT                   WVLRREPLSWVTSPALAEQLPERLPLVLLPDDCMMHQIAVRSLDEQRIPYELVHSASGV
FT                   AGLQSMLAAGLGVGCLCASAIGDGLMRLGGAKYRLPALPDAVFSLTPPMPGERETVTQA
FT                   REVLSRQLLV"
FT   gene            complement(791335..792234)
FT                   /locus_tag="Bmul_3810"
FT   CDS_pept        complement(791335..792234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3810"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4175 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3810"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17494"
FT                   /protein_id="ABX17494.1"
FT                   /translation="MTADLNWERYRTFLAVLTEGSLSAAARALGITQPTAGRHVAALEA
FT                   AFGQTLFTRSPSGLLPTDAALALRGHAEALRSAAAAFERAAASHGAGVRGTVRISASDV
FT                   IAVEVLPPLLAQLRREHPGLVIELVPTDRIQDVLNREADIAVRMASPSQDALVARRIGE
FT                   LEVALYARDDYLARYGAPSTLDALAHHALIGFDTVTPFVRSAGRGLPSWTREAFALRTD
FT                   SNLAQLAMIRAGYGIGFCQSRLAQRDSRLVRVLPDGPAVKLETWVVMHEDLRASPRCRA
FT                   VFDALANGLRAYAEGTGE"
FT   gene            792328..793338
FT                   /locus_tag="Bmul_3811"
FT   CDS_pept        792328..793338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3811"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: bam:Bamb_4174
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17495"
FT                   /protein_id="ABX17495.1"
FT                   /translation="MAANTGTAGGQALVLGASGGIGGEVARQLRDAGWQVRALKRGLES
FT                   EAAERNGIAWIPGDALDRDAVVRAARGCSVIVHAVNPPGYRNWAEQVLPMIDNTIAAAT
FT                   AARATVVLPGTIYNFGPDAFPLLREDAPQRPVTRKGAIRVELERRLAAASAHGVRTIVV
FT                   RAGDFFGAHAGNNWFGQALVKAGQPVTAIRVPNRPGVGHQWSYVPDVARAMVELIERRD
FT                   TLEPFARFHLGGHWDADGTQLAQAVRRVAQRHGMRPAVRRFPWWLVWAAAPFVTTLREM
FT                   LEMRYLWREPLRMDNARITAVLGREPLTPLDTAVEAALTDLGCLHTRDARQPRNA"
FT   gene            complement(793384..794085)
FT                   /locus_tag="Bmul_3812"
FT   CDS_pept        complement(793384..794085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3812"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3812"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17496"
FT                   /protein_id="ABX17496.1"
FT                   /translation="MQVLSFNVIPVHQPPAAVDVEIERVVIAGWAGRDARAIRAHIDEL
FT                   AALGVAPPSATPCFYRVAPALLTQAASIGVLGTRSGGEIECVLIDSAAGTLVTVGSDHT
FT                   DREVEAYGVAVSKQVCAKPLGRDAWRYADVAAHWDAIEMRAWLVSRDGERVAYQHGAVS
FT                   GLLAPDTLWQRFDDRGTMPARCAMFGGTVAVHGAIAAMNDGDAFEMELHDPVLGRSLRH
FT                   RYAVDVLPVVA"
FT   gene            complement(794137..795456)
FT                   /locus_tag="Bmul_3813"
FT   CDS_pept        complement(794137..795456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3813"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B0925
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3813"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17497"
FT                   /protein_id="ABX17497.1"
FT                   /translation="MPDTMSTLAQPAVHAPHRARNSRLATASMIGTSLEWYDFTIYNTL
FT                   AALVFNRLFFPSVDPLAGTILAFSTYAVGYVSRPLGGFVFGNLGDRIGRRAVLMLTLVL
FT                   MGVTTALMGALPTYATAGILSPILLVALRFVQGVALGGEWAGAVLLSVEHGDQKRRGLS
FT                   ASWTQVGPSFGTLLGTGCIALVTLSTTPDGFLAWGWRLPFAASALLVAFGFWVRRGVDE
FT                   TPQFEQLAESHATADVPVAEVLTCHWRRLLVAGGARIGSDVLYALIVVFTLTYVTTVLH
FT                   LSRPLALTAVMIGTACNAIAVPCFGALSDRFGRRPVYLAGAFAGIVWAFAFFALLDSAR
FT                   PAAIVAAVAIGLVIHAVMYGPQGAFVTEQFPTRVRYAGSSLAYTLAGIVGGGFAPLVIA
FT                   ALFRQTGTTTAVSLYVSAALAVTAVALVVARETAHRPLAD"
FT   gene            complement(795516..796199)
FT                   /locus_tag="Bmul_3814"
FT   CDS_pept        complement(795516..796199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3814"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17498"
FT                   /protein_id="ABX17498.1"
FT                   /translation="MTRPSLPHGQLCVWTDIDPAHEADFNAWYDREHMQERVAIPGFTH
FT                   ARRFRATDRGPRKYLALYVTDTLDVFRGDAYRRAFAQQTAWSLANFERMTGTQRRVGEL
FT                   TIEAGDGEGAHLALFVLPPERIDVAQLRARFDAALREPGVHAARLFRTTPELSAPIGAD
FT                   AVARPAADALVLIEGSDAAAARRVAAALAGHDEVRTFELLWRAAAPLRAARGEPAPQAA
FT                   AALPA"
FT   gene            complement(796299..797384)
FT                   /locus_tag="Bmul_3815"
FT   CDS_pept        complement(796299..797384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3815"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4170 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17499"
FT                   /protein_id="ABX17499.1"
FT                   /translation="MNIRFLETFVWLAKLENFRLTAEKLHTTQAAVSSRIASLEEAFDV
FT                   RLFDRNTRSATLTPAGRRMLAYAERIVRLDHEMRREIPSASDVGPIRIGVIESIVHSWF
FT                   PALIARAREHYPRLDVEITSDTTLHLTRLLSTDGVDLILQTDTVPGPDFTNLPLCEFPV
FT                   RWVASPRLGLGGERLDVAQLAEFPVISFSRHSGPHATIERLFAAVERPASINCITSVAA
FT                   MIRLVADGFGVAALPPAIIGRELQEGALELLDVEPAFPALPLVATYRTQGLPLAARIAE
FT                   LASEVARATPSMPIDTAAGTSMRRGAERRAQAPDVRAKTGKDAKAAKGAKEAKDAGRPQ
FT                   RAAEPSTIAAPAAAKRRPRRS"
FT   gene            complement(797527..798318)
FT                   /locus_tag="Bmul_3816"
FT   CDS_pept        complement(797527..798318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3816"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_B0928 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3816"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17500"
FT                   /protein_id="ABX17500.1"
FT                   /translation="MRAARPRTIVITGAGTGIGAACARRFARGGDRVVLIGRRPAPLEA
FT                   LAAETGGLALAGDAAGTADWARFVPAIAARFGRIDALIACAGGHGVGRADETGDAQWRD
FT                   AMHANLDTAFVSARACLPDLIAQRGSIVLVASIAALAAGPGVCGYTVGKHALLGLTRSL
FT                   ARDYGPHGVRANAVCPGWVRTPMADAEMQPLMDAHGDTLERAYARVSADMPLRRAADPD
FT                   EIAAVCTFLASPDASFVTGATLVADGGATVVDVPTLAFDAR"
FT   sig_peptide     complement(798235..798318)
FT                   /locus_tag="Bmul_3816"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.373 at
FT                   residue 28"
FT   gene            798575..799450
FT                   /locus_tag="Bmul_3817"
FT   CDS_pept        798575..799450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3817"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: bur:Bcep18194_B0929
FT                   protein of unknown function, zinc binding 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17501"
FT                   /protein_id="ABX17501.1"
FT                   /translation="MRLDDERESMNVEDRRGAGGFGGGRGATIGIGTIVVALAASYFFG
FT                   IDPRVVLEGASMLQGQQTQQAPAQRQGAPATDPGAVFTRKVLGNIERTWTTIFSTQLHA
FT                   QYQPPKLVMFTNSTPTACGTGQTAMGPFYCPGDQKVYIDLGFYDELRKRFGAGGDFAQA
FT                   YVIAHEVGHHVQNLLGISEKVDAARRRASEARSNALSVRMELQADCFAGVWANNAQRAN
FT                   QRLIEPGDFEQGLKTAAAIGDDRLQQQGQGYVVPESFTHGTSEQRMYWLRRGMESGELS
FT                   ACDTFAANAH"
FT   gene            799708..800502
FT                   /locus_tag="Bmul_3818"
FT   CDS_pept        799708..800502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3818"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   bur:Bcep18194_B0930 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17502"
FT                   /protein_id="ABX17502.1"
FT                   /translation="MPPLGSVGFPDVRPAAPGPTMPLPTPSADPDAADWQRALHACVDA
FT                   FDAFASPSAIVFYRLDASGEPADFELFGMPESMHRTYVARYRMLDPLHPSRCASDARTV
FT                   VTLASQLPDECRDASAYWTRFLRRHGVADVVEIWLRDDGRTVGAFSLLRFDTRGAARGG
FT                   DGASTRFAPGEIDALARLQPLAEAALTPLLRTRRGIHRIECEARLTYREEQIARLVRDG
FT                   RSNKEIARDLALGQPTIKTHLMRMYRKLGVSNRTELVGALFL"
FT   gene            800723..801631
FT                   /pseudo
FT                   /locus_tag="Bmul_3819"
FT   gene            801720..802226
FT                   /locus_tag="Bmul_3820"
FT   CDS_pept        801720..802226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3820"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bch:Bcen2424_4781 betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17503"
FT                   /protein_id="ABX17503.1"
FT                   /translation="MTLGPGLDTTAQINPLVSAQHRDKVVRHIEQARRDGVTFLAGGTR
FT                   VDELPGYYVRPAVIADPRADSAIVRDEVFGPVIVVLPFDDAADAVRLANASPYGLAASI
FT                   WSNDLTRVMNLVPQIEAGTVWVNCHIPLDPSMPFGGYKQSGIGREFGQYAIEGFTETKS
FT                   VCIAH"
FT   gene            802269..803609
FT                   /locus_tag="Bmul_3821"
FT   CDS_pept        802269..803609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3821"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bch:Bcen2424_4780 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3821"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17504"
FT                   /protein_id="ABX17504.1"
FT                   /translation="MSYNEAKFWHPMLHPNEMKRRKPIRIVRGDGCYVFDEDGKALVDG
FT                   VAGLWNVNVGHNRREVKDAIVRQLDELEYFQLFDGITHPRAEELSKRLIDLLEPEGMRR
FT                   VLYSSGGSDSVETALKIARQYWKVRGQADRTKFISLKQGYHGTHFGGASVNGNTVFRRN
FT                   YEPNLPGCFHVETPWLYRNPFTQDPEELGRICAALLEREIQFQSPDTVAAFIAEPIQGA
FT                   GGVIVPPANYWPLVREVCDRYGVLLIADEVVTGFGRSGSLFGSRGWGVRPDIMCLAKGI
FT                   SSGYVPLGATAVNARIEDAFAQNADFGGAIMHGYTYAGHPVACAAALASLDIVVNEDLP
FT                   ANAAKQGAYLLEALQPFVERFAAVGEVRGKGLMLALDLVADKTTREPIDPLSGYANAVA
FT                   EVAREHGVLVRPVGTKIILSPPLVIERPELDRIVDALAAGFEAVPVA"
FT   gene            803797..805296
FT                   /locus_tag="Bmul_3822"
FT   CDS_pept        803797..805296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3822"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0935 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3822"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17505"
FT                   /protein_id="ABX17505.1"
FT                   /translation="MSGWSGMTDAAAGASTGAAAQTGGAALKAGAVGFPTALASAVGLI
FT                   MASPVILTATSGFGMGGWAFAVAMIIAFVMMQAQATTFSEAAAMLPTAGSVYDYLSCGL
FT                   GRFWAITGTISAYFLVHVFAGTAETILSGIMALVNFESLNAALEKHNSSWLVGVGLVIT
FT                   FAITNIIGIKVFSKLEIVLTAGMWLSLMIFGILGLAAAPAVHLDGWFGGSTVGTSVPAV
FT                   LSLVGMAMFMFVGCEFVTPLAPEMKAPGRTIPRAMALGLVGVALCMFLYGAAIRRQVPN
FT                   VPVSADGLTHLLDTPGAIPAFALQVLGPFGRIWFGIAFLCAGAATINTLMAGLPRILYG
FT                   MAIDGALPRCFAYLHPRFRTPVVGIVAAAAVPIVHAWLINGNLDSILHLVLAATCAWGT
FT                   AYLLVTASVVMLRIRRPDLPRPYRSPWFPLPQIVSSVGIVLAIWYITPPGMNARDVYVP
FT                   FGAMLGLTALYALFWTVVVQRRHPFRPVPVEDVLRNEHVAR"
FT   sig_peptide     803797..803859
FT                   /locus_tag="Bmul_3822"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.691 at
FT                   residue 21"
FT   gene            805293..805877
FT                   /locus_tag="Bmul_3823"
FT   CDS_pept        805293..805877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3823"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17506"
FT                   /protein_id="ABX17506.1"
FT                   /translation="MNAVFARRRAGRDALPAGHRPDAVAARVLADLQAVHDARGESGAA
FT                   QLPNGVCVTLTERIEREFLMHTVSVTIAMAACGPVASGRAQVQQTGWVRRTGIRIVAAS
FT                   GSDPRFCRTLAALAADAALVDALRRLHLSACTVDAHDGRWTLAIVPFGGSEVVNRMPSF
FT                   RRYVRLTDEQAAALHAACAAFEVALHGILHG"
FT   gene            805948..806952
FT                   /locus_tag="Bmul_3824"
FT   CDS_pept        805948..806952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3824"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_4160 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3824"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17507"
FT                   /protein_id="ABX17507.1"
FT                   /translation="MLFQSRSHEDVHDHGLAIAGWHQVYRQMTPGRFRGTVTQVLYDDF
FT                   HFFRETTNRRVAQTGLAPAGRTSLAVPLSVPLAGTFQRQPVDGYALLALRAGEDFEFHT
FT                   PEGMGLVGISAASDMIDELCEVEFGAAGIGAPGVGASGPRGARSCATATGARRLRHVTR
FT                   LSDDQGAALGARLSSLIDEAQRNPGCLEYAATRKIFRDAMLGVFFDALDQGIGVERRDI
FT                   THATYSDIVSRCEKYLRDRPEEPVTVLELCRALRCSRRTLQTSFQRVADVTPVAYLRTI
FT                   RLNAVRRLLRTTSAQQLGVGEAAASWGFTHLGYFAREYRDLFGELPSQTQRPE"
FT   gene            807095..808300
FT                   /locus_tag="Bmul_3825"
FT   CDS_pept        807095..808300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3825"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bam:Bamb_4159
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3825"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17508"
FT                   /protein_id="ABX17508.1"
FT                   /translation="MKIGRLAAAVAALGCAHAYAQTSGSVTLYGTVDTGILYSTNQQFT
FT                   RADGSTGGGHAWQMGGGNLVPSRFGFQGAEPLGGGLDAVFTLEQQFLSANGQALQGGTA
FT                   FSRQAWVGLRQDGIGTLGLGRQYDSYTDMLGAYVSSNNWATPYGSHLGDVDNLNAAFNF
FT                   NNAVKFTSADFRGLTFGGTFSFGGQAGDFAAKRGYALAATYSRAPVALSIGYLNLRQPL
FT                   DAALGGANGYIGDFACSNPGAMFCLLQDARSMRAFGAGGSLTLGAATIALTYTHTRLDD
FT                   SRYLTTAAQPRPQAFTFDIGELNVTYLFTPALQGGIAYIFNAAHTDTRGTTRFHQLNVG
FT                   ANYSLSKRTALYAVAIGQLASGTGLGTDANGQPANNAQIPVLANSNSNRQLAVMGGIRV
FT                   NF"
FT   sig_peptide     807095..807157
FT                   /locus_tag="Bmul_3825"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 21"
FT   gene            808416..809633
FT                   /locus_tag="Bmul_3826"
FT   CDS_pept        808416..809633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3826"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bbr:BB1971 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17509"
FT                   /protein_id="ABX17509.1"
FT                   /translation="MSDLASSMPRRADVNAKSLAVAAIAIVVGTTYLARAADARIAALF
FT                   VVGALLGVTLYHAAFGFTSAWRVFIADGRGAGLRAQMVMLAIGTALFFPVLAAGTLFGK
FT                   PVTGLVSPAGTSVVVGAFLFGIGMQLGGGCASGTLYTVGGGSTRMLVTLAAFVAGSVIA
FT                   TAHMPFWTALPSLPPVSVVKSFGALPALAGSWLLFAAIAALTVVVEKRRHGRLVAPELR
FT                   ANASARWLYGPWPLIGGAVALAVLNFATLALSGRPWGVTSAFALWGAKLAAAAGIDVAS
FT                   WPYWTAKANAAALAAPVTRDVTSMMDIGIVIGAMFAASLAGRYAPVWRVPLRSLAAAVV
FT                   GGLLLGYGARLAYGCNIGAYFSGIVSGSLHGWLWLVAAFAGNVIGTRVRPWFGLEVERV
FT                   PRASGC"
FT   gene            complement(809716..809997)
FT                   /locus_tag="Bmul_3827"
FT   CDS_pept        complement(809716..809997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3827"
FT                   /product="lysine exporter protein (LysE/YggA)"
FT                   /note="KEGG: bam:Bamb_4152 lysine exporter protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17510"
FT                   /protein_id="ABX17510.1"
FT                   /translation="MSDNIFSDTLGNPKIMLFYLALLPTIVDLTHVGVVAWAELVGTML
FT                   AVLIFADCFWSLLAMRARSFLTSARAKRIANRTSATAMAGAAVAIATR"
FT   gene            complement(810047..810334)
FT                   /locus_tag="Bmul_3828"
FT   CDS_pept        complement(810047..810334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3828"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17511"
FT                   /protein_id="ABX17511.1"
FT                   /translation="MTKKQSKHAEPTTDMQVVAPINSQISAVHFQGLRITTPDGQPATL
FT                   AVVDMQGRVIESGQTVVRAAWEVAIKAYRNFLSDKGILRVKTISPDKQPT"
FT   gene            complement(810474..810851)
FT                   /locus_tag="Bmul_3829"
FT   CDS_pept        complement(810474..810851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3829"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; KEGG: bch:Bcen2424_6796
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17512"
FT                   /protein_id="ABX17512.1"
FT                   /translation="MFDGRCAYCGELLSDRWHADHFAPVRRDVKIVKTDRGYRWRSGAP
FT                   TRPEFDVIDNFMPSCAPCNIDKHAMDLEEWRKKLSRTLDVLNRNYPTYRHARRFGLVAE
FT                   ISVPIVFYFERRAPPSEGEQK"
FT   gene            complement(810890..811312)
FT                   /locus_tag="Bmul_3830"
FT   CDS_pept        complement(810890..811312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3830"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_1147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17513"
FT                   /protein_id="ABX17513.1"
FT                   /translation="MKALAAKLRRYAGSGFVVEAADAIDTLLAALESSKQEADALLSTI
FT                   AECRDKAHAEGYGESFLYEAIACPDDVPAFIGQTVTELRAALEAAAAYKRDAERYRLLR
FT                   RGQKWSVVNGIGEMLRAEQLDDAIDAQLSQRQEEGS"
FT   gene            complement(811334..811594)
FT                   /locus_tag="Bmul_3831"
FT   CDS_pept        complement(811334..811594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3831"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17514"
FT                   /protein_id="ABX17514.1"
FT                   /translation="MIPASEARELAGPTIRERVEALEPLIRAAAEKKQRQIILHDWWAN
FT                   VGYEGGAAWKEAEKILKEFGYTLEFFYEEQQFVNMYAIVRW"
FT   gene            complement(811613..812152)
FT                   /locus_tag="Bmul_3832"
FT   CDS_pept        complement(811613..812152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3832"
FT                   /product="NUMOD4 domain protein"
FT                   /note="PFAM: HNH endonuclease; NUMOD4 domain protein; KEGG:
FT                   lga:LGAS_0666 homing nuclease of HNH family with NUMOD4 and
FT                   IENR domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17515"
FT                   /protein_id="ABX17515.1"
FT                   /translation="MKITDDMLTEWRDVVGFEAFYEVSASGQIRNKRNNRIVSGTVYSK
FT                   GYVVVCLSVGGNVERRLAHKIVAESWIGRRPDGMQIDHIDGNRRNNSKYNLRYVTAHQN
FT                   ILATVARGRQAAGTRNGQARLTSEQVEEIRATRAKGGRYWGGKATCGSLRRDIADHSES
FT                   RGAQKSPSICPQDRPH"
FT   gene            complement(812149..813333)
FT                   /locus_tag="Bmul_3833"
FT   CDS_pept        complement(812149..813333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17516"
FT                   /protein_id="ABX17516.1"
FT                   /translation="MTPHNEKSPAPAPADEQPASAPIDTPTDREFALSAAICVHPKGVY
FT                   GDEGGSMCCPITHTRDASFAPSPADERAAFESLKGAWQSMPPFDVFCAGWQAGRAASAN
FT                   ETGAEGAEPMAIPAGWKLVPVAPTFEMCRAMEEAIDAGWKDSIVWARGIAAAPQPPAQA
FT                   DARAGLTDEQRSTLESLARTSTPYEQEVLRSILAAHPGQPVADDAAVRGDERAKRKAFT
FT                   AVFLDVTTDEAREIVNHPKWSAGSWSHALDDRDAARAELARAAFSQANPGQPEPRAEVT
FT                   DTEPQWIVNDLGELGVKVGGRFFFLYKGDNIEYGASSSRDGIALHDDGSPMQYRIVGKR
FT                   EFGETCLPVKWVLQGRSEDRYHEKLVYHPGLSFGKPEDGDWKLLPAARTQGGES"
FT   gene            complement(813330..813680)
FT                   /locus_tag="Bmul_3834"
FT   CDS_pept        complement(813330..813680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3834"
FT                   /product="GP53"
FT                   /note="KEGG: bpd:BURPS668_A2370 GP53"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17517"
FT                   /protein_id="ABX17517.1"
FT                   /translation="MTTIDINALTKVERSIILYAESCCVDCGGLLEGIRMNADDMTALR
FT                   KFADAGILTFGCIPARLLGPLSGLREPTHWITFTEEAWQLAHALRRERAARVTASRRKV
FT                   DDALAQRATEAA"
FT   gene            complement(813699..814178)
FT                   /locus_tag="Bmul_3835"
FT   CDS_pept        complement(813699..814178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3835"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17518"
FT                   /protein_id="ABX17518.1"
FT                   /translation="MSLSSHQSARMKNDEWLTPPEWLTALGEFDLDPCAPINRPWATAR
FT                   EHYTIADNGLMREWRGRVWLNPPFGREASKWMRRMAEHGNGVALIPARTETATFFETVW
FT                   AAAEAVCFVRGRPHFHYADGRRAPFNSGAPICLIAYGRRNAYALLDANLGHVVQV"
FT   gene            complement(814186..814398)
FT                   /locus_tag="Bmul_3836"
FT   CDS_pept        complement(814186..814398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17519"
FT                   /protein_id="ABX17519.1"
FT                   /translation="MCITGPRIARRVFQGRKFRPAFLHRRHRWVLGVTGGRRRTLNRSA
FT                   AQRPSCYPTLPYASRAPTPDADATN"
FT   gene            complement(814749..815063)
FT                   /locus_tag="Bmul_3837"
FT   CDS_pept        complement(814749..815063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3837"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17520"
FT                   /protein_id="ABX17520.1"
FT                   /translation="MALTQEQRVALIVARQYIAEGRDAHLCFALNRVARRYPKLNTAAE
FT                   GLRAYIQRALSPYTTLEEWIARHELVKPPRLWRIPRTPAERREARIQWIDWMLDEPKEA
FT                   "
FT   gene            complement(815063..815380)
FT                   /locus_tag="Bmul_3838"
FT   CDS_pept        complement(815063..815380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3838"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3838"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17521"
FT                   /protein_id="ABX17521.1"
FT                   /translation="MNEITTMPELEACGWFVRTKRTDVDPSGLLVADCSAANDRGSMLA
FT                   TLFAASPNMAEILEIVAADADAGTIMLTSGVRLAIDAALIKAGRKKAPEPVRHFTINGG
FT                   V"
FT   gene            complement(815377..815652)
FT                   /locus_tag="Bmul_3839"
FT   CDS_pept        complement(815377..815652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3839"
FT                   /product="GP38"
FT                   /note="KEGG: bpd:BURPS668_A2372 GP38"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3839"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17522"
FT                   /protein_id="ABX17522.1"
FT                   /translation="MDKINDGGPAFPATWANDSDLNAIAPNGQVCPPFSSIPLPGMSLR
FT                   DYFAAKVMQGALADSNVTLEKAGDADILAKASYRIADAMLRARGEA"
FT   gene            complement(815700..816044)
FT                   /locus_tag="Bmul_3840"
FT   CDS_pept        complement(815700..816044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3840"
FT                   /product="GP53"
FT                   /note="KEGG: bpd:BURPS668_A2370 GP53"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3840"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17523"
FT                   /protein_id="ABX17523.1"
FT                   /translation="MTPIDIATLTKVERSILLYAETCCVDAGGLLEGERMNADDMTALR
FT                   KFADAGILSFGRIPYHLLASLSGLRQPTHWITLTDDAWQLAHALRRQRAARGSASRRKV
FT                   DEVLAEREVT"
FT   gene            complement(816073..816819)
FT                   /locus_tag="Bmul_3841"
FT   CDS_pept        complement(816073..816819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3841"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP0513 phage-related hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17524"
FT                   /protein_id="ABX17524.1"
FT                   /translation="MENTPRFTVTLDALRKAGACYEGYNKLVRSLQGQPFTEKDEDRES
FT                   YIRFRHDAEIPLLDILKSNGLDDAIWTLRCVSGADRDIRLFAVWCARKVEHLMQDQRSK
FT                   DALDVAERFANGEATEEERAAAWAAARAAGDAAGDAAGAARDAAWVAARAAGDAAGDAA
FT                   GAARDAAWVAAGAARDAAGAAAWAARDAAGAAAGGAAWAARDAAWAAAGDAAWVAAGAA
FT                   ARDAQTEMFKRMCLGTAPWQQGKVAA"
FT   gene            817303..817821
FT                   /locus_tag="Bmul_3842"
FT   CDS_pept        817303..817821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3842"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17525"
FT                   /protein_id="ABX17525.1"
FT                   /translation="MSGVGRYPVSRLHRRAGRLLPRGSRRTSCTRCSGKGGGPVGYVHR
FT                   MQSPNKQSSTQGPPLEALNVLKNLTLDYWYKMLIPLALGLFVLAITVDLRVISNGSLVL
FT                   LAIGLFMIGLGEWINHPRQEAINLHLNMKITLHRWKPKAWGIALDLAGAVLGGIGFFGI
FT                   VRAAIRAAA"
FT   gene            complement(817931..818107)
FT                   /locus_tag="Bmul_3843"
FT   CDS_pept        complement(817931..818107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3843"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17526"
FT                   /protein_id="ABX17526.1"
FT                   /translation="MSFKFNLNDAVTIAASGETGTVIGRAEYSNAENGYLIRYKAGDGR
FT                   ATESWWSESALAS"
FT   gene            complement(818737..819150)
FT                   /locus_tag="Bmul_3844"
FT   CDS_pept        complement(818737..819150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3844"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17527"
FT                   /protein_id="ABX17527.1"
FT                   /translation="MDQANWKLLTIESDTRVIEAEYVEGRLAGFVSRAKQHDEITGFRL
FT                   RERLGNLLHRLAGFVDGRNVNCSIRVGVIKVERIGISRDVSKVDLKGSTANSASKPVAV
FT                   GANDASTTNIHFDIDLLGQFVRPGKRIVFYFPA"
FT   gene            819391..819729
FT                   /locus_tag="Bmul_3845"
FT   CDS_pept        819391..819729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17528"
FT                   /protein_id="ABX17528.1"
FT                   /translation="MSSYAIAAAIIFGSMLAACGDKEDELVSRAKRERDSQAITQCQDY
FT                   ARSQAAHPSTVDFSIWGARVVEQPDGSVIVGSTFTAKNGFGAELKFEVACQVNGRGIVQ
FT                   AGVREASR"
FT   sig_peptide     819391..819453
FT                   /locus_tag="Bmul_3845"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.833 at
FT                   residue 21"
FT   gene            complement(819949..820116)
FT                   /locus_tag="Bmul_3846"
FT   CDS_pept        complement(819949..820116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3846"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17529"
FT                   /protein_id="ABX17529.1"
FT                   /translation="MNIVHLKAQGSDLRVIAERVADEFQKVANEMPVEDAIRALCPSHL
FT                   RAQAAARIAA"
FT   gene            complement(820140..820676)
FT                   /locus_tag="Bmul_3847"
FT   CDS_pept        complement(820140..820676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3847"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17530"
FT                   /protein_id="ABX17530.1"
FT                   /translation="MSYQLKQFTQDEFEKTRAEWSQYLEKHDMFDLEYKRALDSAEGNR
FT                   EYTRTADNEFAYGVFHDGAQTASAIVSMLHTRRAGRDVGWLKMLQVDLAPEFDEVHVQA
FT                   DLDRLRQVIDIYFAAIVGTVKLGAVHPAKVLKLYGRSTYLLRMLVSVAEKLQQDSANLD
FT                   AEVSMEGRWLVIRAV"
FT   gene            821014..821346
FT                   /locus_tag="Bmul_3848"
FT   CDS_pept        821014..821346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3848"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bps:BPSL1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3848"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17531"
FT                   /protein_id="ABX17531.1"
FT                   /translation="MKRETGVRGLRCRPGDLARIKEAWNPALIGRIVLVKAAHSETEWV
FT                   VMLLGEPGITLTKNRKRIAASNCVLAYDSALEPIRAVEAGTGDEITAADVEGRRRRHSL
FT                   PAPVSL"
FT   gene            complement(821282..821719)
FT                   /locus_tag="Bmul_3849"
FT   CDS_pept        complement(821282..821719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3849"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17532"
FT                   /protein_id="ABX17532.1"
FT                   /translation="MKKVGDRLKELLHAHPNYGERGQSKLSRDTGVPQPTISRILRGGS
FT                   VPEMETLAALAIPFGVTCEWLLTERGPKFVAELYSPQPHDRAADAPRPLPLHVQNLISE
FT                   IKRANEAGVSEEVFAAVATLLRAIPAQASCADDGDLPHLQP"
FT   gene            complement(822262..822621)
FT                   /locus_tag="Bmul_3850"
FT   CDS_pept        complement(822262..822621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17533"
FT                   /protein_id="ABX17533.1"
FT                   /translation="MDIVRRIALAAEDLQYGYHLTGLDDVAPEVFGIHVIWMKEAGLVH
FT                   AHVSEYLSPLDDPPDASVIRLTWSGCEFVDAARSDTIWNKAKTTLIKPAASFSFQILRE
FT                   WLAAEIKQGLPTLRG"
FT   gene            complement(823326..823562)
FT                   /locus_tag="Bmul_3851"
FT   CDS_pept        complement(823326..823562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3851"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3851"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17534"
FT                   /protein_id="ABX17534.1"
FT                   /translation="MEEAKVTFNFIGATASSIPTNIPDALKFRAGFTPNDGDVISFEGL
FT                   PGAFLIHSREFQIRSDGVVDVVLNVDVAQPAKG"
FT   gene            823751..824197
FT                   /locus_tag="Bmul_3852"
FT   CDS_pept        823751..824197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3852"
FT                   /product="GP65"
FT                   /note="KEGG: bte:BTH_II1027 GP65"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17535"
FT                   /protein_id="ABX17535.1"
FT                   /translation="MNIIDAAYAVVHDYPGGSESLAPRLGMSGAMLRNKVNPNNDTHKL
FT                   SLAEAARIADVTNDDRILEAWARERGYALVEIPSPENCSDGEIIELMAKTWETNGDIGK
FT                   EIIRTFEDGRVEKHEVLRVKERTWKHFQMLLGLVSRIEGMAEEQ"
FT   gene            824479..825285
FT                   /locus_tag="Bmul_3853"
FT   CDS_pept        824479..825285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3853"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_2027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17536"
FT                   /protein_id="ABX17536.1"
FT                   /translation="MSLDATTWARHQKVGKGPAKAVLMALADYANEDFITYPSVETLVA
FT                   WTEQDRKTVLANLDRLKEAGWITDTGERAGRTRQVVVYQINVDRGVEVKIGPRELLTGP
FT                   KSEPSQNRNSSENGTVPNSTGNSPNFDGKQSQKPPETVPNLGHRTVGTVENSRNSVGAR
FT                   GTRLPDDWVLTKALGEWALAEQPTWTVEHVRKVAEKFADHWRAQPGQKGRKTDWAATWR
FT                   NWVRTEKPLAGAAVGGGNKQESLEARNHEIARRAAEKFKAQNGGAA"
FT   gene            825282..825929
FT                   /locus_tag="Bmul_3854"
FT   CDS_pept        825282..825929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3854"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17537"
FT                   /protein_id="ABX17537.1"
FT                   /translation="MTPSDYEEFSNLMAGVFAFYKRDVSEFALGVWWAAMKPYDLAAVT
FT                   DALGRHSVNPDSGQFMPMPADIVKMLGGSTQDAALVAWAKVDRAVRSCGTYNSVVFDDA
FT                   LIHRVIVEMGGWVLIGGKSEDDWPFVRNEFVNRYRGYKMRSETPEYLPVLIGMAEAQNN
FT                   RTGHKSQPPVLIGDAHAAHRVMLGGQDKPMLGFVRMAPELAANRPLPQLGAA"
FT   gene            826099..826662
FT                   /locus_tag="Bmul_3855"
FT   CDS_pept        826099..826662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3855"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_4031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17538"
FT                   /protein_id="ABX17538.1"
FT                   /translation="MTKRTAWPMRVDAGTKNVGTARVHDDSRPKMTTAQRAIFEATGNR
FT                   PHVDAAFDDISDGIDAPPVLTPAYRQPDAKTRMQALGRLKAGAMNKTEQRYADHLEARK
FT                   QAGEIVWYRFEGIKFRLADNTFYTPDFTVMLANGQLEAHEVKGHWQDDARVKVKVAADQ
FT                   YPVRFVAVKAAAVRDGGGWQTEEF"
FT   gene            826662..827132
FT                   /locus_tag="Bmul_3856"
FT   CDS_pept        826662..827132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3856"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17539"
FT                   /protein_id="ABX17539.1"
FT                   /translation="MAGNKKPRKAYRPRAVRRTAGFDVLERRTPMDGDQKTDLGIAYYM
FT                   ALNEMTNGRGTEEHWSTVACALNIALVIAETGPGLDSISIIKSALAGAVRARDRAARVG
FT                   KWGFDGDALIDIRIALEIHDAQMATVSKAAILKALGEVHRRIDAGEVFKEAA"
FT   gene            827129..827710
FT                   /locus_tag="Bmul_3857"
FT   CDS_pept        827129..827710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3857"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bxe:Bxe_A3071
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3857"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17540"
FT                   /protein_id="ABX17540.1"
FT                   /translation="MSKRPWQKWSEQEEADLRRVWTADGPIKQYLDLFNGRSMHAVLAH
FT                   GADMGLGERPNRNARAGHPTESAILRALKLGPMDSLELSAKTGISRRTVMKHLKALHAK
FT                   RHVYVSAWERFGASGYPARIYALGNRKDAPRPPARTPGQKWQDRMSHLKKHRPDEYMRV
FT                   MARRRANAQRRTGTAKRDIAAQALFGRATA"
FT   gene            827707..828150
FT                   /locus_tag="Bmul_3858"
FT   CDS_pept        827707..828150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3858"
FT                   /product="GP74"
FT                   /note="KEGG: bte:BTH_II1036 GP74"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17541"
FT                   /protein_id="ABX17541.1"
FT                   /translation="MKRSGFKPRKKPMARGSWSRKSSPLPEQAPRKKLMARRAKRPTVA
FT                   EGSKYLAACRGEPCYLRVPGVCRLNPIDDTVVPCHSNQGRHGKAGAMKAKNEFTVPGCA
FT                   ACHAWLDQNRAGTPKQVKFDVWNRAFEEWAPVRARKMGEANCQ"
FT   gene            828141..828485
FT                   /locus_tag="Bmul_3859"
FT   CDS_pept        828141..828485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3859"
FT                   /product="GP64"
FT                   /note="KEGG: bte:BTH_II1037 GP64"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3859"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17542"
FT                   /protein_id="ABX17542.1"
FT                   /translation="MPVILTVQLPAGRHSFKRKHGMGPAISSEMHRPLVTTVYRIARIP
FT                   TVKRQLLAVVEVDAFIPERHRTHIAPSDPRWVRPGVLRTKAYWIDNKKSRALGQFLASD
FT                   ALEVHLEDEA"
FT   gene            828482..828730
FT                   /locus_tag="Bmul_3860"
FT   CDS_pept        828482..828730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3860"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17543"
FT                   /protein_id="ABX17543.1"
FT                   /translation="MSAAACVLYGDVPEPLLISAIRHRDSVTGAELIAFDECPFSGEIT
FT                   ETEHGVQIAFPWPRNRTLRHAIGDWLTHYGINFTVVM"
FT   gene            828776..829366
FT                   /locus_tag="Bmul_3861"
FT   CDS_pept        828776..829366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3861"
FT                   /product="phage-related hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4527 phage-related hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3861"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17544"
FT                   /protein_id="ABX17544.1"
FT                   /translation="MSEIEFKSAFDAVRFALAYSTQQYGETMMAKRLRGESLGSGMGLV
FT                   GVDGAGQAGMIRAKVWELPELHRAVIIARAAPRDLPCSCGKSCCSGSQPNPEWDAAISW
FT                   LTDASAAYCSGFSHYRVRRAIIEGVFGVKRSLADVAEDCDAHVNTVSKQNAAVRKWLEG
FT                   NSKTGAVGVIDAAWAAIERKLSTAGLLKNCEIA"
FT   gene            829584..829973
FT                   /locus_tag="Bmul_3862"
FT   CDS_pept        829584..829973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3862"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1042 59R"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3862"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17545"
FT                   /protein_id="ABX17545.1"
FT                   /translation="MSKRLTTLKPRVQSLAASRVATMTPGSWRAGKSSSAARGYGYEWQ
FT                   KLRAAHLAKHPHCVFCLRDLGMAGWSPAEVVLACAARGIGEPLGTIGDHIVAHRGDRRL
FT                   QLDPTNIQTLCKTHHDSEKQRLERG"
FT   gene            830135..830614
FT                   /locus_tag="Bmul_3863"
FT   CDS_pept        830135..830614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3863"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17546"
FT                   /protein_id="ABX17546.1"
FT                   /translation="MALTAKKRKFADAVLAGKSNKDAAIAAGYSPATASAAGSRLVKDK
FT                   DVALYIAANRVQKGSNAGDQSQQPAPAQKPDGFDLEAMTNFTDPKAFLIAAMNDSRTEP
FT                   KLRIDAAKALMPFVHKRLGEGGKKEQRDEAAKKAASRFAPAAPPRLIANGGKKVE"
FT   gene            830614..832326
FT                   /locus_tag="Bmul_3864"
FT   CDS_pept        830614..832326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3864"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: bte:BTH_II1044 phage
FT                   terminase, large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3864"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17547"
FT                   /protein_id="ABX17547.1"
FT                   /translation="MEWTTACPDWERRLIARESIIPPPIFPDQAEQAVAIFKELRVCDL
FT                   PGKPTFGECSEQWVFDFVAAIFGAYDAETGKQLIREFFLLISKKNTKSTIAAGIMLTAV
FT                   ILCWREEEEHLILAPTKEVADNSFKPAAGMIRADAELSELFHVQDHIRTITHRVSRASL
FT                   KVVAADTDTVSGKKSGKILIDEHWVFGKRANAEAMFMEATGGQVSRDEGWVIILTTQSD
FT                   EPPAGVFKEKLQYYRDVRDGKIVDRKSLGVLYEFPEEMVKSKAYLDPANYYITNPNLGR
FT                   SVSAEWLEDQLNKIRTKTDGSFQQFIAKHLNVEIGMNLRSDRWAGADFWINAGLPERVT
FT                   LLDLIEQCEVIAAGIDGGGLDDLLGLSAVGRVRGGRNWLAWAHAWAHPSVLERRKEIAP
FT                   ALHDFEKAGDLTIVSRIGEDVVQAAEYVARIERAGLLYKAGVDPAGIGAILDALAAARV
FT                   PEDKVIGISQGWKLSGAIKTTERRIAAASGQRIEGDEAPDGALYHGGQPLLTWAVGNAR
FT                   VVPVGNAVNITKQVSGTAKIDPLMALFNAVSLMALNPPAQGQSVYESRGIRFL"
FT   gene            832340..833629
FT                   /locus_tag="Bmul_3865"
FT   CDS_pept        832340..833629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3865"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   portal protein; KEGG: bte:BTH_II1045 head portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3865"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17548"
FT                   /protein_id="ABX17548.1"
FT                   /translation="MFDFIRREKQPEAQARPHVEPSFQASTPTTSIPGETFEGLDDPRL
FT                   KEYIRRGELNGGTGRETRALRNMAVLRCVTLISGTIGMLPMNLISSDDSKQVLTDDPAH
FT                   RLLKYKPNDWQTPMEFKSLMQLRALLDGESMARIVWSGNRPIRLIPMDRGSAKGRLTST
FT                   WQIVYDYTTPTGDKIELPAREVFHLRDLSIDGVSGVSRVKLSGNALELAEQAERAASRT
FT                   FRTGVMAGGAIEVPKELSDNAYGRMKASVQENHTGSENAGSWMLLEEGATAKQFSNTAA
FT                   SAQQIENRNHQIEEVARMYGVPRPLLMMDDTSWGSGIEQLAIFFIQYGLSHWFVSWEQA
FT                   AARAFLPEKMLGQRQFKFNEGALLRGTLNDQAAFFSKALGAGGQSPWMKQNEVREMLDL
FT                   PRADDPVADQLRNPMTQKQKGSGDEPPATT"
FT   gene            833607..834449
FT                   /locus_tag="Bmul_3866"
FT   CDS_pept        833607..834449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3866"
FT                   /product="peptidase S14 ClpP"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: bte:BTH_II1046 ClpP
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3866"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17549"
FT                   /protein_id="ABX17549.1"
FT                   /translation="MSLLQLPEIRADHRLGAAQFDVRPDALERWNPDVRAANADDAAAI
FT                   SIYDSIGDNWEGTGVTAKRISAALRNIGAREVTVNVNSPGGDFFEGVAIYNLLREHKAK
FT                   VTVNVMGLAASAASVIAMAGDEILMGDGAFLMIHNAWAVAIGNRHDMAAAAATLAPFDA
FT                   AMAKLYAQRAGISEETAAAMMDKETWIGADQAVKDGFATGKLDSAPIAMDTNTSSGRKA
FT                   MALIEASMARAGYSRSMRRDALKALFDGKPGATAGNATPGAGEDVAASLHTLINALKG"
FT   gene            834454..835731
FT                   /locus_tag="Bmul_3867"
FT   CDS_pept        834454..835731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3867"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: major capsid protein HK97; KEGG: bte:BTH_II1047 phage
FT                   major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3867"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17550"
FT                   /protein_id="ABX17550.1"
FT                   /translation="MSKKLLIAVLTAALTGPVGAVPRGIISVRAEGPTEVKALIENLQK
FT                   AFHDFKAEHTKQLDAVKAGLPTSDALAKVDKVSADLEALQAAVDEANIKIAAAQMGANG
FT                   VKPLRDPEYTEAFKAHVKRGDVQAALNKGEDSEGGYLTPIEWDRTITNKLVLISPMRQL
FT                   CRVQPVSKAGFSKLFNMGGTTSGWVGEASQRPQTNAATFQPLSFASGEIYANPAATQQI
FT                   LDDAEIDLESWLATEVQTEFAKQEGKAFLAGDGTNKPNGLLTYIAGGANAAKHPFGAIE
FT                   VVNSGAAADITSDGIIDLVYDLPSAFTGNARFAMNRNTQRQVRKLKDGQGNYLWQPSYV
FT                   AGQPATLAGYPVTEVPDMPDVAANSTPILFGDFQQTYLIIDRIGVRVLRDPYTAKPYVL
FT                   FYTTKRVGGGLLNPEPMRAMKVAASE"
FT   sig_peptide     834454..834516
FT                   /locus_tag="Bmul_3867"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            835805..835969
FT                   /locus_tag="Bmul_3868"
FT   CDS_pept        835805..835969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3868"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3868"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17551"
FT                   /protein_id="ABX17551.1"
FT                   /translation="MATLIKPFKGVKNGEIYPTEFEAGDECPEELEDGARAVGALEGAE
FT                   EKKPTAPKK"
FT   gene            835973..836314
FT                   /locus_tag="Bmul_3869"
FT   CDS_pept        835973..836314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3869"
FT                   /product="gp7"
FT                   /note="KEGG: bte:BTH_II1049 gp7"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3869"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17552"
FT                   /protein_id="ABX17552.1"
FT                   /translation="MALVELKLALGFVRANAGVEDDVVQMLLDAATQSAVDYLNRQVFE
FT                   TEDAMTTAIEAGTAGQNPMVVNAAIRAAILKITAELYANREDTAFGPITELPLNARALL
FT                   RPHRIIPGV"
FT   gene            836317..836646
FT                   /locus_tag="Bmul_3870"
FT   CDS_pept        836317..836646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3870"
FT                   /product="phage head-tail adaptor"
FT                   /note="TIGRFAM: phage head-tail adaptor; PFAM: putative
FT                   head-tail adaptor protein; KEGG: bte:BTH_II1050 phage
FT                   head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3870"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17553"
FT                   /protein_id="ABX17553.1"
FT                   /translation="MLRSSDLTEFIVIERKGGRTNENGEPLPDDWVTHDEVWASVRFVS
FT                   GKEHVISGAVRSSAIASIRIRFREDIDSEMRIRYGDQLYDIVAVLPNRRKGSLDLPVKV
FT                   GEKYV"
FT   gene            836639..837061
FT                   /locus_tag="Bmul_3871"
FT   CDS_pept        836639..837061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3871"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: bpm:BURPS1710b_1684
FT                   phage protein, HK97 GP10 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3871"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17554"
FT                   /protein_id="ABX17554.1"
FT                   /translation="MSSVQILGLADLQADFLKLAKAQSTKALRRATVAGANVIRDEARA
FT                   RAPKKTGKLKRNIVTAALKQKDSPGIATAGVRVRTKGKADSPNNAFYWRFVELGTQFMK
FT                   AEPFMRPAFDASIAQAEGAIRTEIARAIDQVVGGGL"
FT   gene            837058..837402
FT                   /locus_tag="Bmul_3872"
FT   CDS_pept        837058..837402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3872"
FT                   /product="GP10"
FT                   /note="KEGG: bpm:BURPS1710b_1685 GP10"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17555"
FT                   /protein_id="ABX17555.1"
FT                   /translation="MSALTIRDAIGIVGGAKGYVSVASSAAQSPYYVVSRVSGTRDMAL
FT                   GGATGGKSGMFQIDVYAKTYTEADSLADQIIDRVESTGMFSVGGVSDLPDDYSSDTGVF
FT                   RVSLEISVQF"
FT   gene            837459..837923
FT                   /locus_tag="Bmul_3873"
FT   CDS_pept        837459..837923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3873"
FT                   /product="GP11"
FT                   /note="KEGG: bte:BTH_II1053 GP11"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17556"
FT                   /protein_id="ABX17556.1"
FT                   /translation="MAEKSKRTKAQGTKVEVSKTVSTDLDDNTLVFVDLNTTGKTIQWQ
FT                   GGQSSEIDATTLASEEKEYELGLPDPGEFSVDGNYSSDDEGQSLLRTARASGEKHVFRV
FT                   TFADQSQFLFVGMVRQYTWSAAVDGIVTSTYSVRVSGAPKLVPPPAPPAG"
FT   gene            837952..838416
FT                   /locus_tag="Bmul_3874"
FT   CDS_pept        837952..838416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3874"
FT                   /product="tail assembly chaperone"
FT                   /note="PFAM: tail assembly chaperone; KEGG:
FT                   bpm:BURPS1710b_1687 phage tail assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17557"
FT                   /protein_id="ABX17557.1"
FT                   /translation="MTNKVKPGALRAAILNPLAGWRHEFMPMPEWDGVTVAVREPLLED
FT                   RAFWLDPLREAAGVEPDDDEQTARSKYSRVSADAHKLAYARLFVRVLYVETAQGWRREF
FT                   GDSDAQAVAEAYGPAHDRVVTKAIELGGLAADREEAGKKPSAETPTSDSK"
FT   gene            838413..838691
FT                   /locus_tag="Bmul_3875"
FT   CDS_pept        838413..838691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3875"
FT                   /product="GP13"
FT                   /note="KEGG: bte:BTH_II1055 GP13"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17558"
FT                   /protein_id="ABX17558.1"
FT                   /translation="MTLALRLGRTLAELRAQMSAAEFALWQAFDAESPISEERYDLHAA
FT                   MVASAVFQAQGAKVKVADMMPKWGGESEDAQEIEDDPFFVGLMSLAK"
FT   gene            838704..842846
FT                   /locus_tag="Bmul_3876"
FT   CDS_pept        838704..842846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_3876"
FT                   /product="phage tape measure protein"
FT                   /note="TIGRFAM: phage tail tape measure protein, lambda
FT                   family; phage tape measure protein; PFAM: Tape measure
FT                   domain; KEGG: bte:BTH_II1056 GP14"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_3876"
FT                   /db_xref="EnsemblGenomes-Tr:ABX17559"
FT                   /protein_id="ABX17559.1"
FT                   /translation="MATSLRELIVSVTANTTEYDRRMRGLASTAGGYFNAVRDGGRAAD
FT                   AAFASNAASVQVTVRAIEAARGSLRGYAEAAAAAFGIHQLVDYADEWTNLSNRLKIVTR
FT                   DQVDFAVAQDDVLRIAQATRQPLDATAELYQRIANNTSHLGLSIKQVGPLVETISKAVA
FT                   LSGVSADTARLGIVQLGQAFASGQLRGQDLKSVLEELPGVADAIARGMGRGTSELKALA
FT                   EDGKLTVENLIDALRNAGASTDALFGKVDVTVGQAMTRLQTEIVAYVGRANEATGASAK
FT                   LSQGIIYVAEHLDDIVKISASLAAGRLVTYLLQSGIAARQAAIDWNTKRLALAAATKEE
FT                   SAAALVSLEKARSDRDAAAAKLQNAQAAEVAAQAELAGMRAMRESLAMQSALIAGSIRY
FT