(data stored in ACNUC7421 zone)

EMBL: CP000871

ID   CP000871; SV 1; circular; genomic DNA; STD; PRO; 167422 BP.
XX
AC   CP000871; AAVB01000000-AAVB01000037;
XX
PR   Project:PRJNA17407;
XX
DT   16-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
OG   Plasmid pBMUL01
XX
RN   [1]
RP   1-167422
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   "Complete sequence of plasmid1 of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
RN   [2]
RP   1-167422
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Tiedje J.,
RA   Richardson P.;
RT   ;
RL   Submitted (26-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 72b092378ae944572cf98e89c82a03fa.
DR   BioSample; SAMN00623032.
DR   EnsemblGenomes-Gn; EBG00001111111.
DR   EnsemblGenomes-Gn; EBG00001111112.
DR   EnsemblGenomes-Tr; EBT00001702443.
DR   EnsemblGenomes-Tr; EBT00001702447.
DR   EuropePMC; PMC6315756; 30545132.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   StrainInfo; 39670; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002733
CC   Source DNA available from James Tiedje (tiedjej@msu.edu)
CC   Bacteria available from ATCC: ATCC 17616
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..167422
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /plasmid="pBMUL01"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   gene            complement(2..1075)
FT                   /locus_tag="Bmul_6163"
FT   CDS_pept        complement(2..1075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6163"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: bur:Bcep18194_C6563 putative
FT                   arsenate-sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19817"
FT                   /protein_id="ABX19817.1"
FT                   /translation="MNTSNVAPPGKAVAKPSINFFERYLTVWVALCIVAGITLGQVLPG
FT                   LFQQIGRMEYAQINLPVGLLIWVMIIPMLVKVDFGALHEVRQHVKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPTDQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVIIAQILRKRLLANG
FT                   QAAFDAAMARIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRT"
FT   gene            complement(1139..1633)
FT                   /locus_tag="Bmul_6164"
FT   CDS_pept        complement(1139..1633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6164"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bur:Bcep18194_C6562 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19818"
FT                   /protein_id="ABX19818.1"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKDVRAYSAGSAPSG
FT                   RLNPFALEALTTAGVDVSGYRSKSWDEFVGDGAPEMRVVITVCDSAAAETCPYWPGSPV
FT                   KVHWGYADPSNALGGDEGKRLAFELTRQAIGYRMLQLLALPLDRMSNAELQTALTEISQ
FT                   N"
FT   gene            complement(1651..2145)
FT                   /locus_tag="Bmul_6165"
FT   CDS_pept        complement(1651..2145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6165"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: mpt:Mpe_A2345 arsenate reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19819"
FT                   /protein_id="ABX19819.1"
FT                   /translation="MSDKPYNVLFICTGNSARSILSEGLMNRLGEGRFVAYSAGSHPKG
FT                   EVNPFALRELARWQLPTEGYRSKSWDEFAAPGAPALDFVFTVCDKATGEVCPIWPGQPI
FT                   TAHWGVPDPADVEGSDEQKQQAMHDAALTLKRRIDLLLSLPLAKLDNVALQKSLTEIGQ
FT                   K"
FT   gene            complement(2155..2634)
FT                   /locus_tag="Bmul_6166"
FT   CDS_pept        complement(2155..2634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6166"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bpm:BURPS1710b_A0455 glyoxalase
FT                   family protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19820"
FT                   /protein_id="ABX19820.1"
FT                   /translation="MKRFHVHISVPDLVDSIRFYSALFAAEPTVVKSDYAKWMLDDPRV
FT                   DFAISQRGAAPGLDHLGVQVENDAELAEMHTRLNGAALPVDEQIGTACCYARSDKYWTV
FT                   DPQGIAWETYQTLGDVPTFGESRNASAAESNADASACCSPARGKPIGVPVKSSCC"
FT   gene            complement(2631..2966)
FT                   /locus_tag="Bmul_6167"
FT   CDS_pept        complement(2631..2966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6167"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bte:BTH_II0961
FT                   arsenical resistance transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19821"
FT                   /protein_id="ABX19821.1"
FT                   /translation="METNQTIAALAALAHESRLAVFRALVQAGPEGMPAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLLAYLTENCCGGNPCSPAGACS
FT                   PVKEQHS"
FT   gene            3566..6151
FT                   /locus_tag="Bmul_6168"
FT   CDS_pept        3566..6151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6168"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: ajs:Ajs_1878 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19822"
FT                   /protein_id="ABX19822.1"
FT                   /translation="MSDIQKLRLDLPLVLPDIYGAEDRCVSRLQDKLADRPGIEGAHIT
FT                   GAAEGEPQLCVHYDPAVISLSRLRELIRSEGLAVAGRFAHIVGRVNAPMHVRATRRVAE
FT                   QLRSLGGIIEADVSPSGVVRIEYDRSLTDESDLTQRLTLLDISVNWATPAVQPTTAVRS
FT                   CKASADSGTAGHKAAANDHRALQRANHTCGKDEGGEHSHRHGGLFGEKTELIFACLSGV
FT                   FLMAGWLVGRRGTGLEWLSTHCYVVSYFFGGYYTIQEAIENLRAKRFEIDTLMLVAAAG
FT                   AAALGSWGEGALLLFLFSLGHSLEHYAMGRARRAIEALTKLAPDTATVRRDSGTEVVPL
FT                   EKLEVGDVVVVKPNERLPADGVVVVGTSSVNQAPVTGESVPVDKRPVEDGRITIGRFEG
FT                   VAAESRVFAGTINGAGAMDIMVARKADQSTMARVIKMVTEAEAQRSPTQQFTEKFERIF
FT                   VPSVLVLVGLLLCAGVVIDEPFSHTFYRAMAVLVAASPCALAISVPSAVLSGVARAARS
FT                   GVLVKGGGPLENLGTLTSIAFDKTGTLTEGKPKLTEVVPAQGVPEHELLAVALAVEEHS
FT                   DHPLAAAIVNGAKERLRDKTDLPQAVDVKSITGRGVRAQLGGETVHIGKPILFRELSDS
FT                   TVPDDIDEANKKLIADGHTTMIIRKGARFLGVIGVMDTPRPVAGRVMGELRKLGIERLI
FT                   MISGDSQKVAEAVAQTVGLTEAQGDLMPEQKVEEIKKLRTEHGKVAMVGDGVNDGPAMA
FT                   NATVGIAMGAAGSDVALETADVALMADDLAQLPFAVGLSRSTSRVIKQNLWMSLGVVAV
FT                   LIPATVLGLNIGTAVIFHEGSTLLVVANALRLLAYKPFDKSATAAEPAT"
FT   gene            6515..6985
FT                   /pseudo
FT                   /locus_tag="Bmul_6169"
FT   gene            7192..8499
FT                   /locus_tag="Bmul_6170"
FT   CDS_pept        7192..8499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6170"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bch:Bcen2424_3677 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19823"
FT                   /protein_id="ABX19823.1"
FT                   /translation="MLKPNLALAIVFAMAATAHAQPSLSPGPAPGAAAAPIGAPPSDAL
FT                   PASSLTLSDALAVAARNNPALRGARADVDASAGVLMQAGARPNPEVSFLQEGFSRAERT
FT                   STALINQTIELGGKRRARLDVASYGREAASASLDEQGAAVRADVIAAFYGLLAAQRQLQ
FT                   VTEESAAIAARSADLAGRRAQAGKVSPVEATKAQVAAAGVQIEVVTARGRVEVAREKLN
FT                   AVMGEARNDRLAVLGDLETVPPVEPLSALTAQLDDAPLARVARAEMLRSNAAISLERAR
FT                   RIPDVTVSAGVKRVTTGGVPNNQAVVGVSIPIPLFNTNKGALLEATHKAERANADLDRE
FT                   RTRLRLELTQAYANFEAAEQEAQRLKSDILPAARLALDAMWRGYELGKFSFLDVLDAQR
FT                   TLFQGQSQYVRALAGAHAARADIGRLVGTPLAAVAQ"
FT   sig_peptide     7192..7254
FT                   /locus_tag="Bmul_6170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            8525..10000
FT                   /locus_tag="Bmul_6171"
FT   CDS_pept        8525..10000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6171"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bch:Bcen2424_3678 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19824"
FT                   /protein_id="ABX19824.1"
FT                   /translation="MSRSRIFVIAAAVLGGAGIVIGALAVTRGGSGASAPTAAETAQPT
FT                   DAAGVGARGGVVLKRGKLSVEIVMTEKPGDARLVVYPFVDDKPATQGVTVSGTLVRYDR
FT                   THEPLRFDAAGQKFVSAQSIAKPHVFDATIDVKSGNDAASFPFARADGAIALTDAQLAT
FT                   SRIALAKAGPAQIATPFQLPGEIKFNEDRTAHVVPRVAGIVEQVSVSLGQNVAKGQVLA
FT                   VIASTDLADRRSELLTAERRLSGARATYERERTLWQERISAEQDYQQAQVQLREAEIAV
FT                   QNARQKLAALNAPVGAGALNRYELRAPFAGTIVEKHATPGEAIAADASMFVISDLSTVW
FT                   AEMAVPAQRLNDVRVGRDATVSATAFESRSSGPIAYVGSLLGEQTRTAPARVVLPNPDR
FT                   VWRPGMFVNVSVDAGRQGVPLAVASDALQDVDGAPSVFVRSPKGFVAQAVETGRRDERA
FT                   TEVLKGLKPGQEYAASNSFVLKAELGKGSAEHE"
FT   sig_peptide     8525..8602
FT                   /locus_tag="Bmul_6171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.569 at
FT                   residue 26"
FT   gene            10129..13341
FT                   /locus_tag="Bmul_6172"
FT   CDS_pept        10129..13341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6172"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: bch:Bcen2424_3679
FT                   heavy metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19825"
FT                   /protein_id="ABX19825.1"
FT                   /translation="MFERLIRFAIAHRWLVMLAIAAVAALGVFSYQRLPIDAVPDITNV
FT                   QVQINTSAPGYSPLEAEQRITYPVETVMAGLPGLEQTRSISRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEAKDKLPAGIAPAMGPTSTGLGEIYLWTVEADANARKPDGTRYTATDL
FT                   RELQDWVVRPQLRNVRGVTEVNSIGGYVKEYRVAPNPAKLMSYGLTLADVVRALERNND
FT                   NVGAGYIEKRGEQYLVRVPGQARTVDDIANIVLTNVGGVPVRMKDVGVVDIGRELRTGA
FT                   ATSNGEEVVLGTVFMLMGENSRTVSKAVAAKMEDVNRTLPAGVKAIPVYDRTVLVEKAV
FT                   ATVKKNLLEGAVLVIAVLFLFLGNIRAALITALVIPLSMLMTFTGMVNAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCVRRLAHAQSAAGRPLTRDERFAEVFGASQEARRALIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAITVVMALAAAMVLTVTFIPAAVALFIGERVEEKENR
FT                   LMGWARRAYEPVLAAFMTRPARVMIGAGAIVLVTLGLATRLGSEFIPSLNEGDLAVSAL
FT                   RIPGTSLSQSVEMQKSIEKTLKARFPEIERVFARTGTAEIAADPMPPNLSDGYIMLKPA
FT                   DTWPDPKKPRDQLVREIEEALAELPGNAYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   AVLNQTGEQIAAALQKVPGASEVKVEQTTGLPVLTVNLDRDKLARYGVSVADLQDSVAA
FT                   AVGGQKAGTLFQGDRRFDIVVRLPDELRSDIEAIKRLPIALPAPAAGASAPLAAAPYVP
FT                   LAELATIDVAPGPNQISREDGKRRVVVSANVRGRDVGSFVADAREQLQQDVRVPAGYWV
FT                   SWGGQFEQLQSASERLKLVVPLALFMVFVLLFVMFNNVKDGLLVFTGIPFALSGGVVSL
FT                   WLRGIPLSITAAVGFIALSGVAVLNGLVMISFIRNLRDEGMPLDAAVHDGALTRLRPVL
FT                   MTALVASLGFLPMAFATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRVSHAVSWR
FT                   AALRGGFGAGVLRRLGFFKGNA"
FT   sig_peptide     10129..10221
FT                   /locus_tag="Bmul_6172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.836 at
FT                   residue 31"
FT   gene            13338..14024
FT                   /locus_tag="Bmul_6173"
FT   CDS_pept        13338..14024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6173"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bch:Bcen2424_3680 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19826"
FT                   /protein_id="ABX19826.1"
FT                   /translation="MMRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEE
FT                   YDLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTARDDVGDRVKGLELGADDYLAKPFD
FT                   FVELTARIKSILRRGQPRDSNTLRAADLELDLTRRKATRQGDTILLTAKEFALLWLLMR
FT                   REGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEA
FT                   RGGAAA"
FT   gene            14021..15427
FT                   /locus_tag="Bmul_6174"
FT   CDS_pept        14021..15427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6174"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bch:Bcen2424_3681 heavy metal sensor signal
FT                   transduction histidine kinase; TIGRFAM: heavy metal sensor
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19827"
FT                   /protein_id="ABX19827.1"
FT                   /translation="MIARLLPRTLRGRLTALIILSTSVILASSGVALYEALSNRVETTA
FT                   AEQMAGISAALGAHLAEARTTADVARNTDIWIDQLHGHPNMDLAIFDAAGTRLVGTPGF
FT                   RPYAPLMLTNAGRVPVGIAPPGARHQYLLTTVPLAGAGAPVVRVAVQYDRSADVLLLRT
FT                   HAYTIVVIEVFGVVLAAAIAYGIAALGLSPLRRFAARAEQMSSSRLAHPLPELDTSGEL
FT                   KELEHAFNGMLARLNESFTRLSQFSSNLAHDMRTPLTNLQAAAQVVLSQPRSADEYRSV
FT                   IESSIDEYQRLSRMIEDMLFLARSEQAGTSIDVRRLNAAEEAERVAGYYEPLAEDEGVT
FT                   VKVDGHAWVDADLTLYQRALSNLLSNALTYAPRGSVVTIDCVEQGGATTIAVSDTGPGI
FT                   AAEHVGRIFERFYRVDPSRHNSASGTGLGLAIVRSIMDNHGGECGVDSEPGRRTTFWLR
FT                   FPRRPAAIST"
FT   sig_peptide     14021..14122
FT                   /locus_tag="Bmul_6174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.390 at
FT                   residue 34"
FT   gene            complement(15510..15794)
FT                   /locus_tag="Bmul_6175"
FT   CDS_pept        complement(15510..15794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19828"
FT                   /protein_id="ABX19828.1"
FT                   /translation="MKTAKLAALFVTATLSLGMATQAAFAQTQTQGKSRTQVINELKQA
FT                   QHDGIVPINKTQYPPTAEVVARNKELHGISVHGGEKKPQTDNHDALAAK"
FT   sig_peptide     complement(15714..15794)
FT                   /locus_tag="Bmul_6175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            16000..16317
FT                   /locus_tag="Bmul_6176"
FT   CDS_pept        16000..16317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19829"
FT                   /protein_id="ABX19829.1"
FT                   /translation="MADAPAAFVPIATAASIAGGVVQTFIPDRKLPRPAIRLALIAALT
FT                   VPLYAGCVSTRSDTTAAARKAAPANLMPGEQVDYAGHRCGNPNMHVKTHPCLFPQSNSR
FT                   P"
FT   gene            complement(16517..17677)
FT                   /locus_tag="Bmul_6177"
FT   CDS_pept        complement(16517..17677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6177"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bch:Bcen2424_3684 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19830"
FT                   /protein_id="ABX19830.1"
FT                   /translation="MNNPVRLVMMSGALLTTAHAAHATEVMLYGLFDTSLTYVWNADAQ
FT                   GKNLVGLGNGNLLGNRFGVKGAEDLGGGLKAIFTLENGFNPNTGALGQGNRMFGRQAFV
FT                   GLESARWGTLTIGRQYDALADVAWPITGDFYFGSVYATPGDVDNYDTSSRTDNAVKYTS
FT                   PVVGGFQFVGMYALGGVAGKSGAGQTWSAGLSYSNGPFDAAGGYYYAANRSSLANGIRT
FT                   GWNGTSDGTFDGSLVNGGYISAKSIGIARGALRYTFAPFTVGIDYSNAQYKADATSAFR
FT                   GTQKYDTARGFFNYQTTASLLVGVGYSYTKARGDTSATYHQVSAGADYVLSKRTDLYAV
FT                   GAWQRANGEQRTLDGGTQPAQASIGSYGYGGTRTQGIINLGLRHRF"
FT   sig_peptide     complement(17606..17677)
FT                   /locus_tag="Bmul_6177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 24"
FT   gene            17994..18269
FT                   /locus_tag="Bmul_6178"
FT   CDS_pept        17994..18269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19831"
FT                   /protein_id="ABX19831.1"
FT                   /translation="MNIPRPLIGIAAVALSIAAFSQAVAAQPKSRQEVFQELVRARHDG
FT                   VIPSPNHDYPASPAAVARNQEVHRSTVHRGEKMPMVDAHDNRFAVL"
FT   sig_peptide     17994..18071
FT                   /locus_tag="Bmul_6178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 26"
FT   gene            18296..18799
FT                   /locus_tag="Bmul_6179"
FT   CDS_pept        18296..18799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19832"
FT                   /protein_id="ABX19832.1"
FT                   /translation="MRNIVKGIVLAACLMSTAATAAGWPERALSHAPAHDVGSRANERM
FT                   LCEFAVVPAGAWTARFARGLCEVDNGWLTFVPADTGDDSAVAETRIMLGDVRTASHQSR
FT                   KLKEQLQLTTRDEVIALNVLADDGSRKSREHAIDLWTALRDEGVTPVNGTRIVDTYPTG
FT                   ATTW"
FT   sig_peptide     18296..18361
FT                   /locus_tag="Bmul_6179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(18822..19547)
FT                   /locus_tag="Bmul_6180"
FT   CDS_pept        complement(18822..19547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19833"
FT                   /protein_id="ABX19833.1"
FT                   /translation="MTPTAKLALLTLPPVLAACFGALAAAWRAPGPKTSSVIQHFTGGI
FT                   VFAAAALELLPQDRAHALIPVVVGFVLGIALMLAISELSGSIETRFETARLPVSLIIIT
FT                   AIDLVVDGLVLGIAFSASDESGIILTVALTLEVLFLALSVSAALAAAGIGRLLSIVVPV
FT                   ALAALLSVAAVVGNAAFAGLPANIYAALLGLGTVALLYLVTEELLVEAHEVPESPFATA
FT                   SFFIGFIVFFLIEGSVKVG"
FT   sig_peptide     complement(19473..19547)
FT                   /locus_tag="Bmul_6180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 25"
FT   gene            complement(19833..20627)
FT                   /locus_tag="Bmul_6181"
FT   CDS_pept        complement(19833..20627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6181"
FT                   /product="putative uncharacterized conserved protein"
FT                   /note="KEGG: bch:Bcen2424_6868 putative uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19834"
FT                   /protein_id="ABX19834.1"
FT                   /translation="MCYSAKVEANYREYVRRYGADMDIESFRRLYFARAASGDIKIPKA
FT                   VDAALAAAGDDEISAAIFAYRTHRASELESELFKQRTRLAAAEKKLAAKVTKAASEDVR
FT                   IATDKIEAAMRGLEDLRRTDLQERDSRIFPGWYAPVLIELDGKRVIVPMRYRCRLPGWT
FT                   ERDERQKPGTYNARVDSLSTAWRKVFGFSHGLMLVDAFFENVKRDERNVVLRFDPTPRQ
FT                   HMQVACLWTRTEIPGSDDLWSFAAITDDPPPEVAAAGHDRCI"
FT   gene            complement(20762..21241)
FT                   /locus_tag="Bmul_6182"
FT   CDS_pept        complement(20762..21241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6900 histone family protein
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19835"
FT                   /protein_id="ABX19835.1"
FT                   /translation="MGVRTPEIRDSSENRRSDPVDACQLHRAIFAAVSVPAVLGYHPAV
FT                   FQQTMNDMLTDIEALQAQLREVNARLAEVKRDEKRAALDAIREQVALYGISEEELLLAA
FT                   GFRKPRKRRTSAKYYDPSTGKEWSGFGPRPKWLVGKNLDDYRIDRAPKPWWPGES"
FT   gene            21425..21679
FT                   /locus_tag="Bmul_6183"
FT   CDS_pept        21425..21679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19836"
FT                   /protein_id="ABX19836.1"
FT                   /translation="MTEAKRPRGRPPTREAKTATQRVNALDEALKASGGRILNRTRLSP
FT                   EATAALAALSGHFGTDRAAIEAALIDLSKRCAQRKKRLY"
FT   gene            22096..22365
FT                   /locus_tag="Bmul_6184"
FT   CDS_pept        22096..22365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19837"
FT                   /protein_id="ABX19837.1"
FT                   /translation="MVGTERLPIELPAGWIAEDDSRGTVITAIDARGRPAGSVTVCTKA
FT                   RGYTLGVAKVRRARDAAEDVYKGLGWQVRLFSDAVCALSQTLEN"
FT   gene            22767..23192
FT                   /locus_tag="Bmul_6185"
FT   CDS_pept        22767..23192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19838"
FT                   /protein_id="ABX19838.1"
FT                   /translation="MASGNDSHFKLRRPCENCPFLKVGAIELAPGRLDGIVDALVKDDR
FT                   GTFHCHKTVHNERTGGEWDGDGNYVASGQESMCAGAMIYLEKLGCPTVGMRLGRVLGLY
FT                   DPDRLRPAFADVIDPRDRQRENRDDEIRKRRAEEGRD"
FT   gene            complement(24004..24996)
FT                   /locus_tag="Bmul_6186"
FT   CDS_pept        complement(24004..24996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6186"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bvi:Bcep1808_2141 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19839"
FT                   /protein_id="ABX19839.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   gene            25160..25384
FT                   /locus_tag="Bmul_6187"
FT   CDS_pept        25160..25384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19840"
FT                   /protein_id="ABX19840.1"
FT                   /translation="MLIVSFQMAMLIWSSETSLSAAYMDSWRKTGTVLAHLFQIQPGPS
FT                   RRIGIIAFGLVGFYLAIAAAIEIVAPLGH"
FT   gene            25976..27490
FT                   /locus_tag="Bmul_6188"
FT   CDS_pept        25976..27490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6188"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bxe:Bxe_B0125 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19841"
FT                   /protein_id="ABX19841.1"
FT                   /translation="MPGRHINDHQMRLYMKYRLKEGPPQAAARAGFSAATGYRIEEDPR
FT                   LPSQKKAPRGRRRADPLAAIFDTEIVPLLQSAPGIRPIAVLDEMLRRHPDLPGNVRRTL
FT                   ERRIRDWRALHGEEHDVMFRQVHQPGQLGLSDFTEMDSLGVTVAGVTLDHRLYHFRLAC
FT                   SGFEHAHVILGGESYVALAEGLQNAIWALGGAPREHRSDSLSAAFRNLDADARKDLTTR
FT                   YDALCAHYGMQPTRNNRGVAHENGSIESPHGHLKSAVRDALLLRGSHDFDDLGSYRRFI
FT                   DEIVGRINARNGKRIEVERALLQPLPVQRTCDYEETRVYVTTTCGFVLRKVFYTVPSRL
FT                   IGHHLRVRLYDDRLELFLGGTALMTLQRGRAGPNGKHGHVINYRHVIHALRRKPMALLN
FT                   LVYRDQVFPREAYRLSFDRLLEQLPERQACRTMVELLSLAHEHNCEAQLAEALQQCLDD
FT                   GQLPDLDALCSRFEAKPTSSMPEVNIQLAALSDYEALLDMATEVAA"
FT   gene            27487..28338
FT                   /locus_tag="Bmul_6189"
FT   CDS_pept        27487..28338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6189"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B0126 putative
FT                   transposase-associated ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19842"
FT                   /protein_id="ABX19842.1"
FT                   /translation="MSLDIDVTRLSLLLNDLRLPAIKQIWSSFAERSDAEGWPAARLLM
FT                   ALAEHEIAERDRRRVERHLKDAKLLPGKTLENFDFDAVPMVSRAHVSALCAGDGWLRNG
FT                   TNLILLGPSGGGKSHLSSAIGLSLLEKGWKVLFARTTDLVQRLQVARRELALESAINRL
FT                   DRFDLVVLDDFAYVSKDQAETSVLFELISARYERRSLCITANQPFGEWDKVFPDRAMTV
FT                   AAVDRLVHHSTIFELNVESYRRRTALQRKQQGPGRPASRATPKNVGVPPTQEDQHGIDL
FT                   TE"
FT   gene            28915..29100
FT                   /locus_tag="Bmul_6190"
FT   CDS_pept        28915..29100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19843"
FT                   /protein_id="ABX19843.1"
FT                   /translation="MVFDMMKREMRELVNLVEETTQWETSVACGKVNLADVSAEARAAH
FT                   HARLERIVELRAKYDL"
FT   gene            32323..34116
FT                   /locus_tag="Bmul_6191"
FT   CDS_pept        32323..34116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19844"
FT                   /protein_id="ABX19844.1"
FT                   /translation="MQTIDLFPHLQQRPTLDQRVERAVAALRRLFHERRIAICQFSAGK
FT                   DSGVVAALTLEAARRHAAEGGEAVVYVVTADTGVESPEIVAHAQRELAKMHAYGKRHNV
FT                   RVHVQTVAPSLATSWQVTILSGRALPSYAGTNSDCSVSLKIEPSRVFRNQLARAAKQQG
FT                   YAEPVVCLGSRFAESAKRKAGMQARGDRADTPVRNDEGDLTLCVIADWETEDVWEYIGE
FT                   VTSGLRSTYTDFRETSRIYAHAGNSSCAIVSDLSFEEASAGKRKRRGHCDARTGCWTCQ
FT                   QAEDRSLEEMIKFDEDRYAYASGLNRLNKFIRAIRYDWSRRNWVGRTIKEGYICIEPDT
FT                   FNAATVRELVRYMMTIDRDELVRAKRTGSRPKFQTLPLTMMIAVDAMQSLQGLAPPFAI
FT                   WADYRDIYCNGVRYDVPDVMPVAPQPMPEPMFLHVGEHWDDTADQWTGFRDPLFEALTE
FT                   DSPCARKVHHLKGGRTTWEVPTGKRFEVDEESAEMILDFEFERLVEMHDAGFFPGGITA
FT                   GYRWYLNYGTLTLSRAQQREHDEIARRTDFKDRLGLTLDYAVADLLRRAVRFAALPSPA
FT                   RTAWAHKATTSSAQADLPFVL"
FT   gene            35395..35928
FT                   /locus_tag="Bmul_6192"
FT   CDS_pept        35395..35928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19845"
FT                   /protein_id="ABX19845.1"
FT                   /translation="MTAQLVERWEGGGKHGHYQIDVERFESRPGVPFFNIRKSRAGRAY
FT                   DSVVARSSSEARQRIQHTVDWGLAIGPTQYKRTYRDTNLAPIDRDGVLVLTPPPNQHEQ
FT                   AAKLRLFLVNRIGNCNGKWRGKLRAEEQRALLGRYFGRGTLVIDGARARVRYQVEHMFG
FT                   GEVETKADVAWADL"
FT   gene            37035..37388
FT                   /locus_tag="Bmul_6193"
FT   CDS_pept        37035..37388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19846"
FT                   /protein_id="ABX19846.1"
FT                   /translation="MVETIEIGPAPCDEACAQVGDMRYLERSRAECTAFINQIRRTLGE
FT                   PPDGASLFIKSSAHDFGTYWEVVVKVTGGLSADAREAAIAYAYRCESESPTTWDDDARR
FT                   ELTEAGFPVSEVV"
FT   gene            38231..40486
FT                   /locus_tag="Bmul_6194"
FT   CDS_pept        38231..40486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6194"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   bxe:Bxe_A2572 putative chromosome partitioning nuclease,
FT                   ParB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19847"
FT                   /protein_id="ABX19847.1"
FT                   /translation="MKTVIAQDANVNADALPADMPNMLRAGQREVMIPLKRLVASPYNQ
FT                   RKKKRDQATIVAIADNMLAVGQLQNLVVHKMPQRAKKAQEWGVDAGETRRQAFLFNVER
FT                   GYMSMDDEVRCIEISEAQAILASASENDLHVPPHPADQFAAYKALADEGRSPEFIAAVF
FT                   NVSPKVVAGRLKLANVSPKLFELFAADVISLEQIKALAITDNHERQEAAWFGAKGHWNQ
FT                   SPNALRNVLKGEKLSFGDRMVRFVTVAAYEAAGGEVERDLFAEQDDGFIVNRELLARLF
FT                   DEKIACTVESIKAEGWNWVEARPTFDYDDRNQFTQLYSTPVPLTSDEKAKYEEAQMRAD
FT                   ELSEKIEASYDAEVGDAAYLSDEDREKLDGECNQLYAIMQEMDDRDGEFTSEQMKVSGA
FT                   IVTVGYDGALEIVRGLVRRENRAQARAMMEEAGQSVPRSLTKKVKGLHSEKLLLNLTSH
FT                   RTAAVQTALVANPGVALVAVAHRLLLEFVYEHYSDLSAVQIKEQQPMYSADRAVPGIKE
FT                   LPQYDQLARSVLAVTRMIPKNPNELFGWLLEQPQAVVLNILAVCTALSLNGVSRTEEPN
FT                   AINALAGALELDLTKYWKPTCESYLNHVSKDRIVAIVSDVISKEHGARLGKMKKAEAAQ
FT                   EAEKLLADKNWLPEFMAAAEVRTARTYFGDDGNEQEDADGELATADNLGAHEEVLGDEP
FT                   AQPDTVSDSPDGAETGVKPADVAPTEFAGGRVTQSARFPWPFATPTPNVLAGSRPAA"
FT   gene            42158..43729
FT                   /locus_tag="Bmul_6195"
FT   CDS_pept        42158..43729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:p2B15 plasmid-specific DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19848"
FT                   /protein_id="ABX19848.1"
FT                   /translation="MYSTTMAKRSTSGQARAVERFLASVPQGKSSRQQGNIKSNASQAQ
FT                   RIYLAVPPRDIPKARSLGAHLDYDRRLCWIDASMDRTPFAEWIVDETVLANAGIDPEEA
FT                   IADFSLAMRTFGLIPDTVRADGAWHTAKVETPAGPRNSGSYKLERVGGEWRGYIRNFKG
FT                   ASGPWRFQKGRLTREQRAALEAADSDRRAARAAKVIEEQREIAARALKVLVTLPEVECD
FT                   AHPYLARKGVAAHGLRIASGRGMDMITLLNLEHFKSTSDEYLIAPGRDIQDRLRTVQAL
FT                   GPDGSKLFTKGARKTGAFHLIGARRVADLVSAPAVLLSEGYATGASIYEATGLPVVVCF
FT                   DAGNLVAVAKDLVHVLPRRQPKLVCADNDQFFLETAVTRIAELGSVAPETECSFKVNAG
FT                   PRDATRTVRIVDAIADGQWHASAHGKYRLAVECRCGVARSVTVDVITGSDGKHVRSTTS
FT                   NRGVDSAAEAARILRCQAIVPVFNSLVGRPTDFNDLASAEGLAAVREQVRVMLPRELVS
FT                   TNATER"
FT   gene            44203..44814
FT                   /locus_tag="Bmul_6196"
FT   CDS_pept        44203..44814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6196"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase-like protein"
FT                   /note="KEGG: bvi:Bcep1808_1541
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19849"
FT                   /protein_id="ABX19849.1"
FT                   /translation="MTLKLLSWTAPAVIAGCIAELAIALAAFASPVASVATVLTTAAPE
FT                   GRVTSYAFSPDGKGMDLVLYGVGSAHRSIHVLAYVMTYRPLIEALAAKARAGVPVAIAV
FT                   DYGESIANDRDGYIRRGLDYLARAGAAICVVDRYRLMHDKAMILDHRSVQTGSINYTAA
FT                   GAKSNSENVVIAWNDPVLAEAFEQHFRSRLAQCRPLDQVR"
FT   sig_peptide     44203..44292
FT                   /locus_tag="Bmul_6196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.809 at
FT                   residue 30"
FT   gene            45375..45575
FT                   /locus_tag="Bmul_6197"
FT   CDS_pept        45375..45575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19850"
FT                   /protein_id="ABX19850.1"
FT                   /translation="MKSNLLRRIAAFFLGCDLNAEIRVLHRWRREEDDVRAVRVETVVN
FT                   GQRKRVTLYRHAPGAWSPMPL"
FT   gene            46235..46435
FT                   /locus_tag="Bmul_6198"
FT   CDS_pept        46235..46435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19851"
FT                   /protein_id="ABX19851.1"
FT                   /translation="MRNQYLARTSPAPEGTNECPTLCAEARELANVYAVMIFNRETFID
FT                   AAGLNAFQAVALQGALDAREN"
FT   gene            46445..47008
FT                   /locus_tag="Bmul_6199"
FT   CDS_pept        46445..47008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19852"
FT                   /protein_id="ABX19852.1"
FT                   /translation="MQIPCTITREHYADIDRAGRSYTLEFVHYAHAETGNRVRTKAHII
FT                   PTVEPFNREPDAPECQLTGTDPARPTTRSSVYLDANENPAIRLSFGYSHQTRATTQVLA
FT                   VERGRVVTQWMTQEQFDAEYAESDVPPLVAAHALMNIGRTGGIDPTAHRYLLFALNAPA
FT                   WRLALNAYGAVARNWIRRTTQQLY"
FT   gene            48181..48381
FT                   /locus_tag="Bmul_6200"
FT   CDS_pept        48181..48381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19853"
FT                   /protein_id="ABX19853.1"
FT                   /translation="MKSNLLRRIAAFFLGCDLNAEIRVLHRWRREEDDVRAVRVETVVN
FT                   GQRKRVTLYRHAPGAWSPMPL"
FT   gene            48463..48744
FT                   /locus_tag="Bmul_6201"
FT   CDS_pept        48463..48744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19854"
FT                   /protein_id="ABX19854.1"
FT                   /translation="MRGLDVRVNYALAKIKAIVDPQSDLVIASLYDAQAEGYYDYQAGV
FT                   YSVPTMFADVPELVAEWEWGQQMAEECDAVSQCPDCQNDSGNPCPVHG"
FT   gene            complement(49570..49884)
FT                   /locus_tag="Bmul_6202"
FT   CDS_pept        complement(49570..49884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19855"
FT                   /protein_id="ABX19855.1"
FT                   /translation="MNQEKSGTHKPRGRRPAASLEERIAEAERLVASLKEQKKLEERQN
FT                   LERNRKAILDLFKSEGVDTIPIEKWKAAMPELKTVLGVGRGATDVGSGVSEAKGAEQAA
FT                   "
FT   gene            50998..53025
FT                   /locus_tag="Bmul_6203"
FT   CDS_pept        50998..53025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6203"
FT                   /product="Type IV secretory pathway VirD4 protein-like
FT                   protein"
FT                   /note="KEGG: bch:Bcen2424_6944 type IV secretory pathway
FT                   VirD4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19856"
FT                   /protein_id="ABX19856.1"
FT                   /translation="MTEKVISDAGAGRALFMTRVKLTVHAASMAFFVGALPAMVLPSVW
FT                   WMNTLTAHDVDLVKANILSHVVDQEVPRRWRIRDGVGEKKILTVVKSDGELAQWLTPPQ
FT                   FRNVVPDLARPVTAFRYVAWVSVGLGAAGYYAVWRSLARLGRRARENKRVDGALDVVSA
FT                   EELSKAVRREEAGPYTVLDVALPRSAPMQGIMFVGAQGTGKSLGIHDLMGQVFARGRKS
FT                   VIYDHAGEYFRAYYRPGKDLFFNPALLGSVPWSMFMEMENTYDSDTLAHAFLPPKAGVV
FT                   HGASAFFEDAARVLFSVMALRLRQRGAVYTRLISEAILSMPEDELELLIKNSVASSAVG
FT                   GDSKGQRQGVISSIAIYLNGIAAVQDGTWTLREFYEKDDDTRLFLIGTEDTYAMFAPLF
FT                   RLLITMAFQTIAARREIRHEDRYWFFLDETHVLGDIKLDARQAELRKYGVCVAAGIQAD
FT                   KQFNTSMGADRAETLMNCFNTTVTLRLNEPNMQERMARRLGKSETAVVRAGQAIAVTDW
FT                   RDGGQLSQDEREKWVVMPSKIGLLKNCMAYVQVAGDFPPALVNYRHWLPRWYRPWPRTL
FT                   RFRERQPDPPRDPRFKISAADGQDAIESVRAEAEAMKAQAAAAAAAAATSPTAAVTTQG
FT                   KWIVTDLDTGEVMLPTADVGRGDEHSDGREPVSQENEGLF"
FT   gene            53708..56971
FT                   /locus_tag="Bmul_6204"
FT   CDS_pept        53708..56971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6204"
FT                   /product="conjugative relaxase domain protein"
FT                   /note="TIGRFAM: conjugative relaxase domain protein; PFAM:
FT                   TrwC relaxase; KEGG: eli:ELI_00780 TrwC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19857"
FT                   /protein_id="ABX19857.1"
FT                   /translation="MPHPDTGKIQNLANNSKGDKRRAGIDFTIAPPKSVSIAALVGKDD
FT                   RVIAAHLAANARTMEWFEKHASLIRVKDEKGRNRPEVAGNLLYATVLHETNRENEPQLH
FT                   NHNVIVSAVYDGARHSWRSLTNDLLYTLRARGDIIYKAELAAALRHLGYQLVYAENGID
FT                   FELKGFSRDHVDTFSTRAVQVREALLKHGIDPGEASFDARRVAKLDSRAAKQEHPREIL
FT                   QSVWEETAKEANLDVASIVERAREAFADRQVPRRGVERTVEHGAAMGQDSGPSRGAAVS
FT                   VSNDARANALRAVSWAIEHLTEREQAFTLVDLEVTALKFSRGSISEIEWAIDQHVRNHM
FT                   LVDRGITVGGQIQYTTHKAIDNELKLAEHILAGRGQGNVVLDAEDQFDAAVAAFEAKKT
FT                   AEIGEQFKLSGEQIQAARNVLMHEDSIQGIQGEAGTGKTAALAMVKDVAQAMGWEVIGV
FT                   ATSAAAAKELEASSGIQSDTVAGYFAKRDSAIRAVELRLQDLRKSISERATLRGLDDQR
FT                   IEARTLAVKSEDIDYGTHRYTFDHQRGEVFRSPENLRNAIGAALSEIAARHREAAGTEQ
FT                   GHPVTLGEQARETVRAAAANVAASLGRRLMTFEQIGTAEAVAARNTLYLERQGSATELD
FT                   AEYARTQAKLENLRRYGNVDGKKTLIVMDESSLTGVDDTEKLLRFAREIGARTVLQGDV
FT                   KQHGSVAAGRAFEQAQIAGMNVSILEETRRFRDATAQTRQALADMKAGNYAQAIARLDT
FT                   LRVAESDLAKTVAERYLENLQELTAKGVDAPKVGVVAITNSDRKLINAAVHQALTDVGI
FT                   ISGPHFEKPHLDDPKMTGAEQRYASMLSRNRVDALIYRKSYREIGVEKGDVLTVTGYDV
FT                   QKNRIYALNAKGKSVEINPQRQDYFSPAIQESRVFAVGDRVETRAIIRLPGQELNRLDN
FT                   GTQGVIVAIDSLGAKIRWYRDGKESDLKNDDLRFVDHAYAHTSYKEQGATNHREIVAVS
FT                   KIGARVFNREAAYVAASRAKDNTEIITSDLDTLLRNAGREVGKTTAVEFERAESSLDQS
FT                   ADQGAKHGATRSIEVAPTRSVETERTLERSPDPGNLLGF"
FT   gene            complement(57156..57488)
FT                   /locus_tag="Bmul_6205"
FT   CDS_pept        complement(57156..57488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19858"
FT                   /protein_id="ABX19858.1"
FT                   /translation="MLLYLKARDANVVHERPYSDAPRSFPGLGQRKRNERLAEIDMLYD
FT                   RHLIGPAILDVDSAGSVPTEASVHEVRGHWRRPHFRMQPHGPQASLRKLVFIGPTIVRP
FT                   DRLGLL"
FT   gene            57771..59327
FT                   /locus_tag="Bmul_6206"
FT   CDS_pept        57771..59327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6206"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bvi:Bcep1808_7617 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19859"
FT                   /db_xref="GOA:Q51649"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51649"
FT                   /protein_id="ABX19859.1"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT   gene            59344..60093
FT                   /locus_tag="Bmul_6207"
FT   CDS_pept        59344..60093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6207"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding domain protein; SMART: AAA ATPase; KEGG:
FT                   bvi:Bcep1808_7618 IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19860"
FT                   /db_xref="GOA:P55923"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55923"
FT                   /protein_id="ABX19860.1"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT   gene            complement(60149..60913)
FT                   /locus_tag="Bmul_6208"
FT   CDS_pept        complement(60149..60913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19861"
FT                   /protein_id="ABX19861.1"
FT                   /translation="MSRADRSDAAKLDASLRFRLAEALSKSALADDPRYERLPAFVRFR
FT                   ATGAAKAWEAWRRVVEQGPNNVSEMLRTRSIVALVNQFDELAKRLLPYGTPEMMPDEAG
FT                   TVAAHSAIWQAFDLRNGLIFEPTPPLHRLLDDSYISDDVPIGAVEFPADTLCIIPEPSS
FT                   WGQGERSDATVFFRNGQTLGCATWIMRLHDGQRDATIDVVELPLDKPDRTIGALLDEVC
FT                   GSSKTYQTLRAYLRESIDYADFGDGDQSFRRT"
FT   gene            complement(60937..61425)
FT                   /locus_tag="Bmul_6209"
FT   CDS_pept        complement(60937..61425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19862"
FT                   /protein_id="ABX19862.1"
FT                   /translation="MSDNLSQTVDLLISHSQILVRSRPYDEGLSQWGTGNIDQGAVLHA
FT                   DYLIFDPLPDDAFGAKVYLQVLDKFEMDERAARCIVAPFHITDRNALEVASATEKFKIS
FT                   LQLPLNAYDVYYEVCEGDEVFYKFTFVSEAKHHQAKYLRDDPWGGKKDMPLVSGKFDR"
FT   gene            complement(61418..65683)
FT                   /locus_tag="Bmul_6210"
FT   CDS_pept        complement(61418..65683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6210"
FT                   /product="RHS protein"
FT                   /note="PFAM: RHS protein; YD repeat-containing protein;
FT                   PAAR repeat-containing protein; KEGG: bur:Bcep18194_B0648
FT                   rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19863"
FT                   /protein_id="ABX19863.1"
FT                   /translation="MSQPAARKDDPFTHTTLMGDLIGMGGSLLAGMGIGWLLTEGALLA
FT                   AAAVLEVGTAGLATPLVLAIGVGVAATMQASGLNDKIDEAAKGLGNAISPPQEKGHIKS
FT                   GSPDVFINGEHAARAADGADMDTVECQDHPGPQMIAQGSESVYINDLPAARVDDKTTCD
FT                   GTISKGSPNVFVGGGTKTVRDISAARPWVAWLGMAIGIALALCGRGNMKWGNLKGKLPC
FT                   LGIGLLAGLGGTLLGSLMRGHPVNVITGGKILDGADDTDFELPGPLPIVWRRFYSSHDD
FT                   RADSLFGPGWSVPISVELQLVRERGEVVSITYWDEQGRDIVYPAVSPGESYYSVPEGMY
FT                   LICTAGGHYVVETVDGLYRDFGRARTIADTETLKLRRLEDRNGNWIEVTHETAGDVIRP
FT                   ARLHDSAGRLLTLAYDNAHPQRIAAVELTLGVDGEQSETLVRYAYTDAGELAAVTDRSG
FT                   HTGRKFVYEHGLMVQHTLRGGLKCFYAWQGTGRDARVVRHWTDDGEAYTFDADLTQREV
FT                   TITDQLGRITRWTWNEDRQPTHHVDAEGHVWLLEWNAMRQLISATDPAGHVTRFEYDER
FT                   GRQTARIDALGQTARTEWNGFYDLPVAEIDPTNARWIYRYDARGNLTMTRDPAGFATEY
FT                   HRDERGLVHTIRDARGGYKFLAWNARAQLTSYTDCSGKTTRFEYDARGALARVTDAAGH
FT                   ATVYEADAMGRVTAIATADGARQTFHYDDAGRLVEVVAPNQRRTRYELNPRGLLLSRTD
FT                   AADRVVRFGYDNAFRLASLTNENRETYRFRYDRRDLLIEEVGLDGNVRAYEYDMRGLGI
FT                   ALREGKRQTIFERDAIGQLVAKQAARERCEYRYDKAGRIAAGELYALTGRKPSLKNRVT
FT                   LKYGSRGEVLEEYTPTGWLAHTYDELGNRVSTTVSGQQTIDWLHYGSGHVHQIRVDGAA
FT                   IADIERDDLHREVLRTQGKLTSQFGYDAVGRRARAAAQRGASAEVLLAKQWQYDAAGDV
FT                   VQKRDQRYGTTSYRYDPTGRIEQATGPGLPSEVFRWDAAANLVSSDHPGGYVEYNRLRM
FT                   FDDKRFEYDAYGRLARKLSGHGPAREQTFEYDDWNQLKTVVTKDRLGVSTTHFEYDAFG
FT                   RRIRKLNGSYSSTDFLWDGMRLVQETYHDRCGEEALTYLYEANSYAPLARIDHAAPAAN
FT                   DAEARDAVYYFHNDVSGLPEELTDADGELVWQARYKVWGNAVQEEWIARAPQQPAAAWG
FT                   EVQTAATPGHVPRPQNLRFQGQYLDRETGLHYNTFRFYDPDIGRFINPDPIGLNGGHNL
FT                   YRYTPNPITWIDPWGWAGCTLTKAKSKDYDYTLRLKRSEYPQTFGHISDAIGNGHADIV
FT                   TVQRGSAKLNRKLSLAGIKTKAGMDRDEWPMAMFKEGGDGASVRYIDPSDNRGAGSSIG
FT                   NALSDLPDGTRVKVEIFDE"
FT   gene            complement(65680..66153)
FT                   /locus_tag="Bmul_6211"
FT   CDS_pept        complement(65680..66153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6211"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   bur:Bcep18194_B0647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19864"
FT                   /protein_id="ABX19864.1"
FT                   /translation="MHYAIHEGTFDLPDAALDRTVNMLILPIGTGGLSLVVSRGRLRDA
FT                   ESIDAFVDREWGLASRTAKDLTLQTRRPVTVGRNECPGVQTESTHEQDGRTFHQHQTAF
FT                   QLDAGGHVIVMTLTSAAPLTDEQRALANRMLESFEPRPHDPAAPSLVSDSHRP"
FT   gene            complement(66180..68330)
FT                   /locus_tag="Bmul_6212"
FT   CDS_pept        complement(66180..68330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6212"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG:
FT                   bur:Bcep18194_B0646 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19865"
FT                   /protein_id="ABX19865.1"
FT                   /translation="MSFAPNGGLPTGLGGSPLGALTPISSALGGLGGSLASGVGGQLGP
FT                   LAGLAGHVDTLQRATQLAQTGFSLMEKTPGAIAAALNNATGTARLTQLNRYATIDTPLG
FT                   PDVLLLSAAIIDEHVNRLPEIHLDLLSHQHDLTPDQLIGQQVKLKLDHNARQSTLERIV
FT                   AAGATDNERYFDGYVSAFDRVSHPGRVTQYQMTVVPWFWFLTRSTDCRIFQHKTAQDIL
FT                   NEIFLEHGFYDFVFDIRTEQKPLEYIVMYQESYFNFCTRLMEQEGLIWTHRYEKDKHFL
FT                   VIGDTNLLFRPIDGLATVPYAASQSSEFNGIDQLYEGRRFGVGKVTYQDFNHQNPSSPL
FT                   MRVEASPENLKHARLDSTERFEHQSLYDHGDDGNRYARLAMQAEEAQAHRYAGGGYAWR
FT                   MTTAGCVTVTGHPVPANNQEYVILHVRHEVVNDYTQHETKLPYRNSFALLPKKISYRAP
FT                   RITPKPVIHGTHSAKVVGPKGEEIHTNGSCVKLHFPWDRRGKQDGSDSMWVRVSQPWAG
FT                   DGWGAAAIPRIHQEVLVAFNQGDPDNPVVVGRVYNGEQSNPYHGAGGQTMGIKSQTHKG
FT                   AGSNELRFSDVNGQEEFFMHAQRDMNTVVENSETHKVLGPLRTVLIATGSEEKQIPQGN
FT                   LTETIAEKRSTTATTVEVTTPAKDGGGGTQVYMAERGILLKVQDSSISLAPEGIRLEHK
FT                   GSVILMTDDGVMVNGKRIDLNK"
FT   gene            complement(69861..70535)
FT                   /locus_tag="Bmul_6213"
FT   CDS_pept        complement(69861..70535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19866"
FT                   /protein_id="ABX19866.1"
FT                   /translation="MDRTDNAMASDAHKRLVTLGERWLKREGFSVVATELVTSGTREQA
FT                   DVIGFRSNCSAVIEAKATRSDFLADARKPHRISGGLGVYRFYLCPPDVIRVSELPVRWG
FT                   LLYADRRGVREVLRPTGNGWPSFRSTIGDWPAFQHEPDLEAERGVLFSIARRRSLSRSD
FT                   ELYERKLQDATRRADRLARENAALAENIRRLELALYLAERGLNAGVPDAHELKSAIRRK
FT                   VA"
FT   gene            complement(72065..73522)
FT                   /locus_tag="Bmul_6214"
FT   CDS_pept        complement(72065..73522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19867"
FT                   /protein_id="ABX19867.1"
FT                   /translation="MSRAPASLCLPRRTEEPPMLITRIRRLFTSLVVTVLSLPLPTTAQ
FT                   TYGPGACSPVPGSQTCIDTTPCKTSGTGQQICLSTATPPAGALQVPYSCWQYSYSYACT
FT                   GTTVDTCGQYRSNSACGVVGSVCNDTIAETGQCDEWTYTYRCQTKAEQTGQQMNCSNGL
FT                   FDNSGFPTPPNNNNSFLTGAIGLELLGEAQKYTDGNSIFAGVEESCRKGYEGIQNCCKS
FT                   TPGAQSNNMVMTAAIGAAGSVAKYAGEKLIDLASPYVFDAMYTNGIFSEALTQNFTTAF
FT                   SLDAANGGGTLGTQLASGGIQFGVYGFTVGFGTMTPGLFGANMQLASFGSNGYLAFNPY
FT                   VFAAMVAIQVIQGLSKCSQGEQLLALHKGAGLSTFIKEECAKKALGACVQYVDTYCSFN
FT                   SQLAQIINIQGKTQLGLPLEGCSGLTPDQISKIDFKKIDFSAFSSQMMDQAMKGLPKNI
FT                   TGNYTPIMQNTPSGSSQKGGSAVLPTY"
FT   sig_peptide     complement(73388..73522)
FT                   /locus_tag="Bmul_6214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.825 at
FT                   residue 45"
FT   gene            complement(73479..74780)
FT                   /locus_tag="Bmul_6215"
FT   CDS_pept        complement(73479..74780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cho:Chro.60244 oocyst EB module wall protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19868"
FT                   /protein_id="ABX19868.1"
FT                   /translation="MKVFIVALAFAFASTALAQNASDVNNGRTFANSIAPTSQTQIVNP
FT                   AGVNASAWAGQTNMPTSVPSGFAAFSNPNTSSAALMAARGSSLTALGNQAQIDCAAFVP
FT                   GNDPYQNQYCAAVNFLNNQCMQPTTGQKSVLGKTGQTISSNANCAGTFGAGQSQFGYGD
FT                   QVTIDDPMFKVILGLGDSARDALSTICTPKTVVTQPAQYENNTCVVSIDKEENGCSQYL
FT                   NATITNSISQALSVESCPDGMTLQGGMCLHQVTYTPWISCPAGYIQSGANRDQCVQISN
FT                   LQGTPYCPGGFGTGHTDNGTMVCVSMSSYPDPPPNVLNNMPLIDRGLCIGGSCYNPSYL
FT                   PLQSCPDGYTFDGTQCTKTTTVGATYSCPNGGALQGQTCVTNDSANPTVTYSCPPGQTL
FT                   NGSNCVKQVVKTSWTDTCTAYEQSAGVALPTPAN"
FT   sig_peptide     complement(74724..74780)
FT                   /locus_tag="Bmul_6215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 19"
FT   gene            complement(75338..76540)
FT                   /locus_tag="Bmul_6216"
FT   CDS_pept        complement(75338..76540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6216"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19869"
FT                   /protein_id="ABX19869.1"
FT                   /translation="MTRALNIAMHINTVRVRRFALSLLVSTALTGVMVAYAQENGIEPG
FT                   AVKGLAESTFSSPVFADLVNGYRTQNGSIVKSVTADVVDRAKALLPKANQLGERLRFGD
FT                   HNVVSNDGETVVMWMIEAANATGEKRKALLAKLAELSARGVPEAMTFQGFASEYGLFGF
FT                   PKDLGRALSLYRSAAASKYQPAIYNLAIAAGYGKLQRPDLASALMYAGQAAAIAADASY
FT                   RVCGFASFLSYRQGDRVRALQYATSCWSDLAGLSRARYDARASLSERVTLLRNSISTGI
FT                   DDGYALLEQVTRDAGAEPQYLACKYELVNKYRRPTGGRNLRDDAVLCYRRYTPTGTQRE
FT                   ASIRFNTVVPGIIGFVPTEIAALEKLRASNKFHYGWSVPYLPFRQQDVDLFAPYVSHAK
FT                   Q"
FT   sig_peptide     complement(76427..76540)
FT                   /locus_tag="Bmul_6216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            76642..78144
FT                   /locus_tag="Bmul_6217"
FT   CDS_pept        76642..78144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6217"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: mpt:Mpe_B0378 pili biogenesis ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19870"
FT                   /protein_id="ABX19870.1"
FT                   /translation="MQDVHACLPVVEGLDELTDDERRAIMMVREGGNENASVELAIRQV
FT                   FVWAITTQSTDVHVSGRDRRGSIEIYLHIRTPEGFRNFRFRYPKQEGRHWETKLLQLSG
FT                   TPQGASTPEIASTRFEIELPLDFAKAHGLRPFEDAPTYAVDVRVEYTKTFNGFAFICRL
FT                   LDAQRAPELHELGLSYSVYRTIMRAISKPSGLILVTGPTGSGKTTLLNAILSVLNDETR
FT                   AIETIENPVEIALRGNGPIRQRQVSGNITFARALRSILRSDPDVIMVGEIRDSETMEIA
FT                   LQAAQTGHIVLSTLHTNNSAETYTRALDLTKDKARDAYRLAETLKAVISLRRIDRYAGE
FT                   SVVRALTRDEQLWLEANGIDLGDSIREVVPSKHVGKVAIVEVIVTTPEVKQLLRAKRVD
FT                   VTAIYRAACEQDQYEPLAVGGVRAVQSQQTLLRDCIAGLEGSSDAKGYPCSRLRLAKEF
FT                   GLDLVEVACAIDDYHRAADAGGDKPLEAFLVSSRETAYGEVA"
FT   gene            78489..78788
FT                   /locus_tag="Bmul_6218"
FT   CDS_pept        78489..78788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0377 thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19871"
FT                   /protein_id="ABX19871.1"
FT                   /translation="MEASFIGAQERGISTSNWAGIERIGHAAHVPVPVPRLVADHATEL
FT                   ERELRAALVRQKLLGITNTPAVSVAGTYIVTPEFTSGDAALFSQLVNGLISMAK"
FT   gene            79083..79604
FT                   /locus_tag="Bmul_6219"
FT   CDS_pept        79083..79604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19872"
FT                   /protein_id="ABX19872.1"
FT                   /translation="MLTDEQKKLISKGLSRGVPDTLIAKKLGVKHMQVYLYRTSLGIPA
FT                   SRVVEARYDTWIRLLESGVALETVAEMYEVKAESILNSLYRKRDFSYTEAKKRGHRSVH
FT                   ASFRKALGVTLKDAQEKKIETWVRLFDSGMTIDSIADLYDVKPATVRNALRKVTEAEVP
FT                   AIPDMKNFDW"
FT   gene            complement(79972..83394)
FT                   /locus_tag="Bmul_6220"
FT   CDS_pept        complement(79972..83394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19873"
FT                   /protein_id="ABX19873.1"
FT                   /translation="MAIPTLTIYSATADPTTLRAILDSVAMVCKNNLMVWGFAVMVALW
FT                   RLSASTAAAALRSASGQGGAVLGNGALSAAMPFILATVLTNPMLKSTVQIESTVNGSLT
FT                   EVDNVPLAISIIPVAGSVLSMDLNDTVSTAFQRASAEYPTISASANGFLNPLKALLSAR
FT                   TATSRLSGIDSEVKTVLASCLGPDSGVNYSNIQRLVMNAGNTGATSAQSIPVNGINPTA
FT                   IGALLYQASLNSTGKVNDIGLDSTNILSCSDAAYRVADDITNALNSLEFPRVVQGAVNG
FT                   LDSPRPGADYSFNSLASQYYAVSRANTLGGVFAGGTGQANAEFMNLLFSEMVQGDLSCL
FT                   RAGGDTLIQCQASVLQAAEVERNNLQAAASEIPAMRYAGAFGNYLIAVIIGLGPVIIMF
FT                   MMFAGIEAGKSVKTAAHIIVWPLLVNNVGAEIVNGIISIDIANYLQALRQGGWLSQATT
FT                   YTAYKELSLQIGVGSHIMSSLPVLMSIIFGLGESSAMTTVATNIAPRSKETTDNVAPAP
FT                   QATRPMFEGGPVGTISQMGHGAGKLSMTGSVDAVSTSMNFGNMARDASRSLTQSEVRSH
FT                   NLSAGESNLAEFRRAFSTGDFSRLNIDRQVGQTLAENFNNEIRSGKEQHAGNAVTGTRS
FT                   NSNRTTIGAGGSVSASLKSGFSAGLGAHADTSTSADDALQRNDNRGQSDNYSDSVALSR
FT                   ALAKTMAQYSNTSAGSQSTSELSRALSTQRSYQQTLSEVQSVSDAATQGVRESSGFVSM
FT                   SGKIGSEEIAWQQRANPEYAAFQMTQGRRFEENGATRPYLQTAAADAASGATGRLVGDR
FT                   AGQAAINRHRAAVMLAQDQNARPEDRIAAARYLADEARAMQHMKFDPTNPAPMNLEIGS
FT                   PRDGTGVSSSEIAPFARRHLPPPTAPAARIASTTSASPGDDGAHEGAIHPRGGRVGTVP
FT                   AYRGPGASNPVAESQLPQANTSARAVQPGSNDHHAVRAEMPLSRARESKDLGGVTGRRS
FT                   TAADTGAAVASGRQPSGTAADHSTSAPQIPPHTPNGPVHSPRVAPPPVPEQLPAFGGDF
FT                   ERQMRDELASRRDRVSASVQSGDTQAANAGLDAKGHGTAIRAAANVVDNVADIGRTAGA
FT                   GSRTGLAPPVNPQKGRPSTPSANPDLTPGKRGN"
FT   gene            complement(83408..84889)
FT                   /locus_tag="Bmul_6221"
FT   CDS_pept        complement(83408..84889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6221"
FT                   /product="TraH family protein"
FT                   /note="PFAM: TraH family protein; KEGG: bvi:Bcep1808_6750
FT                   TraH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19874"
FT                   /protein_id="ABX19874.1"
FT                   /translation="MRVKKFLLIVAMVVVPHLAFAGILADLGSMVMANSTAPGAMTTKD
FT                   RVGVFMGAFTMRSPIKAVNLVTFDPPRIDAGCGGIDLYGGSFSFINSQQLIQIFRQVAA
FT                   DAAGLAFKAAIKSISPSLDALITEFQTLLQNLNNLAKNSCQMAHLIVDPIDNALSNAVN
FT                   GDGNTGGTNSNMFTDVMGGLKSYLSDANSYFKNQSANNPKSGNPLVKKVVASGASSIMG
FT                   LAGLPNVDGSSDNPSDPNSLNNMVLYALLGYNIDAAPCNSLNQAGQGIQSSRPANNTIG
FT                   QVTCSGPAVMTLDDLVKGGGTGSLRPDVPLQLYRCANPNGSVFGGVDNQICTQMQVISF
FT                   NYVGIEGWVNSMLFGSVDPALSVAGNSIVGQINSVNSTTFSAQQVAFMKQAGVPLAGLL
FT                   SKTSNTATRVAIAQRLAPHIVDCVAARIGEVLYKGANLIQTTPGYDLTDDQKDRIKTLR
FT                   TDYLAKQNACNNSDALLRIITEINEGTRFVNTNIK"
FT   sig_peptide     complement(84824..84889)
FT                   /locus_tag="Bmul_6221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(84900..85916)
FT                   /locus_tag="Bmul_6222"
FT   CDS_pept        complement(84900..85916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6222"
FT                   /product="sex pilus assembly protein"
FT                   /note="KEGG: eba:p1B150 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19875"
FT                   /protein_id="ABX19875.1"
FT                   /translation="MHTACFDIARGRRIAQWIALALLPVSIHVVAAPATDSPRGDAYGD
FT                   AFLNYQPYVTPAAPVQASAPASKPPTQTAPAPATVAETGPQKVDVVFLRKVYPVLEERA
FT                   INDPTDANISAYMYTKRIILDKAQRFSQSVARVLRQDPLLDENNRVPYASTGALSVRNA
FT                   DYQAQQKAVEELARIGGLVAFVDSTCRFCAMQIPVLDMLKRAHKIEYLVVSLDGARPKG
FT                   FNGPLISDNGLFRKLGLKLTPSIVFVPRPRAYVGADDPNRYLVVSQGFYAMDELVKQIA
FT                   YAGHDTKLLSAEVMRDLNVWDRGVTTTQDLNKLRLDPNKPGSFREILQPYLLKQYQN"
FT   gene            complement(85897..86424)
FT                   /locus_tag="Bmul_6223"
FT   CDS_pept        complement(85897..86424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6752 putative pilus assembly
FT                   protein,TrhF (pilin signal peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19876"
FT                   /protein_id="ABX19876.1"
FT                   /translation="MTTVSEIDVETPRPGERGKFAAFFFAILVLVLFFWIQPPITFGFD
FT                   PQSERCLPDLHLAMMVHRQPGEVHRGDLLFWRPDGALAGFKEQYILKMVAGTPGDHLTI
FT                   RAGRVFINGKQVVQGFPLAASYGRDQRAFERDEVVPPNAYFMVGVHPNSNDSRYWGYLD
FT                   ARKVSGYAYRLF"
FT   gene            complement(86855..89437)
FT                   /locus_tag="Bmul_6224"
FT   CDS_pept        complement(86855..89437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6224"
FT                   /product="Type IV secretory pathway VirB4 protein-like
FT                   protein"
FT                   /note="KEGG: mpt:Mpe_B0371 F-pilin subunit assembly into
FT                   extended F pili"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19877"
FT                   /protein_id="ABX19877.1"
FT                   /translation="MTATTLKVRRSPASDILNIETYTSDSNLVISKAPGAERPLIGAVY
FT                   RMSPLAGGGGEFSTVVQNVFKAVPDQSVIQVTLVIHPDHDAPDTYLKGKLYGGPVVQDL
FT                   IKRQADLYRRGLASGELPDLPGINKRTVYVSLAVPHRKADDEAVEKSASLQQEFFTNMR
FT                   GCGFHDVVQLNINQLVGVYRQITNIYEPATVPELDPTLDLRYQVFGPDQTFDFRDPHVG
FT                   EINGNTYCTTVTVKKYPERPFHGIMNLLSGAPFNSGSVREGGGQRIEGPCIITTTVRVA
FT                   NQRREWTRVESAIRSRRQHQPLPIKLGVEDTPRVLADLEEIKRQCAEDGTKFVYVSTNA
FT                   FLFGRDRDEAVRAGASVKGTLDKLGFDGRDVVATGLVRLAQTLPLNFSNTIADDLAGEA
FT                   TMASSEVGCLLPVYGDYLGNVNSDFPLTGMAYPTRRGTMHYFDPYVSNSNFNGVMAAES
FT                   GVGKSFSLQAKITAELAEGDNIVLFDNGRSSLKFCALIGGEYNEFGGAKAWRPSLQPFS
FT                   NLTDEEFDEQQETITSLHMLMAYDEEKPDPGARIALSEAVKAAWGQRGKDAEVSTTIAC
FT                   LQAIVESAAENQIQNQVHVAAANLIPRLKAFVDSPTRGPYFRGPSTLDPKAQFTVFELA
FT                   GLGDDNHLKRVVLFCCVNILLSRIKKFKGRKRIYVDEAQDLFSIDSAADAFEGLYLKGR
FT                   KNGVSVWVIVQSLLKLASFKAGSVILRQSAWKMIMAQKKDEIDAVIDQKVMTAFADDPY
FT                   FQKLIKSVESKKNFWSEILIMSDKTYEVVRLYVDKFTATLFSSEGAARDDVLQMMEEGV
FT                   GPLEAVRKVMGDKKARRREWMSEFLDMCKNIDGLTFNEIVRELKEIAK"
FT   gene            complement(89512..89901)
FT                   /locus_tag="Bmul_6225"
FT   CDS_pept        complement(89512..89901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19878"
FT                   /protein_id="ABX19878.1"
FT                   /translation="MKQKAAATLTATPTWSPKAAMVMAVGMGIMLISIGALNGGTALTG
FT                   SAWDSIQTTIKEMLSSTYVMFAILLTFLVTIWQLAHGQGYRNLAVVLGILATALIGPSI
FT                   VQTVATANGPAPASSNTAPDYGLAH"
FT   sig_peptide     complement(89782..89901)
FT                   /locus_tag="Bmul_6225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.260 at
FT                   residue 40"
FT   gene            complement(89914..90603)
FT                   /locus_tag="Bmul_6226"
FT   CDS_pept        complement(89914..90603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0369 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19879"
FT                   /protein_id="ABX19879.1"
FT                   /translation="MMILPAIAVSLAACSSAFNPIGSNTYDCNRKQDPTSIYCHSFRAV
FT                   EASTNGRLPDSRFDTELKFSEYDKATDIAPPNRRDLTAPPLLTAGGQPVQLGSGGAASQ
FT                   PAPADATPLHAEMPVRMGPVIQRTWIKRFVDENDMWTSDLTVLKEIAPSRWTGFDGGNP
FT                   ARAAGGVYPHKVADTPQDPSAGAVASAQSAPPAAAPPTTNDFIQPGGPAPGGENPAGIP
FT                   MPMSMPQ"
FT   sig_peptide     complement(90535..90603)
FT                   /locus_tag="Bmul_6226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.499 at
FT                   residue 23"
FT   gene            complement(90627..91988)
FT                   /locus_tag="Bmul_6227"
FT   CDS_pept        complement(90627..91988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0367 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19880"
FT                   /protein_id="ABX19880.1"
FT                   /translation="MAMQFKWLEDRKQEWRDMEPKFRYLLVTVAVTGTAFILYQHFTRA
FT                   PKADTAGAVAQGVVAPAAGLPPQPAQPAPAPQGFAGTVGILPTSNRNQGLEDLAAQVGS
FT                   LQQQVVTLTKAVSDGKAGGAPDASKLTTTWTPASAPSASTPTPSDGSNNSPLGKDLPDA
FT                   VNFDQPGNRPSSASGSIAGTAAADPAAFAAARPAEPPAPARPTLVVDKPAPSTASAGNP
FT                   KPDPTFPIYSGIEAVMLSGFNARQGGSNGGPAGAVTKAIDVGAPFVSRVKGATIMPNSW
FT                   KSSDLENCFIGGSATAVLSAERAYVISDKISCVFKNGEIYEGDIVAYGLDVDGNLGLAG
FT                   KVVNKQGSMLMQAALTGMAAGLGSALAPTAVSSYNSNVSAGSTGAYTYPSPSFLLGTSV
FT                   GTGVNKAATELSQFYLNFAKETFPVIEVTAGTRVTWILKQALTLKRKTPPKDQR"
FT   gene            complement(91988..92980)
FT                   /locus_tag="Bmul_6228"
FT   CDS_pept        complement(91988..92980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0366 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19881"
FT                   /protein_id="ABX19881.1"
FT                   /translation="MDQSSTEEVKPMKTRYLSALMAVYFGSTLSTVAFAQGASASVDFG
FT                   VATPPAIESAATTTTTTKTKPKLHGHVKRTRDPLKVDASIAVKNTPQKEIVLPGVLTVP
FT                   GEGIGVPDPSNVQKVSWTNTGNKTVYLSADEPNRILLPFKNAYIVHTSDVQVDKREQSN
FT                   NVYVYWTNAPSQARHLYIEPPDGGSALGLAIVPKKIPAQTILVTDDTGIVSGRRPKSSP
FT                   GSEYTSHIQDLMAAIALGKAPDGFSQVDIQLPPIAMNGLSATVDTRYSSQEGDLYVYTV
FT                   RNPTQSRAVLREEEFDGPEVIAVSIYPKPVLLPGEKTRVIVMARKREEQ"
FT   sig_peptide     complement(92873..92980)
FT                   /locus_tag="Bmul_6228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.960 at
FT                   residue 36"
FT   gene            complement(92953..93552)
FT                   /locus_tag="Bmul_6229"
FT   CDS_pept        complement(92953..93552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_P4G158 sex pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19882"
FT                   /protein_id="ABX19882.1"
FT                   /translation="MNRTARDKSIAEYKQLNRYLSIGIGCLGIAVLLLSLRVIFQNVIV
FT                   QMQVPGMPDGAKIERNGMDVGAMQAYAFAVTNALASVNPSNGESTKRFVQPFLSPAAYT
FT                   KVSLAIDQKIETLKSQRELGSYYFVLKRFDADEKLGRVFVQGDVHTVNAAKDTGEPWVF
FT                   EYPVRFGNYRMTMDDVIAYPGDKAHTSEWIKAQQKK"
FT   gene            complement(93549..93926)
FT                   /locus_tag="Bmul_6230"
FT   CDS_pept        complement(93549..93926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19883"
FT                   /protein_id="ABX19883.1"
FT                   /translation="MSIKFRIPRYGGAGPALFGVQFKDTYILILSLLIAAVAGKFYGTP
FT                   AYLGIPFAGYHINKKYIEWCNERLEGFARVALFRLGLKGYGRFKSQKTLYIGDATVINP
FT                   RNRHLIESILDPSSKEKGKLE"
FT   gene            complement(94437..94934)
FT                   /locus_tag="Bmul_6231"
FT   CDS_pept        complement(94437..94934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19884"
FT                   /protein_id="ABX19884.1"
FT                   /translation="MNRLIVALALFAAAPVHGEPSLSETIAAPWNTYIFVSSRMPLQSI
FT                   IQVTREASRAHAVIVLTGFAGEEPTLTSTQRYAADINRACCTTQPARWIVDPVLTRRYG
FT                   VTAAPSFVIAHGASENPGEFSKVAGDMSLSQALKFFAQNSRLPSARDYASKLYYATYGT
FT                   KY"
FT   sig_peptide     complement(94878..94934)
FT                   /locus_tag="Bmul_6231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            complement(94946..95959)
FT                   /locus_tag="Bmul_6232"
FT   CDS_pept        complement(94946..95959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6232"
FT                   /product="TraU family protein"
FT                   /note="PFAM: TraU family protein; KEGG: rme:Rmet_6167 TraU"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19885"
FT                   /protein_id="ABX19885.1"
FT                   /translation="MRLWASVVLALCLSGNANAQALCNGSFPNLITDVCYDCIFPISIM
FT                   GGFINMGVSGDDYDTGASHFPVCVCANNLAVGTPVSFWEPRYMVDTTTKPGCMPLLGGI
FT                   DIKTPYNAAEYGAENVTNAAISGKRKAAFMQVNEYVNPIMSALGVVVNNPCLDNRSFDV
FT                   PFLSWADPTWNDDALSLMLTPYAYPFAGIPSIAAELPDAISATFGFPMEILFWVAGAWG
FT                   PMYPLNGNVAIANTPEQVSHLMIARLFAKLHAAGAAQATAGNDALQSCGALGVPQLVMD
FT                   KRQYKTNRVFPFPDNKCTPIGRPLAFQEIGAARPQDKDYGYIIFQRKDCCATKTIQ"
FT   sig_peptide     complement(95900..95959)
FT                   /locus_tag="Bmul_6232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(95968..96636)
FT                   /locus_tag="Bmul_6233"
FT   CDS_pept        complement(95968..96636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6233"
FT                   /product="sex pilus assembly and synthesis protein"
FT                   /note="KEGG: bvi:Bcep1808_6621 sex pilus assembly and
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19886"
FT                   /protein_id="ABX19886.1"
FT                   /translation="MNRIPKLLIGLAASLQLSISYAEDLGTKAQTYPLDRDAAEQIKDI
FT                   FRRKQQSGELDAFWKNYRDRTIESIKNPPSLGIATSYGVRTELRELRFQIPQDYRDHTG
FT                   KVIVRRGTVVEPLKVMPLTNGLLFIDGTDARQVEYAIRRSQSERLKIVLTAGSPYALRV
FT                   KYAKVPWHGGTGVPFYFDQRRMIISTLSKLYNIQINSVPAAIFQQGDRLAVQFGMEGAN
FT                   "
FT   sig_peptide     complement(96568..96636)
FT                   /locus_tag="Bmul_6233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(96636..97091)
FT                   /locus_tag="Bmul_6234"
FT   CDS_pept        complement(96636..97091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6234"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   eba:ebA6594 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19887"
FT                   /protein_id="ABX19887.1"
FT                   /translation="MNACFENAARKRHISVDLLRAIGHVESRFRPWVTNAQSGAIGVMQ
FT                   IMPVHLKWLRKYGIEREDLYDGCTNINVGAFVLADMIRMFGPTWRAVGAYGAGIAANKE
FT                   QARKEYATLVQASLEQLKRSGSPALPPVRAQLITTPAAPSRPKMVVD"
FT   gene            complement(97407..98177)
FT                   /locus_tag="Bmul_6235"
FT   CDS_pept        complement(97407..98177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6235"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /note="KEGG: mpt:Mpe_A0592 putative thiol:disulfide
FT                   interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19888"
FT                   /protein_id="ABX19888.1"
FT                   /translation="MHRLAKLAISMICASIATLAHAGFPEELTKRFPAAQGAKIERAFP
FT                   GFWSVAKGSDVFFVRDDLSILISGEVVDLNQHRSLTQSVRDANPPRIDVAQLNLKDAIK
FT                   FGNGSRRLFIFSDPDCPYCRKLEGTLTKLQDVTIFIFPFPLAGHENAAEIAEGIWCQKD
FT                   RAAAWRAYQDLTLTTREPELLSAWQDYLRQHNQPARPTCANPIARNLEFGRQWNIAGTP
FT                   ALVFEDGTLIPGLVPAARIEAQLAKSHSNLAASK"
FT   sig_peptide     complement(98109..98177)
FT                   /locus_tag="Bmul_6235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(98188..98445)
FT                   /locus_tag="Bmul_6236"
FT   CDS_pept        complement(98188..98445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19889"
FT                   /protein_id="ABX19889.1"
FT                   /translation="MKAIVEQDLKEAAIAGTIKDFIIEEVEGGFILLTIFARSNVEHVL
FT                   YTQRKRARTWVNVNSLLEFIVQYKPELPEVRVRLIRRSNN"
FT   gene            complement(98592..98924)
FT                   /locus_tag="Bmul_6237"
FT   CDS_pept        complement(98592..98924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19890"
FT                   /protein_id="ABX19890.1"
FT                   /translation="MRIDHCKSVLSRYRTPSLLGVVAALQILDWHSTLTAPHTRGETNR
FT                   LINWLVQWVSFESAVSTFKLLCLAMLLYGFLFWRKHKGLYETEFALALGVVAVVYGGVV
FT                   FNNYVA"
FT   gene            99240..99491
FT                   /locus_tag="Bmul_6238"
FT   CDS_pept        99240..99491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19891"
FT                   /protein_id="ABX19891.1"
FT                   /translation="MQDNAIEAVKKDPGKFFDAYKADARSFEGRYVAADLFKETFPDFS
FT                   ASREARNRYNNPVHNSAAVLSSALFVTGRRYGANAGSA"
FT   gene            99647..101179
FT                   /locus_tag="Bmul_6239"
FT   CDS_pept        99647..101179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6239"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19892"
FT                   /protein_id="ABX19892.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   gene            101184..101552
FT                   /locus_tag="Bmul_6240"
FT   CDS_pept        101184..101552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6240"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: bvi:Bcep1808_4315 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19893"
FT                   /protein_id="ABX19893.1"
FT                   /translation="MNPSPELNSILKQLRLSGILDSLEQRNRQAIDGQLAYTEFLAMLL
FT                   HDEVARREHKKLGTRLLRAGFAMGKTLETFDFDRLPTLNRSHVHDLATGRYLDEKVAIL
FT                   IAGPTGTGKSQVSIAVRG"
FT   gene            101974..103335
FT                   /locus_tag="Bmul_6241"
FT   CDS_pept        101974..103335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6241"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bvi:Bcep1808_7290
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19894"
FT                   /protein_id="ABX19894.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   gene            103386..103829
FT                   /locus_tag="Bmul_6242"
FT   CDS_pept        103386..103829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6242"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   bvi:Bcep1808_4315 IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19895"
FT                   /protein_id="ABX19895.1"
FT                   /translation="MAQALGHCAARQGRDVLFISQTELLKRLNAARATGAYDRKFQQYA
FT                   RVPLLIVDDFALKPLRTPQDEDFHDLVAARYEHAATILTSNLDFGEWGAAFPDNRILGT
FT                   ATLDRLRHGAYRLVLEGDSYRTPKPMPDPPQNAVAKNGKKPQP"
FT   gene            104005..104889
FT                   /locus_tag="Bmul_6243"
FT   CDS_pept        104005..104889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19896"
FT                   /protein_id="ABX19896.1"
FT                   /translation="MVLKSGELPRDAVMVFEGQMSNFETSRAKIQQVLDAGYRAHIIVV
FT                   HARVENALDNTLQRFYEEGRGSSIATIANIVGRLPESLEQLNSVFGPNLLLDVVDVRDR
FT                   ANPVQLQGFENIEVLKSEGNYEHIQRRLQQRVEDQREFGRIDEDAYRQALGLAPRDRVG
FT                   LDRAGHDWDQGNARERAGAERSGGQTLLTAPPSRSHITHVPPGLRITESTSLGPDVVVQ
FT                   GKVIDVSDKQVLVQTSRTDAVRFSKDELSGNVYQGQNVQLNFQPNELARTTERAKEIKQ
FT                   PGVNEKARGIADT"
FT   gene            104939..106168
FT                   /locus_tag="Bmul_6244"
FT   CDS_pept        104939..106168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6244"
FT                   /product="protein of unknown function DUF1173"
FT                   /note="PFAM: protein of unknown function DUF1173; KEGG:
FT                   ajs:Ajs_4238 protein of unknown function DUF1173"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19897"
FT                   /protein_id="ABX19897.1"
FT                   /translation="MVRFEIDGKTYSEDDPGLQGALARIHGSAIRPLCLCVDPKPGIPM
FT                   YVSKVHGQYLIKRMPDSGPLHSAEKNCPSYEAPAQLSGLGEVMGHAIKEDVDDGTTSLR
FT                   LDFALNKIAGRAPPTPTDSEQDSVKGETSKLTIRSLLHYLWDEARLTHWHPGMEGRRSW
FT                   ATVHKYLLRAAQGKFTKGMHLPSTLYVPEPFYVDRKHEIEQRRRALLAAAHKPGRGGQR
FT                   LFIAIGEIKAVTAARYGHKIELKHAPGFFFMMSADLNKRLKVFEAEKSLWNAYPDIHLV
FT                   MIATFSVDVAGVAELEEMALMTVNEQWIPFSTVEEKSFLETLVSDRRRFVKGLRYNLPS
FT                   TRPLASVVLNDTEGKHTAVYMVPGNASEAYKVALAELLADERMNHLQWESGNAMPVLPP
FT                   PSVRTVSEAA"
FT   gene            106497..106766
FT                   /locus_tag="Bmul_6245"
FT   CDS_pept        106497..106766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19898"
FT                   /protein_id="ABX19898.1"
FT                   /translation="MVAFENVRWWNAAPAALAPLLSLPIAAASALWRTRTLATLEASDI
FT                   AIWFGLAQLLVGAWPSPTDLRLAGRSWPLLAIVGISASAYFALH"
FT   sig_peptide     106497..106580
FT                   /locus_tag="Bmul_6245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.438 at
FT                   residue 28"
FT   gene            complement(106949..108130)
FT                   /locus_tag="Bmul_6246"
FT   CDS_pept        complement(106949..108130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_0841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19899"
FT                   /protein_id="ABX19899.1"
FT                   /translation="MKRNETTPCSTTSIKRLTLAIVAASMLSTLAACGGGGGDSGAAAG
FT                   TPSNNSQTNAKLQVVAFGDELSDVGTYSPKILLGFGGGKYTTNPGDVWAQKVAASYGGT
FT                   LSPAYQGGFGLPLAAANGLGYAQGGARVQESIGIGHAAEGTPDADYAQATTTPVTQQLQ
FT                   NYLQAHQSFNSGQLVLINGGMNDILALAPALQSAVATDVAGGMDPAIAVQKEGGAVLAP
FT                   IAQALASTVQQIVAAGATRVVLVNVPDLGQTPYAVRSGAAAQQLLSGLSTIYNTFLAQS
FT                   VQSLGIPASKLIAVDLAGWQDGVLASYKSNGFAVGNTGTACNIDAMIGNAAKAGVANPQ
FT                   AFGSALFCSPQTYVTEGADQSYMYADLFNPSSHLHALFADQVQQQLKASGMTN"
FT   sig_peptide     complement(108026..108130)
FT                   /locus_tag="Bmul_6246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.403 at
FT                   residue 35"
FT   gene            complement(109553..110056)
FT                   /locus_tag="Bmul_6247"
FT   CDS_pept        complement(109553..110056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19900"
FT                   /protein_id="ABX19900.1"
FT                   /translation="MNAVSLDLVGACLPLALAIGYLPRLVRSLDAWTWMLLVGSLGISA
FT                   TFSFCDSKAVHVVPGIYLLCFVTWLRRGRGQCRRVPAAGIFSATMITIFPGDLYGALTC
FT                   HAIGIARIGGGGHLDALLLTPLLLSTMHAAVYYFCELDEHRRVPVGSFLRRQFSLFEYS
FT                   VRSR"
FT   gene            complement(110129..110467)
FT                   /locus_tag="Bmul_6248"
FT   CDS_pept        complement(110129..110467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_02566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19901"
FT                   /protein_id="ABX19901.1"
FT                   /translation="MAALEIIESLAKGIDPRTGEILSEHGPFNDPSVIRALFEAANALR
FT                   TAGATSERNVVGKPKPTNAGRAWPLEEDVRLLADFDAGVTPQELARKHGRSTGAIKSRL
FT                   VKHGRIER"
FT   gene            complement(110943..112163)
FT                   /locus_tag="Bmul_6249"
FT   CDS_pept        complement(110943..112163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19902"
FT                   /protein_id="ABX19902.1"
FT                   /translation="MKNISPESGQALPRRLPYPSSRLFGLLLAVLSTGTSLWISVVAGE
FT                   ERGGSSIERGVWAAIGLVLLVAAHLIPAVTRGTAARIRLPALLLWAVCMVITGYGHATF
FT                   FLAAQRHAGDVRATTVHRSSQLAEIRQPDGRSLAAIARDQAHVRQQLAVARYMRCLNRC
FT                   EQQTIRRETLAAQLAALDVEAGEARRREEAADHIRSTIERQQAREEQARIDPVTAQAAQ
FT                   LVNASRETIDLMVALVHGAVLECVACLGWLLALHPGRRYAESHLQTLAALNAGVTGRSN
FT                   VGGTDSLFPQQKLHTTAEQGKATVTPRRSIGAAGNVSPREALSRQIVDSDFFRLSHAIA
FT                   EGRLRPTVKDIRGFLRCSQDKAMRMRRRLLAVIEGGPSIPPSAAARVRAEQRPRLVHSS
FT                   PDQPWAA"
FT   sig_peptide     complement(112032..112163)
FT                   /locus_tag="Bmul_6249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.471 at
FT                   residue 44"
FT   gene            complement(112628..113485)
FT                   /locus_tag="Bmul_6250"
FT   CDS_pept        complement(112628..113485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6250"
FT                   /product="TrfA family protein"
FT                   /note="PFAM: TrfA family protein; KEGG: bch:Bcen2424_6873
FT                   TrfA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19903"
FT                   /protein_id="ABX19903.1"
FT                   /translation="MANSIVDHVKAIAARASSAGAETQSHPTQIPLWPPNVRGMPNALA
FT                   RSALFNVNKSNAPRSRMEKALIASVDGVEITFSGEELRQDDADVFLEVLHLARDTQLNE
FT                   KVEFTGYSVLKSLGWGTSVKCYDRLVTTLERLQAGQVKVRFSGNKKGFVGSLIRKFLWK
FT                   EGTETGTDGKTRWVAYVEPEIVALFSDDDYTRLAREQRQRLRYELSKWLHTYYHTHAVP
FT                   YAHSVRFLHRQCGSQTKELFHFRANLKKALDELVKEGFLVSWTIDKNDLVHVVRASARG
FT                   AIAA"
FT   gene            complement(114230..115195)
FT                   /locus_tag="Bmul_6251"
FT   CDS_pept        complement(114230..115195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6251"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bch:Bcen2424_6874 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19904"
FT                   /protein_id="ABX19904.1"
FT                   /translation="MATFRKKAVDIERVAAVEDAASSAPIVGDPRLAPTMPSVSQRESG
FT                   AVGSSQDPRKYEVGHVYEIPIGKIRSNSVNPRAIYTASAVSEMAESLLARGQGQAAIGY
FT                   VNDDAEIVLIDGERRLRGARTAGLSTLRIEIRPKPGSERELYEEARAANVERKDQSPLD
FT                   DAIKWKELIARKIYPTQAALAKALNLGEDHVSRTLSLAQLPNKLVQAAAEHPELLSLKM
FT                   LNAIREFWEVKGDDETLELISEAAKNGLGYRDVAARRKAAAKGPVRRPRSTREQLSFRG
FT                   AKGEFKSFEEDGRIELKLKGLAPDVAAEISEKILALFPKE"
FT   gene            complement(115195..115866)
FT                   /locus_tag="Bmul_6252"
FT   CDS_pept        complement(115195..115866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6252"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: bch:Bcen2424_6875 ATPases involved in
FT                   chromosome partitioning-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19905"
FT                   /protein_id="ABX19905.1"
FT                   /translation="MVITIGAEKGGVAKTRLATHIAALAASEGVDVVLLDTDKQGSAMS
FT                   WSRIRNEEGVTPSIPVLALPANPARELANLANKYTLVVVDIGAQNYRTMLECALLSDLV
FT                   LVPCGPDQQEVESTLNVFATLKDMGPRHESGEIPAYVVLTRVSPIEGSKATAELRSYFK
FT                   SEDIRLFDSQIPQREAWRATGKTGRAVHELKGRDRSKKAIEEMEAVYREIIKRINGGEE
FT                   E"
FT   gene            116360..117391
FT                   /locus_tag="Bmul_6253"
FT   CDS_pept        116360..117391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6253"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, ligase domain protein;
FT                   PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: bch:Bcen2424_6876 ATP dependent
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19906"
FT                   /protein_id="ABX19906.1"
FT                   /translation="MQRRTTAQKTRAGVVVAKNARMSEFIAPALAVLMSEPPPAGDWAY
FT                   EIKFDGYRMLVRVDDGDVRLYTRNGHDWTSKLPHLTAVLKRLPVQRAWLDAEAVCFAPD
FT                   GRPNFSRLQEAFNSRRTTGICLVVFDLMWIDDTDLRRRPWHERRSALTGIIGEVLREEV
FT                   RFSEAIEADASAMLASACELGLEGIIGKQIDAPYRSGRSDRWIKLKCVRRQEFVIGGFS
FT                   RRKGATAGVRALLLGVYEEGGRLRYVGHVAPSFTPRQAREFESRLSALGRKRSPFASAP
FT                   DPEVDREFHWLKPDLVAEVAFLEWTPAGRLRHPSFCGLRADKPARTVSRENPASPKGAG
FT                   SRR"
FT   gene            117493..117735
FT                   /locus_tag="Bmul_6254"
FT   CDS_pept        117493..117735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6254"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG:
FT                   bch:Bcen2424_6877 SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19907"
FT                   /protein_id="ABX19907.1"
FT                   /translation="MPTHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIE
FT                   PVEAPSLRELFAQWAPLDETFPDIENLPAEPVDIE"
FT   gene            117732..118139
FT                   /locus_tag="Bmul_6255"
FT   CDS_pept        117732..118139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6255"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   bch:Bcen2424_6878 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19908"
FT                   /protein_id="ABX19908.1"
FT                   /translation="MSLYLLDTNILSNVIRDPRGACASRIGETRPEQVCTSIVVAAELR
FT                   YGVCKRGSSALAQRVEQLLASLTVLPLQSDADQCYGRLRADLERQGQLIGANDMLIAAH
FT                   AMAVDAVLVTDNTAEFTRVTGLAVENWLRPA"
FT   gene            118483..118803
FT                   /locus_tag="Bmul_6256"
FT   CDS_pept        118483..118803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19909"
FT                   /protein_id="ABX19909.1"
FT                   /translation="MTSFAASNHQDICRCVGGPLHRDGLSPYGGSAGLLFRLTHDFAGE
FT                   PARQALYEGRPLTRQTDAGPETRDFLVLTSVTDQDGKQVDAGLSDDQALALTLDAPALF
FT                   WK"
FT   gene            118835..119443
FT                   /locus_tag="Bmul_6257"
FT   CDS_pept        118835..119443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19910"
FT                   /protein_id="ABX19910.1"
FT                   /translation="MTQIPSSFAAMANYSTVDVGGYSWMLLHRSDGSVELSPSGEPRLP
FT                   DVTLVERPGANERAPTFLATVRATGLYELAARKDGFATAEDALAWATAFEFAKRRSGSV
FT                   TWYALAADASHWHAVIGTTVAEIVGYELGGRATYAVKRRMKLGKQAVEFAITDLSYGDE
FT                   PKSIVSFEQASAIALTMPDYVMELMRVAADVAPPSGLGE"
FT   gene            119591..120511
FT                   /locus_tag="Bmul_6258"
FT   CDS_pept        119591..120511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19911"
FT                   /protein_id="ABX19911.1"
FT                   /translation="MSESRQRGTYAQRVEQAKARKQAELDRHRAAALVGVAAPEFFEPR
FT                   FADGRPADPATVVVSMFRRTEDGQAMEIVGTGFFVAPGVLITAAHVAQVAFESDPHGYP
FT                   RLWCVHVLDGGQYQRRPVVHAVTHAVTDIALCVLAPSVHRVTGAPLPNPILRLSARDPV
FT                   IGEHVFTFALPDAVFEAQQGGRNARLDLHSHYYDGHIVEHYPVMRDRVLLPFPSFETSM
FT                   HLHGGASGGPVFDDSGAVVGINVSSQEPDTDCSYIAKVRDAFDLSLPCEVDGGQVVQLT
FT                   LRELAARGFSCLQADSPAAPAGGVA"
FT   gene            120623..120808
FT                   /locus_tag="Bmul_6259"
FT   CDS_pept        120623..120808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19912"
FT                   /protein_id="ABX19912.1"
FT                   /translation="MRRYRGTLPADVVQALLDVAHELEATEDAFAVVVDQKDALQRRLA
FT                   LAESNLRAALALRANP"
FT   gene            120819..121127
FT                   /locus_tag="Bmul_6260"
FT   CDS_pept        120819..121127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19913"
FT                   /protein_id="ABX19913.1"
FT                   /translation="MALTTTYVRARFLAFAQQRWIADQHAAQDTNKFSALFAGHPAHLQ
FT                   FETDGAWRLSYLGFRSERIFHPADAQCAAPAFMRDVLARMAALIEGAPRRSATGGHA"
FT   gene            121124..121855
FT                   /locus_tag="Bmul_6261"
FT   CDS_pept        121124..121855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19914"
FT                   /protein_id="ABX19914.1"
FT                   /translation="MSELRASRRCWSIEHWPEPLRILYHALLGGLLIVIASTFEAAGDA
FT                   WRKAAQHGDTAARAARAWVRAAVGHHDALSALEHAATGAGCALIGFGILQVGYAVLVSG
FT                   RDRPVEPFAEPFVAWQWAIFALGAAALSYGVGSVMYPGTRVLMGVITAAYVLVPLIYRQ
FT                   QVAQAALAVPQWFTAVAGSGFWLFLDVMWKIYHAPRVHEAPALVAVHLGLGLAGLMGVS
FT                   WGLGWIARRTAWLHPTPTGGQ"
FT   gene            121857..124169
FT                   /locus_tag="Bmul_6262"
FT   CDS_pept        121857..124169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6262"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bvi:Bcep1808_7050 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19915"
FT                   /protein_id="ABX19915.1"
FT                   /translation="MRASPARATLRLTPGHFALYRAYLEGLDEATLHAHYGVPGTDVRV
FT                   TRRTIATLRDTLTIAARRARDVDAAHLLRLKPGSLPRDAHAGAAAGREVPTLEEFRAEV
FT                   DPDAFYSERELVALYIETYPPASSPALDSKTARNRRLRDRQDAALARMEASLVEAPRPD
FT                   HTLDGWFDSRVVARLAAAGITTFAELLALMRTRRQRWYRAIPRLGAIGAQRITDFIAQH
FT                   PDTLGYLSPLAVTPRRHFAPGHPALQPLPGAAADVAPLEALRVPAALDGSAGLNRAPVP
FT                   AHQAELNTDLQAVHAWIATRGARSEATRRAYRREAERLLLWAIVAKGKPLSSLNTMDCA
FT                   EYLDVFLRDPQPAARWIGRSRVERFDPAWRPFVGPLSERSRDTARRILNAMGEWLVAQQ
FT                   YLRVNPFAGLPAAPSVPIDATGRSLTRAQWQYVLQTVLRPTSAFDGGDSQLANRSANQA
FT                   ANARDAFLLLFAYVTGLRRAEIAAATTGALTRTALDGALDDAWSLKVMGKGRRARTVPM
FT                   PRRLIDALRAQLRARPIPLTLETAPADTPLIANLVTGEALHPDVVGRLYKGIFARAADQ
FT                   LAATYPNAAADLRRASTHWLRHTFANHGLDAGADIRDMQELLGHASLGTTTLYTKADAV
FT                   RQFQSVEALFNAALDRADPPAAMGVPVASPPARADTGAAAQLVAVHVKLRVEPKRPGGR
FT                   GRARVLERVEREVLAGFGRTPIRDGVTVLQVPFDNQDAFDRRVDDLLVQIAMTAEQHRC
FT                   ASESEAWAEVAGERWTW"
FT   gene            124820..125713
FT                   /locus_tag="Bmul_6263"
FT   CDS_pept        124820..125713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_2974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19916"
FT                   /protein_id="ABX19916.1"
FT                   /translation="MFPNELWLRKAIEIVQKNPSPDRIPVTGDERLKQRNYFYAGLDGI
FT                   EGEGDVLIVGLSRSGVLGRPWHDGRYQPDAVDIPMARAVQAKPTFVYYLRRFEFIERDP
FT                   FRFWLKVRTRHYSRVARRKERREGRFNRRQLERKERMDVLQAIVRLSMDQDGRTIDAVM
FT                   IATLLYQRGWIRHPAADEVLQRIRALVRVLVAEGLVEVVQQNTAYRMLPNAVRVLDQYL
FT                   TEERRHADSQALQRKVMILGGVAAVASAVQAVVNVKQEWFDKPTGETPAFHATNENATA
FT                   TARPASVAIAPTRGAQ"
FT   gene            complement(126657..127223)
FT                   /locus_tag="Bmul_6264"
FT   CDS_pept        complement(126657..127223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6264"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bte:BTH_II1559 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19917"
FT                   /protein_id="ABX19917.1"
FT                   /translation="MPRSIPITSERYRRLRVQLATMRIRAGLTQTELAKRLHIDQSNLS
FT                   KIERGERYVDFLTYVDWCRACGVSPATSMRKFLEQDDSPRRPADTSIPKSARSQPTKHG
FT                   PRRDQQHSPHRVPPVKVVSSISQQEFLRFAKATLGMTWDQLAAAAEINARALKTYRMPD
FT                   TSKDFRPLPMLARAAIEKLLDGHSA"
FT   gene            128172..129014
FT                   /locus_tag="Bmul_6265"
FT   CDS_pept        128172..129014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6265"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   ajs:Ajs_4224 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19918"
FT                   /protein_id="ABX19918.1"
FT                   /translation="MVAMKKISIVNGKGGTGKTTIVRHLVYTAIERGIRVLVVDLDPQG
FT                   NLTRSMLYRKLTAKSGPSVMGAALTWEHLGLPDVTENSSAHLLYQGKRDVNPMRIVDGA
FT                   AMIGATPELEDVMTWPLESAAKARESLDALADQFDLCVIDTAPTMSNLVLGGMICADYV
FT                   VIPTDLGIDSMSGLLSTSEKLELVKREWNPDLELVGVLLNKVNLRRADDQSMRTTVRNA
FT                   FDDAVLEHELRDRAGVRLTSFHPVWARRRGESDRLAAKEMHAVCDSILERIGLSVSNA"
FT   gene            129029..130387
FT                   /locus_tag="Bmul_6266"
FT   CDS_pept        129029..130387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6266"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   ajs:Ajs_4223 ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19919"
FT                   /protein_id="ABX19919.1"
FT                   /translation="MQQATSGKFASISALTRAASAASRVAEIEQATGAVTRFIAVNKVR
FT                   IKPQVRDDFADVQAFAERLRAIGHVHTPILVRAISDSDEYELIAGERRIRGSLLNDWPE
FT                   IQAKIFPAGTSDLAIRMYQVSENIDRKQLSVRETAIGLATDVELYGREQAASIWAAPSG
FT                   KERSASWVSKHLRFLRYGPTTRALFDEDMFDDVEAANKMADIEACSAATAHEIATDMRA
FT                   GKKFGRLTLDARLNLLKQVAAPSVKDAVGEAAAMARSSAPAEAPGSTASQSIDDGQQPS
FT                   PGPVFEGQAAHGAEHDADVPNMADARLAPSPAASPEGLRQVPKAKRLHAAAADPSETSV
FT                   WRVEEIYEIGTGSVERVRRLHADLSAAGVRAEDIEWRLWVCFVDLAASALAGMPTETAG
FT                   KIINRFNDEINSSGPLELLNRLHPCRRPGVLPDDFGYDTDREIHPLAPNDWSL"
FT   sig_peptide     129029..129094
FT                   /locus_tag="Bmul_6266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.463 at
FT                   residue 22"
FT   gene            130501..130860
FT                   /locus_tag="Bmul_6267"
FT   CDS_pept        130501..130860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19920"
FT                   /protein_id="ABX19920.1"
FT                   /translation="MRKHAREFGTRPFDEATRDIARAVIVDGRPAADVASEFGVSRQRV
FT                   SQLVKRYYESLTNSELRSAEVIVWLKQEFEVPSPLVEPLARFLAKAQRSKDTNKVQSAV
FT                   SALIKHLGTQTSKLE"
FT   gene            130883..132007
FT                   /locus_tag="Bmul_6268"
FT   CDS_pept        130883..132007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19921"
FT                   /protein_id="ABX19921.1"
FT                   /translation="MSTVNSENSYSLRGAGAAQLPMGARPPLARSQGAEQSENSADGDD
FT                   VVRLDEGEFDPEQLELFFGEQLDLSWKPREDLHSLEFPLFSLQKGKDTRVRVYRNGEQI
FT                   VRIIPSGVGAANIFDKDLLVYAATLICKAADSDIPVSRRIRFKVRDFLKYTRRSTGGAS
FT                   YERIVDSCRRLKGTIIETNFDTTRPGANEAGIHETLRGYGLIQEYSVITYTANRKGALE
FT                   VELVLSSWTYDLLLSRRILTLHPGYFDLGQGLERRLYDLAKKHCGDKLWFKIGLEKLYG
FT                   KSGSAQALKYFRRDLIAAMKADKLPEFHIALDDDKAMVVFFRCDRDNRRQDEQLTASIH
FT                   RELLAKKLSKWYYALRRWDSDARDVGQLELIAGT"
FT   gene            complement(132436..135585)
FT                   /locus_tag="Bmul_6269"
FT   CDS_pept        complement(132436..135585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6269"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bch:Bcen2424_6871 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19922"
FT                   /protein_id="ABX19922.1"
FT                   /translation="MSAASYGALPAYAELQVASDFSFLHGASRAEEYVARAAQLGYSAI
FT                   AITDECSLAGVVRAHVEAKAAGLPLIIGSHFRLTAADGAPAIAFSALAMNRDGYGNLCE
FT                   LVSLGRMRGKKGSYRLAPRDLEQPDAPFTHLRGLPDCIAILSPDFPANEQRLDAQVEWF
FT                   ARVFGDRAWVALTLHARAMDDIHRGVVERVAARHGVPVVATSWPLMHVRSRKPLQDVLT
FT                   SIRLGRPVSECGYELAPNAERHLRSRLRLANLYPAGALEETVRVARRCTFSLDDLKYEY
FT                   PDEVVPAGYDVATYLREQTYIGAQRRFPAGIPVDVQAQIEHELQLIAELNYEAYFLTVY
FT                   DIVQFARQNGILCQGRGSAANSAVCYCLGMTEVDPSRQSMLFERFMSKERNEPPDIDVD
FT                   FEHQRREEVMQYIYRKYGRDRAALTAAVSTYRPRSALREAGKALGVDPAIVDRVAKSHH
FT                   WFDSRADLLQRFAEAGLDPEAPLNQQWAAFAAQLLGYPRHLSQHSGGFVISRGKLTRLV
FT                   PVENAAMEDRTIIQWDKDDIEALGILKIDVLALGMLSMVRRALDMISEKRGETFELQDI
FT                   PAEDKATYDMLCDGDSMGVFQVESRAQMSMLPRLRPQCFYDLVIEVAIVRPGPVQGGMV
FT                   HPYLRRRQGLEPVTFPSDGMEKALKRTLGVPIFQEQVMQVAMLAAGFSAGEADQLRRAM
FT                   AAWKRKGGLEPYHDRLVSGMLERGYDREFAEAIFAQIKGFGEYGFPESHAASFALLVYS
FT                   SAWLRRHEPAVFLASLLNSQPMGFYTPSQLLQDARRRGVEVLPVDVNVSTWDSVIEGPT
FT                   TSAPVRLGFSLLRGMRADVAGRIELARAVRPFVDVADLARRAQLDRHDLQVLARANALR
FT                   SLAGGNRRAALWLAAAAIPDRDLLRGTERDDAVPALPQASEGKEIVTDYRAMGFTLGRH
FT                   PLALLRDRLTLDRLQSAEQLATLRSGQLARACGLVTVRQRPGTANGVLFMTLEDETGQV
FT                   NVILWPGLLEKFRKEALGAALLAVYGVWQAEGKVRHLIASKLVDRSELLGSLPTTAREF
FT                   C"
FT   gene            complement(135592..137070)
FT                   /locus_tag="Bmul_6270"
FT   CDS_pept        complement(135592..137070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19923"
FT                   /protein_id="ABX19923.1"
FT                   /translation="MQVWIGVHLPHLNLETFRPRSPAPSPDDARGLVVLESGRVVALDR
FT                   AARALGIVVGMRRAGVLSLAPDAQIRERDVVRERELVLGVAYALLQFTPNVVDADEAVV
FT                   LLDVTASLRLFHGIRALRRRVRDVVASFGVSAAISVASTGPAAWMVARGLRGGLALSAR
FT                   SLRRALARVPLVVAPDARRYATWFDELGCETLADLQRLPRAGLKKRCGTQLLDWLDQVA
FT                   GTAPAAYDWLDMPPSFDTRVELMDRVEHAEALLFVARRLILQLTGWLTAKQLDVAAFAL
FT                   LLEHERGRDAIAPTEIEISLGAPTRFEEHLTRLVKERLGHVELAGPVIAVRLVARRVQE
FT                   AAAPSDSLFPEPGGTPQDHARLLELLTARLGAENVLVPAPIADYRPEPAARWVPMRDAP
FT                   KAAPLPADLPRPAWLLAKPVPLLTRQHRPFYGTPLRMVSPGERIEGGWQDGQTVTRDYF
FT                   VAEDDNGICYWIFKERPTASDESDSRYFLHGLFG"
FT   gene            complement(136991..137707)
FT                   /locus_tag="Bmul_6271"
FT   CDS_pept        complement(136991..137707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19924"
FT                   /protein_id="ABX19924.1"
FT                   /translation="MQAALAHPETIHPALWRASQLARSSSRGVDTGHAELTAELPGGGW
FT                   PAGALVDLLTQQAGIGELRLLAPVLARSSGRPIMLIQPLHGLQPLALSYWGVDSSSFVL
FT                   LPAPRTADALWAAEQVLRAGTCAAVLLWQSNVRADALRRLNLAAQTGSALFFLFRPAAA
FT                   ARDASPAPLRLALAPKRDGIEITFVKRRGPARDTPLFVPLSPSPILLNRHASLDRRASA
FT                   APQPRNVPATLAGAIA"
FT   gene            138114..139349
FT                   /locus_tag="Bmul_6272"
FT   CDS_pept        138114..139349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6272"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: psp:PSPPH_1149
FT                   site-specific recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19925"
FT                   /protein_id="ABX19925.1"
FT                   /translation="MARAIQASSEDVARGQRVRYVRATDEFVFAGRPRPGFPLILDDSM
FT                   EPAQPFHDYLLYRLLESGKALDQKTWEAYGRRLWDFARFLQANEWCWDDPFMSVGQSVV
FT                   SVYRDWQAQDLKLDPATINARLELVTAMYRWAHERGRIDRLPFTCSDVAVYGIEHDLTH
FT                   ITGGRKRSSRPAVLLNEWNKEPAFLTADQLKIVRQSIRSAAQRLLFDLMARVGLRSVEA
FT                   RTFPLSYVVDPRTQKAWKPGTFIDVRLDPRDMEIKFNKSRVVHVPYSLMEDMYAYTTFE
FT                   RNGLADAADRKELILTIHGQRYSKESAVKVYTDLSNTVGFRVRPLMLRHSYAIHTLLLL
FT                   RSRPEIPMEPLMYVRDRLGHASVQTTMVYLQQIERLLGAEALAMMDEFDRLYGVGKALA
FT                   TAPHASTVDPRH"
FT   gene            139358..141259
FT                   /locus_tag="Bmul_6273"
FT   CDS_pept        139358..141259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19926"
FT                   /protein_id="ABX19926.1"
FT                   /translation="MVRKKNYNVSENRAAPVGVISASLERPKPGADDACIDMVALLGLE
FT                   ARFPQRIKTLDLRDWLGRGIDDWVCSSGFCLKAMLLSGARATASVTTYFGQLPYLFEYL
FT                   AGSSQTPLPQRPKLPSDLSPMHVQHFIGWLQKRAQAEGWRPSSTRNTYRGVKAVLAEMF
FT                   AQGFIEGEPSRFFRRGALPWSSEDSLQTSLSDAEQERLAKAIKSDLVDVHHGRLQLKQS
FT                   AVQGLRLLLVAHRQGLNPTPLLEMCRDALAPGFLPGTILIRTAKHRSKKIRSNVGRSAL
FT                   GRHASNQPNEQADEQNLCFDLSEGAVLQQAIASTRELVGEAPSAFKTRIWLYRAEASAG
FT                   STKRGNITCLDSKSLNRAIEGVIERRSLLGDGGLPLRVNLSRLRKSRFDRALRTADGDI
FT                   AITANLMGNTPRVAGVNYPSMNEARKADAASFMNGDYTVLMRAEAQAPRGNEIRPVQVE
FT                   PFKVGKGSISAPPSPTPVSACSDSISGEHAPNDGRSHCDRYVMCLFCSSFAIVGTVDEL
FT                   WRLFSFQMFAQAELDYLDEALGPERTTDGLLEDLRDRYRVVIPYIDDFTQRQFARSRVA
FT                   QARAKTVSGLHPYWQHQMTMSRRARHRASAPDLRVDGSHGDTAIPRIRGTQQAGPRA"
FT   gene            141256..143208
FT                   /locus_tag="Bmul_6274"
FT   CDS_pept        141256..143208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6274"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="KEGG: pap:PSPA7_0097 site-specific recombinase,
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19927"
FT                   /protein_id="ABX19927.1"
FT                   /translation="MRSTSASILDTPQTLSGARAVPATSLPAPRALRAFELLAAQPISL
FT                   VGIPPAERDAIVVTAVADAAGHEHPVSRFGDRVWDLAPEIEAKNRKGSALKIVWPDDVP
FT                   KALIDDAKAALYCAQRRGPHGRKWSGSSIADIGRSGVLALRYLAQLGLADFSQVRALHL
FT                   SDHIADLRRTLKPVSVRGRLQIVDLVWTFHTEVLHPLLEHPWAGLALWDACGGNEDNRM
FT                   PSGRTGTTPVIPRSVQRILFAYCEASLAQADELFQARDAGGLGAPKRPAMTSIRNAVLY
FT                   LLQISSGMRNSESTGVTSGCWRTEQRNGVTYHWVRTREVKTTGGTEVDFLVPPEAIRAL
FT                   EILQRYAQPLQARLVGEARWLEDLMAQGPDLTGHLCNGMKMAEAAHRLNHVREIGRHLV
FT                   LGLNVKASDHLGTGSRVEVLSSASCGYQLKQLAAAAGTEWNLANHQCRRTFAYNVANSR
FT                   LGRMGLVFLKWQLKHASMSWTQLYAASPHQDHALYREFEEEMADARLGLLESWAHSDAL
FT                   LSGGAGKKIMQTRTRAARDLKQLLRQTAESIELRSTGHAWCISGTRGCHGQGVYDPSMC
FT                   AGCSQAIIDQGQASAWQMIHLDNLRLAAITDCGPAVADKARRVVERSTQVLRDLGCALP
FT                   TDDRARAYTAALEGA"
FT   gene            143205..143642
FT                   /locus_tag="Bmul_6275"
FT   CDS_pept        143205..143642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19928"
FT                   /protein_id="ABX19928.1"
FT                   /translation="MSSRAGTSPDDTRPGSAPRRRSRGKTREALQLAILRVKTRGLKLS
FT                   ISSVAAEAGVSAGLIHNTYPDIAEEIRTQVGRGIRQQRDATVAEVKKVREQLKTVRAER
FT                   DAALADVATLASINETLRQEIATLQAVASGKIHVLPPVRDV"
FT   gene            complement(143709..144017)
FT                   /locus_tag="Bmul_6276"
FT   CDS_pept        complement(143709..144017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6276"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bvi:Bcep1808_7182 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19929"
FT                   /protein_id="ABX19929.1"
FT                   /translation="MELKCVVAVLRPEVLTALEQRLGALHIHGMTVTKAKGFGAHPNFF
FT                   GNDWTTEHIRIEVFTVAESVDALVEEITTVANEQSGGDGVVAVVPVERFLRVRSATP"
FT   gene            complement(144054..144611)
FT                   /locus_tag="Bmul_6277"
FT   CDS_pept        complement(144054..144611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19930"
FT                   /protein_id="ABX19930.1"
FT                   /translation="MKRYKRHQSGSAANERSGRVVKVKLNLLSLLALILAVSTALVWGP
FT                   SLVHWAFGPKSAAVTLENTVQQVPGWRVGMLRPDGLRIISSGVSDASHVLNPVQFPDIA
FT                   VRHAYWVATQIPATLNKLYCWCGCENRGEHRSNLQCFEDKMAVSCPVCQGTAEIAYQMT
FT                   QAGVRDAAKIQAAVDAKWAPKG"
FT   sig_peptide     complement(144483..144611)
FT                   /locus_tag="Bmul_6277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.694 at
FT                   residue 43"
FT   gene            complement(145153..145440)
FT                   /locus_tag="Bmul_6278"
FT   CDS_pept        complement(145153..145440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19931"
FT                   /protein_id="ABX19931.1"
FT                   /translation="MNASHARMAVLSTLLVAASAVSFAATGSASGTSAQDREHGHGSMM
FT                   MGGMMGGCPMMGGSAGLDSKTAMRMHAEMMRAMSDIMMKYSDQAGAAPSK"
FT   sig_peptide     complement(145366..145440)
FT                   /locus_tag="Bmul_6278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.887 at
FT                   residue 25"
FT   gene            complement(145560..145922)
FT                   /locus_tag="Bmul_6279"
FT   CDS_pept        complement(145560..145922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19932"
FT                   /protein_id="ABX19932.1"
FT                   /translation="MKFWVKLVACFLIAWLPMLGYPAQAALCPEMSSMPAVQHHMKAAS
FT                   AIEATGCTSGTKPLGTSDRPSACHAGMGSAVCGMLAIPMSHRVGIVVSTADYRAITPFL
FT                   AEQFIPELPAPPPRSL"
FT   sig_peptide     complement(145845..145922)
FT                   /locus_tag="Bmul_6279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            complement(145974..147845)
FT                   /locus_tag="Bmul_6280"
FT   CDS_pept        complement(145974..147845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6280"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: bvi:Bcep1808_7178
FT                   protein-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19933"
FT                   /protein_id="ABX19933.1"
FT                   /translation="MRTTSSNTYRYVYRTADALSRMLRFVLVLVFGLVSFAAYAVNESE
FT                   LLAPEQAFPLTVSLASHKEVVLDFKTKPGYYLYRDRFSFAVSGAPVKPVAMPPSETKND
FT                   PTFGVVQVYHQPVRILLPLSAAVTSSATLTVTSQGCADVGVCYPPQTRRFRIAADGGVT
FT                   PAALVGSAKGADFPVAEKDRQATVLGLPLRPANGIGIAEMLGFLLAGLLMAGTVCMYPL
FT                   IPIVTAVIDGTRERLPVWRGFSLSLAYVQGLAITYAAAGTVAAVIGIPLVALTQKPWLL
FT                   ATFGMLMLAFALGMFGVFRLQLPTGWQTRFAGWSKRLPGGRVGPVFVMGMLSALIVGPC
FT                   STPALAGALLYIANSRDISGGALALYLMGIGIGIPLLLVGTFGTRLLPKSGHWMVAVQN
FT                   TLGVMLLAAALWFVYSLLPAWLLMSLIALLLTACGTMLRAIDPLPADATGIARVGKALG
FT                   VLLLVAGIAEFVGVASGNFDILTPLGGLTRTSTSAGGGTSAATQFDTITSNAKLDEALK
FT                   AARGQPVMVDFYADWCITCKELERFTFTDARVMNEFTHWKLLRIDVTKNTEADTAMLRR
FT                   FGLFGPPALIFFDKTGRPQPDAQLIGFIGADTFLAHLKRLQSGDVAQ"
FT   sig_peptide     complement(147723..147845)
FT                   /locus_tag="Bmul_6280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.989 at
FT                   residue 41"
FT   gene            complement(147921..148271)
FT                   /locus_tag="Bmul_6281"
FT   CDS_pept        complement(147921..148271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6281"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bvi:Bcep1808_7177 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19934"
FT                   /protein_id="ABX19934.1"
FT                   /translation="MKKLIVVSAALAAAFVTPAFAGNDMAGMDMSTKASAMKASSNNAL
FT                   TDAEVKKVDTATGMVTLKHGALENVGMPPMTMAFKAKDAAMVKQIKEGDKVKVRVEEVN
FT                   GTLTIVKLEKRS"
FT   sig_peptide     complement(148206..148271)
FT                   /locus_tag="Bmul_6281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(148268..151474)
FT                   /locus_tag="Bmul_6282"
FT   CDS_pept        complement(148268..151474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6282"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: bvi:Bcep1808_7176
FT                   heavy metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19935"
FT                   /protein_id="ABX19935.1"
FT                   /translation="MIARLIRWSIHNRFLVLLATVLVTGWGLYSVAETPLDALPDLSDT
FT                   QVIIKASYPGKAPQVIEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDKTDQY
FT                   WARSRVLEYLNQVQSRLPQGATVSLGPDATGVGWVYEYALVDRSGRHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVADALGKANQESGGSVV
FT                   EMAESEYMVRSSGYLRSLDDFRHVVLRTNDAGTPVLLGDVARIQIGPEMRRGIAELNGQ
FT                   GEVAGGVIVMRSGKNALKTIDAVKAKLADLKRSLPPGVEVVTTYDRSQLIERAVDNLKD
FT                   KLIEEFIIVGLVCAVFLFHLRSAFVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAFDHEHPDTRMTAAQRWELIATSAAEVGPALFFSLLIIT
FT                   LSFIPVFSLEGQEGKLFSPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPHENANPI
FT                   NRVLIRLYRPLLEATLRRPWTAIGLAAVALVLTIVPISRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAQKASELLQQTDRLIKTVPEVETVFGKSGRADTATDPAPLEMFETTIQFKPRSQ
FT                   WRPGMTPEKLVDELDRTVKVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTQID
FT                   RIATQVETAVKGVPGVTSALAERLNGGRYIDVDIDRLAAARYGLSVADIQSVVSSAVGG
FT                   ENVGEVIAGRERFPINIRYPREIRDSLEKLRQLPVVTDRGAQIQLGDVAHITIADGPPM
FT                   IRSENARLSGYVYVDIRNTDLQSAVKAMQKVVAEQVQLPPGYSIAWSGQFEYLERAAAK
FT                   LRTVVPVTLVVIFVLLFLTFNSAADALLLMSTVPFALVGGFWLIWMLGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALNRRLEDGEPLTEALLFDAIREGAVLRVRPKAMTVAVV
FT                   LAGLIPIMVGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWFLLQRRRARQAPAAS
FT                   FPQAVPSGTNVPVNQTGEVQ"
FT   sig_peptide     complement(151376..151474)
FT                   /locus_tag="Bmul_6282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 33"
FT   gene            complement(151471..153000)
FT                   /locus_tag="Bmul_6283"
FT   CDS_pept        complement(151471..153000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6283"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bvi:Bcep1808_7175 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19936"
FT                   /protein_id="ABX19936.1"
FT                   /translation="MTQKPLVRAVLTVFAGAALLAAGYFAGTRHAATPAAAASTVTASS
FT                   GEKIDPKTGRKVLYWHDPMVPNQHFDKPGKSPFMNMQLEPVYADDGGGSSGIKIDPGLQ
FT                   QNLGIRYATVRRQETTGGFDAVGTTQFDESRSDVVQSRVTGYIDRLYASAPMQRIAKGA
FT                   PIASLFVPDWLAPQEEYLALKRGGMDASLLEASRARMRAMSIPDGIIASLDRTGRAQTH
FT                   VVLTSPEAGVVSELNVRDGAMVAPGQTLAKIAGLSKLWLIVEIPEALALSVQPGMTVDA
FT                   TFAGDPAQHFAGRIREILPGISTTSRTLQARLEIDNASLKLTPGMLMRVRVAGQKAVSR
FT                   LLVPSEAVITTGKRSVVIVKNGDGRLQPATVTVGNDIGSETEVLSGLNDGDTVVASGQF
FT                   LIDSEASLKSVLPRLEGGSGASATAPASAPVATAQTYETTGKVEKVTAADITFSHQPVP
FT                   ALGWGAMTMAFNKPAPSAFPDIKAGQMVHFVFKQSDEGYQLTKVEPVGGAQ"
FT   sig_peptide     complement(152905..153000)
FT                   /locus_tag="Bmul_6283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 32"
FT   gene            complement(153012..154304)
FT                   /locus_tag="Bmul_6284"
FT   CDS_pept        complement(153012..154304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6284"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bvi:Bcep1808_7174 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19937"
FT                   /protein_id="ABX19937.1"
FT                   /translation="MLFIFGTPLRRRVPWRAHALVSALFLAGVVHAQQAPMTLDAALQS
FT                   ATDRSASMQAAQASVRASSEAAVKAGQLPDPMLKAGIDNLPINGPQRFTVGQDFMTMRR
FT                   IGIEQEWVSGDKRRLRSALADRMVGRERAGYLVQLANVRQQTATAWLNAVYAKQALALQ
FT                   QALLDHMHHELAATKASYRGAKAGASDVVQAQAMLAQTQDQVLKAQQTYQTALIGLSRW
FT                   TAAPVSEVTGEPPAPESFVSSLPPDELRLSQPTLVAAADDISVAEADTAVANSERSPNW
FT                   TWEVAYQQRGGAYSNMVSIGVTIPLPLNRKNRQNRDVAEKAELATKARLMYEDALRQVQ
FT                   ADIRTQSATLASGRERIANLSQSLLPAADQRVQLANAAYRAGSGSLADTFAARRAQLEA
FT                   ELQVLDLKREVSQTWAQLEYQVVPSTMAAAQ"
FT   sig_peptide     complement(154206..154304)
FT                   /locus_tag="Bmul_6284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 33"
FT   gene            complement(154395..154772)
FT                   /locus_tag="Bmul_6285"
FT   CDS_pept        complement(154395..154772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19938"
FT                   /protein_id="ABX19938.1"
FT                   /translation="MLAMKLLRTFILSLLCAVLPISGLAASGLTGECPMQQTMSMGADA
FT                   SMSGDMPGCDLMKSSSVDKAKAKSVFCKVTAQCQFGSLYHPAAKTDISRPAAVGTPVIF
FT                   HYVQSLPVRDPNGLWRPPRLV"
FT   sig_peptide     complement(154695..154772)
FT                   /locus_tag="Bmul_6285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.573 at
FT                   residue 26"
FT   gene            154934..155263
FT                   /locus_tag="Bmul_6286"
FT   CDS_pept        154934..155263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6286"
FT                   /product="protein of unknown function DUF326"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   tbd:Tbd_2742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19939"
FT                   /protein_id="ABX19939.1"
FT                   /translation="MAHQQYQTCISACDACATACDHCAAACLEETQVGQLIDCIKLDLD
FT                   CATLCRLASAAMARGSKQVKAVCSSCATLCDACATECEKHQHAHCKECAQVCRRCAQEC
FT                   RTMAQ"
FT   gene            complement(155641..155862)
FT                   /locus_tag="Bmul_6287"
FT   CDS_pept        complement(155641..155862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A1522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19940"
FT                   /protein_id="ABX19940.1"
FT                   /translation="MVSNESVAAPATAQIENTVSRGKTREQVQQELIQAYHDGLLPTSK
FT                   HDYPPSEATIARNKELHQLSEPKWAAQH"
FT   gene            complement(156230..157171)
FT                   /locus_tag="Bmul_6288"
FT   CDS_pept        complement(156230..157171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6288"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bvi:Bcep1808_3974 copper resistance D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19941"
FT                   /protein_id="ABX19941.1"
FT                   /translation="MNDGFLGILRLIAVAIQNVGFAVIVGALLSSQWLARGDSTWQADV
FT                   GRRLVLTVRMASTLALLASVLSFWAHCALMSESTLLEAGPAVWSMLVGTGFGHAWLVAA
FT                   VFMVCVVVLALLRSGSDGSFPTGIWLALAAVALARSNGGHPVDSGLFSLPVWVDWLHLL
FT                   AISAWVGLVLVTTYVVMPRLLDAPGSERQTSASFVQSLSDTSTYALVILFSTGAYNGWR
FT                   GVSTPANLWTSTYGQILLLKFVLVLVAAALGGHNRFFEMPTLMSTLKNPAQEVPTVPLR
FT                   RFSTVLHVESLILLGVLMVAAVLVSSPLPGTT"
FT   gene            complement(157171..157545)
FT                   /locus_tag="Bmul_6289"
FT   CDS_pept        complement(157171..157545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6289"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bvi:Bcep1808_3975 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19942"
FT                   /protein_id="ABX19942.1"
FT                   /translation="MKILTLRHFAGLAVASAVAFAPIAALAHGKLESATPASGSTVDVA
FT                   PDALRLTFNEDLESTFSSVKIADATGAPVTKEKAKIDASNPRVMTLVVPKLASGAYTVQ
FT                   WAVMTSDAHKTKGTYTFKVK"
FT   sig_peptide     complement(157462..157545)
FT                   /locus_tag="Bmul_6289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 28"
FT   gene            complement(157607..157954)
FT                   /locus_tag="Bmul_6290"
FT   CDS_pept        complement(157607..157954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19943"
FT                   /protein_id="ABX19943.1"
FT                   /translation="MKKALFSIAIGCALAFSASTYAAGDMGNMDMSGGTKQSTDAKSSM
FT                   SHGEIKKVDTTAGKLTIKHGPLENLGMEAMTMVFKAKDPAMLSQVKVGDKIDFVAEEVN
FT                   GALTVVKLQKQ"
FT   sig_peptide     complement(157886..157954)
FT                   /locus_tag="Bmul_6290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 23"
FT   gene            complement(158020..159315)
FT                   /locus_tag="Bmul_6291"
FT   CDS_pept        complement(158020..159315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6291"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; KEGG: bur:Bcep18194_B2764 multicopper
FT                   oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19944"
FT                   /protein_id="ABX19944.1"
FT                   /translation="MVSRRQFLSGSGAAILGAAMVSKAGAASLPEAPTMAKATMQPPLV
FT                   PPNGRPYTPVATLNGWTLPWRMKNGWKEFHLTAEPVVREMAPGMKANLWGYNGQSPGPT
FT                   IEAVEGDKVRIFVTNKLPEHTTIHWHGMLLPNGMDGVGGLTQPHIPPGKTFVYEFQLEK
FT                   HGTFMYHPHADEMVQMAMGMMGMFIVHPKDRSVMPVDRDFVFLLSAYDIDPGSFTPRVN
FT                   EMTDFNMWTFNSRVFPGIDPLPIRAGDRVRIRFGNLTMTNHPIHLHGYHFEVAGTDGGW
FT                   IPPAARWPEVTADVAVGQMRAIEFTADRPGDWAFHCHKSHHTMNAMGHSVPNMIGVPQK
FT                   DLAKRINKLVPDYMAMGSTGGAMGEMEMPLPDNTLPMMTGTGPFGPLEMGGMFTVAKVR
FT                   QGLGRNDYRDPGWFKHPKGTVAYEYTGELPDS"
FT   sig_peptide     complement(159235..159315)
FT                   /locus_tag="Bmul_6291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            complement(159317..160813)
FT                   /locus_tag="Bmul_6292"
FT   CDS_pept        complement(159317..160813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6292"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bur:Bcep18194_B2765 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19945"
FT                   /protein_id="ABX19945.1"
FT                   /translation="MMKRLVSTRMGAGVSIMVFLAGCTTFSKDGGFGTVSSTATERLGK
FT                   DAVIVKTDADRDAVAKRTQELLAKPLSMDDAVQVALLNNRGLQASYAELGLSEADLVQA
FT                   GRLPNPGFTFSRTRAGNGDLSIGRTFSANVLSILTLPFAAHIEGRRFEQTKLETADTML
FT                   KLAAEARRAYVNAVAAEQAAKYAEQVKDSADAGAELASRMRQAGNFSKLDYAREQAFYA
FT                   DSVAQAAKARQQAVSAREKLTRTMGVWGTGTQYTLPERLPDLPKDRPELKDLERFAMQN
FT                   RLDIQAAKLQTQGVASSLGLSKATRFINAIDVGYQNNYETDKGHEHGYEISIEIPIFDF
FT                   GSAKVARAEAIYMQSANRLAQTAIDARSEVREAYSAYVNSYDVAKHYRDEVVPIRKTIS
FT                   DELLLRYNGMLASVFELLADSREQVGAVNSYIDALKDYWLAETDLQQALGGRLPRAGAE
FT                   QTEQTPPGPNSAPQSAPRPAARPEPASTAQPAHETHSEGK"
FT   sig_peptide     complement(160730..160813)
FT                   /locus_tag="Bmul_6292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.937 at
FT                   residue 28"
FT   gene            complement(160810..161127)
FT                   /locus_tag="Bmul_6293"
FT   CDS_pept        complement(160810..161127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19946"
FT                   /protein_id="ABX19946.1"
FT                   /translation="MRLISAALLGAAASLPTLVHATTTIPDPTDAAASVPAISAPSAFN
FT                   GYRPYNDADNPTWQQLNQAVQEKPAKGGMTHGGAMGHGGAMNKPAGDHQSNHSQHGEPA
FT                   K"
FT   sig_peptide     complement(161062..161127)
FT                   /locus_tag="Bmul_6293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            complement(161215..161616)
FT                   /locus_tag="Bmul_6294"
FT   CDS_pept        complement(161215..161616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19947"
FT                   /protein_id="ABX19947.1"
FT                   /translation="MSYWRKLFVVVLLALSLPVQSFAAISMNCVASHAEASETPIVHAG
FT                   QSMSGHHRDMHGAALAADDHHTYHHGGGHHAHSCSTCAACCFGTGLPAVPSVVVSSDVT
FT                   RVTTSIPPSAGVVSFLTDGIERPPRHTLV"
FT   sig_peptide     complement(161545..161616)
FT                   /locus_tag="Bmul_6294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 24"
FT   gene            161907..162578
FT                   /locus_tag="Bmul_6295"
FT   CDS_pept        161907..162578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6295"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bam:Bamb_5186 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19948"
FT                   /protein_id="ABX19948.1"
FT                   /translation="MRILIVEDEPKMASYLRKGLTEASYTVDVAENGKIGLFLALHENF
FT                   DLVVLDVMLPELDGFEVLKRLRAEKQTPVLMLTAREAIEDKVAGLELGADDYLHKPFAY
FT                   AEFLARIRSLLRRAPRSIRDILLVADMEIDLLKRRVRRGDNRIDLTAQEFALLQLLAER
FT                   EGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKVDNAYDKKLIHTIRGMGYVLEDR
FT                   S"
FT   gene            162575..163969
FT                   /locus_tag="Bmul_6296"
FT   CDS_pept        162575..163969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6296"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: bur:Bcep18194_B2769 heavy metal sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19949"
FT                   /protein_id="ABX19949.1"
FT                   /translation="MTGKAAPYSLLTRLTVAFAVVAGLAFALTGAYLYRSLSIELQRRD
FT                   DIEIGGKLSQFLQLAHASGSVQAIRATPAVFHEVLLSHPGVYLGIYDGQNNSLIEHTAA
FT                   PGVTLKSIASSDRPPRIPYTCDPTGIGPSRCVFARDRLPSGEDVRIALVRTATDRQSLL
FT                   KSYRVDIWLAVAVGAILLGGLGYAIARRGLRPVESLGRQTSIIEAHNLSERLDIRGGPM
FT                   ELRELASSVNRMLDRLERAFVRLSQFSSDLAHDMRTPLANVISSSQVTLSRPRTSDEYE
FT                   ALIDSNIEECERLQRMIENMLFLARTENAHLHLKVSDLDTEMELQRLASYYQSIADEKG
FT                   VNFVVVGDAHVVADATLFRRAVSNLISNALDHAFAGTAIKLASSRSLQYVVVEVTNHGR
FT                   PIAPEHLDRIFERFYRVDASRHGSSKNAGLGLAIVKSIMELHRGQVQVSSNDVSTTFHL
FT                   QFPRER"
FT   sig_peptide     162575..162658
FT                   /locus_tag="Bmul_6296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.918 at
FT                   residue 28"
FT   gene            164121..164516
FT                   /locus_tag="Bmul_6297"
FT   CDS_pept        164121..164516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6297"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   bxe:Bxe_B2299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19950"
FT                   /protein_id="ABX19950.1"
FT                   /translation="MQTRISIPWFVINVIATLGLMIGTTSAQQATSMPDMNMGQSTKAN
FT                   SASVQAFKGADQRMMRRMQGQTYTGDADKDFVSHMIPHHQGAIDMAAAELKYGKDPEMR
FT                   RLARSIVKAQKEEITKMKRWQAKYGSQ"
FT   sig_peptide     164121..164210
FT                   /locus_tag="Bmul_6297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.455 at
FT                   residue 30"
FT   gene            complement(164606..165034)
FT                   /locus_tag="Bmul_6298"
FT   CDS_pept        complement(164606..165034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6298"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_C6566 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19951"
FT                   /protein_id="ABX19951.1"
FT                   /translation="MEIRPATVDDLASIETLLRQCGLPVVGVSDHLRNFVVATEGSMMC
FT                   GCGGLEHYGDAALVRSIAVAERARDSGPGQRIVSRLVAECHALQVRSLVLLTTTAEHYF
FT                   TRLGFVRVARGDVMPLVLASSQFQGVCPGSAVSMLRVL"
FT   gene            complement(165056..165793)
FT                   /locus_tag="Bmul_6299"
FT   CDS_pept        complement(165056..165793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6299"
FT                   /product="arsenical resistance protein ArsH"
FT                   /note="TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase; KEGG: bur:Bcep18194_C6565
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19952"
FT                   /protein_id="ABX19952.1"
FT                   /translation="MRRASVSEQLNDMPQLDATLFRVPDAAQLRPATPSTHPPRLLLLY
FT                   GSLRERSFSRLLVEEAEHLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELRELVIWSE
FT                   GMVWCSPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRV
FT                   LGRWMRMLTIPNQSSVAKAFAEFDEAGRMKPSPYYDRVVDVMEELVKFTLLTRDIGPYL
FT                   VDRYSERKESAEELSKRVNQRSI"
FT   gene            complement(165771..166193)
FT                   /locus_tag="Bmul_6300"
FT   CDS_pept        complement(165771..166193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6300"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: bur:Bcep18194_C6564 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19953"
FT                   /protein_id="ABX19953.1"
FT                   /translation="MSNITIYHNPDCGTSRNALALIRNSGEEPVVIEYLRTPPSRETLV
FT                   KLLADAGLTVRELLREKGTPYAELGLGDPKWTDEQLLDFIGQHPILMNRPIVVTPIGTK
FT                   LCRPSEAVLDILPNPQTGPFTKEDGEVVIDAEGKRV"
FT   gene            complement(166190..167422)
FT                   /locus_tag="Bmul_6301"
FT   CDS_pept        complement(166190..167422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmul_6301"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   har:HEAR1961 putative major facilitator superfamily
FT                   transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmul_6301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19954"
FT                   /protein_id="ABX19954.1"
FT                   /translation="MSTHAPRPHAWLTPSLGLTQIVGWGSMFYAYGVLMQPMQDELGLS
FT                   KPVVVGAYSVALLISGLLSTSAGSIIDRVGGRALMAGGSLLAALMLVCLSRVNNVVGLY
FT                   LVWAGIGVAMSATLYQPAFTVITQIFGNDYRRAITHLTLFGGFASTVFWPLTQTLLQHV
FT                   GWRDTWQLYAGANLAICVPVHVALPSRSHAPHGVTPTQTEQPAANLGAVLRDPAFYLVT
FT                   AAVTLNALVFAAMSLHMIAVLQAHGISAANAAWVGALVGPMQVLGRVLETTIGKRASTR
FT                   QVGMAAMALLPLSLVLLFASGTWLPVYVVFAALYGIGNGVMTIVRGALPAELYGRTAYG
FT                   AISGAMATPVQIAIAAGPFVASLLYVAGNGYPGTLLALAGIGATGAILFRYAILHLRHH
FT                   AVPLSKQGIST"
XX
SQ   Sequence 167422 BP; 32508 A; 50641 C; 52046 G; 32227 T; 0 other;
     gtcaggtccg gcactcgtac cagcccttcg actggttgac gatgcgcacc accaacagca        60
     tgaccggcac ctcgatcagc acgccgacga cggtagccag tgccgcgccg gaatggaaac       120
     cgaacaggct gatcgcggcc gcgacggcaa gctcgaagaa gttggatgcg ccgatcagcg       180
     ccgacgggca cgcgatgttg tgcttctcgc ctacggcgcg gttgagccag tacgcgagcg       240
     ccgagttgaa gaacacttga atcaggatcg gcaccgcgag cagcgcgatc accagaggct       300
     gcttcaggat cgcttcgccc tggaacgcga acagcagcac aagcgtggcc agcagcgccg       360
     cgatcgacca agggccgatc ctcgccatcg cggcatcgaa tgcagcctga ccattcgcga       420
     gcagccgctt acgcaggatc tgcgcaatga tcaccgggat aacgatgtag agcacgacgg       480
     acgtaagcaa cgtcgcccac ggcaccgtga ttgcggacat gccgagcagc aggccgacca       540
     gtggcgcgaa ggcgatcacc atgatgctgt cgttcagcgc gacctgcgac aacgtgaaca       600
     gcggatcgcc gcccgtcagt cgactccaca cgaacaccat cgccgtacac ggtgctgcgg       660
     ccaacaggat caggccggcg atgtagctgt cgagctggtc cgtcggcagc atcggcgcga       720
     acagatggcg gatgaacaac caaccgagaa acgccatcga aaatggcttg acgagccagt       780
     tgacgacgag cgtgacgccg atgcctttga cgtgctgacg cacttcatgc agcgcgccaa       840
     agtcgacctt gaccagcatc gggatgatca tcacccaaat cagcagcccg accgggagat       900
     tgatctgggc atattccatc cgcccgatct gctggaacag gccgggcagc acctggccga       960
     gcgtgatgcc ggcgacgatg cacagcgcca cccagacggt gaggtagcgt tcgaagaaat      1020
     tgatggaagg ctttgcgacg gccttgcccg gcggggcgac attggacgtg ttcatggata      1080
     gggttcagtc ttgaagtcgt cggcggccgc gcggttcagc ggaccgccat gcgaatggtc      1140
     agttttgcga gatctcggtc aacgccgtct ggagttcggc attgctcatg cgatcaagcg      1200
     gcagcgccaa caactgcagc atgcgatagc cgatcgcctg gcgcgtgagt tcgaaggcga      1260
     gtcgcttgcc ttcgtcgccg cccaacgcgt tcgacggatc ggcgtagccc caatgcactt      1320
     tgacggggct gccgggccag tacgggcacg tctcggcggc cgcgctgtcg cacaccgtaa      1380
     tgacgacgcg catctccggc gcaccatcgc cgacgaactc gtcccagctc ttgctgcggt      1440
     agccgctcac gtcgacgcca gcggtcgtca gcgcttccag cgcgaacgga ttgaggcgac      1500
     cgctcggcgc actgccggcg ctgtatgcgc ggacgtcctt gccgagcttc gcggcccaat      1560
     gattgagcat cccttcggac agcacgctgc gcgccgagtt gtgggtgcag aggatcagta      1620
     cgttcgtggt catgggttga cgatccaaag ttacttttgc ccgatctcgg tcagggactt      1680
     ttgcagtgcg acgttgtcga gtttggcgag cggcaatgac agcagcaggt cgatacgacg      1740
     cttcaacgtc agcgcggcgt cgtgcatggc ctgctgtttc tgttcgtcgg agccctcgac      1800
     gtcggccggg tcaggcacac cccaatgtgc ggtgatcggt tgaccgggcc agatcgggca      1860
     cacctcgccg gtggccttgt cgcacacggt gaagacgaaa tcgagcgccg gtgcgccggg      1920
     tgccgcgaat tcgtcccagc tcttgctccg gtagccttcg gtcggcaatt gccaacgcgc      1980
     cagctcgcgc agcgcgaacg gattcacctc gcctttcgga tgactgcccg ccgagtacgc      2040
     cacgaagcgg ccctcgccaa ggcggttcat cagtccctcg gacaggatcg atcgggcgga      2100
     attgccggta cagatgaaca gcacgttgta gggcttgtcg ctcatggttg gacctcagca      2160
     gcaggacgat ttcaccggca cgccgatcgg cttgccgcgt gcaggggaac agcaagcaga      2220
     agcgtcggca ttcgattcag ccgccgacgc gttacgggat tcgccgaagg tggggacgtc      2280
     gccgagcgtc tggtacgttt cccatgcgat gccttgcggg tcgaccgtcc agtacttgtc      2340
     ggagcgggcg tagcagcacg ccgtaccgat ttgctcgtcg accggcagcg cggcgccgtt      2400
     caagcgcgta tgcatctccg ccagctcggc atcgttttcg acctgcacgc caagatgatc      2460
     tagaccgggc gccgcgccgc gctgcgagat cgcgaagtcg acgcgaggat cgtcgagcat      2520
     ccatttcgcg tagtcgctct tgacgacggt cggctcagcg gcgaacagcg ccgaatagaa      2580
     acggatgctg tcaacgagat ccggcacgct gatgtgcaca tggaagcgct tcatgagtgt      2640
     tgctccttga ccggggaaca cgcgcccgca ggcgagcagg gattgccgcc gcagcagttc      2700
     tccgtgaggt aagccaacag gccgttcatc gtggcgaagt tcgcgcagta gaagacgaag      2760
     cggccttcct ggcggctggt gacgagttgt gcatgcgcca gttccttcag atgaaaggaa      2820
     agcgacgacg gcggcacgtc cagcagcgtg gcgatctgcc cggccggcat gccctccggc      2880
     cccgcttgca cgagtgcacg aaagacggcg agccgggatt cgtgggcgag tgccgcgagg      2940
     gcggcaatgg tttggtttgt ttccatgttt caatagtagt cgaaatatcg aaagcaggaa      3000
     agaaatcggt cgatatttcg gccctgcatt ggaatgcctg gatttgatag tgtcgaaccg      3060
     cggccccttg tcgggcgcaa actcgagcga tgcgggcacc tacggcaaaa attagagcgc      3120
     tccgatgttg gcgagcggca aactgttcgt agtggaagtg cataccaaaa caacgactta      3180
     ccatcgtgta acagttagta gagggtccgc cgggattcgt gaatatgcga accttcgcat      3240
     aagtgcttat cccggccgac cttcaacctg tcagcgaggg attagacgag acgcgggggg      3300
     cgccataacc cgttcgggtc acggaccgga agagactgga cgtaatggaa gttggcgaat      3360
     ttcacgtcct gacccgcgcg acgtcggccc ctatctgatt gattggtatc ctgatctcag      3420
     ctcggagcat ctgcttcggg cagcgcagcc ggcgctattt gccggcgatt ggaacggact      3480
     gatagactct cttgctgatg gagcaccctg gtggccggtg aaccttccgg gccggctggc      3540
     catttgtatg aaaatggagc cgttcatgag cgacatccag aagctgcggc tggatctgcc      3600
     gttggttctg ccggacatat atggcgccga agaccgctgc gtgagccgcc tgcaagacaa      3660
     gctggcggac aggcctggca ttgaaggggc tcatatcact ggcgcggctg aaggagagcc      3720
     gcagttgtgt gtgcactacg accccgccgt gatctcacta agcaggctgc gtgagctgat      3780
     tcggtctgaa gggctcgctg tggcgggccg cttcgcgcac attgtgggac gagtgaatgc      3840
     gccgatgcat gtgcgtgcca ccaggcgtgt tgctgagcag ctgcgctcac tcggtgggat      3900
     cattgaggcc gacgtatcgc caagcggcgt tgtccgcatc gaatacgacc gttccctcac      3960
     tgacgagtcc gatctcacgc agcgcctgac cttactcgat atctctgtga attgggcaac      4020
     gccggctgtt cagccgacca cggcggtccg ctcttgcaag gcatccgcag attccggcac      4080
     ggcagggcat aaggcggctg ccaatgacca ccgtgcgctg cagcgagcca accacacttg      4140
     cgggaaagac gagggcggcg agcacagcca tcgacacggc gggttgttcg gcgaaaagac      4200
     cgagctgatc tttgcttgct tgtccggagt cttcctgatg gctggatggc tcgtggggcg      4260
     acgcggcacc ggtcttgaat ggctgtccac ccactgctac gtggtttcgt acttcttcgg      4320
     cggctactac accatccaag aagccatcga gaacctgcgt gccaagcgtt tcgagatcga      4380
     cacgctcatg ctcgtagcgg ctgcgggtgc cgcggctctg ggctcctggg gagaaggcgc      4440
     tttgttgctg ttcctcttca gccttgggca ttcgctcgag cactacgcca tgggtagggc      4500
     ccggcgtgcc atcgaggcct taaccaagct tgcacctgac acggccacgg tgcggcgcga      4560
     ttccgggacg gaggttgtgc cactggagaa gctggaagta ggcgacgtcg tcgtcgtgaa      4620
     gcccaacgag cggctgcctg cggacggtgt tgtggtcgtt ggcacttcca gcgtcaatca      4680
     ggcaccggtc acgggcgaga gtgttccagt cgacaagcgc cccgtcgagg atggccgaat      4740
     cacaatcggg cgcttcgagg gcgtagcggc tgagagccgc gtcttcgccg gcacgatcaa      4800
     cggcgcgggc gccatggata tcatggtcgc ccgaaaggcc gatcagtcga cgatggcgcg      4860
     cgtcatcaag atggtcactg aggcggaggc ccagcgctcg ccgacacagc agttcaccga      4920
     gaagttcgag cgcatcttcg tgccatcagt gctggtgttg gtcggtctgc tgctgtgcgc      4980
     tggtgttgtt atcgatgagc cattctccca caccttctac agggcgatgg ccgtgttggt      5040
     ggctgccagc ccctgcgcgc tcgcaatctc agtgcccagt gcagttctca gcggcgtagc      5100
     gcgcgccgcg cggagcggtg tgctggtcaa gggtggtggg cctttggaga acctgggcac      5160
     gctaacctca attgcctttg acaagaccgg cacgctgacc gaggggaagc cgaagctcac      5220
     cgaggtggtc ccagctcaag gcgtgcctga gcacgaactg ctggcagtgg cgctggcggt      5280
     ggaagaacac agcgaccacc cgctcgccgc ggcgattgtc aacggggcga aggaacggct      5340
     gcgagacaag accgatctgc cgcaggctgt ggatgtcaaa agcatcaccg ggcgcggtgt      5400
     ccgggctcag ttagggggcg agactgtcca catcggcaag ccgattctgt tcagggagct      5460
     gtctgattca accgtccctg atgacatcga cgaggccaac aagaaactca tcgccgacgg      5520
     acatacgacg atgatcatcc gcaagggagc gcgcttcctg ggcgtgatcg gcgtcatgga      5580
     cacgccgcgc cccgtcgctg gccgagtcat gggcgaactc aggaaactcg gcatcgagcg      5640
     gctaattatg atttccggcg acagccagaa ggtggccgag gccgttgcgc aaaccgttgg      5700
     cctgaccgag gcccaaggag accttatgcc cgagcagaag gtcgaggaga tcaagaaact      5760
     gcgcaccgag cacggcaagg tggcgatggt gggagacggc gtcaatgatg gacccgccat      5820
     ggctaacgcg accgtgggca tcgcgatggg tgccgcaggc tccgatgttg cgttggagac      5880
     cgccgacgtg gcactgatgg ccgacgatct ggcgcaattg ccgttcgctg tgggcctgtc      5940
     gagaagtacg agccgcgtca tcaagcagaa cctgtggatg agtcttggcg tcgtggcggt      6000
     gctgattccg gcaaccgtgc tagggctgaa catcggtacg gcggtcatct tccatgaggg      6060
     gtctaccttg ctcgtggttg ccaacgcgct gcggttgctg gcctacaagc ctttcgacaa      6120
     gagtgccacg gcagctgagc ctgccacgta acgttaaaac aatgggaggg gggaccgcca      6180
     tgccttccga agacagtgag ccagggtagt taatgcagac cgcggacggt accggtgacc      6240
     tgaccgacga ttgcctaccc gcagagaggt ccgtgcacca aggaaggcgg cggagtcgta      6300
     accgatgcgg agggcaagcg cgtctgaaca attggacgac ccgcctcagt tcgacaccac      6360
     gctgatcctc gtgccggaag gcgcggccga cgccaccgtc gacccatccg ccccggctcg      6420
     tgcttctgca cggctccctg catgaacgct tgttcagctg cttgccggtc gaggaagctg      6480
     cgccgccgtt cacagcgatt ggtgccgggt acgcgtgttc aatccaagtg ggcggccttc      6540
     gtccgatttt gcacccgaga gccacccgaa ggtggccggg ttgcgcgggg tggtgacgtg      6600
     agcggaaggc atagtgtagt gctcgccgga acggcacggc gcaatgaccg gcatcatgaa      6660
     atcacggatc gactggattc cttcgtcggt cggcgcggtg cggccgaagc agggcaagac      6720
     gctcgcggtg atgcaggtgg gcggcggatc tcagtcgttc aacgctgtaa accggatgcg      6780
     catgctctga ggctggatgc gcatgctgat gatcccgaac cagtcgtcgt cggccaaggc      6840
     gttcgcggaa ttcgacgaag cagggcggac gaagccgtcg gcccattacg atcggctcgt      6900
     tgacgttatg gaggagccag tcaagttcac tctacccgag acgacggccc aaatctggtc      6960
     gaccgataca gcgagcgcta ggaaagggcc gaggaactgg cgccgcgcgc gtaccagaga      7020
     aagatctgat gatcgatggg cagcgagact ttcacacaac ctttacccca gccgtgggtt      7080
     tccgaagtgc tttcttgact ctcccaagat gacggaaacg tcatcaccgt gtcatgttcg      7140
     cgctgcggcg tgatcgtagc atcggtcaca aaccgttacc gcaggaccaa catgctcaaa      7200
     cccaacctcg ccctggccat cgtgttcgcg atggccgcga cggctcatgc gcagccatcg      7260
     ctgtcgccgg ggccggcccc gggtgccgcc gccgcgccga tcggcgcacc gccgtccgat      7320
     gcgcttcctg cgtcgtcgtt gacgttgtcc gacgcgctcg cggtcgcggc ccggaacaat      7380
     ccggcgctgc gcggcgcacg cgcggatgtc gatgcatcgg ccggcgtgct gatgcaggcc      7440
     ggcgcgcggc cgaaccccga agtgtcgttc ctgcaggaag gcttcagtcg cgccgaacgc      7500
     acgtccaccg cgctgatcaa ccagaccatc gagttgggcg gcaagcgccg cgcacggctc      7560
     gacgtcgcgt cgtacggccg ggaggcggcc agcgcgtcgc tcgacgagca gggcgccgcc      7620
     gtgcgcgccg acgtgatcgc cgcgttctac gggctgctcg ccgcgcagcg ccagcttcag      7680
     gtgaccgaag aatcggccgc gatcgccgcg cgttcggcgg atctcgcggg gcgtcgcgcg      7740
     caggccggca aggtgtcgcc ggtcgaggcg accaaggcgc aggtcgcggc ggccggcgtg      7800
     cagatcgaag tcgtgaccgc gcgcggccgt gtcgaggtcg cgcgcgagaa actgaacgcg      7860
     gtgatgggcg aggcgcgcaa cgaccggctt gcggtgctcg gcgacctgga aaccgtgccg      7920
     ccggtcgagc cgttgtccgc gctgaccgcg caactcgacg atgcgccgct cgcgcgggtc      7980
     gcgcgcgccg agatgctgcg ctcgaacgcg gccatatcgc tcgaacgcgc gcggcgcatt      8040
     ccggacgtga cggtcagcgc cggcgtgaag cgcgtgacca ccggcggcgt gccgaacaac      8100
     caggcggtgg tcggcgtgtc gatcccgatt ccgctgttca acacgaacaa gggcgcgctg      8160
     ctcgaggcga cgcacaaggc cgagcgcgcg aacgccgatc tcgatcgcga acgcacccgc      8220
     ctgcggctgg agttgacgca ggcatacgcg aatttcgagg cggccgagca ggaagcgcag      8280
     cggctgaagt ccgacatcct gccggccgcg cgcctcgcgc tcgacgcgat gtggcgtggc      8340
     tacgaactcg ggaagttcag cttcctcgac gtgctcgacg cgcagcgcac gctgttccag      8400
     ggccagtcgc aatacgtccg tgcgctcgcc ggcgcccatg cggcccgcgc cgatatcggc      8460
     cggctcgtcg gcacgccgct cgcggccgtc gcgcaataag cgcgcctctt actggaggat      8520
     catcatgtca cgcagcagaa tcttcgttat tgcggcggcc gtgctcggcg gcgcagggat      8580
     cgtgattggc gcgctcgccg tcacgcgggg cggcagcggc gcgtcggcgc cgaccgccgc      8640
     cgaaaccgcg cagccgaccg acgccgccgg cgtcggcgcg cgcggcggtg tcgtgctcaa      8700
     gcgcggcaag ctgtcggtcg agatcgtgat gacggaaaag cccggcgacg cgcggctcgt      8760
     cgtctatccg ttcgtcgacg acaagccggc gacccagggc gtgaccgtgt ccggcacgct      8820
     ggtgcgctac gatcgcacgc acgaaccgtt gcgattcgac gcggccggcc aaaagttcgt      8880
     gtccgcgcag tcgattgcga agccgcacgt gttcgatgcg acgatcgacg tgaagtccgg      8940
     caacgacgcc gcgtcgttcc cgttcgcgcg cgccgacggt gcgatcgcgc tgaccgacgc      9000
     acaactggcg acgtcgagga tcgcgctcgc gaaagccggc cccgcgcaga tcgcgacgcc      9060
     gttccagctt cccggtgaaa tcaagttcaa cgaggatcgc accgcgcacg tcgtgccgcg      9120
     cgtggccggc atcgtcgagc aggtgtcggt gtcgctcggc cagaacgtcg cgaaagggca      9180
     ggtgctcgcc gtgatcgcga gcaccgatct ggccgaccgc cgcagcgagc tgctgacggc      9240
     cgagcgccgg ctgtcgggtg cgcgcgcaac ctacgaacgc gaacgcacgc tgtggcagga      9300
     gcgtatttct gccgagcagg attaccagca ggcgcaggtg cagttgcgcg aggccgagat      9360
     cgccgtgcag aacgcgcggc agaagctcgc cgcgctgaat gcgccggtcg gcgcgggcgc      9420
     gctgaaccgt tatgaactgc gcgcgccatt cgcgggcacg atcgtcgaga agcatgcgac      9480
     gcccggcgag gcgattgccg ccgacgcgag catgttcgtg atctctgacc tgtcgaccgt      9540
     gtgggccgag atggcggtgc ccgcgcagcg gctcaacgac gtgcgcgtcg gtcgcgatgc      9600
     cacggtgagc gcgaccgcgt ttgaatcgcg ttcgagcggc ccgatcgcgt acgtggggtc      9660
     gctgctcggc gagcagacgc gcaccgcgcc ggcgcgcgtc gtgctgccga acccggatcg      9720
     cgtgtggcgc ccgggaatgt tcgtcaacgt gtcggtcgac gccggcaggc agggcgtgcc      9780
     gctcgcggtc gcgagcgacg cgttgcagga cgtcgacggt gcgccgtcgg tgttcgtgcg      9840
     ctcgccgaag ggcttcgtcg cgcaggccgt cgaaacgggg cggcgcgacg aacgggcgac      9900
     cgaggtgctc aaggggctca agcccggcca ggaatacgcg gcgtcgaaca gcttcgtgct      9960
     gaaggcggag ctcggcaagg ggagcgcgga acatgaatga gcagcaatac gcgtgcgccg     10020
     tggcgcgact ggcggcccgc tatgcggcct gctttccggt cggccgggtg accggccgcg     10080
     cggcccgtcc ggtgcggccg accgtgcccc gtttcaagga atcccgacat gtttgagcgc     10140
     ctgatccgct ttgcaattgc gcatcgctgg ctggtgatgc tggcgatcgc ggccgtggct     10200
     gcgctcggcg tattcagcta ccagcggctg ccgatcgacg cggtgcccga catcacgaac     10260
     gtgcaggtgc agatcaacac gtccgcgccc ggctactcgc cgctggaggc cgagcagcgc     10320
     atcacctatc cggtcgagac cgtgatggcc gggctgccgg ggctggagca gacgcgctcg     10380
     atctcgcgct acgggctgtc gcaggtcacc gtgatcttca aggacggcac cgacatctac     10440
     ttcgcgcggc agctcgtcaa cgagcgcatc caggaagcga aggacaagct gccggccggc     10500
     atcgcgcccg cgatggggcc gacgtcgacc ggcctcggcg agatctacct gtggaccgtc     10560
     gaggccgacg ccaacgcgcg caagcccgac ggcacgcgct atacggcgac cgacctgcgc     10620
     gagctgcagg actgggtcgt gcgaccgcaa ctgcgcaacg tgcgcggcgt gaccgaggtc     10680
     aactcgatcg gcggctacgt gaaggaatac cgcgtcgcgc cgaatccggc gaagctgatg     10740
     tcgtacgggc tgacgcttgc cgacgtcgtg cgcgcactcg agcgcaacaa cgacaacgtc     10800
     ggcgccggct acatcgaaaa gcgcggcgag cagtatctgg tgcgcgtgcc gggccaggcg     10860
     cgcaccgtcg acgacatcgc gaacatcgtg ctgaccaacg tcggcggcgt gccggtgcgg     10920
     atgaaggacg tcggcgtggt cgacatcggc cgcgaactgc gcaccggcgc cgcgacgtcg     10980
     aacggcgagg aagtcgtgct cggcacggtc ttcatgctga tgggcgagaa cagccggacg     11040
     gtgtcgaagg ccgtcgccgc gaagatggag gacgtgaacc gcacgctgcc ggccggcgtg     11100
     aaggcgattc cggtgtacga ccgcacggtg ctggtcgaga aggccgtcgc caccgtgaag     11160
     aagaacctgc tcgaaggcgc ggtgctcgtg atcgccgtgc tgttcctgtt cctcggcaac     11220
     atccgcgcgg cgctgatcac cgcgctcgtg attccgctgt cgatgctgat gaccttcacc     11280
     ggcatggtca acgcgaaggt gagcgcgaac ctgatgagcc tcggcgcgct cgacttcggg     11340
     atcatcgtcg acggcgcggt ggtgatcgtc gagaactgcg tgcggcggct tgcgcatgcg     11400
     cagtcggcag ccggccggcc gctcacgcgc gacgagcgct ttgccgaagt gttcggcgca     11460
     tcgcaggaag cgcgccgcgc gctgatcttc gggcaactga tcatcatggt cgtgtacctg     11520
     ccgatctttg cgctgaccgg cgtcgaaggc aagatgttcc atccgatggc gatcaccgtc     11580
     gtgatggcgc tcgccgccgc gatggtgctg accgtcacgt tcattcccgc ggccgtcgcg     11640
     ttgttcatcg gcgagcgggt cgaggagaag gagaaccggt tgatgggctg ggcgcggcgt     11700
     gcgtacgaac cggtgctcgc cgcgttcatg acgcgcccgg cgcgcgtgat gatcggggcg     11760
     ggcgcgatcg tgctggtcac gctcgggctc gcgacgcggc tcggcagcga gttcattccg     11820
     agcctgaacg agggcgatct ggccgtgtcc gcgctgcgga ttcccggcac gagcctgtcg     11880
     caatcggtcg agatgcagaa gtcgatcgag aagacgctga aggcgcgctt tcccgagatc     11940
     gagcgcgtgt tcgcgcgcac cggcacggcc gagatcgcgg ccgacccgat gccgccgaac     12000
     ctgtcggacg gctacatcat gctgaagccc gccgacacgt ggcccgaccc gaagaagccg     12060
     cgtgaccagc tcgtgcgcga gatcgaggaa gcgctcgccg agctgcctgg caacgcgtac     12120
     gagttctcgc agccgatcca gctgcgcttc aacgaactga tttcgggcgt gcgcagcgat     12180
     gtcgccgtga agatcttcgg cgacgacatg gccgtgctga accagaccgg cgagcagatc     12240
     gcggccgcgt tgcagaaggt gccgggcgcg tcggaggtca aggtcgagca gaccacgggc     12300
     ctgccggtgc tgaccgtcaa cctcgaccgc gacaagctcg cgcgctacgg cgtgagcgtg     12360
     gccgacctgc aggactcggt ggccgcggcc gtcggcgggc agaaggccgg cacgctgttc     12420
     cagggcgacc gccgcttcga catcgtcgtg cggctgcccg acgaactgcg ctccgacatc     12480
     gaggcgatca agcggctgcc gatcgcgctg cccgcgccgg ccgccggcgc cagcgcgccg     12540
     ctcgcggcgg cgccgtacgt gccgctcgcg gagctcgcga cgatcgacgt ggcgcccggc     12600
     ccgaaccaga tcagccgcga ggacggcaag cggcgggtgg tcgtcagcgc gaacgtgcgc     12660
     ggccgcgacg tcggctcgtt cgtcgccgat gcgcgcgagc agttgcagca ggacgtgcgc     12720
     gtgccggccg gctactgggt gtcgtggggc gggcagttcg agcagttgca aagtgcgagc     12780
     gagcgcctga agctcgtcgt gccgctcgcg ctgttcatgg tattcgtgct gctgttcgtg     12840
     atgttcaaca acgtgaagga cgggctgctg gtgtttaccg gcattccgtt cgcgctgagc     12900
     ggcggcgtcg tgtcgctgtg gctgcgcggg attccgctgt cgatcacggc ggcggtcggc     12960
     ttcattgcgc tgtccggcgt ggccgtgctc aacggtctcg tgatgatctc gttcatccgc     13020
     aacctgcgcg acgaaggcat gccgctcgac gccgcggtgc acgacggcgc gctcacgcgg     13080
     ctgcggcccg tgctgatgac cgcgctggtc gcgtcgctcg gcttcctgcc gatggcgttc     13140
     gcgaccggca ccggcgccga ggtgcagcgc ccgctcgcga cggtcgtgat cggcggtatc     13200
     ctgtcgtcca cggcgctgac gctgctggtg ctgccggtgc tgtaccgggt cagccatgcg     13260
     gtgtcgtggc gcgcggcgtt gcgcggcggc ttcggcgcgg gcgtgctgcg ccggctgggt     13320
     tttttcaagg gtaatgcgtg atgcgaattc tgattgtcga ggatgaaccg aagacgggcg     13380
     cgtatctgcg caagggcctg accgaggccg gctacgttgt cgactgggtc gaggacggca     13440
     tcacgggcca gcaccaggcc gaaacggagg agtacgacct gctcgtgctc gacgtgatgc     13500
     tgcccgggca ggacggctgg acgctgctgc agaacctgcg gcgcagcaaa tcgacgcccg     13560
     tgctgttcct cactgcccgt gacgacgtcg gcgatcgcgt gaaggggctc gagctcggcg     13620
     cggacgacta tctcgcgaag ccgttcgact tcgtcgagct gaccgcgcgc atcaagtcga     13680
     tcctgcggcg cggccagccg cgcgattcga acacgctgcg cgcggccgat ctcgaactgg     13740
     acctgacccg ccgcaaggcc acgcggcagg gcgacacgat cctgctgacc gcgaaggagt     13800
     tcgcgctgct gtggctgctg atgcgccgcg aaggggagat cctgccgcgc gcgacgatcg     13860
     cgtcgcaggt atgggacatg aacttcaaca gcgacacgaa cgtcgtcgat tcggcgatcc     13920
     gccggctgcg ctcgaagatc gacgacgcgt acgaaccgaa gctgatccac acggtgcgcg     13980
     gcatgggcta cgtgctcgaa gcgcgcggcg gcgcggccgc atgatcgcgc gcctgctgcc     14040
     gcgaacgctg cgcggccggc tgaccgcgct gatcatcctg tcgacgtcgg tgatcctcgc     14100
     gtcgagcggc gtcgcattgt acgaagcgct gagcaaccgt gtcgaaacga cggcagccga     14160
     gcagatggcc ggtatttccg ccgcattggg cgcacacctg gccgaggcgc gcacgacggc     14220
     cgacgtcgcg cgcaacaccg atatctggat cgaccagttg cacggtcatc cgaacatgga     14280
     tctcgcgatc ttcgatgccg ccggtacgcg cctcgtcggc acgcccggct tccgtccgta     14340
     cgcgccgctg atgttgacga acgccgggcg cgtgccggtc ggcatcgccc cgcccggcgc     14400
     aagacaccag tatctgctga cgaccgtgcc gctcgccggc gcgggtgcgc cggtggtgcg     14460
     cgtcgccgtg cagtacgatc gcagcgccga cgtgctgctg ctgcgcacgc atgcctatac     14520
     gatcgtcgtg atcgaggtgt tcggcgtggt gcttgcggcc gcgatcgcat acggcatcgc     14580
     cgcgctcggg ctgagcccgc tgcggcggtt cgcggcgcgc gcggagcaga tgtcgtcgag     14640
     ccggctcgcg catccgctgc cggaactcga tacgtccggc gagctgaagg agctcgagca     14700
     tgcgttcaac ggcatgctcg cgcggctgaa cgaatcgttc acgcggctga gccagttctc     14760
     gtcgaatctc gcgcacgaca tgcgcacgcc gctgacgaac ctgcaggcgg ccgcgcaggt     14820
     tgtgctgtcg caaccgcgca gcgcggacga ataccggagc gtgatcgagt caagcatcga     14880
     cgaataccag cggctgtcgc ggatgatcga ggacatgctg tttctcgcgc gttcggaaca     14940
     ggccggcacg tcgatcgatg tgcggcgcct gaatgcggcg gaggaggcgg agcgggtggc     15000
     cggctactac gagccgctgg cggaagatga aggcgtgacc gtgaaggtcg acggccacgc     15060
     atgggtcgat gcggacctga cgctgtacca gcgcgcgttg agcaacctgc tgtcgaatgc     15120
     gctgacctat gcgccgcgcg gcagcgtcgt gacgatcgat tgcgtcgagc agggcggtgc     15180
     gacgacgatc gccgtgtcgg atacggggcc cggcatcgcg gcggagcacg tcgggcggat     15240
     tttcgagcgt ttttatcgcg tcgatccgtc gcgccacaat tcggcgtcgg gcacggggct     15300
     cggcctcgcg atcgtccggt ctatcatgga caatcacggc ggcgaatgcg gcgtcgacag     15360
     cgagccgggc cgccgcacga ccttctggct gcgctttccg cgacggccgg ccgccatcag     15420
     cacctgacag cgcgggcgga cactcccgcg cgttcgccgc aaggcggcct cgcgcggcgc     15480
     gtcgccggcg gcggtgtggc tgcggttcat tacttcgcgg cgagggcgtc gtggttgtcg     15540
     gtctgcggct tcttctcgcc gccatggacc gaaatcccgt gcagttcctt gttgcgcgcg     15600
     acgacctcgg cggtcggcgg gtactgcgtc ttgttgatcg gcacgatgcc gtcgtgctgt     15660
     gcctgcttca gttcgttgat cacctgcgtg cgggacttgc cctgcgtttg cgtttgggcg     15720
     aacgcggcct gcgtggccat gccgagcgac agcgtggcgg tgacgaacag tgctgcgagt     15780
     tttgccgttt tcatcgagtg ctctccttga tcagggccgc cgggtggcga accatggacc     15840
     cagtatgcga aagcagccgt gcgtgatcgt gatagcgaga tgaaaaatgc gtcagattgc     15900
     gaggtgcggg atgtactgga cggactcggt cgatatgacg caatcgtcat gttcgcgtca     15960
     cggatgcgat gagcgggaag cggaacatga agcccgccgt tggccgatgc gccggcggca     16020
     ttcgtgccga tcgcgacagc cgcatcgatc gcgggcggcg tcgttcagac cttcattccg     16080
     gaccggaaat tgcctcgtcc cgccattcgc ctcgccttga tcgcagccct gaccgtcccg     16140
     ttgtacgcgg gctgcgtatc gactcgttcc gataccactg ccgccgcccg caaggcggca     16200
     ccggccaatc tgatgccggg cgagcaggta gactacgccg ggcatcgctg cggtaatccg     16260
     aacatgcatg ttaagacgca tccatgcctg ttcccgcagt ctaattccag gccgtgatcg     16320
     tcgaacgccc aaaaaaaagc ccggtactcg atgagtccgg gcccaatgcg tgatcgtgcc     16380
     gtgtggcagc gacccgctgc gtggatggga gcgggcaggg cccgccaccg ttccgatcgt     16440
     agcgccacga cacatcgcga agttgatcgg aacatgaaat tttcgtcaca cggcccgcat     16500
     ggttgatcgc cgtgattcag aaccggtggc gcaatccgag attgatgatg ccctgcgtgc     16560
     gcgtaccacc gtagccgtag gaaccgatcg acgcttgcgc tggctgcgtg ccgccgtcga     16620
     gcgtgcgctg ttcgccattc gcgcgctgcc acgcgccgac tgcatagaga tcggtgcgct     16680
     ttgacagcac gtagtcggcg ccggcggaca cctgatggta ggtcgcgctc gtatcgccgc     16740
     gcgccttcgt gtagctgtaa ccgacgccga cgagcaggct ggctgttgtc tgatagttga     16800
     agaatccgcg cgcggtgtcg tacttctgcg tgccgcgaaa ggccgacgtc gcatcggcct     16860
     tgtactgcgc attgctgtag tcgatgccga ccgtgaacgg cgcgaaggtg tagcgcaacg     16920
     caccgcgcgc gatgccgatc gatttcgcgg agatatagcc accgttgacg agcgacccgt     16980
     cgaatgtgcc gtccgatgtg ccgttccacc cggtccggat gccattggcg agcgatgaac     17040
     ggttggccgc gtagtagtag ccgcctgccg cgtcgaacgg gccgttgctg tacgacaggc     17100
     cggccgacca ggtttgcccg gcgccgctct tgccggctac gccgccaagc gcgtacatgc     17160
     cgacgaactg gaagccgccg accacgggtg acgtgtactt caccgcgttg tcggtgcgcg     17220
     acgacgtgtc gtagttatcg acgtcgccgg gcgtcgcgta cacgctgccg aagtagaaat     17280
     cgccggtgat cggccatgcg acatcggcga gcgcatcgta ctggcggccg atcgtcagcg     17340
     tcccccagcg cgcgctttcc agcccgacga acgcctgccg gccgaacatc cggttgcctt     17400
     gcccgagcgc gccggtgttt gggttgaagc cgttttccag cgtgaagatc gccttcagcc     17460
     cgccgccgag atcctccgcg cctttcacgc cgaagcggtt gccgagcagg ttcccgttac     17520
     cgaggccgac gaggttcttg ccttgcgcat cggcattcca cacatacgta agcgaagtat     17580
     cgaacaagcc gtagagcatc acttccgtgg catgcgcagc atgcgcggtc gtcagcagcg     17640
     ctcccgacat catgacgagt cgaaccggat tattcatggt gtgttcctga agttgaaggt     17700
     gatcgtttcg tgcatcgttc gatgccggcg ccgaacttgt gtcgcgacgg gccggaatat     17760
     cgcgattgcg gtggcgattc tggaaagcgt tcggatcgtg gaggtgatgg acaaatgaga     17820
     aaaatgtcat cgcggtgtca tgcgtgcgga aacatgcggt gatttcgatt cgtactgcga     17880
     tgtacaagat gcgcggacgg tgacgaaagc gtcatgaagc ggtcacgcat ccgcaccgcc     17940
     gcgggatcaa agtgacggct cctgtcacgg aattccagta aggagcccac cccatgaaca     18000
     ttccgcgtcc gctgatcggc attgccgccg tcgcgctgtc gattgccgcc ttctcgcagg     18060
     ccgtggccgc gcagccgaag agccgccagg aagtgtttca ggaactcgtg cgtgcgcgcc     18120
     acgacggcgt gatcccgagc ccgaatcacg actatccggc gagtccggcc gccgtcgcgc     18180
     gaaatcagga ggttcatcgc tcgaccgttc atcgtggcga gaagatgccg atggtcgacg     18240
     cgcacgacaa ccgcttcgcg gtgctttgat cgttgattca agaaaaggag gggcgatgcg     18300
     aaatatcgtg aaaggaatcg tgctggcggc gtgcctgatg tcgacggccg cgacggcggc     18360
     aggctggccg gaacgtgcgc tgtcgcacgc gccggcccac gacgtcggca gccgcgcgaa     18420
     cgagcggatg ctttgcgaat tcgcggtcgt gccagccggc gcgtggaccg cgaggtttgc     18480
     gcgcgggcta tgcgaagtcg acaacggctg gttgacgttc gtgccggccg ataccggaga     18540
     cgattcggcg gtcgcggaga cgcggatcat gctcggcgac gttcgcaccg cgtcgcatca     18600
     gtcacgcaag ctgaaggagc aactgcagct gaccacacgc gacgaagtga tcgcgctgaa     18660
     cgtgctggcc gacgacggca gccgcaagtc gcgcgaacat gcaatcgatc tctggaccgc     18720
     gttacgcgac gagggtgtca cgccggtcaa cggcacgcgg atcgtcgata cctatccgac     18780
     tggcgcgacg acctggtaac cgccgcgccg ttacgcccgg ttcatccgac tttcaccgat     18840
     ccttcgatca ggaagaacac gatgaagccg atgaagaacg aagccgtcgc gaacggcgat     18900
     tcgggcactt cgtgcgcttc gaccagcagt tcctcagtga cgaggtacaa cagagcgacg     18960
     gtgcccagcc ccagcagcgc tgcatagata ttcgccggca gcccggcgaa cgccgcattg     19020
     ccgacaacgg ccgcgacgct cagcagggcc gcgagcgcga ccggaacgac gatcgacagc     19080
     aagcggccga tgccagccgc ggccagcgcc gcgctgaccg aaagggcgag gaacaacacc     19140
     tcgagcgtca gtgcgacggt caggatgatg ccgctttcgt cgctcgcgga aaaggcaatg     19200
     ccgagcacca ggccgtcaac gacgaggtcg atcgcggtga tgatgatcag gctcaccggc     19260
     agccgcgctg tctcgaagcg cgtttcgatc gatccggata gctcgctgat cgcgagcatc     19320
     agtgcgatcc cgagcacgaa accgacgacg accggaatca acgcatgcgc acggtcttgg     19380
     ggcagcagtt caagcgcggc ggccgcgaac acgatgccgc ccgtgaaatg ctggatcacg     19440
     ctcgacgttt tcgggcccgg cgctcgccaa gcggccgcga gggcgccgaa acaggccgcc     19500
     agcacgggcg gtaacgtgag caaggcgagc tttgcagtcg gtgtcatgga gtccaagcgg     19560
     ttggcgtgtg gcaggcgggt agggctgaag ccaggtagcg atacacgatt ccgtcatgcc     19620
     ggaagcggca gcgaactcgt ccaacggcga attagggatc gaatacccgg aagggacttc     19680
     aggatcgtgg catttgacaa tggctggaaa ctcagtcgga ggatagctga cgattattga     19740
     atcgtattaa cgtggccggc gcgcggcaaa ctattcgttg tcaaaatcca cattcaatca     19800
     acgagttacg atcgtctaac ggctaatagt attcagatgc atcggtcgtg tccggccgcg     19860
     gcgacttccg gcggcggatc gtcagtgatc gccgcaaacg accagagatc gtccgagcca     19920
     gggatttcgg tgcgcgtcca caagcaagcg acctgcatgt gctgccgggg cgtcggatca     19980
     aagcgcagca cgacgttccg ctcgtcgcgc ttcacgttct cgaagaatgc gtcgaccagc     20040
     attagcccat gcgagaaccc gaacaccttg cgccacgccg tcgacaacga atcgacgcgc     20100
     gcattgtagg tgccgggctt ttgcctctca tcgcgctccg tccatccagg cagtcggcac     20160
     cgatagcgca tcggaacaat cacgcgcttc ccatcgagct caatcaacac gggcgcatac     20220
     caaccaggga aaattcggga atcgcgctcc tgcaggtcgg tccgacgaag atcctcgagg     20280
     ccgcgcatcg ccgcttcgat cttgtcggtg gcgattcgaa cgtcctcgct ggcggccttg     20340
     gtgaccttcg ccgccagctt tttctccgcg gccgcaagcc gtgtccgctg cttaaagagc     20400
     tcggattcaa gctcgctggc acggtgagtg cgatacgcga agatcgcggc cgaaatctcg     20460
     tcgtctccag ctgctgcaag cgccgcgtcg accgctttcg ggatcttgat gtcgccggac     20520
     gctgcacgcg caaaatacag gcgcctgaat gactcgatgt ccatgtcggc gccgtagcgg     20580
     cgcacgtatt cgcggtagtt agcttcgacc ttggcggaat agcacatcga cgtctccagt     20640
     cagctgcggc ataaaggcag gttacagcaa gtcgcggatc acgataaaca ccggacgctg     20700
     agcgtcccac cgcacgagag aatcggtctg gacagtgtga cgtttgacgt ggcgccgcgt     20760
     attacgactc gccgggccac cacggcttcg gggcgcgatc tatccgatag tcgtcgaggt     20820
     tcttcccgac cagccatttc ggacgagggc cgaatccgga ccattcctta cccgtcgacg     20880
     ggtcgtagta tttcgccgaa gtgcggcgct tacgcggctt acgaaagcct gcagccagca     20940
     aaagctcctc ctcggagatg ccgtatagcg cgacctgctc gcgaatggcg tccagtgcgg     21000
     cacgcttctc gtcgcgcttc acctccgcga gtcgggcgtt cacttcacgc aattgggcct     21060
     gaagagcctc gatatccgtc aacatgtcgt tcatcgtctg ttggaaaacc gcaggatggt     21120
     agccgagaac agcgggcact gaaacggcgg cgaatatcgc gcgatgcagt tggcaagcgt     21180
     cgaccggatc gctgcgccgg ttttccgagg aatcgcgtat ttccggggta cgaacgccca     21240
     taccgggcgt cagacggact tcctcgtaac agtcttcgaa gtggaggcat tacgagcata     21300
     gatgcgcagc agaaacaacg ctgcgttcat ctatcgatgc aaccgttgcg cgcaatgtta     21360
     tattgcacca agacatgcct catgccgcac acgaggccgc tctcattcta ttttggtggg     21420
     accaatgact gaagcaaagc gccccagagg ccgtccgccg acccgcgaag cgaagactgc     21480
     tactcagcgc gtcaacgcct tagatgaggc actaaaggcg tcgggggggc ggatcttgaa     21540
     tcgcacccgc ctgtcgcccg aggcaacagc cgcgctggct gcgctgtccg ggcattttgg     21600
     gacggacaga gccgcgatcg aagcagcatt gatcgatctt agtaagcgtt gcgcgcaacg     21660
     aaaaaagagg ctatattgac cttcatgatc gacgcacgct taccgataac ccgggaagga     21720
     agacaatgaa cctcgaccgc gcgatctcag tcctgaaata cacaacgatc ctcgctcttg     21780
     gcggatcggt cttctgcgtc ggcgtgcttt ggtcgtttcc gctcgatgtg cccgcgtggt     21840
     tcgcggcgac gtgcgccagc ctagcgattg cactagcaag cgccgtcggc gaaaccgtat     21900
     tgcgtcgtag gcgcacagga atgccgctga aggcaacggc gcgatagagg acgggaagcg     21960
     aaaagttgac cagacgagtc gtgcaccaca ttgtgcgcag cgaccgttcg ggggaaaccg     22020
     gctgaccaca atcagaagca gtgtccgcac gacaacgcaa agtgaaaatt tgtgagccgg     22080
     aaaaccggag aaactatggt gggaactgaa agattgccga tcgagctacc tgcaggatgg     22140
     attgcagaag acgattcccg agggaccgta atcaccgcaa tcgacgcacg cggacgaccg     22200
     gcaggctcgg tgacggtctg cacgaaggca cgaggttaca ccttgggagt ggcgaaggta     22260
     cgacgagcgc gagacgccgc cgaagatgtg tataaggggc tcggttggca ggttaggctt     22320
     tttagcgatg ctgtttgtgc attgagtcag acgctcgaaa actgagcaag gaaaaatact     22380
     gagcaaggtc aacatgatga acagcaaacg agccaaccga atgcttgccg acggtgaata     22440
     cgaggcaacg tgccgcgagc gcacaatatt ctcggcagcc gcgaatggcc acagtgctgt     22500
     gtttccgcgc gcaaggatgg tcgtgaagaa tggttgcgcg acattcaccc gcgacggcgc     22560
     ggaagtttgg aactgcaacg cgcgttacgc agcagcccac ttcgacgttc agcggatacc     22620
     gcaccggaaa acgcaatgaa cgaaaagctt tggacggtcg cacggtttcg cagtggaatt     22680
     tggagctttg gaggcaggcc tgcgacccat gtattaccga cggtaacggc gcgaacgcgc     22740
     gcagcatcta cgcaacggaa aacgtaatgg cgtctggaaa tgactcgcac ttcaagctgc     22800
     gtcgcccatg tgagaactgc ccgtttctca aggtcggggc tatcgagctc gcgcctggcc     22860
     gcctcgacgg tatcgtggac gccttggtga aggacgatcg aggcacgttt cactgccaca     22920
     agaccgtgca taacgagcga actggcgggg agtgggatgg cgatggcaac tatgtggcca     22980
     gcggccagga gagcatgtgt gcgggcgcga tgatctacct ggaaaagctc ggctgcccga     23040
     cagtagggat gcgtctgggt cgggtacttg gactctatga cccggatcgc ttgcggccgg     23100
     ctttcgccga cgtgattgat ccgagggaca gacaacgtga aaatcgcgat gatgaaatcc     23160
     gaaaacgacg agccgaggaa ggccgagatt gagtctctgg cacgtacgcg ggagccgcac     23220
     gtatgggcgc tggaccctcc ggactgttcg tcagcacagt accgcttggc gtcgatggag     23280
     cgggcagaag atgcgcttcg cgagcaacgc ggtcttgctc cgatcagacg ctacgattga     23340
     ccggcaaaag ccggcgctgc cgacatgaag gaaaacggtg gaacgggcac acacgcgtaa     23400
     ctgatttcgt tcgaagcgta gcgctcaggc tgacaaagag gaaacaaaaa atgcgaatgc     23460
     tcgcaacttt ggtggccctg gctactctcg gtatgggctg tctgtctttc ggccttgaga     23520
     ttgcacagca cctcccccat ccggccagca ccttcgcggc gatcgcgtcc ggcaccgttg     23580
     tgatcctgtt gctagtggct acccgccact gatgagtcgc cgtcagcgcg tcgagccgat     23640
     aggagtgcgg aaactagtca atgctggctc gaaggtcaca aggaaaagat tgagatggcg     23700
     cagaaattag atacagagtt ggatacctac cggtggcaga tcgagcacct ggggtgatcg     23760
     attatgcaac gcgcccagcg acaactcctc ggaacactga acgggaaggc ccggagccgc     23820
     tggcttggtc ctgtcgttga gcgcgcgaac ggccggagca gccggcacct agggaaacgc     23880
     tgatcaatgg accaacttcc gaagttgcag gcgagatggc ttcaaatttt ctggatgacg     23940
     aagcgaatcg gcgctcaatt cagtgaattt ggcgcgtaag cgagcctccc ctgctcgcat     24000
     ttttcatacg catgacggac tgctcccatg gaccgatcgc aacagatttc gcgcaatcac     24060
     cagattcgcc agagcgaaca ggctgaacag ttgcgcggtg ttcttggcca agcccttgta     24120
     tcgggtcttg cgatgctgaa acagattctt gacgatatga aacggatgct caacccgcga     24180
     acggatctgc gccttggttc gctcgagcgc gatcaccagg tccttcagcg ctccttcttg     24240
     catcgccttg atctttcccc gcctggcagc gacgtgccac ttcacggcct tgcccgccat     24300
     ttcctcgcgc ttgtcgacgc caatgtagcc cgcgtcggcg aacacctgct cttcatgccc     24360
     gtgcagcagg gcatgagctt gcgatacatc cgacacgttg gccgccgtgc caaccacact     24420
     gtgaatcagg cccgagtcgg cgtcgacgcc aatgtgggct ttcatgccaa agtgccattc     24480
     gttgcccttc ttcgtttgat gcatttccgg gtcacggctc ttcccggcat tcttggtcga     24540
     cggcggcgct tcaatgatcg tcgcgtcaac cagcgtgcct tccttcatca tcagcccacg     24600
     ctcgcacagc gagatgccaa tctcgtcgaa caacttccgt gtcagttcgt gttcgatcag     24660
     caggcgccgg aacttcaaca gcgtggttgc atcaggcacg ttctcgatcg ccagatcgat     24720
     gccggcgaag gctcgcagcg tgatgctgtc atacagcgcg tcttccagtc cttcgtccga     24780
     cagtccgtac cactgttgca cgaagtagat tcgcagcatc cgctcaaggc caatcggcgg     24840
     gcgacctcgc gtgcccttcg gatagtgcgg ttcgatggcc gacagcaagc gctgccacgg     24900
     aacgaccttc tccatctctt ccaggaagcg ttggcgcctc gtcactcgct tcttgcctgc     24960
     aatttccgct tccgcgaagc cgatctgcct cttcatcgtc gtgggtccgt tccgtgagct     25020
     gtcttctaaa cgtcctcggc tacgtctgcg atgaccgccg agccgaataa atcagcgttt     25080
     ccctagaaaa cgccggcacg ccggcatcga agaagagagg caaattttgt tggtactgca     25140
     agcgcttggg gtagccgtaa tgttgatcgt cagtttccag atggcgatgc tcatctggtc     25200
     gtcggagacg tcgctgagtg cggcgtatat ggacagttgg cggaaaactg gaacggtgtt     25260
     ggctcacctt ttccagattc agccaggtcc cagtcggcgg atcgggatca tcgcattcgg     25320
     tctcgtcggc ttctacctcg cgatcgcagc ggcaattgaa atcgtcgcgc cgctcggcca     25380
     ctgacctagc agaaaacaaa atgaccgaag cgctgataca ggaatgcgcg ggtcggaaaa     25440
     ggcagagatc gagcaactcg attgaacaat tgctcacatg gaaggctatc gcgagcagcg     25500
     agcgcgactc cgcgctgatg tgccccgcga atcacgaact gtaggaaaac agaacgatgt     25560
     ccgaggtagt cgcagaagca gagtggaagc aagaatcgcc ctacggctgg tcacacgcta     25620
     gcgggtggac gatcggaaga tacgtcgttt ccggtgtgtc tcgtttcatg ctttggcaag     25680
     gtcgcgatca ccgcggtaac ttcgacagcc tcgaagcagc tcaggcacat caaaaacaga     25740
     gcggctgaga actgagaaaa ggcgtgatga tggacgttgc cgcgcgtcaa acaagatgag     25800
     agcagcgcgt caatcaggat gagagtacgg gcgttgcggc agcggtggag ggcgtagccc     25860
     ggaaccgctg ccgcaacgcc gcgccgagga gtccgccccg ctgccggggt gccttgtcgg     25920
     tggtcgcggt aaatcgggta tgaacagctc ttccatgtag cgaagggagg ctgagttgcc     25980
     cggccgacac atcaacgacc atcagatgag gctctacatg aagtacagac tcaaggaggg     26040
     gccgccccaa gcggctgcgc gcgctgggtt cagcgccgct acgggctatc gcatcgaaga     26100
     ggatccgcga ttgccatcgc agaagaaggc cccgcgcggg cgtcgccggg ccgatcccct     26160
     ggccgcgatc tttgacaccg agatcgtgcc actgctccag tccgctcccg gcatccggcc     26220
     gatagccgta ctggacgaga tgcttcggcg ccatcccgac ctcccgggca acgtgcgccg     26280
     cacactggag cgccgtattc gcgactggcg cgcactccat ggtgaggagc atgacgtcat     26340
     gttccgtcag gtacaccagc ccggtcagct aggcttgtcc gacttcacag agatggacag     26400
     cctgggcgtc accgtggcgg gtgtcacgct ggaccaccgc ctctatcact tccggctggc     26460
     ctgctcgggc tttgagcacg ctcacgtcat tctcggcggc gagagctatg tcgcgctcgc     26520
     cgaagggctg cagaacgcta tctgggcact cgggggcgcg ccgcgcgagc accgcagcga     26580
     cagcctgtcg gcggcgttcc gcaatctcga tgccgacgcg cgcaaggatc tgaccacgcg     26640
     ttacgatgcg ctgtgcgccc actacggcat gcagcccaca cgcaacaacc gtggcgtcgc     26700
     ccacgagaac ggctccatcg agagccctca tggccacctc aagagcgcag tgcgtgatgc     26760
     gttgcttctg cgcggcagtc acgacttcga cgatctcggt tcctatcgcc gcttcatcga     26820
     cgagatcgtc ggtcgaatca acgcgcgtaa tggcaaacgc attgaggtcg agcgggcact     26880
     gcttcagccg cttccggtcc agcgtacgtg cgactacgag gaaacgcgcg tgtacgtcac     26940
     gaccacctgc ggtttcgtcc tgcgcaaggt gttctatacc gtcccgtcac gcctgatcgg     27000
     ccatcacctg cgcgtacggc tgtacgacga ccggctggaa ctgttcctgg gcggcacggc     27060
     cctgatgaca ctgcagcgcg gccgcgcggg tcccaatggc aagcacggcc acgtcatcaa     27120
     ctaccggcac gtcatccacg cgctgcgccg caagcccatg gcgctgctca acctggtcta     27180
     ccgcgatcag gtctttccgc gcgaggccta tcgcctgagc ttcgatcgcc tgctcgaaca     27240
     gctcccggag cgccaggcat gcaggaccat ggttgaactg ctcagcctgg cccacgagca     27300
     caactgcgaa gcccaactgg ccgaggcgct gcagcagtgc ctggacgatg gacagttacc     27360
     cgatctcgac gcactatgtt cgcgcttcga agcgaagccg acgagcagca tgccggaggt     27420
     gaacatccag ctcgccgcgc tgagcgacta cgaagccctg cttgacatgg caacggaggt     27480
     ggcagcatga gtctcgacat cgacgtcacc cgcctgtcgc tgttgctcaa cgatttgcgg     27540
     ctgcccgcca tcaagcagat ctggtccagt tttgccgagc gatccgacgc ggaaggctgg     27600
     ccggcagcac gcctgctgat ggcgctggct gaacacgaga tcgccgagcg cgatcgacgc     27660
     cgggtcgaac gtcacctcaa ggacgcaaag ctgctgccgg gcaagacgct ggagaacttc     27720
     gatttcgacg cggtgccgat ggtgtcccgc gcgcacgtct cggcgctttg cgctggcgat     27780
     ggctggttgc gtaacggcac caacctgatt cttctgggac cgagtggggg tggcaagtcg     27840
     cacttgtcgt cggccattgg actgagcctg ctggagaagg gctggaaggt cctgtttgcg     27900
     cgtaccaccg acctcgtgca gcggttgcag gtcgcgcgcc gcgagctcgc tctggaatcc     27960
     gccatcaacc ggctggatcg cttcgatttg gtcgtcctcg acgatttcgc ctatgtcagc     28020
     aaggatcagg ccgagacgtc ggtcctgttc gagctcatca gcgccagata tgagcgccgt     28080
     tctctttgca taacagcaaa tcaaccgttc ggcgaatggg acaaggtctt ccccgaccgg     28140
     gccatgacgg tggccgccgt cgaccggctg gtccatcact cgaccatctt tgagctgaac     28200
     gtcgaaagct accgtcgccg tactgccctg cagcgcaagc agcagggacc gggacgcccg     28260
     gccagtagag cgacaccgaa gaacgttggc gtgccaccga cacaggagga tcagcacggc     28320
     atcgacctca ccgaatgacc cgctgttctc atcctgattg acgcgcggct cgcaggcaaa     28380
     gctagccggc gtcaatcaac cccggcatca ccttccacgc gaccacattc tcatcctgat     28440
     tgtcgcgcag ccagaatacc tgcggcgtca ccattacaca gcaatcctca acgactcgtg     28500
     gcttcagctt gattgtcgcg cgacacccgc tcgccagcgt caatcaaaac cgcgcgtcaa     28560
     tcagtaaacg cttgccagcg tcaatcaaca tcggcatcat cattcctgcc gcgacattct     28620
     caagctgatt gtcgcgcgtc tctcatccag attgtcgcgc cacaggacgt caagcgaagt     28680
     gattttgacc gagcagttca gaagctgctc ggcactgagg cctacgagag cgcggttgtt     28740
     ctcacccaag cgtcagtccc ggcgcagtgc gatgctgttg cgcgggccat gcttcttggt     28800
     gaactcgcgt ccgacgacgg agaggcgatc gcgatcgtgc gtcttattgc gcaacggctc     28860
     atgcgcggcg tgggtgctca cggcctcact aacggctagg aacaggggaa agggatggtg     28920
     ttcgacatga tgaagcgcga aatgcgggag ctcgtcaacc ttgttgagga aacgactcaa     28980
     tgggaaacgt cggtcgcctg cggaaaggtg aatctcgcgg acgtttcggc agaagctcgc     29040
     gcggcgcatc acgcgcgctt agagcggatt gttgaattgc gcgcgaaata cgacctgtaa     29100
     cggtgaacgc gatgaagaag ctgtcgctga ctgtgacact ggcgacgctt gcaacaagcg     29160
     cggcagcggg ccagcaagtt cctttgatgc tggagacgag cttgcaagac gcaaatcctc     29220
     ggataatccg cctgagtgac gctgcgcatt gcaagtacgt tggtacactt cagccgtcga     29280
     ttggttggca aatcaccatc acggaaaaga catgcgagga tgctgtcgtt tcacgcgtct     29340
     ccctcatcgt gccgttgcgg aacctcaacg ctgagccggg atacgcggct gggtcggtcg     29400
     tgctggcgca ctcaccgaag taacgggtcg gccagatcga gggggcacgc gatgtgccgc     29460
     gaagtgcgat aggaaaagcg atgacggcaa aacagcgcct gagagcgaaa catccggacg     29520
     cagtggtagt gcgcgaagtc ggcacgttcg ccggagggcg cgtgcgatat gtcgtcaaac     29580
     tgaagcctaa ctcgcgcaag cctgtcggtt atggccaacg cgaatcgtgg gcgtgggcag     29640
     acgcctgtcg cgctcttggt ctataacaac ggaaagcggt ccatgaacga ggtcgcgaag     29700
     atgaacgcag acaaaggact tagctggctt gcattcgcga ttgccttcgc ggtgctgatt     29760
     gctgccatca tgcttcggta ccaatacgat cgtgaaggta cggttcgaat caaccgatgg     29820
     accggagaag ggcaagaatg gtgcgggctt gctaacggtc ggtgggcttg ggttgaggac     29880
     tgcttcgacg cacagaaccc tcactgatac gagaacctcc acccgctttt ttccagcttc     29940
     cgtagggttc ggatctgagt gaagggaccg gcgcgttcgg cctggctagc gtctccatcg     30000
     cgaccgtaat tgagatcgca acgcgtgcgg caacttaatc aaccggactc caacgggcag     30060
     gccgccactg ccaaaccgcg ctcgtgtatc agcatcgaga ccgagtatcc ggcgggagaa     30120
     ttcatacggc tcgcatggat actgtaccga tcgattgttg cgtcggctga tacgtctatc     30180
     gcgccacctc acgctaaccg acacgttccc ggcgaggtga cgaggcgtcg tgtctatcac     30240
     gccaccataa tccggcgtct attgcaccac tctgtcgcga ggctttgtcg ctcctgaagt     30300
     gtcgatcgca ccaccgttcg ggacgtctat cgcaccaccg gagttgaagg tcatgttctt     30360
     tcaatagctt acgcagtaag ggtttctgca gtaggaccag ccggcgcggc aggcgagtgc     30420
     catgtgttcg ctgtattttt tgcgggcgtc tattggacca ccggaaccga atctgtggat     30480
     aagtccggat gctgtgcgtc tatggcgcca ccgtgcgcgt ctatcagtcc cgcagagatc     30540
     gtctttcgca ccaccggtcg cgcgtcgaac ggaccacctc atcagcccat gtcccttgtg     30600
     caccggcgtt cagcaaatgc gtaaacgcgc gcgcggttaa ccgaattttt taacttggtt     30660
     ttaactccgg aatggaacgg cgccaccctc agtgaggggg ggctccaaag agcccccccg     30720
     gccgggttcg ccggctaaag ccggccccac ccacccggcc cccccccccg aactgcaata     30780
     tcgtggcccc tacggggcat ggatacgaaa cacccccctc aagtcacccc tttcgcgcgg     30840
     caggcactaa ggcgccgacg tgcctatggc acgccggccc ccaagtgcgc gtaaaagatc     30900
     accggggtgg cccgccaccc cggtgatcaa cgcgctcgtg tgctcgccca ttgccgagac     30960
     gcgccctcgc gcaaccaccg tctaccccat gctctgcaag gagggggctc gcggtctgaa     31020
     aaaggctccc atggaagcgc gtagaggctc ttggcgcggt ccggaagagt ccgaaagggg     31080
     ttgaggcgcc gagggcgctg ggcaaccggt cagcgcgcgg ataagcgttc gctcgcgaaa     31140
     ctgaccatac caacagggcg caacgccccg gcaaggcgca cctatgagcg tgcggggcgc     31200
     ccagcgatcg atagcggttt agtggaagcg gtcccgacga acgcgtcgga tctaacgtgc     31260
     ggcgcggacg cgggcaacaa gggccgcccg acgtgcttaa cttttggcca tgcccgctgc     31320
     acaaagccaa aggcccgctt gcgcgggcct ttgactgcct ttgggaaaga gaactgctag     31380
     agacgccctg atcgtcaggg ccggttaatt taaccgtaca atggctccgt ttgcaatata     31440
     cgtttaaaag tatcgtcatt tcattaagtg ataagaatta atattttctg tcggtcaaga     31500
     accaccacgc gcggtggttt gatgtacgcg gccgcggctt gtccggcttt ttttcagcca     31560
     tgatccgaac gcttccacaa cccttcgttg acgccttggc tgtcctagac gccagcattg     31620
     atagtcgcaa tgagtcgcta ctcgacgtac tcgcgtctat cgtgcacccc gacatgatct     31680
     gcagcctctt tgacgtttgt gcgctcgaag cggaagcgaa gcgtgtcgct ttgcgttgca     31740
     tcgactacgc gcttaccagc ggactcgacg ccgagcagtc ggcagcgctc ttcgccgtaa     31800
     ttgaaccgaa gatcgccgga cgcttctagc cgcggatccg cgttaggaac cagccgtcgc     31860
     gcggtacggg tggaccggtg cgccagcccc acccgtaccg cgcgacggta tctgacgagt     31920
     gcgctgttct accgtcctgc gcactaaaag gccgaaattg tgtcacgcgg cgccgctggc     31980
     gcttgccgcg tgaaagggcg ctcgccgcgc ggcgttctgt ctcgcgcgac gtcacgccct     32040
     gactccttct tccccctcat tcgtcgtcca tctccgcgac tgtagctgcg gcctgcgcac     32100
     catcaaggcg cgcggggccg tgtcagtcgc tgcgctccat cccgcaccgc cccgcgcgtc     32160
     gcccttgacg ttgctccggt cctcgctccg atcgtcgcgg gacgacgaac tcaggggaac     32220
     ggcggcaggc gcagcagcgg ccccgccgac tcgacagaac ggcttacgcc gggactcgga     32280
     atctatgggc ccggcgccac ccaacatgcg gatagagcag ccatgcaaac gatcgatttg     32340
     tttcctcatc ttcaacaacg gccgacgctt gatcagcgag tagagcgtgc cgtcgcggcc     32400
     ttgcggcggc tatttcacga gcgccgtatc gcgatctgcc agttcagcgc cggtaaggac     32460
     agtggcgtcg tagcggcgct gactctcgaa gccgcccgtc gacacgcggc agaaggaggc     32520
     gaggcggtcg tctacgtcgt taccgctgac accggggtcg agtcgcctga gatcgtagcg     32580
     cacgcccagc gggagttggc gaaaatgcac gcgtacggaa agcggcacaa cgtcagggtc     32640
     cacgtgcaaa cggtcgcgcc gtcactggcc acctcttggc aggtcacgat tctcagcggt     32700
     cgagcgctcc caagctatgc aggtacgaac tcggactgct cagtgagctt gaagatcgag     32760
     ccttccagag tgttccgaaa tcaactcgcg cgcgctgcga agcagcaggg gtatgctgag     32820
     ccggtcgtat gcctcggatc gaggtttgcc gaaagcgcga agcggaaggc cggcatgcaa     32880
     gcccgtggcg atcgtgccga tacacccgtg cgcaacgacg agggtgacct cacgctgtgt     32940
     gtgatcgctg actgggagac tgaggacgtc tgggagtaca tcggcgaagt aacgtcaggt     33000
     cttcggtcta cctacacgga cttccgagaa acctcgcgaa tctatgcgca cgcaggcaac     33060
     agcagctgcg cgatcgtctc agacctctca ttcgaagagg cgtcggccgg aaaacggaag     33120
     cgcagggggc actgcgacgc gcggacagga tgttggacgt gccaacaggc ggaagaccga     33180
     tcgctcgaag agatgatcaa atttgatgag gatcgctacg cgtatgcgag tggactgaac     33240
     cgcctcaaca agttcatccg tgcgattcgg tatgactggt cccgccgaaa ttgggtcggt     33300
     cgtaccatta aagaaggcta catctgcata gagccggaca cattcaacgc ggccactgtg     33360
     cgagagcttg tgcggtacat gatgacgatc gaccgagacg agctggtccg cgcaaagcgc     33420
     actggatcgc ggcccaaatt tcaaacgttg cccttgacga tgatgattgc cgtcgatgct     33480
     atgcaatcgc ttcaaggcct ggcaccaccc ttcgcgatat gggctgacta tcgtgacatc     33540
     tactgcaacg gcgttcgata cgatgttccg gacgttatgc cggtcgcgcc gcagccaatg     33600
     ccggagccta tgtttctgca tgtcggagag cactgggacg acaccgcgga tcagtggaca     33660
     gggttccgag atccgctgtt cgaggctttg actgaagact ctccatgtgc tcggaaagtt     33720
     caccatctca agggcgggcg aaccacttgg gaggtgccga ccggtaagcg gttcgaagtc     33780
     gacgaggaat cggccgagat gatcctggac ttcgaattcg agcgcctggt cgaaatgcat     33840
     gatgccggat tcttccctgg aggcatcacg gctgggtacc gttggtacct aaactatggc     33900
     acgctgacat tgtcacgagc acagcaacga gaacacgacg agatcgcgcg tcgtacagat     33960
     ttcaaagatc ggcttggact aacgctcgac tatgccgttg ctgatctgct tcgccgcgcg     34020
     gtgcgttttg cggcgttgcc gtcgccggcg cgcactgcat gggcacacaa ggcaacgacc     34080
     tccagtgcgc aagcagacct gccgttcgtg ctttgagcaa acgagtgctg gaattctcaa     34140
     ggtccgtgcc cagcaccttc agtcaaacaa caccgagatg gcggcagcga cggtcgcccg     34200
     taagtgcgcg cggtcggagc tgtggggttt tttgccattg cagggtactc gcactcgctg     34260
     cggctcgtcg catcgggccg atgcgggacc aggcgccaat agcgtcgaaa gcgcgagagg     34320
     agggcggttt gcgcggtcgc cccctcgatt tcggagtacg cgtcggggga tcgggggcga     34380
     ccatagcgcc acacgcgcga cctaagtggt cgttgctgcc caatatcagg cctttcagcg     34440
     gtaaagctgt cggcatcgag ccggatccgt ggcgaggaaa ctcgccacgg accgggaaac     34500
     aaactgaacg ctccagggct tcgcccggcg cttgccgccc attccagtcg ctccgcttcg     34560
     ctgcgcgaac aggcgctacc cgcgcgggcc tttcgcgcga tcgcaggtca cgcgttacgc     34620
     accgttcccc gtcatcgccc agttctgcga ccgtagtcct cgtcagcctc gcgtcaaggc     34680
     gtgcggggcc gtgtccttcg ctgcgcttcg tcccgcaccg cccccgccct tgcctccttg     34740
     acgcgacgcc tcctcgaact tccggagtcg cagggcgatg aactcagggg aacggcggca     34800
     acgctgcgac ccaatcagcg tccgccgaaa ggaaacccct acgaagggct ccgaatcttg     34860
     gggcccggtc agcaaacatc cacggagcta tgcaatgaca cgacgcgcaa cgaaacccca     34920
     actgcatgcc atgctgtacg tcgaacggga ccacaacgtt actgaactcg tcgttgagat     34980
     tcaacgcgcg gtggtcagtg cggtggggta cgagtattcg gggacgattg agcttcgcgc     35040
     cttcgtcagt cgcgaccatg cagtggcatt cggccatcgc gtcgtgttga acagtctcac     35100
     cccggaattg ggcgaattgc gcgctgccgt ccgcaagatc gaacgcattc agcagcgtat     35160
     gcgaagggtt gaaagggagc acggcgaggc agacaccttt gcggaatatg cccggcgcgg     35220
     gctgcaggcg gccggcgtca gtgtagtaca cgttgcgcga gatgcggctg gtcgtccacg     35280
     cggcgaatcc agctacatca ccgtgcttgc cgacgacgat ggcgtcctta tcgatacagc     35340
     agcacgcctc gaagcagtcg cactgatgct gttcggccgt cgtgtggagg cagcatgact     35400
     gcgcaactag ttgagcgatg ggagggtggt ggcaagcatg gccactatca aatcgacgtc     35460
     gaacgattcg aatcgcgacc gggtgtcccg ttcttcaata tccggaagtc gcgcgccggc     35520
     cgcgcatacg attcggtggt tgcccgctct tcatcagagg cacggcaacg gattcagcat     35580
     acggtcgatt gggggctggc tatcggccca acccaataca agcgcaccta ccgagacaca     35640
     aacctcgcgc cgattgaccg ggacggcgtg cttgtgctga cgccgccgcc gaaccagcac     35700
     gaacaggcag cgaaactgcg cctattcctc gtaaatcgca tcgggaactg caacggtaag     35760
     tggcgcggca agctccgggc ggaagaacaa cgagctctgc tgggccgcta ctttggtcgc     35820
     ggaacgcttg tgatcgacgg tgcacgtgcg cgcgtgcggt atcaggtcga gcatatgttc     35880
     ggcggcgaag tggaaacgaa agccgacgtt gcatgggcgg acctctaaac tgaaaaaact     35940
     gatcggacgc gggcactcaa tccggtgtcc gcgtcacgca atccatcatg aaggaatcca     36000
     acttgtattc cgtgacgttg ccgcgagagt ggccgcttgc cacatcgaac cgcgttcgga     36060
     acgcacaaat tcgcatcatc ctcaacacga tcgttactga cgccttatac gcgtggcaac     36120
     gtgctcccca cagaacgtgg aaagacatta gcagactggt cctccgccaa atggcgacgc     36180
     tcgaccggct ttacccgaac gcgggcgtgc ttgctccgac tgttcaggca attgctgttg     36240
     aattcttcgt gtcgaacgtt gaccgcgcca ttgttgactt cggacgccga gtgagcgatc     36300
     cacccgcggc gttcgatgga tctatggatg cccaccgcgt gtgtcgaact cctgcgcgca     36360
     ctacccaggc ccgccgaagc gggcagcagg gggacgggta gccgtcatct tcatgagctt     36420
     caactcgctc gaccgcactc catgggaccg ccatcggacc gcaattggca gggacggcga     36480
     tccgagtcct cgaccgggat cgccggtgac atgcgggccg ccgggcagcg ccttccgcgc     36540
     cggccggcgc tgccggccgg cacgtaagct gcgcacgcgg cggcccggaa tccggacact     36600
     tccgctcttg gggctgcgcc gcgtgccgcg gacttgcccc ggcgcgggcc atccctccag     36660
     cctcgcggcg ctcctcgcgt cgcgccggct cggatagcgc gctcgccgcg cgggcgttcc     36720
     ggctcgtcac ggagcaagca ctgtccgcac ccccgtcccc ctcgttcgtc gtccattccc     36780
     cgcgaccgta gcgtcggcct ctgccgcgtc aaggcgcgcg gggtccgtgt cggtcactgc     36840
     gctccctccc gcgcccaccc cgcgcttgac tccttgacgc gtcgccggct cgtcgctcga     36900
     ggcgtcgcgg gacgacgaac tcaggggaac ggcggcagct gcgaagcgcg gcccgccgac     36960
     tcgccagaac ctttcacgcc gggactcaga atcttggggc ccggtcagtc tatatttttt     37020
     aggagagctg tacgatggtg gaaacgattg agattggacc agcgccatgt gatgaggcat     37080
     gtgcgcaagt gggcgacatg cgctacctgg agcgtagccg agccgaatgc acggccttca     37140
     tcaaccaaat caggcgcacc ttgggcgaac cccccgacgg tgccagcctg ttcatcaaga     37200
     gcagcgccca cgacttcggg acatactggg aggtcgtggt caaagtaacc ggcggtctgt     37260
     cggccgacgc acgcgaagcg gcaatcgcct acgcgtatcg ctgtgagtcc gagtcgccga     37320
     cgacctggga tgacgatgcg cgccgtgagc tcactgaagc cggtttccct gtctctgagg     37380
     tggtctgata tgtttcacac cattggctac aaggggcatt tcatccatgt ctcgatcgag     37440
     cggggagttg agacagtcca aacacagatc atgcggaatg atggaggttt cgatctagag     37500
     cgccgcagga cattagttag cgcgcgacgc gcgatcacga aacacgtgca gaaccgagat     37560
     cgcactgagc aaagcgcgta actatcgttg ggcgagcgcg acgctcgccc catacgtatt     37620
     ggccgaattc tcgtggggcg tgggaacgga agaaggcgcg gacctaccga cgctgcactg     37680
     acggtggacc tgggcccgga agccagccgg gccgccgcac cttgcgcgcc ggccggcact     37740
     accggccgac acgcaagccg cgcacgcggc ggcccggaga ccaaacactt ccgctcttgg     37800
     ggctgcgccg cgtcccgcgg acttgccccg gcgcgggcca tccctccagc ctctcggcgc     37860
     tcctgacgtc gcgccgctcg gatagcgcgc tcgccgcgcg gggcgttctg gctcgtcgtg     37920
     gtaccggtgc tgccttcatc tccgtccccc tcgttcgccg tccacctccg cgactgtagc     37980
     tgcggccagc gcaacgtcaa gggcgcgcgg gaccgtgtca gtcgctgcgc tccctcccgc     38040
     accgacccgc gcgtcacccc ttgacgatgc actggtcctc gctccgatcg tcgcgggacg     38100
     acgaactcag gggaacggcg gcagctgcgg agcgcggccc gccgactcga cagaacggct     38160
     tacgccggga ctcagaatct tggggcccgg cggtcccgtc acaacttcaa tgttaatttt     38220
     gaggaatgct atgaaaaccg tgattgcaca agacgccaac gtgaacgccg atgcactgcc     38280
     cgccgacatg ccgaacatgc ttcgcgcagg gcaacgggaa gtgatgattc cgttgaaacg     38340
     gctggtcgct tcgccgtata accagcgtaa gaagaagcgc gatcaagcga ccattgtggc     38400
     aatcgcagac aacatgcttg ctgtcggtca actacagaac ctcgttgtgc ataaaatgcc     38460
     gcagagggcg aagaaggcgc aggagtgggg cgtcgacgcg ggggaaacgc gccgtcaagc     38520
     gttcctgttc aacgtcgagc gcggctacat gtcgatggac gatgaagtgc gttgcatcga     38580
     gatttcggag gcgcaggcga tccttgctag tgcgtcagaa aatgacttgc acgtaccccc     38640
     gcaccctgca gaccaattcg ctgcctacaa ggcgcttgca gacgagggcc gaagccctga     38700
     gttcattgcg gcagtcttca atgtcagtcc gaaggtcgtc gccggtcgat tgaagctcgc     38760
     gaacgtttcc ccgaagctct ttgaactgtt tgctgcggac gtcatcagcc tcgaacagat     38820
     caaggcgctt gccatcaccg acaaccacga gcgacaggaa gcggcgtggt tcggtgcaaa     38880
     gggacactgg aaccagagcc ctaacgcact gcgcaatgtg ctgaaaggcg agaaactgtc     38940
     gttcggggac cggatggtgc gattcgtgac tgtcgccgca tacgaagcag ccgggggaga     39000
     ggtggagcgc gacctgttcg cggagcaaga tgacggtttc atcgtcaatc gtgagctgct     39060
     ggctcgattg ttcgatgaga aaatcgcctg cacggtcgaa tcgatcaagg ccgaaggctg     39120
     gaattgggtt gaagcccgac cgaccttcga ctatgacgac cgcaaccagt ttacgcaact     39180
     ttattccact ccggttccgc tcactagcga cgaaaaggca aaatacgaag aagctcaaat     39240
     gcgggccgac gaactcagcg agaaaatcga ggcaagctac gatgccgaag tgggcgatgc     39300
     tgcgtacctc agcgacgagg accgggaaaa gctggacggc gagtgcaatc agctttacgc     39360
     gatcatgcag gaaatggacg accgcgacgg agagttcacc tcggagcaga tgaaagtgag     39420
     cggggcgatc gtcacggtcg gctacgacgg agcacttgaa atcgtgcgcg gcttggtgcg     39480
     tcgcgagaat cgggcgcaag cgcgtgcgat gatggaagag gcaggtcagt cggtcccgcg     39540
     tagcctgacc aagaaggtta aggggctgca ttcggagaaa ctgctgctca atctgacgtc     39600
     gcaccgcacg gcagcggttc aaaccgcgct tgttgcgaac cccggcgttg cgctcgtcgc     39660
     tgtcgcacac cgactgttgc tggagttcgt ctatgagcac tatagcgacc tcagtgctgt     39720
     gcagatcaag gaacagcagc cgatgtacag cgcggatcga gctgtgcccg gcatcaagga     39780
     gttgccccag tacgaccagc ttgcacggtc ggtgctggcg gtcactcgca tgattccgaa     39840
     aaacccgaac gaactgttcg gatggttgct cgaacagccg caagcggtag tcctgaacat     39900
     tctcgccgtt tgcacggctc tgagtctgaa tggtgtgagc cgcacggaag aaccgaatgc     39960
     tatcaatgcg ctcgccggcg ctctggaact tgacctcacg aagtactgga agcccacctg     40020
     cgagtcgtac cttaatcatg tctcgaagga tcgaatcgtt gcgatcgtga gtgacgtcat     40080
     ttcgaaggag catggggcga ggttggggaa aatgaagaag gcagaggcgg cgcaggaagc     40140
     ggaaaaactg cttgccgaca agaactggct tcccgaattc atggctgctg ccgaagtccg     40200
     taccgcgcga acctatttcg gcgatgacgg taatgagcag gaggatgcgg acggcgagct     40260
     cgcgacggcg gacaatctcg gagcccacga ggaagtgctg ggtgatgaac cggcgcaacc     40320
     tgacacggtc tcggatagtc cggacggtgc tgagaccggc gtgaagccag ccgacgtcgc     40380
     gccgacggaa tttgcgggag gccgagtcac tcaatcggcg cgattcccgt ggccgtttgc     40440
     gacgccgacg ccgaacgtgc tcgctggaag ccggccggcg gcttaattca acgatatctc     40500
     tgagcagtcg caaatttgcc ccgtcggtga cggggttttt ttttgtgcac tacctcgcgc     40560
     catccagcgt cgcacggcgc cttcctcaac gcgcctggcg gcgctaaatc gtccgggccg     40620
     tgcgccgagc gggatatcgg cggacgccga ccaaggggga accccgaccc ggttccccct     40680
     tggatccccc tccctcgggc gtgaaccgct ccatacatat caattgcaat catgtgcaaa     40740
     ggtgattaaa atttatccac cgtcccgcca gcgggacgaa attaatgcgt gagagagacc     40800
     aatcagaatg agcacgtcac cccggaacac gtcgccgtgc gcagtgccgg tcgccttcgc     40860
     gacgcactac gcacggcgac cggggcgacc atatatccat cgcgagcctg ggattcatcg     40920
     agtcgttcct cagaatcgga tggtgtggtg gtgccggacg tgcgtcgttc gatagaggaa     40980
     gaattcgcga gcgttaagct cgccgaccga taccacatcc aactggctct cgagcagcca     41040
     gatacatcgt ggtcttttcg gcgtcgggcg atcgcattct tcgcgtatat cgtcgcaatc     41100
     gcgactgctg gtgcactgct atggatactc gctccgcact ttgcttcttt agttggttgg     41160
     gtggtgccct cactggagga tctgacggat ttccgcgagg ttgtgggctg taccgctgca     41220
     gctcgcgatt ggtatctcgt caaaagggtg ctagttggat acgcggcgat gtgtgtgctg     41280
     ttgctgggcg gcctgttcgt gtgcctaggt gtacggtttc ttattttgaa acggaagcgg     41340
     cgagttgcaa attgaacgcc actcttggct tacgtaaccg aattgaggag gtatgcgaag     41400
     aattcacttg gggcgtcttt gctccgcaaa gaccggctat gttgcgctac gtccgcgcga     41460
     tgcgcggcct aagcgtcgag cctcctgcgg agtctcgccc cgcgcccttc gggcggggct     41520
     gccagcgcct cgccggccgc tcgctgcgct cccggaaagg ctcaccttcg ctctttcctg     41580
     ctcttagcat gctgcggttt gctcgtgccg tgccctcgga agcagcatgt tttgccccgc     41640
     accagcgggg cttttttttc gcttcgctct tcgtccatcc ggacgcgctg tcgcgtcgcg     41700
     cttcgcgcga tgggcgctcg ccgcgcggcg ccgagcctcc ggtattcctg ccctgcagct     41760
     ccgtcccccc ctttgtcctc gtccttgcgc gcgaccgtag gttcggcggc ccgtcggtca     41820
     aggcgctcgg ggccgtgttg tcgctacgcg actgcccgcc cctatcccct cgcttgcccc     41880
     cttgaccgac gggtcacctc acctgactag ttcgcgggac gaggaactca ggggaacggc     41940
     ggcagcagct gcgggtagcg ctgcgtcgac tcggccggta cgccgggact cagaatcttg     42000
     ggttccggtc ggctcaaaac caacggagaa cgcgatggta cgcaacggga aggtttcggg     42060
     gcaggggata agcaaagaat ttcatgcagc ggcgctgacc gttgtggtcg gctgcctgcc     42120
     gctcgacgcg atccgcctct gagaaaggag gtgtctcatg tacagcacaa ccatggcaaa     42180
     acgttcgact agtgggcagg ccagggccgt tgagcgcttt ctcgcctcag ttccgcaggg     42240
     aaaatcgtca cggcagcaag gaaacatcaa gtccaacgca tcgcaagcgc agcgaattta     42300
     ccttgcggta ccccccagag acattccgaa ggctcggtct ctcggggcgc atctcgatta     42360
     cgatcggcgc ctttgctgga tcgacgcgtc gatggatcgg acgccttttg ccgagtggat     42420
     cgtcgatgag accgtgcttg cgaatgccgg cattgaccca gaggaagcga tcgcggactt     42480
     cagcctcgcg atgcgtacct ttgggcttat ccccgacacc gtacgtgcgg atggagcctg     42540
     gcatacggcc aaagtcgaaa cgccggccgg accacgcaac agcggaagct acaagctcga     42600
     gcgtgttggt ggggagtggc ggggttacat ccgaaatttt aagggggcat ctggcccgtg     42660
     gcgctttcag aagggacgcc tgacacgcga gcaacgcgcc gcactcgagg cggccgatag     42720
     cgatcgccgt gcggcgcgcg ctgcaaaggt gatcgaggag cagcgcgaga tagcggcgag     42780
     ggcattaaag gtgctcgtga ccctgccgga agtcgaatgt gacgcgcacc cgtatttggc     42840
     ccgcaaaggg gtagccgcgc acggtctccg gattgcgagc ggccggggta tggacatgat     42900
     taccctgctg aacctggagc acttcaagtc gacatccgac gaatacttga tcgctcccgg     42960
     acgggatatt caagaccggc tgcgaactgt ccaggcgctc ggtcccgacg gaagcaagct     43020
     attcacgaag ggagcgcgaa agaccggtgc ctttcacctg atcggcgcgc gacgtgtcgc     43080
     tgacctcgta agcgcgccgg cggtgctgct ctcggaaggg tacgcaacgg gagcgtcgat     43140
     ttacgaagcg acgggcctac cggtggttgt gtgcttcgac gcaggcaacc tcgttgcggt     43200
     tgcgaaagac ctcgtgcacg tcctgccgcg gcggcaaccg aagctcgttt gcgccgacaa     43260
     cgaccagttt tttcttgaga cagccgtcac gcggattgcc gaactaggta gcgtggcgcc     43320
     tgagaccgaa tgctctttca aggtcaacgc gggaccccgg gacgcgactc gaaccgtgag     43380
     aatcgtcgat gcgatcgcgg acgggcaatg gcatgcgagc gcacacggaa agtaccggct     43440
     tgcggtggaa tgccgctgcg gggttgctcg ttctgtgacc gttgatgtga tcacggggag     43500
     cgacggaaag catgtccggt ccacgacgtc caacagaggt gtcgactcag ccgccgaagc     43560
     agcacggatc ctcagatgcc aggcgatcgt gcctgtattc aactccctcg tcgggcgtcc     43620
     gaccgatttc aatgacctcg caagcgccga aggtttggcg gccgtgcggg agcaggtcag     43680
     ggtgatgctg ccaagggaac ttgtatcgac caacgccact gaacggtgac ctatgcccac     43740
     aatccgttat tttttcgagc tcgatagcag tcagcagctg caagcccgcg ccctcgttgg     43800
     agacctcctg ccggaatggc attgttatct agtcagtggt cgcggtgagg tggcgcaggc     43860
     gcttcctctt cacccaatcg ttgagaccgg tagcatcaaa atgtcgacag ccgctcgagc     43920
     ggtgctcgcg tcacttgatc gccgtgagat ggagttcgtc attcggcacg cgatcggaga     43980
     ttggtcggag ctcccgtcga ctgagcatct tgcgaatcaa ctggcgatcg ccgagggggg     44040
     catcgtcacc tcgcggtttt cgctcgatcc ggcgacgtgg gtttacgtga cgacgcaggc     44100
     cgatcgctgc cagacacacg tgagcgttgg acgcgtcatc ccggcgaatc agtttccccc     44160
     ggtcgcacgg ctccggccgg ttacttcggg gagcgcgcgg acatgacact aaagctgctg     44220
     tcatggacag cccccgcagt gatcgccgga tgtattgccg agcttgcgat cgcgttggcg     44280
     gcatttgcct cgccagtcgc gagcgtcgca acggtgctca cgaccgcagc ccccgagggt     44340
     cgtgtgacct catatgcttt ttctccggac ggtaagggga tggatctcgt cttgtacggc     44400
     gtgggttcgg cgcatcgttc cattcacgtc ctggcgtacg taatgacgta tcggccgcta     44460
     atcgaggcgc tggcagcgaa ggcacgagcg ggggtccccg ttgcaatcgc cgttgactat     44520
     ggcgaaagca tcgcgaacga tcgagatggc tacatccgcc gcgggctcga ctatctcgcg     44580
     cgcgccggtg ctgccatatg cgtcgtggac cgatatcgct taatgcacga caaggcaatg     44640
     atactggacc accggagcgt ccagactgga agcatcaact acaccgcggc gggcgcaaaa     44700
     tcgaacagcg agaacgtggt gatcgcatgg aatgacccgg tattggcgga agccttcgag     44760
     cagcactttc ggtcaaggct ggcgcaatgc cgaccgctcg atcaagtgcg ctaggtgcac     44820
     tccagctcgc caagcgatct cgaggcgcct gcggtggaaa cgcggcaatt cgcaccgtag     44880
     cgctgcaatg gacccaaggc gaaatcgccc ctgatctcat gtggtcggac cacacgtgtc     44940
     cgtggcccgg cttcgccgga cgaaaggggc tgagcccctt tctcccgaac gcctgaagtg     45000
     aagcggccta cggccgcttg tgggcgctcg ccgcgcggcg tttctgccct cgcgcggtgt     45060
     gcagcgccct tcgccagccc cctgagttcg ccgtcccttt ccgcgacagt agcccttcgc     45120
     cgcgcccggc caagggttcg cttcgccgtg tcctcgcccg ttcggtgctc gcctgcggct     45180
     gcgctccgca tgcggcctcc gggcacgccc ttgtccggcc gcggctacgg gctcctttgt     45240
     cgccgggacg acgaactcag gggactggcg gcagcacaga agcagctgcc ggtcgggcag     45300
     aaacaaaccc tacgagggga ctcggaatct agggtcccgg tcagcctgaa acccttaaac     45360
     cgcacggagc aaccatgaaa tcgaatcttc ttcgccgcat cgccgctttc tttctgggct     45420
     gtgacctgaa cgcggaaatc cgtgtactgc accggtggcg ccgcgaggaa gacgatgttc     45480
     gcgcggtccg cgtggagacg gtggtgaacg gccagcgcaa gcgcgtcacg ctgtaccgcc     45540
     acgcccccgg cgcttggtcg ccgatgccac tctaaaaggt aactcgaagc gtgccctgag     45600
     cgatcggggc cgtccaacct aacgatgaat aggagtcgcc catgacgcat atcgagaacc     45660
     acgacgcggt ggatgccctc agcttccagt tcaaaccgta tggcaggaaa agggccgttc     45720
     cagatcgatt tcaatatcct ggattgcaca tgctgtacct cgagctcgag caagcgattg     45780
     gcatagccag ccatcgaccg tctgcatacg acttggcttg caagtacttg cgtagaggta     45840
     agtggagttt cgtcggggcg ctcctagcgg agtacgcccg tgcctttcag gtggaggatc     45900
     cttggaaaga gttcgacttg gttgcgattc atgcacgggg aaacgcggcg cttcgagcga     45960
     tcgcagcagg ctatcttaat gaggcaacca gtcaacgcga tgaagaggag gatctctgtt     46020
     gcggcggtcc gcatgcgctc cgacaagtcg cgcggaggcg agccgcagtc gcgcgaatgc     46080
     ttcgttggct tcgggcgaag cgcggtgaat acaagcagat ggtgactcac tggagccaga     46140
     tcggattttg aaggcgcgac gtgaaaccac tggatatcaa aaattcggaa gaaaggggct     46200
     gagccatgtc gctaaccact attgagcaga tcgagtgcgc aatcaatatc tggcgcgcac     46260
     gtcaccggcc ccggaaggca cgaacgaatg ccccacgctt tgcgccgagg cgcgcgagct     46320
     tgccaacgtt tacgcggtga tgattttcaa ccgcgaaacg ttcatcgacg ccgccggcct     46380
     gaacgcattc caggccgtcg cgctgcaggg cgcgctcgac gcccgcgaga attgagagac     46440
     catcatgcaa attccatgca ccatcacccg cgagcactac gccgacatcg accgcgccgg     46500
     acgttcctat acgctggaat tcgtccacta tgcacacgcc gaaacgggta accgtgtccg     46560
     gacaaaggcg catatcattc caaccgttga gcccttcaac cgtgaaccgg acgcgcccga     46620
     atgccagctc accggaaccg acccggcgcg tccgactacg cgcagctcgg tgtacctgga     46680
     cgctaacgag aacccggcga tccgcttgtc cttcggctac agccaccaga cgcgcgccac     46740
     gacgcaggta cttgcggtcg aacgtggacg cgtcgtaaca cagtggatga cacaggagca     46800
     gttcgacgcc gaatatgctg aaagcgacgt tccgccgctc gtcgctgcgc acgcgcttat     46860
     gaatatcgga cgtactggag gcatcgaccc gactgcgcac cgctatctgc tgttcgccct     46920
     gaatgcgcct gcatggcgac tcgctctgaa cgcatatgga gctgtcgcga ggaactggat     46980
     caggcgaacg acccagcagc tttactgatg gagattggaa tgaccgcata cacctacgaa     47040
     gacgcatgcg atatgacagt aacgcgtgct gaagccgagg ccgaaattgg acgccacgat     47100
     gtcgaaggcg gcttttctgc ctttctcgcc gaggttggcg atcgcccgga gtatgagggt     47160
     aaggaagtgc tcgactggct aggttactag gagaatcagg tgatttatcc gactcgctgc     47220
     ggtgtaaaaa tcgttcccgc caaggacagt ctgctgaccg tgagcgccga aagcacggat     47280
     gcggtcccgc cgctaattct ccgcgacctc ggaggctcag tattgctcga agtgcccgca     47340
     gacggtgcgt ggacgataga gcggcttgtc ggtctgctcg gcagtccgcg tgcgtgcgag     47400
     tgtgtgatcg acgccttcgg cgcagatgtc tttatcggta aggagtggat cggaggcacc     47460
     gaggtatgaa gacagcggac agcgcaaata ccgtcgaact ctgcattgtc gccatccacc     47520
     agtgcaccgg agggctgctt tcgatcatgg gacacgggtg ggtgagagtg cgccgtggag     47580
     gcatcgttga cggacgttgc accgggctgc gggagtacct tctaatacgc gcgcattggg     47640
     agcagaccgg tttctgacgt aaggcccgaa agggcctttt tcttcgcttc gctgtagacg     47700
     aagcagcgcc gccatctagt gccgccaagc ggcatgatta gcgatatgcc cgcttgcgcg     47760
     ggagccgaaa agggccttcg gccctttcgg acattcaccc ctgaagtgat gcggcctgcg     47820
     gccgcatgaa gggcgctcgc cgcgcggcgt ttttgccctc tcgcgcggac acgccgtcgc     47880
     cagtcccctg agtccgccgt cccttttcgc gacagtagcc cttcgccgcg cccggccaag     47940
     ggttcgcttc gccgtgtcct cgcccgttcg gtgctcgcct gcggctgcgc tccgcatgcg     48000
     gcctccgggc acgcccttgt ccgggcgcgg ctacgggctc ctttgtcgcc gggacgacga     48060
     actcagggga ctggcggcag cacagaagca gctgccggtc gggctaaaac aaaccctacg     48120
     aagggactcg gaatctaggg tcccggtcag cctgaaaccc ttaaaccgca cggagcaacc     48180
     atgaaatcga atcttcttcg ccgcatcgcc gctttctttc tgggctgtga cctgaacgcg     48240
     gaaatccgtg tactgcaccg gtggcgccgc gaggaagacg atgttcgcgc ggtccgcgtg     48300
     gagacggtgg tgaacggcca gcgcaagcgc gtcacgctgt accgccacgc ccccggcgct     48360
     tggtcgccga tgccactgta acgccccgga aggttcgccc cggtcagccc gggctatcga     48420
     tcacttaaga gacggaaccc acacgtgata caggagataa aaatgcgtgg cttggatgtt     48480
     cgagtgaact acgcgcttgc aaagatcaaa gcgattgtcg accctcaatc ggatttggtg     48540
     atcgcctcgc tgtacgacgc gcaggccgag gggtattacg actatcaggc aggggtctac     48600
     agcgtgccga cgatgtttgc ggacgtgccg gaactggtcg ccgagtggga gtgggggcag     48660
     cagatggccg aagaatgcga cgcggtttcg cagtgccccg actgccagaa cgatagcggc     48720
     aacccctgcc cggtgcacgg ctgagtgtgc caatccggcc cgctgcggcg ggccacaaca     48780
     gcccggagtt actatgacca aggtagaaac acccggcgcg ccgacgcccg ccgaagtgaa     48840
     gaaatttgac gatggacggc tcgccgtgcg ttgcgaatgc ttcgaatcga aggcttgcgg     48900
     gtagcagggc gcaccgaatt gaaatctcga ctttcgcctg cgaaagtcgc acctcggcga     48960
     gctagggtgg gcagtttcgg gcccctagcg ctgctatcca gatttggcgc aattccttgc     49020
     tccaaattga atcgtccgat ccgtctcctg gcgctagcgc gccactcgtc agatctaccg     49080
     tacgggtatc cgctccgcat tgcattgctg cgcaatgcac atgctcgcgc cgtcgcgagc     49140
     cggtcaccct gtgacccgct cgcgagaagc cccagccttt cgcgagagta ccgatcacga     49200
     aaaatcaacg attctcgggg acagcgcggt tgtcggaagc tgctatccag atcccgctcg     49260
     tctccgatcg ggataaggtg atttttgagt gagtttcgac ggctgcgccg cctacactcc     49320
     ctgacgtcgg attgacgacg tcggccggcg ctctcgcggc gcatccgcgc cgcgatcgct     49380
     ttcgaccgcc ggtcgcaccg cagccgcccg tggcccagtg cagcgcgttt cccaacaagc     49440
     cccaccgcag cccgcgccga atgagatacc cacaacaaac gacgttgtgg atatctcgcg     49500
     cggcggacgg ctcttgcgat ccaaacgaat cgctgccgtc cgttcgctgc cgtggatttg     49560
     tggaaaacgc tatgccgcct gttccgcgcc tttggcttcg cttacaccgc tcccgacgtc     49620
     ggtcgcaccg cgaccaacgc cgaggaccgt cttcagctcc ggcatcgccg ccttccactt     49680
     ttcgatcgga atcgtatcga cgccttcgct tttgaacagg tcgagaatcg ccttacggtt     49740
     cctctccaag ttctgacgct cttcaagctt cttctgctct ttcagactcg ccacgagcct     49800
     ttcggcctcg gcgatcctct cctcaagaga cgctgccggt cggcggccgc gcggcttgtg     49860
     agttcctgat ttttcctggt tcattggact cctcgaatag tgatgatgga ccggacgatg     49920
     ccggctgcgt gcgcccgaga atccccgctt tctcacgcct caaaagcaat tcccggcatc     49980
     gtcctgttgt cgtggcgcat gccgttgtcc gccatctatc cgatcgcggg aaagtcaaag     50040
     ccgcccctcc acaaaagcac agacatgacg cacgtaccgt gcagacgtca aaaccatcgc     50100
     aagcagatga tttatcgcgc ttttttgcgc accacaatta taatcactac ttccactgat     50160
     gtaaatttct gtctagaatc agcaacagaa tcattgggtt agtaagtggt gcagattgca     50220
     ccacccgata tcaaaaccaa gtttttgcgg agagaccaaa ccgtgactct gaaatctgtc     50280
     cacttccgcg tggactggaa ggaattcgag atgctggagg aagaggccag gaagagaaag     50340
     ctaaccccta acgcgtacgc gaagcttctt catcgtgacg ctttagcgaa ctacgacaga     50400
     cggcatgaag tgttgctgga tcaacttgag gccctccggg gccagtacgc ggagctgcat     50460
     acgctgttgg taaagacggc agccctctcg gccggggccg ttgccgcggc ttcaattcca     50520
     cccggtatgg cgacgtctat accggcgcca atgagggaac aggtgaaagg ccatatcacc     50580
     gcttcggtga gggaaggcga gcggatcagt cgcgcgtttg atgaaggtgt cttcagggta     50640
     gggggccccg atgctgctgc cgattaagtt tgcctctata aacgagccgg tgcatttgcg     50700
     gccaggcaaa taccgcgtca cgtgttcgac ctacgtgagt ccgtcccgta gcgagtgtgc     50760
     gtttcagttc gaataccaac tcgcgggggg gccaaccgtt actgcgatcg acatgatttt     50820
     tgtgggacgt gacggagcta tccgagcggc cgattttctg agaatgcctg ataggagatg     50880
     gcgcgacaat ttcggtgcgc ggtctgagga gctggccatg ctgttgccga cggaagtact     50940
     cgattttcaa cttgtccgcg ttgacgactg cggcgttcag gtcatagcgg aggcggcatg     51000
     accgaaaagg taatctccga tgccggcgcg ggacgcgcgc ttttcatgac tcgggtcaag     51060
     ctgactgtcc atgctgcctc gatggcattt tttgtcgggg cgttgccggc gatggttctg     51120
     ccgagcgtct ggtggatgaa cacgcttact gctcatgatg tcgacctcgt taaggccaat     51180
     atcttgtccc acgtcgtcga tcaggaggta ccgcgacgct ggcggattcg cgatggtgtt     51240
     ggggagaaaa agatcctcac cgtcgtcaaa tccgacggcg agctcgccca gtggttaact     51300
     ccccctcagt ttaggaacgt tgtacccgac cttgctcggc cagtcacggc attccgatat     51360
     gtcgcgtggg tcagcgtcgg acttggtgcg gccggctatt acgcggtttg gcggtccctt     51420
     gcgcggctcg gtcggcgggc tcgtgagaac aagcgcgtcg acggagcgtt ggacgtcgtc     51480
     tcggctgaag agctgtcgaa agctgtacgc cgcgaggagg cggggccgta taccgtcctt     51540
     gacgtggccc ttcctcgatc tgcgccgatg cagggcatta tgtttgtcgg ggcgcaagga     51600
     acaggcaaat cgttgggtat tcacgatctt atgggccagg tgttcgcgcg cggccgaaag     51660
     tcggtaattt acgatcatgc cggcgaatac tttcgagcgt actaccgtcc cggaaaagac     51720
     ctgttcttta atcccgccct gcttggctcg gtcccttggt cgatgttcat ggagatggag     51780
     aacacctacg attcggacac gcttgcacac gcattcttgc cgcctaaggc gggggtcgtg     51840
     catggtgcga gcgcattctt tgaggacgca gcgcgagtgc tattttcggt gatggcctta     51900
     cgcttgcgtc aacgcggggc ggtctatacc cgcctgattt ccgaggccat cctttccatg     51960
     ccggaggacg agcttgagct cttgatcaag aattctgttg cgagctcggc agtcggcggc     52020
     gactccaagg ggcagcgtca aggggtgatc agttcaatcg ccatctactt gaacggaatc     52080
     gccgcggttc aggacggcac ttggacgctc cgcgagttct acgaaaagga cgacgacacg     52140
     cgacttttcc tcatcggcac cgaggacacg tatgcgatgt tcgcaccgct atttcgcctc     52200
     ttgatcacga tggcatttca gacgattgcc gcgcgccggg aaattcgtca cgaggaccgc     52260
     tattggtttt ttcttgatga aacgcatgtc cttggtgaca tcaagctgga cgcccggcaa     52320
     gcggagttgc ggaagtacgg ggtttgcgtc gccgctggca ttcaagcaga caagcagttc     52380
     aatacgtcca tgggtgcgga ccgcgccgaa acgctaatga actgcttcaa caccactgtt     52440
     acgctccgtc tcaatgaacc gaacatgcag gagcgaatgg cgcggcgctt ggggaagagt     52500
     gagacagccg tagtcagggc gggacaggcg atcgccgtga ccgattggcg tgacgggggg     52560
     cagcttagcc aggacgagcg cgaaaagtgg gtggtcatgc catcgaagat tgggttgctg     52620
     aaaaactgca tggcatacgt tcaggttgcc ggtgactttc cgccggcatt ggtgaactac     52680
     cgccactggc tacctcgatg gtatcgaccg tggccacgaa ccttgcgatt ccgcgagagg     52740
     cagccggacc cgccacgcga tccgcggttc aagatatccg ccgcggatgg tcaagatgcg     52800
     atagaaagcg tccgggccga ggcggaagca atgaaggccc aagctgctgc agcggcagcg     52860
     gcagcggcaa ccagtccgac ggcggccgta acgacgcagg gaaagtggat cgtcaccgat     52920
     ctagacactg gcgaagtgat gcttccgaca gccgacgtcg ggcgtggcga tgaacatagc     52980
     gacggtcgag agccggtctc gcaagaaaat gaggggttgt tctgatgaag tcgctatttc     53040
     gaaaatggct gctgatggta gccgcgggcg ccgtcatcgt aagctggttg ttttcctctc     53100
     aactgtgggg catcgctgcg gattggatag ggcgccagga cggcgcaacg cgagttctat     53160
     cagctgcgga aatcgctgaa attcgagcga tccgttatct acccgaggac caccaggtga     53220
     ccacagtcac ggtatcggat ctccgcgtgc ttgcgcataa cgggaagaca gcaaccgtcg     53280
     aattgcaact ggcgagcagc aaacccacga tgctctaccc agcaattcgc gtgtacttgc     53340
     gatcaggaag tcgcaccgtt cgcacgctgc tttatcgagc gacagaatac gcacatcgcg     53400
     accgccttga aagcgaaccg gtacgccttg tcatcccgct gcaagcaggg gaaacgggat     53460
     tcactgcgac agcattcttc gacttcagtg gggtgtgagg gtgatttcga aggaaccgat     53520
     tcgtagcgtc gccgatgctg cgagatatca cgacaagtct tttaacaaag acgcggggaa     53580
     gaaggctgac aactactatg taaacgagaa agcgacggct cactggcagg gacgcggtgc     53640
     cgattttctc ggtatcaggg ggaaggcagt tacgaaagag gagttcattc aattcctaag     53700
     cgggcggatg ccgcatccgg acactggcaa gatccagaat ctggcgaaca acagtaaggg     53760
     ggacaagcgc cgggcgggta tcgacttcac gattgcgccg ccgaaaagcg tgtcgatcgc     53820
     ggcattggtt gggaaggacg accgtgtgat cgcggcgcac cttgcagcga atgcgcggac     53880
     gatggaatgg tttgagaagc atgcttctct gattcgcgtg aaagacgaaa agggaagaaa     53940
     ccggccggaa gtggccggca acttgctgta tgcgacggtg ctgcacgaaa ctaaccggga     54000
     gaacgagccg cagcttcata accacaacgt gatcgtatcc gctgtttacg atggggcacg     54060
     ccattcgtgg cgcagcctta ccaacgacct gttgtacacg ctacgggcgc gcggcgacat     54120
     catttacaaa gcggagctcg cggctgccct gcgacatctt ggttaccaac ttgtgtatgc     54180
     ggagaacggc atcgatttcg agctgaaggg cttttcacgc gatcacgtcg acacattcag     54240
     tacccgcgcg gtccaggtcc gcgaggcgct tttgaagcat ggcatagatc cgggcgaagc     54300
     tagctttgat gcacgcaggg tagccaaact cgacagccga gcagccaagc aggagcaccc     54360
     ccgggagatt ctgcagtcgg tgtgggagga gacggcgaaa gaagcaaatt tggacgtggc     54420
     ctcgatcgta gaacgcgcgc gggaggcgtt cgctgatcgg caagttccgc gacgcggtgt     54480
     agagcgaacg gtggagcacg gggcggcgat ggggcaggat tccgggccaa gtcggggcgc     54540
     agcagttagc gtttcgaacg atgctcgagc gaacgctctg cgggcagtct cctgggcgat     54600
     cgaacatttg accgaacggg agcaggcttt cacactcgtt gatctcgagg tcacggcgtt     54660
     gaagttcagt cgcggcagca tttctgagat cgagtgggcg atcgatcagc atgtgcgtaa     54720
     ccatatgctg gtcgatcgcg gcatcacggt gggcggccag atccaataca cgacccacaa     54780
     ggcgatcgat aacgagctta agcttgcgga gcacattctc gccggccgag gtcagggaaa     54840
     cgttgtgctc gatgcggaag accaattcga cgccgcggtc gcggcattcg aagcgaagaa     54900
     gacagccgaa attggagagc agtttaagct ctccggggaa cagatacagg cggctcgcaa     54960
     tgtcctgatg catgaagatt cgattcaggg cattcagggc gaggccggga caggcaagac     55020
     ggcggcgtta gcgatggtga aggacgtcgc tcaagcgatg gggtgggagg taattggcgt     55080
     ggcgacctcc gcagcggccg cgaaggagct cgaggcttcg agcggcatcc aaagcgatac     55140
     cgttgcaggg tatttcgcga aacgagacag tgccatccgg gcggtcgagc ttcggcttca     55200
     agacctacgg aagtcgatct cggaacgggc gacgctccgg ggcctcgacg atcagcgaat     55260
     cgaggctcgg acgttggcgg taaagagcga agatattgac tacggcaccc acaggtacac     55320
     gtttgatcat cagcggggtg aagtcttccg gtcgccggag aaccttcgca atgcgatcgg     55380
     ggcagcgtta tcggaaatcg cggcgcgtca cagagaagcg gccggaactg aacagggaca     55440
     ccctgtaacg ctcggcgaac aggctaggga gacggtgcgt gctgcagcgg ctaacgttgc     55500
     ggcgtccctc ggccgtcgac tcatgacatt cgaacagatc ggaacagcag aggctgtcgc     55560
     ggcgcggaac acgctttacc ttgagcggca agggtccgca acggaactcg atgcggaata     55620
     cgctcggacg caggcaaagc tcgaaaacct tcggcggtac gggaacgttg acggaaagaa     55680
     gactctgatc gtgatggatg aatcgtcctt gaccggcgtg gacgacacgg agaaactcct     55740
     acgattcgcg cgcgaaatcg gcgcgcggac cgtcctgcaa ggcgacgtga agcagcacgg     55800
     cagtgttgca gccggtcggg cgttcgaaca agcgcagatc gcagggatga acgtgtcaat     55860
     tctcgaggag acgcggcgtt ttcgggacgc taccgcgcaa acacgccaag ccctcgcgga     55920
     catgaaggcg gggaactacg cacaggcgat cgcgcgtctc gacaccctgc gtgtagcgga     55980
     atcagacctt gcaaaaactg tagcggagag gtacctggag aacctccagg aattgacggc     56040
     aaagggtgtc gatgcgccga aggtcggtgt ggtcgcgatc accaacagcg accggaaatt     56100
     gataaacgcc gctgttcatc aggctttgac cgatgtaggg atcatcagcg gcccgcactt     56160
     cgaaaagcca caccttgacg acccgaagat gaccggcgcc gagcaacgct acgcatcaat     56220
     gctgtctcga aatcgggtag atgcgctcat ctatcgaaag agctaccgcg aaatcggcgt     56280
     tgaaaaaggc gacgtgctca cagtgactgg gtatgacgtc cagaagaacc ggatctatgc     56340
     gctgaatgcc aaaggaaagt cggtggagat taaccctcaa cgccaagact acttttcccc     56400
     ggcgattcaa gagtcgcgcg ttttcgccgt aggtgaccga gtcgaaacca gggcgatcat     56460
     acgccttcca ggtcaggagt tgaatcggct agacaatggc acgcaaggcg ttattgtcgc     56520
     gatcgacagc cttggtgcca agattcgatg gtatcgagat ggaaaggagt cggacctaaa     56580
     gaacgacgac ctgcggtttg tggatcatgc gtacgctcac acgtcgtaca aggagcaagg     56640
     ggccacgaac caccgggaaa ttgtggcggt cagcaagatc ggtgcgcgcg tgttcaatcg     56700
     tgaggccgcg tatgttgctg cgtcgcgagc gaaagacaac accgagatca tcacctcgga     56760
     tttggatacg ctacttcgca acgccggtag ggaagtgggc aagacaacag cagtcgagtt     56820
     tgaacgggct gagtcttccc ttgatcagag tgctgaccaa ggggcgaagc acggtgctac     56880
     tcggagtatt gaggtagcac cgactcgttc ggtggaaacc gagcgaacct tggagcgttc     56940
     acccgaccct ggaaacttgt taggctttta atctggcggc cggtgcaacc ggccattagc     57000
     ggtgatgctc atctccgggt tcgagcgaca gcgtccgcaa ctttttagtc cgcagcggca     57060
     actacatctc tctagtcaag ccggtcgaca ggtgcgtcgc agcggacact ttctgctttc     57120
     catcgtgctc gctcgtgaca ctacctcagc agcaatcaca aaagaccaag gcgatcgggc     57180
     cgcacgatcg tcgggccaat gaagaccagc ttgcgcagcg atgcctgcgg accgtgcggt     57240
     tgcatccgga aatgcgggcg gcgccagtga ccgcgtactt cgtggaccga agcttccgtc     57300
     ggcacactgc ctgctgagtc gacatcaaga atcgcaggcc cgataaggtg ccgatcgtag     57360
     agcatgtcga tttcggctag gcgctcgttc cgctttcgct gacctagccc agggaacgat     57420
     cgcggtgcat cggagtaggg gcgctcatgg accacgtttg cgtcgcgggc tttgagatac     57480
     aggagcatct tgaccgcgta gtcgattgcg tattccggcg aacgtgatca cgcatttcgg     57540
     cggatcgtga tcatggattc cgaatgatcg tgatcacccg tttcggttga tcgtgatcgc     57600
     tgatcacagg tttccgaaac gcgtgatcac gatgccggaa tgagcgatca cgggaccgaa     57660
     acgggtgatc acgtaaccgg aacgtaatcc gggtttgagt ctggcggtgg cgttgcgcat     57720
     gtattcaccg acggcgttag cctgctccct tttttgcggg agaagtgccg atgccgacac     57780
     ctcggatgag catgcgcaaa ttgaaggaag tcctgcgact aaagtgggcg tgtggcctga     57840
     cgcatcggca gatcagccgg gctatcggca tcagcgtcgg tgccgtctcg aagttcgcgg     57900
     cccaagccag ccaggcggga ctcgattggg cggcagccga agcaatgtcc gacgacgaac     57960
     tggacgcgcg cctgaggcct gcggcaacca atgccgcggc gacgacgacg cgacgcatcg     58020
     agcccgacta cacggcattg catcgcgagc tgcgccgcaa gggcgtgacg ctgcaactgc     58080
     tgtgggaaga atacgctgaa gcgaaccccg gccagcggac gtaccgctac acgcagttct     58140
     gccagaagta caaggattgg gcgaagtcga tcaagcgctc gatgcgtcag cagcaccgcg     58200
     ccggcgagaa gctgttcgcg gacttcgcgg gtcccaccgt gccggtcctg gcgagcgatg     58260
     gcggcgtcga gttcgaggcg cacgtgttcg ttgccgtgct cggcgcatcc aactacacgt     58320
     tcgcgtgcgc gacgcgcacc gagacgatgg cggactggat cggcagcctg tgcgatgcgc     58380
     tagagttcat tggcggcgtg cccgagctgc tcgtgcccga caacccgaag gcgctgatcg     58440
     cgcgacccga ccgttacgaa cccggactcg gcacgaccac gcaggacttc gtgaaccact     58500
     acggcaccgc gatgctgccg gcgcgtccgc gcaaaccgca ggacaaggcc aaggtcgaag     58560
     tcggcgtgca gatcgtcgag cgctgggtgc tggcccgact gcgccactat cgcttctaca     58620
     gtctggctga actcaacaag gcgattgcag aactgatcgc cgacctaaac cagcgcccgt     58680
     tcaagcggct cgaaggcaac cggcgtgaat ggttcgaacg gctggaccaa cccgtcctgc     58740
     gcccgttgcc cgtgcgtcgc tacgagatcg ccaccttcca gaagtgccgt gtgaacatcg     58800
     attaccacgt cgatgtcggc ggccactatt acagcgtccc gcatagcctc gcacggcagg     58860
     aggtctgggc gcgtatcaca cgccacggcg tagagatcct gcatggcggc aagcgtgtcg     58920
     ctgcgcacgc tcgctcgcgc ctcaaaggca aacacacgac catcgccgaa cacatgccgg     58980
     ctgcgcatcg cgcgcacatg gaatggacgc ctgggcgcct gctcaactgg ggcgcatccg     59040
     tcggccccgg cgccgaggct gtcgtgcggc atctgctgac caacaaacct caccccgaga     59100
     tgggctatcg cgcctgtctc ggtcttctct cgctcgcgcg caagtacggc aaacaccgcc     59160
     tcgaggccgc atgccagcgt gcattgaaga tcggctcgcc cacgcgtcgc tccgtgctgt     59220
     caatcctgga agcgggactt gacctgcagc cctcgctccc gaccacgccc gccgaatggc     59280
     gctcgcccga gcacgagaac gtgcgcggcc ccgactacta ccactgaccc gaaggaggtc     59340
     acgatgttga tgcagcacac ccttacccag ctaaaggcgc tcaaactgga cggcatggct     59400
     cgcgcgttcg aggagcagtc aacgctcacg gcaagcacca gcctgtcatt cgaggaacgc     59460
     gtgggcatgc tcgtagatcg cgagctggcc tggcgtgata cgcgacgact cgaacgtttg     59520
     ctgcgcgccg cgaagctcaa gaacccacag gcctgcgtcg aagacattga ataccggcaa     59580
     acccgtgggc tggaccagcg catcgtcgcc acgctcgccg gctgcgactg ggtgcgcaat     59640
     gctcagaacc tgatcctgac cggccccacc ggcgcgggca agacgtggct cgcttgcgcg     59700
     ttcggccagc aggcgtgccg gcagggcttc tccgtgttct atgtgcgcgt cgcgcggctg     59760
     ttcgaagagc tgaaaatcgc gcacggcgac ggcagcttca cacgtcggct tgcgcaactc     59820
     gcgaagattg atgtgctgat cctcgacgat tggggcttgc aggatctcga ccaggcggcg     59880
     cgcaatgatc tgcttgaggt acttgatgat cgtgtcggta cgcgctcgac tgtgatcacc     59940
     agccagttgc cgctcgaaca ctggcacgcg tggctgcagg accccacgct cgccgatgcg     60000
     attctcgatc ggctcgtgca tcaggcccac aagcttccgg tcaagggcga ttcgatgaga     60060
     aagaaaacga aatccgagtc cgctgacgcc tgatcgtgat caccgtcgct ataatccatt     60120
     gaccgcgcaa caccaccttc cagactgatc acgttcgccg aaacgattga tcaccatcgc     60180
     cgaaatccgc atagtcgatt gattcgcgca gatacgcgcg gagcgtttga taggttttcg     60240
     acgatccgca aacctcgtcg agcaacgcgc cgatggtccg atccggcttg tccaacggca     60300
     gctcgacaac gtcaatcgtc gcgtctcgct ggccgtcgtg aaggcgcatg atccaggtgg     60360
     cacagcccaa ggtctgcccg ttcctgaaaa agactgtggc gtcactacgc tccccttgac     60420
     cccaagacga gggctccgga atgatgcaca gtgtgtcggc gggaaactcg acggcgccga     60480
     tcggcacatc gtcagaaatg tacgagtcgt cgagcaggcg atgcaggggc ggagtgggtt     60540
     cgaaaatcaa cccgttccgg aggtcgaacg cctgccagat cgcactatgc gctgcaactg     60600
     ttccggcctc gtccggcatc atttccgggg tgccgtatgg aagcagccgt tttgcaagct     60660
     cgtcaaactg gttgaccagt gcaacgatcg agcgtgtgcg cagcatctcc gatacgttgt     60720
     tcggcccctg ttcgacgacc cggcgccacg cttcccacgc tttggccgcg cctgtcgcgc     60780
     ggaagcggac gaaagcaggc aagcgctcat aacgcggatc gtcggcgagc gcacttttac     60840
     tcaatgcttc agccaaccga aagcggaggc tggcgtccaa tttggctgcg tcagaacgat     60900
     cagctctgct catatcgcag acaccgataa ggcgaactat ctatcgaact tcccagaaac     60960
     aagaggcatg tcttttttcc caccccaggg atcatctcgc aaatattttg cttgatgatg     61020
     cttggcttct gagacaaacg taaatttgta gaaaacttcg tcgccttcgc aaacctcgta     61080
     atacacgtcg taagcattaa gcggtagttg cagcgagatt ttgaattttt cggtcgcgga     61140
     agcgacttcg agcgcgttac gatccgtaat atgaaaggga gcaacgatgc accgagcggc     61200
     ccgctcgtcc atctcgaact tgtccagcac ttgcaggtag acctttgcgc cgaaggcatc     61260
     gtccggaagc gggtcaaaaa tgaggtagtc ggcatgcaag accgcgccct gatcaatgtt     61320
     tcccgttccc cattggctca aaccttcgtc atagggtcga gaccgcacca gaatctgact     61380
     atgggaaata aggagatcaa ccgtttggct gagattgtca ctcatcgaaa atttctacct     61440
     ttactcttgt tccgtctggc aaatcagaca acgcgttgcc gatgcttgat ccggcaccgc     61500
     ggttatcgct tgggtcaata tatctcacgc ttgcgccatc accaccttcc ttgaacatcg     61560
     ccatcggcca ctcgtctcgg tccatgccgg ccttggtctt tatgccggcc agactgagct     61620
     tccgattcag cttcgcgctg cctctctgaa cggtcacgat atccgcgtgt ccattgccga     61680
     tagcatcaga gatatgcccg aacgtctggg gatattcgga tcgcttcaac cgcagagtgt     61740
     aatcatagtc cttcgatttg gctttggtca gcgtacatcc tgcccatccc catggatcga     61800
     tccaggtgat cggattaggt gtgtagcggt ataagttgtg gccgccgttc agaccaatcg     61860
     ggtcggggtt gatgaaccgt ccgatatcgg gatcgtagaa gcggaacgtg ttgtagtgca     61920
     gcccggtctc gcggtctaaa tactggccct ggaagcggag gttctgcggc cgcggcacgt     61980
     ggcccggtgt cgccgccgtt tgcacttccc cccatgcagc cgcaggttgc tgcggcgcac     62040
     gcgcgatcca ctcctcctga actgcgttgc cccacacctt gtagcgggcc tgccagacca     62100
     gctcgccgtc agcgtcggtc agttcctccg gcaatccaga cacgtcgtta tggaaataat     62160
     agacagcatc tcgagcctcc gcgtcgttgg ccgccggcgc agcgtgatcg atccgtgcga     62220
     gcggggcgta gctatttgct tcgtacagat acgtcagcgc ctcttcgccg caccggtcgt     62280
     gatacgtctc ctgcacgagc cgcatgccgt cccacaggaa atccgtgctc gagtagctgc     62340
     cgttgagctt gcggatgcgg cgaccgaacg cgtcgtattc gaagtgcgtg gtcgacacgc     62400
     cgagccggtc cttcgtcacg acggtcttca gctgattcca gtcgtcgtat tcgaacgtct     62460
     gctctctggc ggggccgtgg ccgctgagct tgcgcgcgag ccgcccgtac gcgtcatact     62520
     cgaagcgctt gtcgtcgaac atcctgagcc ggttgtattc gacgtatcca cccgggtggt     62580
     cactcgatac cagattcgcg gcggcatccc agcggaacac ctcggacggt aggcctggcc     62640
     ccgtcgcctg ctcaatgcgg ccggtcgggt cgtacctgta gctcgtcgta ccgtagcgct     62700
     gatcacgctt ctggacgacg tcgcccgccg cgtcatattg ccactgcttt gcgagcagta     62760
     cttccgccga tgcgccgcgc tgcgccgccg ctcgcgcgcg gcgaccaacg gcgtcgtagc     62820
     cgaactggct ggtcagtttg ccctgcgtgc gcagcacctc ccgatgcaga tcgtcgcgct     62880
     cgatgtcggc gatcgcggcg ccgtcgacgc ggatctggtg cacgtgtccg gagccgtaat     62940
     gcaaccaatc gatggtctgt tgccccgaga cggtggtgct gacgcgattg ccgagctcgt     63000
     cgtaggtgtg cgccagccat ccggtcggcg tgtactcctc gagcacctcg ccgcgcgagc     63060
     cgtattttag ggtaacgcga ttcttcagcg acggtttgcg acccgtgagc gcgtacagtt     63120
     cgcccgctgc gatccgaccc gccttgtcgt aacggtattc acagcgctcg cgtgcggctt     63180
     gcttggcgac gagctgaccg atcgcatctc gttcaaatat ggtctggcgc tttccctcgc     63240
     gcagcgcgat gcccagcccg cgcatatcgt attcgtacgc gcgcacgttg ccgtcgagcc     63300
     cgacttcctc gatcagtagg tcgcggcgat cgtagcggaa gcgataggtt tcgcggttct     63360
     cgttggtcag gcttgcgagc cggaacgcat tgtcgtagcc gaagcgcacg acacgatccg     63420
     ctgcatcggt tcgcgacagc agcaggccgc gcggattcag ttcgtagcgt gtacgtcgct     63480
     ggttaggggc gacgacttcg actagccggc cggcgtcgtc gtaatgaaac gtctggcgtg     63540
     cgccgtcggc ggtcgctatt gccgtcacgc gacccatcgc atcggcttcg tacacggtgg     63600
     catggccggc ggcatcggtc acgcgtgcga gtgcaccgcg cgcgtcgtac tcgaaacgag     63660
     tggtcttgcc cgaacagtca gtataggagg tcagctgcgc gcgcgcattc catgcgagaa     63720
     atttgtagcc gccgcgcgcg tcgcgaatcg tgtgcacgag gccgcgctcg tcgcggtgat     63780
     actcggtggc gaagcccgct ggatcgcgcg tcatcgtcag gttgccgcgc gcgtcgtaac     63840
     ggtagatcca gcgtgcattg gtcgggtcga tttctgctac cggcaggtca taaaaaccgt     63900
     tccactcggt gcgcgcagtc tggccgagcg cgtcgatgcg cgcggtctgg cgaccacgtt     63960
     cgtcgtattc gaagcgcgtc acatggccgg ctgggtcggt cgcgctaatt aattggcgca     64020
     tcgcgttcca ctcgagcagc cacacgtggc cttccgcatc tacgtgatga gtcggctgcc     64080
     gatcctcgtt ccacgtccac cgcgtgatgc gcccgagttg gtcggtgatc gtcacttcgc     64140
     gctgggtcag atccgcatcg aacgtgtagg cttcgccgtc gtcggtccag tggcgcacca     64200
     cgcgcgcgtc gcggcctgta ccctgccagg catagaagca cttcaagccg ccgcgcagcg     64260
     tatgctggac catcaggccg tgctcgtata cgaacttccg gccggtatgc ccgctgcggt     64320
     cggttacggc ggccaactcg ccggcgtcgg tatacgcgta gcgcaccagc gtctcagatt     64380
     gttcgccgtc gacgccgagc gtcagctcga cagcggcgat ccgctgcggg tgtgcattgt     64440
     cgtaggctag cgtcaacagg cgcccagcac tgtcgtgcaa ccgggccggt cggatgacgt     64500
     cgccggccgt ttcgtgcgtc acttcgatcc agttgccgtt gcgatcctca aggcgccgca     64560
     gctttagcgt ctcggtgtcc gcaatcgtcc gcgcacgccc gaagtcgcga tagagaccgt     64620
     cgacggtttc gaccacgtag tggccgcctg cagtgcagat cagatacatg ccctccggca     64680
     cgctgtagta gctttcaccg ggcgacacgg ccgggtacac gatgtcgcga ccttgttcgt     64740
     cccagtacgt gatcgacacg acttcgccgc gttcgcgcac aagctgcagc tctacgctga     64800
     tcggcacact ccatcccggt ccgaacaggc tgtccgcacg atcgtcgtga ctgctgtaga     64860
     agcgccgcca gacgatcggc agcgggcccg gcagttcgaa gtcggtgtcg tcagcaccgt     64920
     ccaggatctt gccgccggtg atgacgttga ccgggtggcc tctcatcaga ctgccgagga     64980
     gggtgccgcc gagaccggcc aacaggccga tcccgaggca cggcagtttg cccttcaggt     65040
     tgccccactt catatttccg cgcccgcaca gcgcgagcgc aatgccgatt gccataccga     65100
     gccaggcaac ccacggccgc gccgcgctga tgtcgcgtac cgttttcgtg ccgccaccca     65160
     cgaacacgtt gggcgatcct ttggagatcg tgccgtcgca ggtggtcttg tcgtcaacac     65220
     gtgcggcggg cagatcgttg atgtagacgc tctccgaacc ctgcgcgatc atctgcgggc     65280
     caggatggtc ctgacattcg acggtatcca tgtcggcgcc gtccgccgca cgcgcagcgt     65340
     gttcgccgtt gatgaacacg tccggggagc cgctcttgat gtggcctttt tcttgcggcg     65400
     gtgaaatcgc attgccgagc cccttcgcgg cctcgtcgat cttgtcgttc agccccgagg     65460
     cctgcatggt ggcggcaacg cccacgccaa tcgcgagcac cagcggcgta gccaggccgg     65520
     ccgtgccgac ttcgagcacg gcggccgcag caagcagggc gccctcagtc agcaaccagc     65580
     cgatgcccat gccggctagc agcgagcccc ccatgccaat caggtcaccc atcagggtag     65640
     tgtgggtgaa cgggtcgtcc ttgcgcgcgg cgggctgact catgggcggt ggctatcgga     65700
     aacgagcgag ggcgccgcgg ggtcgtgagg gcgcggctcg aaactctcga gcatccggtt     65760
     cgcgagcgca cgctgttcgt cggtcagcgg cgccgcgctg gtcaacgtca tgacgatcac     65820
     atggccaccg gcgtcgagct gaaacgccgt ctggtgttga tgaaacgtgc gaccgtcctg     65880
     ttcgtgcgtg gattctgtct ggacgcccgg gcactcgttc cgtcctactg tcaccggccg     65940
     tcgggtctgc agagtgaggt ccttggcagt gcgcgacgcc agtccccatt cccgatcgac     66000
     gaaggcgtcg attgactccg cgtcgcgcaa tcggccgcgc gacacgacca ggctcaagcc     66060
     acccgtcccg atcggaagaa ttagcatgtt gacggtgcgg tcgagcgccg cgtccggcaa     66120
     gtcgaaggtc ccttcgtgga tagcgtagtg catggcaggt tatagtcgtg cgtgttcgat     66180
     tacttgttga ggtcgatgcg cttgccgttg accatcacgc cgtcgtcggt catcaggatc     66240
     acggagccct tgtgctcgag gcggatgccc tccggtgcaa gggagatcga gctgtcctgg     66300
     accttcagca agatgccgcg ctcggccatg tagacctgcg tgccgccgcc accgtccttc     66360
     gccggcgtcg tcacttcgac ggtagtggct gtggtgctgc gcttctcggc gatcgtctcg     66420
     gtcaggttgc cctgcggaat ctgcttttct tcgctgccgg ttgcgatcag gacggtgcgc     66480
     agcggcccga gcaccttgtg cgtctcgctg ttctcgacca cggtattcat gtccctctgc     66540
     gcgtgcatga agaactcttc ctggccgttc acgtcggaga aacgcaactc gttcgagccc     66600
     gcgcccttgt gcgtctgact cttgatcccc atagtttgac cgccggcgcc gtggtacgga     66660
     ttgctttgct cgccgttgta tacgcggccc acgactaccg gattatccgg gtccccctga     66720
     ttgaaggcga ccagcacttc ctggtgtatc cgcggaatcg ctgccgcgcc ccagccatcg     66780
     cccgcccatg gttgcgacac ccgcacccac atcgagtccg agccgtcctg tttgccgcgc     66840
     cgatcccagg ggaagtgcag tttcacgcag ctgccgttgg tgtgaatctc ctcgcctttc     66900
     gggccaacca ccttggccga atgcgtgccg tggatcaccg gcttgggggt gatacgcggc     66960
     gcccggtacg aaattttctt cggcagcagc gcgaagctgt tgcgataggg gagtttcgtt     67020
     tcgtgctgcg tgtagtcgtt cacgacttcg tggcgcacgt gcaggattac gtattcctgg     67080
     ttgttcgccg gcactgggtg accggtgacc gtcacgcacc cggcggttgt catccgccac     67140
     gcatagccac cgcccgcata gcggtgcgcc tgcgcttcct cggcttgcat ggccagacga     67200
     gcatatcgat tgccgtcgtc accgtggtcg tacagcgact gatgctcgaa gcgctcggtc     67260
     gagtcgagcc gcgcgtgctt caagttctcc gggctcgctt cgactcgcat cagcggcgac     67320
     gacggattct ggtgattgaa atcctggtat gtgaccttgc cgaccccgaa gcgacggccc     67380
     tcgtacaact ggtcaatccc gttgaactca cttgattggc tggctgcata cggtacggtc     67440
     gcgagcccgt cgatcggtcg aaacagcaag ttcgtgtcac cgatgaccag gaagtgcttg     67500
     tccttctcgt agcggtgcgt ccagatcaag ccttcctgct ccatcaagcg cgtgcagaaa     67560
     ttgaaatagg actcctggta catcacgatg tactcgagcg gcttttgctc ggtgcgaatg     67620
     tcgaacacga agtcgtaaaa gccgtgttcc aggaagatct cgttcaggat gtcctgcgca     67680
     gtcttgtgct ggaaaattcg gcagtcggtc gagcgcgtca ggaaccagaa ccacggcacc     67740
     accgtcatct ggtactgggt cacgcggccg gggtggctga cgcggtcgaa cgcggacacg     67800
     tagccgtcga agtagcgttc gttgtcggtc gcgccggccg cgacaatgcg ctcgagcgtg     67860
     gactgtcgcg cgttgtggtc gagcttgagc ttgacctgct ggccgatcag ttgatccggc     67920
     gtgagatcgt gctggtgcga cagcaggtcg aggtggattt ccggcaggcg attgacgtgt     67980
     tcatcgatga tcgcggcgct gaggagcagc acgtcggggc cgagcggcgt atcgatcgtc     68040
     gcgtagcggt tcagttgcgt caggcgcgcg gtgccggtcg cgttgttcag tgccgcggcg     68100
     atcgcccccg gcgtcttctc catcaaagaa aagccggtct gcgcgagctg cgtcgcgcgc     68160
     tgcagggtgt cgacgtgccc ggccaagccc gccagcgggc ccagctggcc gccgacgccg     68220
     gaggcgagcg agccgccgag gccgcccagg gcgctgctga tcggcgtcaa agccccaagt     68280
     gggctgccac cgaggccggt cggaagaccg ccattcggag cgaaactcat tgttcttcct     68340
     tcgtctcagg ttctgccggc caggccgacg gcctgaggca tcgctaattt aggggaaaac     68400
     gagaggttac ggaagtctcg cgcaaacgtt ttacggattc tgacaatttg gatcgagcca     68460
     gcaacgcgct ctctcttgcc gtacgccggg cggcgccgaa ccgtgaagct ttgtgtcgca     68520
     atgtgaactg aaatgggggc ggcgctgtgg aagagcatgg gcgttacaac gttgaggcga     68580
     tcgtcgatct cgttgaagtc agtcgccaaa aagaagccca tgcccaactc ggcagagcgc     68640
     cagtacccga tactgaagcg gtccgaccga catttgcgcc cggccgttac gtttggtgcc     68700
     ggaaactcca ccgccatcgg cgctgctttc gcgacccagt cggcgaacga accccgcggt     68760
     ccacgccacc ctcgcatcga ccgcgaaagg ctgaattgct gggtcggtcc tcgcgtaccc     68820
     ttgggcggca agcgagtcga ccctcgaatc ggtgcatatc gcgacctatc caataagggc     68880
     agcgagcgct cgaaggcaga ccccgtagcc aagacctacc gttgggattg cgaggaacac     68940
     cgcaccaagt accatgagcg gatcggcttt ctttaccccg atcaccccga taaccaggac     69000
     gatgagcgtt gcggcgacag tgacgagagc ttggatagtg agcggcgtca tttcattgca     69060
     atatgagagt tgggtgcccg ccactttgca gatctgtttg tgtcagaaat tgacgtcccg     69120
     agacgtctgc gtgcccggag tggcgagaac gaaggcgagc ggcagaacaa tagttagggc     69180
     cccattttac ataaactaat ttatcggtgt tttcgatagg aatgcgctat tgtgtccgac     69240
     accatgcgcg gataccgacc accttggttc caagccacaa gaaccgcgga accgtaaccg     69300
     tctcgaccga caggacctca aggccgtcac gcgcgatcgc agaattcagc gcatcgatcg     69360
     ctgcattggt ctgcgactcc ggcctgtcgg caccgagttg gacgaacgga atttcgatca     69420
     cgcggatcgt cattatttcc ctcactcaaa cttactaaaa gtgcgaatag cgccgtacga     69480
     tgcgatcgtg gcgcatacgc agcgcttcga gtttgcactc tgcaacgatc caagcttcct     69540
     ctttgtgcag cacactgcgg cgcagccatg cgtagaacgg tgtcatccac aagttacgcc     69600
     acccctcgat ggctttgatc ttactgacca ggcggatttc cgcgcctcgc accgtttgct     69660
     tccacgttac tcgtgtcatc tataccccca atgcggcgta ccgctttccg agctatgcaa     69720
     tctctagcga tcttcgatca atccgatcgg caagccgtcc ctcgcgcgga cgcgaccttc     69780
     gtgcgtcaga ggcgttaact tgcgtctccg attcattcag ttggtgctca acgaggctat     69840
     aacttagccg gcccacaacg ctatgccacc ttccgtcgta tcgcggattt taattcgtgc     69900
     gcgtccggga caccggcatt gaggccgcgc tcagccagat agagcgcgag ttccagccgc     69960
     cgtatgttct ccgccagagc ggcgttctcg cgtgcgagcc ggtctgcgcg acgtgtcgcg     70020
     tcctgcaact tccgttcgta caattcgtca gaacgggaaa gtgagcgtcg gcgcgcaata     70080
     gaaaagagga cgccgcgctc tgcttctagg tctggttcgt gttgaaacgc gggccaatcg     70140
     ccgatcgtcg atcgaaacga tggccatccg ttgcctgtcg gccgaaggac ttcgcggacg     70200
     ccacggcggt ccgcatacaa cagcccccat cgcaccggca attcggatac tctgatgacg     70260
     tccggcgggc aaaggtagaa tcgatacacg cccaacccgc cacttatgcg atgtggcttc     70320
     cgcgcgtcgg ccaaaaagtc cgatcgcgtc gccttcgctt cgatcaccgc agagcagttc     70380
     gatcgaaaac caatcacatc ggcttgctcg cgcgtgccgc ttgtgaccag ctcggtcgca     70440
     acgactgaaa aaccttcccg cttaagccat cgttcgccga gcgttaccaa ccgcttatga     70500
     gcgtcacttg ccatcgcgtt atctgtcctg tccatgcatc gacatgccgc agcaccaatt     70560
     gcagactgag cgcctcgccg aatgccctct cgtcgggcgt cgatcctcgt cgacacggtt     70620
     cctgcatgag gcgcgcccgg cccgcgagct gcagaccggg ctatcagcgt tagccgaaat     70680
     gcttccagaa cgagttggcg aggaccaaga ggattgccac gaatgcgacc caggtcagga     70740
     gtccattctt ccgcagaacc ttgggtacgg gcttttgttg cttggtcgag tcagtcattg     70800
     ttggcctcca ttttggcact tgccttcatt aacacatgcg tcccaaatcg agacgcgctc     70860
     ttgaaaatcg gcccgccgcg ccgattcgac ggcatcagcg gtggtttgag cacccgcgac     70920
     aatcgctatt gcacggacca aggcttcagc ctcggcctct ggggtttttt cccccttgta     70980
     tgcgataaca atttctccgg gggtgtcggg tttgaattcg actcgccgca catcgatttg     71040
     tcgatatgcc gccggatcga ggtccggcaa acgtactggg accagcgccg cgcgcgaacc     71100
     gcgcggaagc ttgccgatgt cttctgcgag accagaattc atcatcacct gagcgccatt     71160
     tgcaacgccc aagctaccgg tcggtaagaa cagtgctcca atagagaggg cattgccgat     71220
     catccctttg atgttgtacc gcgttgccag ggtacgtggg tcccccgctc tttctacgaa     71280
     tcgcctgtag tactcggcct gagctcgtgc gaaggtcggg tatgcgtcgg ccgcgaaggt     71340
     agccacgtcg aggacgtgga agaggtaggg cgcgttccgc acaagcgtga tccgttcctc     71400
     ggcgagggtt gcctctacgc cgcgagttat cgggttgtcg cttatgccct gcagaatgag     71460
     cggactgccg cgatagcggg tgccatccaa tatcacgtcg taggagacct tgcgctcgcg     71520
     gagcgactcg agggagtgct tctgcgccga tgagtcgcca gaccaactgt cgatcggacg     71580
     cgcgacgatg acgtgcgcgg atgctgtatc gaactcgaca ggcgatgcgc aggccattgc     71640
     gctgccgatc gccgaggacg ctgcaacggc gatcgtcgcg atgaacgtgt cagtgcgcgg     71700
     cacgctatgc acctcccttc accgagcggc gcaaggtctc gcacgcagct gcttgggtag     71760
     cgaatgcatc aacgttgtct ttgagtttat tgagttccgc ttggttggcg tccccctggt     71820
     tccgaagccc tttgagctcg gcgtcgctgg tagacagacg ctcgcctagc ttccgtacgt     71880
     cctccttcag tgcgctaatt tctcgcgcct gctccgcgtt ccgtttgctc aaattgacgt     71940
     tcagcttgta accgattgca gctgcgccga gcgacgcaag cagcgtgatg attccgacag     72000
     tgaagatcgc tcgtttcaca aatactttgg ctttcatgaa ggtcctggtc tcgttgttgg     72060
     tatatcagta agtcggaaga acggcagagc cgcccttttg ggaagatccg ctcggagtgt     72120
     tctgcatgat cggtgtgtaa ttcccggtga tatttttcgg gaggcctttc atagcttgat     72180
     ccatcatctg gctcgagaat gcactgaagt caatcttctt gaaatcgatc ttgctgatct     72240
     ggtccggagt caggccactg caaccctcaa gcggaaggcc cagttgcgtc ttcccttgaa     72300
     tgttgatgat ctgagcgagt tgcgagttga aggaacaata ggtgtcgacg tattgaacgc     72360
     aggcacccag cgccttcttg gcacactcct ctttgatgaa cgtgcttaga ccggcaccct     72420
     tatgaagcgc caggagctgc tcgccctgcg agcacttcga taggccttgg atgacctgaa     72480
     ttgcaaccat cgcagcgaag acatatgggt taaacgcgag gtatccgttg gagccgaagg     72540
     aagccagttg catgttcgcg ccgaaaagcc ctggggtcat cgttccgaac ccgaccgtga     72600
     aaccatatac gccgaactgt atgccgccag aagcgagttg agtaccgagt gttccgccgc     72660
     cattggccgc atcaagagag aatgctgtcg tgaagttctg cgtcagcgcc tcggagaaaa     72720
     ttccgttcgt atacatcgcg tcgaacacgt atggcgacgc gagatcaatc agcttctcgc     72780
     cggcatactt ggcgaccgaa ccagctgcgc cgatggccgc tgtcattacc atgttgttcg     72840
     attgcgcgcc aggggtactc ttgcagcaat tctggattcc ttcgtaaccc tttctgcagc     72900
     tttcctcgac cccggcgaag atgctattgc cgtcggtgta cttctgtgcc tcaccgagca     72960
     gttcgagccc gattgctccc gtcaggaacg agttgttgtt gttcggcggc gtcggaaagc     73020
     cgctgttgtc aaacagaccg ttcgagcaat tcatctgttg gccagtctgc tcggccttgg     73080
     tttgacaacg gtaggtatac gtccattcgt cgcactgccc agtttcggcg atcgtatcat     73140
     tgcaaacgct accgaccacg ccgcaggctg agttgctgcg gtactgaccg caggtgtcga     73200
     cggtggtgcc ggtgcaagcg taactgtagg agtactgcca gcagctataa gggacctgca     73260
     gtgcgcctgc gggcggcgtc gcagtggaaa ggcaaatttg ctgaccagtg cctgacgttt     73320
     tgcacggcgt cgtgtcgatg caagtctgcg accctgggac gggggaacat gcgccggggc     73380
     cataggtttg tgccgttgtc ggcaggggaa gggaaagcac cgtgacgacc agcgaagtga     73440
     agaggcgtcg aatacgggta atcagcatcg gtggttcctc agttcgccgg ggtaggcaga     73500
     gcgacgccgg cgctctgctc atacgcggtg caggtatcgg tccaactcgt cttgaccact     73560
     tgtttgacgc agttcgaccc attcagggtt tgccccggcg ggcaactgta tgtcaccgta     73620
     gggttagccg agtcattagt cacgcaagtc tgaccctgca gtgcccctcc gttcgggcag     73680
     ctgtaggtcg cgccgaccgt ggtggtcttc gtgcattgag tgccgtcgaa ggtatagcca     73740
     tcgggacagg actggagcgg caaataggac gggttgtagc agctgcctcc aatacacaag     73800
     ccacgatcaa tcaaaggcat gttgttgagg acgtttggcg gcggatccgg ataagacgac     73860
     atggacacgc acaccatcgt tccgttatcg gtatggcctg tcccgaagcc gccagggcaa     73920
     tacggtgtac cttgaagatt cgaaatttgc acgcactggt cgcgatttgc gccgctctga     73980
     atgtagcccg caggacacga gatccacggc gtgtaggtga cctggtggag gcacattccg     74040
     ccttggagtg tcatgccgtc cgggcagctt tcgacagaga gcgcttggct gattgaattc     74100
     gtgatggtcg cattcaagta ttgcgagcag ccgttctctt ctttgtcgat agagacgaca     74160
     cacgtgttgt tttcgtactg cgccggttgc gtgacgacgg ttttcggcgt gcaaatcgtt     74220
     gagagcgcgt ctcgcgcgct atccccgagg ccaaggatca ccttgaacat ggggtcatca     74280
     atcgtcacct ggtctccgta gccgaactgg gattgcccgg cgccgaacgt tcccgcacag     74340
     tttgcgttgc tcgagattgt ctgtccggtt ttgcccagaa ccgacttttg acctgtagtc     74400
     ggctgcatgc actgattgtt caggaagtta actgcagcac aatactgatt ctggtatggg     74460
     tcgttacctg gcacgaaggc cgcgcaatca atttgagctt ggttgccgag agcggtgagg     74520
     ctactacctc gcgcggccat cagcgcagcc gagcttgtgt tcgggtttga aaatgcggca     74580
     aagcccgatg ggacactagt cggcatgttg gtttgcccag cccaagcgct cgcgttcacg     74640
     ccggccggat tcacgatctg ggtctgggat gtgggggcga tcgagttggc gaatgttcgt     74700
     ccgttgttga catccgaagc attctgagcg agcgcggtgc tagcgaacgc gaaggcgagc     74760
     gcgacgatga ataccttcat ttgaggcgct ccgtttcggc gccgccggca ggcatcgcgg     74820
     ccgcccggac ccggcgagcc gcctcgcgcg gatccattcc ccctgcagcc gtggcggatt     74880
     tgatcgcgtc cgcgacctca ggtgtatcga ccggcgtcga gccgtcggcg catgccgagt     74940
     caggtagaac gagcttgcta ggttcggcgg cacagatacg caggggtggg ttaccgtcgt     75000
     cgcagatgtt gagctcccct cccatatcgg tccacgcggt gtgggacgac ggctgcgcga     75060
     cgatgaatgc gacacgtccg catctcggtt gttctttgaa cgacgcaatt cgcctcgcga     75120
     gtactacaac cggaccgttg tcgccggtcc tctcgcgaat agccgaaatc gcaaccgagt     75180
     actgcccgtt gctgtcgagc ggcgcggttg cagttccatt ttccagcgcg atcatgaaca     75240
     cgctttgcgg accaccggac agcgttgtag ctgacaagga tgcggaaaga aggctcaaga     75300
     tggctgtaat ggcgagcttg cgcatgctgg cggtccttta ctgcttggcg tgggagacgt     75360
     atggtgcgaa aaggtccaca tcctgttgcc ggaacgggag atacggaaca ctccaaccgt     75420
     agtgaaattt gtttgatgca cgcaacttct caagggctgc gatttcggtc gggacaaaac     75480
     cgatgatgcc cgggactacg gtgttgaatc ggatcgaagc ttcgcgctga gtccccgttg     75540
     gcgtatatcg ccgatagcaa agaaccgcat cgtcgcgtag gttgcgacct ccggtcgggc     75600
     ggcgatattt gttgacaagc tcgtacttac aggcgaggta ttgaggttct gctccggcgt     75660
     cacgggtcac ttgctcgagg agcgcatagc cgtcatcgat accggtgcta attgaatttc     75720
     gtagaagagt cactcgctcg gagagcgatg ctcgcgcgtc gtagcgggcc cgggaaaggc     75780
     cagcgaggtc tgaccaacat gaggtcgcgt attggagcgc gcgcacacgg tcgccttgcc     75840
     tgtagcttag gaaggacgca aacccgcaca ctctatatga tgcatcggct gcgatcgccg     75900
     ctgcctgacc cgcatacatg agcgcagatg cgaggtcggg tcgctgcagt tttccgtatc     75960
     cagccgcaat cgcgaggtta tagatggccg gctgatattt cgacgcggcg gctgacctgt     76020
     atagactaag tgctcgacca agatcctttg gaaaaccgaa gagcccgtac tccgaggcga     76080
     acccctgaaa ggtcatggct tcggggacgc cacgcgcact gagctcggcg agctttgcca     76140
     agagcgcttt gcgcttttcg ccggtcgcgt tggccgcttc aatcatccac atgaccaccg     76200
     tctcgccgtc gttactcacg acgttgtggt cgccaaatcg tagacgttca ccgagttgat     76260
     tcgcctttgg aagaagtgcc ttcgcacgat cgacaacgtc ggccgtcaca ctcttcacga     76320
     tagatccgtt ttgggtgcgg tagccgttga cgaggtctgc gaaaactggc gagctgaacg     76380
     tcgattccgc gagccctttg actgcaccgg gctctattcc gttttcctgc gcgtacgcaa     76440
     ccatcactcc tgtcagcgca gtgctgacta gaagactcag agcgaagcgt cggactcgga     76500
     ctgtgttgat gtgcattgct atgttgagag cgcgtgtcac ctaaattata atcagttcgg     76560
     aagtgtaccc aaatttatat ttctggggct cgccaagttg caacgaggcg cgtgctggaa     76620
     gccacttgcg gggaattgga gatgcaggat gtccatgcgt gcttacccgt cgtcgaaggg     76680
     ctggacgaac taacggatga tgaacgccgc gccatcatga tggtgcgaga ggggggcaac     76740
     gagaacgcct ctgttgaatt ggcaatccgg caggtgttcg tctgggcgat tactactcag     76800
     tcgactgacg tgcacgtgtc cggtcgcgat cgacgtggct ctatcgagat ctatttgcac     76860
     atccgaacgc cggagggctt caggaatttt cggttccgct atccgaagca ggaaggccgg     76920
     cattgggaga caaagcttct tcaactctct ggaacgccgc aaggcgcgtc gacccccgag     76980
     atcgcatcaa ctcggttcga gatcgagctg ccattggact tcgcgaaagc ccatggattg     77040
     aggccgtttg aggatgcacc gacgtatgcg gtggatgttc gcgtcgagta cacgaagacg     77100
     ttcaacggct tcgcattcat atgccgactg cttgacgccc agcgcgcccc tgagctgcat     77160
     gagcttgggc tgtcgtattc agtctatcga acgatcatgc gagcgatcag taagccaagt     77220
     ggcctgatct tggtgactgg gccgacgggg tccggaaaga cgacgctgct taatgcaatt     77280
     ttgtcggtgc tgaacgatga aactcgcgcc atcgagacga tcgaaaatcc cgtagagatt     77340
     gctttgcgtg gaaatggtcc gattcggcaa cgacaggtca gcgggaacat aacgtttgct     77400
     cgagcactcc ggtctattct ccgctccgat ccagacgtga tcatggtcgg ggaaattcga     77460
     gattccgaaa cgatggaaat cgcgttgcag gccgcgcaga ccggccacat cgtgctttca     77520
     acactgcaca ccaacaacag cgccgagacc tatacgcgcg ctctggattt gacgaaagat     77580
     aaggctcgcg acgcgtatcg tctcgcggaa acgttgaagg ccgtcatctc cctacggcgg     77640
     attgatcggt acgcggggga gtcggtcgtg cgcgcgctca cccgcgacga gcagttgtgg     77700
     cttgaagcga acgggattga tctcggcgat tcaatcagag aggtggtgcc ctcgaagcac     77760
     gtaggaaagg tggcgattgt cgaggtgatc gtcactaccc cagaggtcaa acaattgcta     77820
     cgcgcaaagc gggtcgacgt gacagcgatt tatcgcgcag cctgcgaaca ggaccagtac     77880
     gagccccttg cggttggagg tgtccgtgcc gtgcaaagcc agcaaactct cctgcgcgac     77940
     tgcatcgcgg gcctggaagg cagcagcgat gcgaaaggct atccgtgcag ccgcctccgg     78000
     ctcgccaagg agtttggcct tgatctcgtc gaggtcgcat gtgcgatcga tgactaccac     78060
     cgcgcggcgg acgccggcgg tgacaaaccg ctagaagcat tcctcgtgtc gtcgcgtgaa     78120
     acggcctatg gagaagtcgc atgacatcga tcgcctggtg caaaacacct cttctctccc     78180
     ttgctgtcgg cctttggctc tgcggcccgc tgccggccat cgctcaggta cccgcgggaa     78240
     tggaacagct gaaaccctac ctccaagtca aaccggtaga gggggaagaa gaaacggttc     78300
     gcgtcttctt ctctccaagt tgccagttct cccggaatta cttccaattt ttcaataatt     78360
     tggaagccac tcttccgcgt caaaagattt tcaaatttac tccgttggta aataaagcag     78420
     acggcatcca gtttgcgttg agctttatcg cggttcaaaa atactaccca acctatctaa     78480
     ggaacttcat ggaggcgtca tttattggcg ctcaagaacg aggaatatca acgtcgaatt     78540
     gggcgggcat cgagcggatt ggtcatgctg cgcatgtgcc agttcccgtc ccccgcctcg     78600
     tcgcagatca cgccactgaa ctcgaacgcg agctgcgcgc cgcactcgtt cggcaaaagc     78660
     tgcttggaat cacaaacact cccgcggttt ccgtcgcggg cacctatatc gtaacgcctg     78720
     agtttacgtc tggcgacgca gcactgttca gccagttggt gaacgggttg atttcgatgg     78780
     cgaagtgaag tgccgaccgg gcatccgccg gcggcatggg ccagattaca tttattaaca     78840
     cttattaacc ctttgacaca cgcggcgcgg taccatgctg ggttcgcgcg aacgggcgag     78900
     gatgtttgac cttggacgtc cccatggtgg ccgtcaaggg tccgggttta cgcctttatt     78960
     gagaagcgcc cgccatgtac agtttcggtg gagaatgatc ggcaaaactt gccgaaccaa     79020
     ctgttatgtg gttgtaatct agcgatcctc ccgccacgcg gcgacactcg aagactgtgc     79080
     ttatgctgac ggacgaacag aaaaaactaa tatctaaggg tctgagcagg ggcgttcctg     79140
     acacgttgat agcgaaaaag ctcggcgtaa agcacatgca agtgtacctt taccgcacgt     79200
     ctcttgggat tccggcgtcc cgagtggttg aggcacgtta cgacacctgg atcaggctcc     79260
     tcgagtcagg cgtcgctcta gaaacggttg ccgaaatgta tgaggtgaag gccgagtcta     79320
     tcctgaatag cctgtaccgc aagcgagatt tctcctatac ggaggcgaaa aagcgtggcc     79380
     accgaagcgt ccatgcgtct ttccgtaagg cgctcggcgt cactctgaaa gatgcgcaag     79440
     agaaaaaaat cgagacctgg gtgcggctct ttgactcggg catgaccatc gactccatcg     79500
     ccgacctgta cgacgtgaag cctgccacgg tccgcaacgc gttacgaaag gttaccgaag     79560
     ccgaggtgcc cgccattccc gacatgaaga atttcgactg gtaggcggcc aaaaatcgaa     79620
     gggggtggtt tcgcatgcga aaccaccccc cttttacagc gaacgtcaca acggaacttg     79680
     ggattcacca gccggaacgg ctattcattc cccaatcgtt attcggaccg cggctgccga     79740
     tgccgaatcc attatgcgga tcgccgcctg cggaattcct gcgggcgcgc gcgacataat     79800
     cttcacgaaa atcgtcgtca gcggaaactc gctttagaag tgccaggagc ttgaccgccg     79860
     cacgtttcaa gaatgccatt ctgcacccct gctctttttg tagatgttca acgagactac     79920
     cacagaatgg aagaggccgc ttgaacttgc gcgacccctc tttgataacc ttcaattccc     79980
     tctttttcca ggcgttaaat ccgggttagc gctcggagtt gacggtcgac ccttttgggg     80040
     atttaccggc ggagccagac cggttctgga gccggcgcca gccgtgcgac cgatgtccgc     80100
     gacattgtcc acgacgttcg cggccgcgcg aatcgccgtg ccatgcccct tcgcgtcgag     80160
     cccggcgttg gccgcctgag tgtcgccaga ctggaccgaa gcgctaactc gatcccttcg     80220
     gctagccagt tcgtcgcgca tctgtcgttc gaaatcgccg ccaaatgccg gcagttgttc     80280
     ggggactgga ggcggagcga cccgtggcga atgaacgggc ccgttgggag tatggggggg     80340
     tatctgtggc gcggaggtgg agtggtcggc cgcggtaccg gacggctggc gaccggaagc     80400
     gacggcagcg ccggtgtcgg cggcagtcga ccggcggcca gtgacaccgc cgagatcttt     80460
     ggactcgcgc gcccgagata gtggcatttc ggcccgtact gcgtgatggt cgttcgaacc     80520
     tggttgaaca gcccgcgcgg acgtgtttgc ttgcggcagt tgggattccg cgaccgggtt     80580
     ggaagcgccg ggcccccgat aggccggcac ggttccaacg cggccaccac gaggatgaat     80640
     ggccccctca tgggcgccgt cgtcgccggg cgacgcggaa gtggtggacg cgattcgcgc     80700
     tgccggtgct gtgggcggcg gcaaatggcg acgcgcaaag ggtgcgatct cgctactgct     80760
     aacgccagtg ccatcacgcg gcgatccaat ttcgaggttc atcggtgcag gattcgttgg     80820
     atcgaacttc atatgctgca tagctcgagc ttcatcagcc agatagcgcg cggccgcgat     80880
     tcgatcttcg ggacgggcgt tctggtcttg cgcgagcatc actgctgccc gatgccgatt     80940
     aatcgccgct tgcccggctc gatcgccgac gagacggccc gtcgcgccgg acgccgcgtc     81000
     tgccgcagca gtttggaggt acggcctcgt cgcgccattc tcttcgaagc ggcgcccttg     81060
     agtcatctgg aaagcggcat attcggggtt cgctcgctgt tgccacgcga tttcctcaga     81120
     gccgattttt ccgctcatgc taacgaagcc cgagctctcc cggacacctt gtgttgccgc     81180
     gtcgctcacg gattgaactt ccgacagagt ttgctgatag ctgcgctgtg tcgacagcgc     81240
     gcgagacagc tcagacgtcg actgactacc ggcgctggta ttggaatact gagccatagt     81300
     ctttgccagt gccctgctaa gcgctaccga gtcggaatag ttgtccgact ggccacggtt     81360
     atcgttgcgt tgcagcgcgt cgtccgctga agtgcttgtg tcggcatgtg ccccgagacc     81420
     ggcgctaaag ccgctcttca ggctcgcgct cacgctgccg cccgctccga tagtcgttcg     81480
     atttgagttg ctgcgtgtac cggtcaccgc gtttccggca tgttgctctt tgccgcttcg     81540
     aatctcgttg ttaaagttct ccgcgagcgt ttgcccaacc tgacggtcaa tgttgagacg     81600
     gctgaaatcg cccgtcgaga acgcgcggcg aaattcggcg aggttggact ctcctgcgct     81660
     gagattgtgg ctgcgtacct ccgactgtgt gagcgatcgg ctcgcgtcgc gtgccatgtt     81720
     cccgaagttc atgctcgtcg agaccgcgtc gacgctacca gtcatcgaaa gcttgcccgc     81780
     accatgtccc atctggctga ttgttcctac cgggccgccc tcgaacatcg ggcgggtcgc     81840
     ttgcggcgcc ggcgcgacgt tgtcagtcgt ttccttggat cgtggtgcga tgttagtggc     81900
     gacggttgtc atagccgacg attcgcccag gccgaagatg atgctcatca agaccggcag     81960
     actcgacatg atgtgagagc cgacgccaat ctgcaggctc agctccttgt atgcggtgta     82020
     cgtagtggcc tgtgaaagcc acccaccttg gcgcagtgcc tggagatagt tcgcgatgtc     82080
     gatcgaaata atcccgttga cgatctcggc gccgacgtta ttgaccaaca gcggccacac     82140
     gatgatgtgt gcggccgtct tcaccgactt gccggcctcg ataccagcga acatcatgaa     82200
     catgatgatg acgggcccga ggccgatgat gaccgcgatg aggtagttac caaaggcgcc     82260
     ggcgtaccgc atggcaggaa tctcgctggc cgccgcttga aggttattgc gctcgacctc     82320
     agccgcttgt agtaccgaag cttggcactg aattaaggtg tcgccgcctg cacgaaggca     82380
     acttaaatcc ccttgaacca tctcggaaaa cagtagattc atgaactctg cattcgcctg     82440
     accggtcccg ccggcgaaca caccgccaag agtattcgcc cgggaaactg cgtagtactg     82500
     cgaggcaagc gagttaaaac tgtagtccgc gcctggacgc ggtgagtcga ggccgttcac     82560
     cgccccttga acgacacgtg ggaactcgag cgaattcaga gcgttcgtga tgtcgtccgc     82620
     cacgcgatac gctgcgtcag agcatgacaa aatgttggtc gaatctaggc cgatgtcgtt     82680
     gacctttcct gtactgttca gcgaagcctg gtaaagaagc gcgccgatcg ctgtcggatt     82740
     tatcccattg acggggatcg actgtgcgct ggttgccccc gtgtttcccg cgttcatgac     82800
     gaggcgttga atgttcgagt agttgacacc agaatcaggg ccgaggcatg acgcgagaac     82860
     ggttttcacc tcggagtcaa tcccgctaag tcgcgatgtc gccgtacggg cgctgagaag     82920
     cgcttttaga ggattgagaa agccgttggc actggcggag atcgtcggat actccgcgct     82980
     cgcacgctgg aacgctgtcg aaacggtgtc gttcaggtcc attgatagaa cgctgccagc     83040
     gaccgggatg atcgagatcg caagcggcac attgtcgact tcagtaaggc tcccgttgac     83100
     cgttgactcg atctgaaccg tgcttttcaa catcgggttt gtaagcaccg tggccaggat     83160
     aaagggcatc gccgcgctca acgcaccatt tccaagaact gcccctccct gtcccgatgc     83220
     cgaccgcagc gcggcagcag cggtcgacgc gctcaggcgc catagcgcca ccatcacggc     83280
     aaaaccccaa accattaggt tgttcttgca taccattgcg acgctgtcca ggatggcacg     83340
     cagggtggtt gggtccgcag tcgcggaata gattgtgaga gttggaatag ccatcagttt     83400
     ccccggttta cttgatgttg gtattcacga agcgcgtccc ttcgttgatc tcagtgatga     83460
     tccggagaag tgcatcgctg ttattgcagg cgttctgctt ggcgagatag tcggttcgaa     83520
     gcgtcttgat acggtccttc tgatcgtcgg tgaggtcata cccaggtgtc gtttggatga     83580
     ggtttgcgcc cttgtagagg acctcaccga ttcgagccgc cacgcagtcg acgatatggg     83640
     gagccagccg ctgcgcgata gcgacgcggg tcgcggtgtt cgacgtcttg gataggagcc     83700
     ccgcgagcgg aacgcctgct tgcttcatga aggcgacctg ctgagcggag aaggtggtcg     83760
     aattcacgct attgatttga ccgacgatcg agtttcccgc cacggagagc gccgggtcaa     83820
     ccgagccgaa cagcattgag ttaacccatc cctcgatgcc aacgtaattg aaggagatga     83880
     cctgcatctg cgtacagatt tggttatcaa cgcccccaaa aacactcccg ttggggttcg     83940
     cgcagcgata aagctgcaga ggtacatcgg ggcgaagcga cccggttccg ccacccttca     84000
     ccaagtcgtc gagggtcatc acggccggcc ccgaacacgt cacttggcca atggtgttgt     84060
     tggcgggacg tgacgactgg atgccctgcc ccgcctgatt aaggctgtta cacggcgcgg     84120
     catcgatgtt gtagccaagc agtgcgtaaa gcaccatgtt gttcagactg ttcggatcgg     84180
     atgggttatc gctgctcccg tcgacgttcg gtaagccggc gagtcccatg atcgacgacg     84240
     cgccggacgc gactaccttc ttcaccagag ggttcccgct cttcggattg ttcgcagact     84300
     gattcttgaa gtacgagttg gcgtcggaga ggtagctctt gagaccgccc atcacatctg     84360
     tgaacatatt cgagttggtt ccacctgtat tgccatcgcc gttcaccgcg ttggaaagag     84420
     cgttgtcgat cggatcaaca atgaggtgcg ccatctggca ggagttcttc gcaaggttgt     84480
     tcagattttg cagcagcgtc tgaaactcgg tgatcaacgc gtcgagcgag ggggagattg     84540
     acttgatcgc cgctttgaac gcgagcccgg ccgcgtcggc ggctacctgc cggaaaatct     84600
     gaattagctg ctgactgttg atgaaactga aggatccacc gtagaggtcg ataccgccgc     84660
     agccggcgtc gattcgcgga ggatcgaatg tgacgagatt gactgctttg atcggcgaac     84720
     gcatcgtgaa tgcgcccata aagacgccaa cacgatcctt cgtggtcatg gctcctggcg     84780
     cggtactgtt cgccatcacc atagaaccga ggtcagccag aatgccggcg aatgcgagat     84840
     gcggcacgac gaccatcgcc acaatcaaca gaaatttttt cacgcgcacg ggcgcctcct     84900
     tagttctggt attgcttcaa gaggtacggc tgaaggatct cgcggaacga gcctggcttg     84960
     ttcggatcga gcctcagctt gttgaggtcc tgtgtagtcg ttacgccacg gtcccagacg     85020
     ttgagatcgc gcattacctc cgcgcttaac agcttcgtat cgtgaccagc gtacgcgatc     85080
     tgtttaacga gttcgtccat cgcatagaac ccttgggaca ccaccagata acggttagga     85140
     tcgtcggccc cgacatatgc gcgaggccgg ggaacgaaga cgatggaggg cgttagtttc     85200
     agcccgagtt ttcgaaacag accgttatct gagatgagcg ggccgttaaa tcccttaggg     85260
     cgagcaccgt caagcgacac caccagatac tcgatcttgt gcgcgcgttt gagcatgtcg     85320
     aggacaggga tctgcattgc gcagaaccgg catgtactgt cgacgaaggc gacaagcccg     85380
     ccgatgcggg cgagctcttc cacggccttt tgttgagctt gatagtcggc gttgcgtaca     85440
     gatagcgctc cggtcgaggc atacggaacc cggttgtttt cgtcgagtaa cgggtcctgc     85500
     ctaagcacac gcgcaacgct ctgagagaat cgttgagcct tgtcgagaat aatgcgcttc     85560
     gtatacatgt acgccgagat attggcgtcg gtggggtcat tgatcgcccg ctcttctagc     85620
     accgggtaaa cctttcgaag aaagactacg tcgacttttt gggggcccgt ctcggctact     85680
     gtagctggcg ctggcgccgt ttgtgtgggc ggcttagacg cgggtgcgga ggcttggacg     85740
     ggcgcagctg gtgtgacgta aggctgatag ttgaggaaag catcgccgta tgcgtcaccc     85800
     cgtggcgagt cagtcgctgg cgccgcgacg acgtggatcg agactggcag cagggcgagc     85860
     gcgatccatt gggcaatgcg ccgaccgcgc gcgatgtcaa aacaggcggt atgcatagcc     85920
     tgacacctta cgcgcatcga gatagcccca gtaccgcgag tcgtttgagt tcggatgcac     85980
     tccgaccatg aagtaggcat tgggtggaac aacttcgtct cgctcaaacg ctcgttggtc     86040
     gcgaccgtag gacgcggcga gagggaagcc ctgcacgacc tgctttccgt tgatgaagac     86100
     tcttcccgcg cgaatcgtga ggtgatcgcc gggtgtgcca gcaaccatct taaggatgta     86160
     ctgttccttg aagccagcga gtgcgccgtc cggtcgccag aagagcagat cgccgcggtg     86220
     cacttcgccc ggctgtctgt gaaccatcat tgcgaggtgc aggtccggca gacagcgttc     86280
     gctctgcggg tcgaagccga acgtgattgg gggttgaatc cagaagaaga gcaccagcac     86340
     gaggatggcg aaaaaaaacg cggcgaactt gccgcgctcg ccgggacgtg gagtttccac     86400
     atcgatttcg cttacggtcg tcattgtttt gctccctcgg cactcgtcga aacggtgggc     86460
     gcgcttaccg cgacttcgga ggcagctgac ttctgaagag ggagctgtgc cgctttgcgc     86520
     agttcgttgg tgatgtccac cgtgtcggcc ggtagcgcag tgacggtcat ttcaccctgg     86580
     tcgtttcggc tggtgtccac gacgacgaaa ccttgcgcga ggtattggcg caaaacggag     86640
     ttaatcggat ccgtgataag tgccttcatc tgcgccggcg tagcggacgg atgattgaga     86700
     gcagcctcta gaacgacagc gcccttctcc gcgatcgcga cacgaaccgg tggctttgcc     86760
     gcatggtgtc cagcctggta accgatcgca tacaccgaga acgatagcag gcacaccacc     86820
     gagtacggta cacgcccacc actaaggatc cctttcattt tgcgatctcc ttgagctctc     86880
     taacgatctc attgaaggtc aggccgtcga tgtttttgca catgtctaga aattcgctca     86940
     tccattcgcg ccggcgcgct ttcttgtccc ccatcacctt ccggacggcc tcgagaggcc     87000
     ctaccccctc ctccatcatc tgcagcacgt catcgcgcgc ggctccctcc gagctgaata     87060
     gcgttgccgt aaacttatcg acgtagagac gtactacctc gtacgtcttg tcgctcatga     87120
     tgagaatttc gctccagaag ttctttttcg actcgacact cttgatgagc ttttgaaaat     87180
     acgggtcgtc cgcgaacgcg gtcattacct tctgatcgat gacggcgtcg atctcgtcct     87240
     tcttctgcgc catgatcatc ttccatgccg actgcctgag gatgaccgag cccgctttga     87300
     agctggcaag cttcaagagc gattggacga tgacccagac cgagacaccg ttttttcgcc     87360
     ccttgaggta gaggccttcg aacgcgtcag cggccgaatc gatcgaaaaa aggtcttggg     87420
     cctcgtcgac atagatgcgc tttcgtccct tgaacttctt gatgcgggaa agcaggatgt     87480
     tgacgcagca gaacaggacg actcgcttga ggtggttgtc gtcgccgagt ccggcgagtt     87540
     cgaaaacggt gaactgcgct ttcgggtcga gtgtgctcgg accgcggaaa tacgggcccc     87600
     gggtcggcga gtcaacgaaa gccttgagcc gagggatgag gttggccgcg gcgacgtgga     87660
     cttggttctg aatctggttc tctgcagcgg attcgacgat tgcctgcaga caggcgatcg     87720
     tcgtcgaaac ttcggcatcc ttgccgcgct gcccccatgc agccttgacg gcttcgctta     87780
     atgcaattct tgcgccggga tcgggctttt cctcatcgta ggccatcagc atgtggagcg     87840
     atgtgatggt ctcttgctgc tcgtcgaatt cctcgtctgt caggttggag aacggctgca     87900
     gcgatggccg ccaagcttta gcgccaccga attcgttata ttctcccccg atgagtgcgc     87960
     agaacttcag gctgctgcgg ccgttgtcga atagaacaat gttgtcgccc tcggcgagct     88020
     ccgcggttat cttggcttgg agactgaacg acttgcctac acccgattca gcggccataa     88080
     caccgttgaa gttggagttg ctgacatacg gatcgaagta gtgcatcgtc ccgcgacgcg     88140
     ttgggtaggc catccccgtc agcggaaagt cggagttgac gtttccgaga tagtcgccgt     88200
     agacgggaag caaacacccg acctcggagc tggccatcgt cgcttcgcca gcgaggtcgt     88260
     cggcgatcgt gttggaaaag ttcaggggta gggtctgggc gagtcgtacc aagccggtag     88320
     cgaccacatc ccgcccgtcg aaaccgagtt tgtccagcgt gcctttgacg gatgcgccag     88380
     cgcggaccgc ctcgtcgcgg tcgcggccga agaggaacgc gttcgtcgaa acatagacga     88440
     acttcgtgcc gtcttctgcg cattgccgtt taatctcctc gagatcggcg agcacgcgtg     88500
     gcgtgtcctc gacgccgagc ttgatgggaa ggggctgatg ctgtcgacgc gagcggattg     88560
     cgctctcgac acgcgtccat tcgcggcgct gattcgcgac tcgcaccgtg gtcgtgatga     88620
     tgcacggccc ctcgatccgc tggcctcccc cctcgcgcac gctgcccgag ttgaacggtg     88680
     caccgctcaa caggttcatg atcccgtgga acggacgctc ggggtacttt ttaaccgtga     88740
     cggtggtgca gtacgtgttc ccgttgatct cgcctacgtg gggatcccgg aaatcgaaag     88800
     tctgatccgg gccaaatacc tgataccgca gatcgagcgt agggtcgagc tccggaacgg     88860
     tggccggctc ataaatattg gtgatctgcc tatacacgcc gaccagttga ttaatattga     88920
     gctgcacgac gtcatggaag ccgcacccgc gcatgttcgt gaagaactct tgttgcaagc     88980
     tggcggattt ttcgacagcc tcgtcgtcgg ctttccgatg cggcactgcg agcgaaacgt     89040
     agaccgtccg cttattgatg ccagggagat caggtagctc gccactcgcg agtccgcggc     89100
     gatagaggtc cgcctgccgc ttgatcaggt cttgcacgac agggccgcca tacaatttgc     89160
     ccttcaaata ggtatccggc gcgtcgtggt cagggtggat taccagagta acctggatca     89220
     ccgactggtc gggcacggcc ttgaacacgt tttgaacgac tgtgctgaat tcgccaccgc     89280
     ctccagcgag cggactcatc ctgtagacgg cgccgattag cggccgttcg gcgcctggcg     89340
     ccttcgagat cacgaggttg ctatccgacg tgtaggtctc gatgttgaga atatcgctcg     89400
     ccggtgatcg tcggactttg agggtggtgg cggtcaagat gaactctctt tcgacttgaa     89460
     acggatgggg cgcgcgttcg gcgcgccccg atcctcgacg gggacggttg tttagtgcgc     89520
     gagtccgtag tcgggcgcgg tgttgctgga tgccggtgca ggcccgttag ctgttgcgac     89580
     cgtctggacg atgctcgggc cgatcaacgc cgttgcaagg atgccgagga caaccgcgag     89640
     gttgcgatag ccctgcccgt gcgcgagctg ccagatagtc acgaggaaag tcagcagaat     89700
     ggcgaacatc acatacgtgc tgctcagcat ctccttgatc gtggtctgga tcgaatccca     89760
     tgcgctaccg gtcagcgcgg ttccgccatt aagggcgccg atcgagatga gcatgatgcc     89820
     catcccgacg gccatcacca ttgccgcctt cggcgaccag gtcggcgtgg cggtcagggt     89880
     tgcagctgct ttctgtttca ttggtttcct cgtttactgt ggcattgaca ttggcatcgg     89940
     gatgccagcg gggttttcac cgcccggcgc gggtccgccg ggttggatga aatcgttggt     90000
     cgtcggcggg gcagcagccg gaggcgcgct ttgcgccgag gcgaccgcgc cagcagacgg     90060
     gtcttgaggc gtgtcggcaa ccttgtgcgg atagacgcca ccggccgccc gtgcggggtt     90120
     gccaccgtcg aatcctgtcc atcgagatgg cgcgatttcc ttgagcacgg tgaggtcgct     90180
     cgtccacatg tcgttctcgt cgacgaaacg cttgatccag gtccgctgga ttaccggacc     90240
     catacggacg ggcatctctg cgtgcagagg cgtcgcatcg gccggcgcag gctgggacgc     90300
     cgctccaccc gagccaagct ggaccggttg tccgccggca gtcagtagcg ggggagcggt     90360
     caagtcgcga cgattcggcg gggcgatgtc agttgccttg tcgtactcgc taaatttcag     90420
     ctcggtatcg aagcggctat caggcagtcg accattggtc gaagcttcaa ccgcgcggaa     90480
     actatggcaa tagatgctcg tcggatcctg ctttcgattg cagtcgtacg tattgctccc     90540
     gatcggattg aatgcggacg agcaagcggc gagcgaaaca gcgatggccg gcaaaatcat     90600
     catgccgaga tttcttgagg agcgattcat cgttggtcct tggggggcgt cttgcgcttc     90660
     agggtgagcg cttgcttgag aatccaggtg actcgagtac ccgcggttac ttcgatgacc     90720
     gggaacgttt ccttggcgaa gttcaggtaa aactgcgaga gctccgttgc ggccttattc     90780
     acaccggtac caaccgaggt gccgagcaga aagctgggac tcgggtaggt ataggcgcca     90840
     gtcgagccgg cgctcacgtt gctgttgtag ctagagacag ccgtcggagc gagtgccgac     90900
     ccgaggccgg cggccatgcc cgtcagcgcg gcttgcatca gcatggagcc ctgcttattc     90960
     acgacctttc cggcgagacc taggttgccg tcgacgtcca gtccgtacgc gacaatgtca     91020
     ccttcataga tttccccgtt cttgaagacg cagctgatct tgtcggagat aacgtacgcg     91080
     cgctcggcgg acaggacggc agtagccgag ccgccgatga agcagttctc gaggtcggaa     91140
     gacttccacg agttcggcat gatcgtcgcc cccttcactc gggacacgaa cggtgcgccg     91200
     acgtcgatcg ccttcgtgac ggcgccggct ggaccaccgt tcgacccgcc ctggcgcgcg     91260
     ttgaagccgg agagcatgac tgcctcgatg cccgaataga tcgggaaagt cgggtccggt     91320
     ttggggtttc cggcacttgc agtcgacggt gctggcttgt ccacgactaa ggtcgggcgc     91380
     gccggcgccg gcggctctgc cggtcgagcg gcggcgaagg ccgcggggtc ggccgccgcg     91440
     gtccctgcga tactgcccga tgcgctggac ggacgatttc ccggttgatc aaagttcaca     91500
     gcgtcaggga gatccttgcc cagcggactg ttattcgaac cgtcggacgg cgtgggcgtc     91560
     gatgccgaag gcgcgcttgc cggcgtccat gtcgtcgtca gcttcgatgc gtctggtgcg     91620
     ccgccagcct tgccgtcgga aaccgccttt gtcagagtga caacctgctg ctggagcgag     91680
     ccgacctgtg ccgccaagtc ctcgaggccc tggttccggt tcgacgtcgg caaaatgccg     91740
     acggtgccgg caaacccttg gggcgcgggc gccggctgcg ccggttgagg cggcaagccg     91800
     gccgcgggag cgaccactcc ttgtgcaaca gcgcccgcgg tgtccgcttt gggtgctcgt     91860
     gtgaagtgct ggtacaggat gaaggcggtc cccgtgacgg cgacagtgac cagcaggtag     91920
     cggaacttag gctccatatc ccgccattcc tgcttgcgat cttcaagcca cttaaattgc     91980
     atcgccatta ctgctcctcg cgcttacgcg ccatcacgat cacgcgggtc ttctctccag     92040
     gaagaagtac cggtttcggg taaatcgata ccgcgatgac ctcagggccg tcgaattcct     92100
     cctcgcgcaa cacggccctg ctctgcgttg gatttcgaac cgtatagacg tagagatcgc     92160
     cctcttggct gctgtaccgg gtgtcaacgg tggcggagag gccgttcatt gctatgggag     92220
     gcaactggat gtcaacctgt gagaagccat ccggcgcctt tcccaaagcg atcgccgcca     92280
     tcaagtcctg aatatgggat gtgtactcac tgcctggcga cgacttgggg cgtcgccccg     92340
     atacaatgcc ggtatcgtcg gtcacgagaa ttgtttgcgc ggggatcttc ttcgggacga     92400
     tagcgagacc gagcgctgac cccccgtcgg gcggctcgat atacaggtgg cgagcttgcg     92460
     aaggagcgtt cgtccagtag acgtacacgt tattgctttg ctcacgcttg tcgacttgaa     92520
     cgtcactcgt gtggacaatg tacgcattct tgaacggcag cagaatccgg ttcggctcgt     92580
     ctgcgctcag gtataccgtt ttgttgcctg tgttggtcca ggagaccttc tggacattgg     92640
     acgggtcggg cacgccaatg ccctcgccgg gtaccgtcaa aacgccagga agaacgattt     92700
     ccttctgcgg tgtgttctta actgcgattg acgcatcaac cttcagggga tcacgggtcc     92760
     gtttcacgtg gccatggagc ttcggcttcg tcttcgtcgt cgtcgtcgtc gtcgccgcgg     92820
     attcaatagc cggcggcgta gcaacgccaa agtccacgga cgctgatgcg ccttgggcaa     92880
     acgcaacagt ggacagtgtc gatccgaaat agaccgccat aagggcggaa aggtagcggg     92940
     ttttcatcgg cttcacttct tctgttgagc tttgatccat tcggaggtat gagccttgtc     93000
     gccggggtag gcgatgacgt cgtccatcgt cattcgataa ttgccaaagc ggaccgggta     93060
     ttcgaagacc catggctccc cggtatcctt ggctgcgttg acggtatgga cgtcaccttg     93120
     gacgaacacg cgcccaagtt tctcgtcggc atcgaagcgc ttcagaacaa agtaatagct     93180
     tcccagctcg cgctgcgact tcagcgtctc gatcttctgg tcgattgcca aactgacttt     93240
     cgtgtacgcc gcaggtgaga gaaatggctg aacgaagcgt ttcgtggatt cgccgttact     93300
     cggattgacc gatgcgagag cattagtcac tgcgaacgca tacgcttgca ttgcaccgac     93360
     atccatcccg ttgcgctcga tcttcgcgcc atctggcatt cccggaacct gcatttggac     93420
     gatgacgttc tggaagatca cccgcaaaga cagcagcagg actgcaatgc ccaagcagcc     93480
     gatcccgatc gagagatatc ggttcagctg cttgtattcg gcgatcgatt tatctcttgc     93540
     tgtgcgattc attccaactt tcctttttcc tttgaactgg gatcaagaat cgactcgatg     93600
     aggtgcctat tgcgtgggtt gatcacggtt gcgtcgccga tatatagcgt cttctgagat     93660
     ttgaatcggc cgtagccttt caaaccgagt cgaaacaggg ccacgcgggc aaagccttct     93720
     agccgttcgt tgcaccactc gatgtacttc ttgttgatgt ggtaccccgc gaacggaatt     93780
     cccaggtacg cgggggttcc gtagaacttt ccggctactg ctgcgataag tagggagaga     93840
     atcaggatgt aggtatcctt gaactgcacg ccaaacaggg cgggccctgc cccgccgtat     93900
     ctcgggattc ggaacttaat cgacatggcg actcccctta tcccagcaga caagatgctt     93960
     ctgccagtca gcagaagtcg cgaatgcggt tgtcggaaca cacgttttct cgccaaccac     94020
     gatgaccttc ggccagttca gaatcgaccc ggatcgcgcc ttcccgcgac ttgccgtgtg     94080
     ccggctatgc cgcgcgagcc gcgtgcgctc ggcagccaac attgactccc gtgtattcca     94140
     aagggctgct tcctccttct cgctgaataa gtcgtagttc tggcgcggtg cttttccaag     94200
     catgaagcgc tgcgggcgtc gcccgtcatc gggaagctga ttcgagtaga cgtagctccc     94260
     cccttgcggc gactcgacga ttgcaccgcc atcgacgtag ggcccatgga cgtcgaatgc     94320
     gacgccgttg gtggagggga ccgcgtatgc cgaagatgcg acgagagagg caagtgcgag     94380
     gatgagaaca ggtgtcttca tacctaaatt ttaatcacta gccgagagga tcacaattaa     94440
     tatttcgtgc cgtaggtcgc gtagtacaac ttcgacgcat agtcgcgcgc ggaaggcaat     94500
     ctcgagttct gcgcgaaaaa cttgagcgcc tgcgaaaggc tcatgtcgcc agcgactttg     94560
     gagaattcgc cggggttttc gctcgctccg tgtgcaatta cgaatgacgg ggccgcggtt     94620
     acgccgtacc gacgcgtgag cacgggatcg acgatccagc gcgcgggctg cgtcgtgcag     94680
     caagcccgat taatgtcagc tgcgtatcgc tgcgtgctgg taagtgtcgg ctcctcacct     94740
     gcaaaacccg tgagcactat gacggcgtga gctcgactcg cttcgcgcgt gacctggatg     94800
     atcgattgaa gcggcattcg gctcgaaacg aagatatatg tgttccacgg cgcagcgatc     94860
     gtttcactga gcgagggttc gccgtggact ggtgctgcgg cgaagagtgc aagcgcgacg     94920
     atcaagcgat tcatgacgtt ctccgttact gaatggtctt cgtcgcgcag cagtctttgc     94980
     gctggaagat gatgtatccg taatccttgt cttgcgggcg tgcggcgcct atctcttgga     95040
     aagcgagcgg ccgcccgatc ggcgtgcatt tgttgtcggg aaacggaaag acacggttcg     95100
     tcttgtactg acgcttgtcc atcacgagct gagggacccc cagcgcgcca cacgattgaa     95160
     gggcgtcgtt tcccgcggtg gcttgcgcag ctccggcagc gtggagcttg gcaaagaggc     95220
     gcgcgatcat caggtgcgat acctgctccg gggtgttggc gatcgcgaca ttgccgttca     95280
     gtgggtacat cggcccccac gctccggcca cccagaaaag aatctccatc gggaacccga     95340
     acgtcgcgga gattgcgtcc ggcaactcgg ccgcgatgct cggaatcccg gcaaagggat     95400
     atgcgtatgg ggtaagcatc agcgaaagtg catcgtcgtt ccatgtcggg tcggcccagc     95460
     tgaggaaagg gacgtcgaac gaacggttgt ccaggcacgg attgttcacg accacgccga     95520
     gtgctgacat gatcgggttc acgtattcat tcacctgcat gaaggccgct tttcgcttcc     95580
     cgctgattgc cgcgttggta acgttctccg cgccatactc agctgcgttg tacggggtct     95640
     tgatatctat gccaccgagc aacggcatgc aaccgggttt ggtcgtggtg tcgaccatat     95700
     accgtggctc ccagaacgag actggggtgc ccactgccaa gttgtttgcg cagacgcaaa     95760
     ctggaaagtg gcttgcgccc gtgtcgtagt cgtcgcctga cacgcccatg ttgatgaacc     95820
     cgcccataat cgagatcggg aaaatgcagt cgtagcagac gtccgtgata aggttcggga     95880
     agctgccatt gcaaagtgct tgggcgtttg cgttaccaga gaggcaaagt gccaagacga     95940
     ccgaagccca aagacgcatg aagcttttca atttgcgccc tccataccaa actggacggc     96000
     gagcctgtcg ccttgttgga aaattgccgc cggcacactg ttgatctgga tgttgtacag     96060
     cttggacagc gtgctgatga tcattcggcg ttgatcgaag taaaagggaa cacccgtccc     96120
     cccatgccac ggcactttcg cgtacttcac gcgaagcgca tacggagagc ccgcggtcaa     96180
     tacgatcttt aagcgctcgg actgactgcg cctgatcgca tactcgacct gacgagcgtc     96240
     ggtcccatcg atgaacagaa gtccgttcgt cagcggcatg accttgaggg gctctacgac     96300
     agtcccgcgc cgaacgatga ccttcccggt gtgatcgcga tagtcttgcg gaatctggaa     96360
     acgcagttcg cgcagctcgg tgcgcacgcc gtagcttgtg gctataccga gggacggcgg     96420
     gttcttgatg ctctcaatcg tgcgatcgcg atagttcttc cagaatgcat cgagttcgcc     96480
     tgattgctgc tttctccgga aaatgtcctt gatctgctca gccgcgtcgc gatcaagcgg     96540
     ataggtttgt gcctttgtgc cgaggtcctc ggcataggaa atggagagtt gcagcgaggc     96600
     tgcgagcccg atgagcaatt tcgggatgcg gttcattagt ccaccaccat ctttggtcga     96660
     gagggagccg cgggcgtcgt gatcagctgc gccctgacag gaggaagggc gggcgagccg     96720
     ctacgcttga gctgttcgag cgacgcttga acaagggtgg cgtactcctt gcgtgcctgt     96780
     tccttattcg ccgcaattcc agcgccatag gcaccaacgg cacgccacgt cgggccgaac     96840
     atccggatca tgtcggcgag gacgaaggcg ccgacgttga tatttgtgca tccgtcgtac     96900
     aggtcctctc gctcgatacc gtattttctg agccatttga gatggaccgg catgatctgc     96960
     atcacgccga ttgcgccgga ttgagcgttg gtcacccaag gtcggaatcg ggattcgaca     97020
     tgaccgatcg ctcggagcag gtcgacgctg atgtgccgct tgcgggcagc attttcgaag     97080
     cacgcattca aatcggccga gctcgcgttg ctgcaggcga gtaggactac taaagcaatg     97140
     gtcgcaaatc ggaaggtcat tttgcgcgcc gcagagcccg ccgagcgagc gatcgtccta     97200
     cgaccgtaat gccgagggcg acctcggccg ttacagcggc gactaccatg taaaaggcca     97260
     gtgcaatcac gagcgggccc atcggcccta gatcactggc agtgagaatg atgaacgccg     97320
     cggtcccgag cagcgcgact acagcaacgt gaatggtggt atgtcggccg tgtaccgcaa     97380
     gccaagcgag aaatttttcc gtcatcttat ttcgacgccg ccaagttgga atgggatttt     97440
     gcaagctgtg cctcgatccg cgctgcgggc acgaggccgg gaatcagcgt tccgtcctcg     97500
     aagacaagcg ccggcgtccc cgcgatgttc cactggcgtc cgaactcgag gtttcgcgcg     97560
     attgggttgg cacacgtcgg ccgcgctggc tgattgtgct ggcggagata gtcttgccac     97620
     gccgacagga gctcgggctc acgagtggtc agcgtcaagt cttggtaggc tcgccacgca     97680
     gccgcccgat ccttttggca ccagatccct tcggctattt ccgcagcatt ctcatggccg     97740
     gcgagcggaa acggaaaaat gaagatggtg acgtcttgaa gcttggtcag cgtaccttcg     97800
     agctttcggc agtaagggca gtccggatcg gagaagatga agagacggcg agaaccgtta     97860
     ccgaacttaa ttgcatcttt caggttcagc tgagccacgt cgatacgcgg aggattggcg     97920
     tctcggacgg actgcgtgag ggagcgatgt tggttgaggt cgacgacctc gccggaaatg     97980
     agtatcgaaa gatcgtctcg cacaaagaag acgtcgctcc ccttcgcgac tgaccaaaag     98040
     ccggggaagg cccgttcgat ctttgcacct tgagcggccg gaaaccgctt ggtgagctct     98100
     tccgggaagc cagcatgtgc gagggtggca atgctggcgc agatcatgct gatagcaagt     98160
     tttgcaagac ggtgcatggg tcctctttca attgtttgag cgccggatga ggcgaacacg     98220
     gacctcgggc aactcaggtt tgtactgcac gataaattcg agcagcgagt tcacgttcac     98280
     ccaggttctc gcgcgcttgc gctgcgtata gagaacgtgt tcgacgttcg accgggcaaa     98340
     gatggtgagg agaatgaacc cgccttccac ttcctcgatg atgaaatcct tgatcgtccc     98400
     tgcgatcgct gcttccttca ggtcctgctc aacaatagct ttcatgccct actccagtcg     98460
     ttaatgccga aatgataccg aacggtgtca aagcggcttg acgactcccc ttctcgaccc     98520
     ctgatcgctg gcgagcttcg cgcggcgaaa cgggctgggc aacggccgtg atcaaaacat     98580
     caaaagtgag attatgcaac gtagttgttg aatacaaccc cgccatacac gacggcgacg     98640
     acaccaagcg caagggcgaa ctcggtttca tagagaccct tgtgcttgcg ccagaacagg     98700
     aagccataca gaagcatggc taggcaaagc agcttgaagg tggacacggc cgactcgaag     98760
     ctgacccact ggacgagcca gttgatcaac ctgtttgttt cgccgcgcgt gtgcggagcg     98820
     gtcagcgtac tgtgccaatc caaaatctgg agagccgcga cgacaccgag caggctcggt     98880
     gttcggtatc tcgagaggac ggatttgcag tggtcgatcc tcatggtttc cccgttccgg     98940
     cctggtcggg ttataaactt gtatcaggcc gcgaggtgag tataatttaa ttcccgacgt     99000
     gatgcatcta tcgccgttgc acgacggcaa ccgcgaaacc atcgcgttaa cggtgggtct     99060
     tcgcgcgaca agtcaatctc gcaacgtgcg tggacggacc caatagtcgt cgcccaggtt     99120
     gccgaccgaa gtgatgttgc cgagagcaac atggtgatgc gaacaacagt aaaccggggt     99180
     aaccaatgaa actagaagat atccggtacg taaatttcga ggagccggat cgcaggcgtg     99240
     tgcaggacaa cgcgattgag gcggtgaaga aggatccggg aaagttcttc gacgcgtaca     99300
     aggcggacgc gaggtcattc gagggacggt atgttgcagc tgacctgttc aaggagacgt     99360
     ttccggactt cagtgcttcg cgagaagccc ggaatcgcta caataatccg gtccacaatt     99420
     cggcggcggt cctatcgtcg gctctttttg tcacggggcg gcgctatgga gccaatgcgg     99480
     ggtcggcata agggcgccac ttgaggggcg gcacataggc gccagtccaa gggcggcgta     99540
     atggcgccac gttaggggcg gcgcataggc gccagcagca tcagggcgag aacgcggttc     99600
     gaactttccg agtcggtacg ctccgttctt tttgaacgga gcgtccatgg ccaacaggag     99660
     gttcgaattg tttgaatacc gccaagtcct tgtccgcatg cggcaaggcg attctgaccg     99720
     cgacatcgcg cgcggcggtt tgatggggcg caagaagctg acgaccgtgc gccgcgaggc     99780
     tgaagcgcgt agttggctgg atccggtgca gccgctgccg gacgacgcta cgatcgcggg     99840
     tgtcttcggg cgcacgccgc acctgccgca cacctgtgtg tcgacggttg agccatatcg     99900
     cgaacaggtc cgcgaatggc ttgccgccgg cgttcagggc accacgatcc atgccgccct     99960
     tcaacgcaat catggctacg ccggcagcta ttgtgccgtg aagcgcatgc tgcgccatct    100020
     ggctgccgag cgcagcgtgg ccaccacaac gatcctcgac ttcgcaccgg ccgacgccgc    100080
     gcaggtcgac ttcggcgcgg gacccgtgct gacggtcgag ggcattgcgg tccggacgtg    100140
     gatcttcgtg atgacgttgt gctggtcgcg ccaccagtat gccgagatcg tgctggacca    100200
     gaccgtcgag acgtggctcg ccagccaccg gcgcgccttc gaatggttcg gcggctgtcc    100260
     cgaccgggtc atcatcgata acgcgaagtg cgcgatcatc cgggcgtgtc gatacgagcc    100320
     ggcggtgcaa cgctcgtacg ccgcgcttgc cgagggatat ggattccgga tcgacgcctg    100380
     tccgccgcac gatccccaga agaagggcgt cgtcgaatcg ggcgtcaaat acgtcaagaa    100440
     gtccttcgtg ccgctgcgcg agttccggga tctggccgac gccaaccggc aactgcgcga    100500
     atgggtgatg cagcaggccg gcactcgtat ccacggcacc gtccacgaac ggccgctgac    100560
     gcgcttcggc gtcgagcgcc cgttgctcgc tgcattgccg gacgtgccgc cggtactgtc    100620
     ggtctggaag gaggtggcgg tccatcgcga cggccacgtc gtctacaagc acgcgctgta    100680
     ctctgcaccg ttcacgctcg tcggcaagtc gctctggctg aaggcgaccg atacggtcat    100740
     ccagctgttc catcggcatg aactcgtcgc aacccatccg cggcagcggg ccggcggtcg    100800
     ccacacggtg cgagatcacc agccgcccga agcgcaggcc tggctcgagc acgatccgca    100860
     gtggtgtctg gcgcgcgcga aggagatcgg gccgtcgtgc cacggcgtga tcctcgcgct    100920
     gttcaacgac aaggtgctcg tcaacctgcg cggcgcgcag gggatcatcc ggctgcgaca    100980
     gaaagtcggc gatcagaggc tggaagcagc ctgcgagcgt gcgctcgcgt tcagcagcgc    101040
     gaagtacagc accatcaagg gcatcctcga caaaggcctg gacagcgaac cggtgccgcg    101100
     tcccgcgtcg gccccgactg gcgcttacca gaacggcggc cgcttcggcc gtgatctcca    101160
     atccctgctg atccactgac accatgaacc cgagtcccga attgaattcc atcctcaaac    101220
     agctgcgcct gtccggcatc ctcgactcgc ttgagcagcg caaccgtcag gcgatcgacg    101280
     ggcagctcgc ctataccgag ttccttgcca tgctgctgca cgacgaggtt gcccgtcgcg    101340
     aacacaagaa gctcggcacc cgtctgctgc gcgccggctt cgcgatgggc aagacgctcg    101400
     agacgttcga cttcgaccgg ctgcctacgt tgaaccgctc acacgttcat gatctcgcga    101460
     caggccggta tctcgacgag aaggtcgcga tcctgatcgc cggtccaacc ggcaccggca    101520
     aaagccaggt atctatagca gtgcggggtt gacgccgagg ggcaagtcga tgatagggct    101580
     tcagggcgcc tcgacgaagt gatcgcgggt cgaccttcgc accgtcgaat tcgatagctt    101640
     cttgtctgaa tcggggtgca ggacgtacgc cgaggggcaa gagtatgagg ccgagcttct    101700
     gtcgcttctg actcgccgtt caactccgcc cgctcgctcg ctggtactct tgcctgcggg    101760
     caccggaccc ggcgacctta agaacgtggg agagcccgca aagttcgtcc cgacgatgtg    101820
     aagcccatgg ttgcggggtt cgggctggcg caggcaagag taacgagatg gtggcgcatg    101880
     aatctgcgag tttcaagcgg ccacgaatga aacacctggc agtgctgccc agcgacgagc    101940
     cctctgattc gttgataagg agaacaataa ctcatggctt ctatcagcaa tgcacccgtg    102000
     cgtcaccgga ccgtcggcat cgatctggca ataagtgcag ttcaggtcgc gcagatcttc    102060
     gatgatggac gtgcaattgg caaaccgatc cgcttccgtt tgacgtcaac cgacctcagg    102120
     cgtttcgtgt cagccatcaa gagcggcgtc ggcgccgata cgccgatcac agccgtgatg    102180
     gagccaaccg gcatggcatg gtttccggtg gccaactggc tgcagcgtgc cggaatcaaa    102240
     gtcattcggg tcaagggtca gcgcgtgaag gcgttacgca aatacctcag cgagcatgcc    102300
     aagaccgacg cggccgatgc acatgtattg ggcgcaatac ccggctttgg tggccgtggc    102360
     ctcgacccag ttcatgtgcc agggcccgag caacattcac tacaacgact gaccaaacag    102420
     cgtcaccgct atcaggagct agtgtgttcc gcgcggcgcc gcgttcttga cctcatccgc    102480
     tgggcgtgcc cggcgcttga gcctgtgttg cccgatacgg tcacgcaact cacgctagca    102540
     attctcggcg agctgttgga tccgcgcaag gtcgtagcca tgcgacgcga tgtgctcgcc    102600
     cgattcctgt cacaacacgc ctcagggaat catcccaaga gcggcccctt catcgattcg    102660
     ctggtcgaga aacttaaggc agcggccgaa gagaccattg agctccacgg cgatagcgtc    102720
     gatttcaccg ctttgcaatt cgaggtggcg caagaagtcg aacatttgcg actgtgggat    102780
     cgccacgtcc gcgcgatcga gcgtgaagtg gagcagatct atcagcgggt gcatccgtcc    102840
     gatgcgcttc gatctattcc tggcataggg gcgaccttgg ctccgctgct catcggcgta    102900
     ctcggctacg cgaaacgctt ccgtaacgaa gatcacatac gcggattctg cggtatgttt    102960
     cctaccagaa gttcgtccgg tggtatagag aagcccggtc aaaggctgac aaagagtggt    103020
     agtgatcgcg tcaagcgggc gctgtacatc gctgcggacg ttgcacgaaa gatcgatcca    103080
     gatcttgccg ccgtgtactg gcgtcttatg gtgaacaaag ggcatcacca caagcaagcc    103140
     atctgcgcag ttgcgacgcg cttgatcaac cggatctatc gcgtgttgaa gaccggcgag    103200
     ccgtacgtgc ttcgagatca ggaaggtaac tcgatttccg tccaagaggg caaacgtatc    103260
     gttgctgcgc aattcaaagt gccgctcgag gtccgccagt ctcgccgcaa ccagcctatg    103320
     cccgaaccgg cgtagagccc tgctccgaag ccgcgaacat gcgttgacag tcggtacgag    103380
     atcacttggc ccaggcgctg ggccactgcg ccgcccgcca aggccgcgat gtgctgttca    103440
     tctcgcagac cgagctgctc aagcgattga acgccgcgcg cgccaccggc gcctatgacc    103500
     gcaagttcca gcagtacgcc cgggtgccgc tgctgatcgt cgatgacttc gcgctcaaac    103560
     cgctacgtac cccgcaggac gaggacttcc acgatctcgt cgcggcccgc tacgagcacg    103620
     cggcgaccat cctgacgtcg aatctcgact tcggtgaatg gggcgccgcg ttccccgaca    103680
     accgcatcct cggcaccgcc acactcgacc gactacgcca cggcgcctac cggctcgtcc    103740
     tcgagggcga cagttaccgc accccgaaac cgatgccaga tccccctcaa aatgcagttg    103800
     ccaaaaacgg caaaaaaccg caaccttgaa accgttcgaa tccgcgtttt acccccggtt    103860
     ctgctggcgc cattacgccg cccatccccg gctcctttac gccgccccgc gacacttttc    103920
     actgagaacc ttgcaggacc acgtgtcagc ggtcgagata cagtctattt cttgactggg    103980
     tcccccggcg ccgggaagac ctcgatggtg ctgaaatctg gcgagttgcc gcgcgacgcg    104040
     gtgatggtgt ttgagggcca gatgtccaac ttcgagacaa gtcgcgccaa aattcagcag    104100
     gtgcttgatg ctggttaccg ggcgcatatc attgtggtac atgcgcgggt cgaaaacgcg    104160
     ctcgacaaca cgctccagcg tttctacgag gaggggcggg gatcaagcat cgcgacgatc    104220
     gccaacatcg tcggtcgcct ccccgaatcg cttgagcagc tcaatagcgt tttcggccct    104280
     aacctacttc tcgacgtggt tgatgtcaga gaccgcgcga accccgttca gctgcagggt    104340
     ttcgagaaca tcgaagtatt gaaatcggaa ggtaactatg aacacatcca aagacgactc    104400
     cagcaacgcg tcgaagacca gcgcgagttc ggacgaattg acgaagacgc ctatcgacaa    104460
     gctctcggac tcgcaccgcg cgatcgcgtc ggactggatc gcgcgggcca tgactgggat    104520
     caaggaaatg cacgagagcg agccggcgcg gagagaagtg gcggacaaac tcttctgacc    104580
     gcgcccccgt cgcgcagtca cattactcac gttccgccgg gcttacggat taccgaatcg    104640
     acgagccttg gaccggacgt tgtcgtccag ggcaaggtga tcgatgtctc agacaagcag    104700
     gtcctggtgc aaaccagccg gaccgacgcg gtgcgattca gcaaggacga gctcagtggg    104760
     aacgtctacc agggacaaaa tgtgcaactc aattttcagc ccaacgagtt ggcgcgcacc    104820
     actgagcggg caaaagaaat caaacagcct ggcgtcaatg agaaagcgcg cggcatagcc    104880
     gacacctgat cgagaggcaa ctgcccgttc ggcgcggcag ttgaagtacg gggaagatat    104940
     ggttcgcttt gagatagacg ggaaaactta ctcagaagat gaccccggtt tgcaaggtgc    105000
     actcgcgaga attcacggct cggcgattcg tccgctctgc ctttgtgttg atccgaagcc    105060
     cggcatcccg atgtacgtct cgaaggttca tgggcagtat ctgatcaaga gaatgccgga    105120
     ctctgggccg ctacattcgg ccgagaagaa ctgcccgtca tacgaggcac cggcgcagct    105180
     cagcgggctc ggtgaggtca tgggccacgc gatcaaggag gacgtcgacg acggaacgac    105240
     gagtcttcgg ttggatttcg cattgaacaa gatcgccggc cgggcaccgc ctacaccgac    105300
     cgattccgag caagatagcg tcaagggcga aacatctaag ctcacgatac ggtcccttct    105360
     tcattacctt tgggatgagg cgcgtcttac ccattggcat ccgggcatgg aaggccggcg    105420
     tagctgggcc accgtccata agtacctgtt acgcgcagcg caggggaagt tcacgaaggg    105480
     gatgcatttg ccgtccacgt tgtacgtgcc ggagccgttc tacgtcgatc ggaaacacga    105540
     gatcgagcag cggcgcagag cgttgctcgc ggcggcacac aagccggggc gcggtggaca    105600
     gaggctgttt atcgcgatcg gtgagatcaa ggcagttact gcagcgcggt acggacacaa    105660
     aatcgagctc aaacatgcgc cggggttctt tttcatgatg agcgccgacc tgaacaagcg    105720
     cttaaaggtg tttgaggccg agaaaagcct ctggaacgcg tatcctgaca ttcatctcgt    105780
     catgattgcc accttcagtg tcgacgttgc gggagtcgcg gagctcgagg agatggcgct    105840
     gatgaccgtg aacgaacagt ggattccgtt ctcgacagtc gaggagaaga gcttccttga    105900
     aacactggtc tcggaccgac gtcgattcgt gaagggcctt cgctataact tgccatccac    105960
     ccgtccgctg gcctcagtgg tccttaacga caccgagggg aagcataccg ctgtctacat    106020
     ggtgcccgga aatgcgtccg aggcttacaa ggtcgcgctt gcggagttgt tagcggatga    106080
     gaggatgaac catctgcagt gggaatccgg taacgcgatg cccgttctac cgcctccaag    106140
     cgtccgcact gtatccgaag cagcctaaga catccagagc ctttcgcatg cgaaaggctc    106200
     gttgcttcgt cactccatct gcaatcgttc catccccatt cgccaaagtg gcccactcga    106260
     gtgtcctgta ttcaacgcat ctgtgcgccg ccatgcttta tctgctgccg ccgatcgcag    106320
     gggctgccct acttctgaaa ttcgcgcgga gcggcgccct cttcgctgca ctttgcttgc    106380
     cggcgacgat tgcgcacgaa ttattgcact ttgtcgttgg ccacctcgtg tgggctcgcc    106440
     caacgaggct ctctatattt ccgcatcggt cacccaatgg ggtatacgtt tatgggatgg    106500
     tcgccttcga aaatgtgcgt tggtggaacg cggcgccggc ggcgctcgcg ccactcctaa    106560
     gcttgccgat cgccgcggcg tcggcgttgt ggcggacacg taccttggcc acgttagagg    106620
     cgtcggatat cgcgatctgg tttggactcg cccagcttct tgttggagct tggccgtcgc    106680
     ctaccgattt gcggctagct ggaagatctt ggccgctgct tgcgatcgtt ggaatcagcg    106740
     catcagcgta cttcgcgttg cactagcgag ggccgtgtag tcccgttcga gcgaggggga    106800
     ccgacgttct agaggcgtcg acgcccaagt ggggagttca gagatgtcag cgtgctgggg    106860
     agctgttgcg cagattttcc tgccgagaag ccgggtgatg gccgatgcgg agcatttggc    106920
     ccgcgcatcg accgtgcctt tcatcgaatc aattcgtcat gccgctcgcc ttcagctgct    106980
     gctgcacctg gtcggcgaac agggcgtgca ggtgcgatga cggattgaat aggtcagcgt    107040
     acatgtacga ttgatcggct ccttccgtga cgtaggtttg cggggaacag aacagtgctg    107100
     aaccaaaggc ctgcggattt gcgacgcccg ctttcgccgc gttgccgatc atcgcatcga    107160
     tattgcatgc tgttccggtg ttgccgaccg cgaacccgtt cgatttgtag ctcgcaagga    107220
     cgccatcctg ccatcctgca aggtcgacgg cgatcagctt gcttgcggga atgcctagcg    107280
     attggacgga ctgcgcgagg aacgtgttgt agatcgtgct caacccactg agcagctgtt    107340
     gcgcggccgc accggatcgg acggcgtaag gggtttggcc aaggtccggg acattcacca    107400
     gcacgacacg ggtcgcgcca gccgcaacga tctgctgcac cgtgcttgca agtgcctgtg    107460
     cgatcggcgc tagaaccgcc ccgccttcct tctggacggc gattgccgga tccatgcctc    107520
     cggcgacatc ggttgcgacc gccgattgca aggcgggagc caacgccaga atatcgttca    107580
     taccgccgtt gatcaggacg agctggccac tgttgaagct ttgatgggcc tggagatagt    107640
     tctgaagctg ttgcgtcacg ggcgtcgtcg tcgcttgagc atagtcagcg tccggcgtcc    107700
     cctcggcggc atgcccgata ccgatcgatt cttggacacg agcgccgcct tgggcgtagc    107760
     ctaggccgtt tgcggccgcc aacggtagcc cgaacccacc ttgatatgcg gggctcaggg    107820
     tcccgccgta cgaggcggcc accttctgag cccatacatc gccgggattc gtggtgtact    107880
     tgcctccgcc gaagccgaga aggatcttcg gagagtaggt gccgacgtcg gagagctcgt    107940
     cgccaaaagc gaccacctgc agtttcgcgt tcgtctgcga attgttggaa ggggtgccgg    108000
     cggccgcccc gctatcgccg ccgccaccac cgcatgctgc gagtgtggac agcatcgacg    108060
     ctgcgacaat ggcgagggtc aaacgcttga tcgatgtggt gctgcaggga gtggtctcgt    108120
     tgcgcttcat tcttttggtt cctcgttgtg gttcttcgtt gtcggttgcc tggggcgagt    108180
     gctccagatg gtcagacggc cggcgacata gccccggggg ccttgctccc agggctttta    108240
     cgtaccgctg accgtgatct cattatatca aaacagcgat tttgatgttt tgaattttgg    108300
     ggtatcaaga ttgagatggg aagttcggcc cagtttcccg tatgtccaaa tcacattcga    108360
     ttgacgggcc cgtcgttgaa agcgcgctca cggtgcagag ctgcacggta cgctagccac    108420
     aaaatcgtcg catatgcgag catcgtagga ccgagccagt agttctcacc catgattccc    108480
     cgtttgatcg tcccattgga gacggcaaac ccggaagccc aagcggtcca cgtgagtaga    108540
     aagttcgccg cgctgccgcc cataagtgcg aagagatacc tcaggccttg ggtcacgtgc    108600
     gagctgccgg ggcgcgtgcg ggccagcaag aggaaagtcg tggccgcccc ggcgaccaag    108660
     aaggcaagcg cgttgatctc gccttccaac gttccgccct tccacgaagg cgcgatcgtt    108720
     agaagtccgg ccgcttccat caagaagagt ccgaaagccg cataccagca tcgcttggca    108780
     ctcgtccgac aggtcattac gggccagaag cttacagggc agcgagggtt gcttcggtga    108840
     cgcccgagag cagccggaaa aaacgcggac ggcttgagct ggtcaacttt tccacgggtg    108900
     cgactgcgct tagagaccgt gtcgcatcca atggtgtcaa cgccgacgtg aacggcgctc    108960
     gagaggcgcc gaagtacact ttcccgctcg caatcgcggc gtcgagtaca tctcttactt    109020
     cgaaatatcg agactggcgg gccgcggtca ggaaaacgcc gtcgaagacc gtcgtatttc    109080
     ccgaattcga atgcgtcaag gcggaaagca gcggcaagtt cgtgtccggg ccgtcgctat    109140
     cagagaagga tggatccttt gaagttgggc tcgcaaatag cgtgacggtg acgatattcg    109200
     gatcgttgat tgcgtcgatg agtccctgag cgttttgcgt tgtgtttccg ttcgtccagc    109260
     gggtggcggc catgtccaaa tgtcctcgtg actgatgttc ttgtgagtct atttcgctca    109320
     acctttcgta ggggcaactg gtcgacgcag ccaggatttg gtgccgacgt ctcgccccta    109380
     ggcgtggcgg caatcggtct gccgccttct gtagattacg gtcacgcgtg ccataacttg    109440
     agcggtcgcg tccctcgatt agaatttcga tcagtattgg gcgtggctag aatgccgcaa    109500
     atcgggtgcc gcgaattgat gcgggttgcc tacgaagttt gtacgctatc ggtcagcgac    109560
     ttcgaacgga atactcgaat aacgagaact ggcgccgcag gaagcttccc acggggactc    109620
     gacggtgttc gtccaactca cagaagtagt agacggccgc gtgcatcgtc gacagcagta    109680
     agggcgtcaa gagcaatgcg tcaagatgcc ctccaccgcc gattcgggcg ataccgatgg    109740
     cgtggcaagt gagagcgcca tacaagtcac cgggaaagat cgtgatcatc gtggcgctga    109800
     aaatgcccgc agcaggaacc cgccgacatt gaccgcggcc gcgacgcaac catgttacga    109860
     agcacaggag gtaaataccg ggcacgacgt gcacagcttt gctgtcgcag aaggagaagg    109920
     tcgcagaaat gccgagggac ccgacgagca acatccaggt ccaagcgtct agcgacctga    109980
     ccagtcgcgg tagatatccg atcgcgagcg ccagaggtag acatgcccct acaaggtcga    110040
     gggaaacggc gttcatgccc gtttccttga aaagcggaag gtgaacacgc cctgaagact    110100
     tgctagtcga accgtcaccg tggcgtctct atcgctcaat tcgcccgtgc ttcacgaggc    110160
     gcgactttat tgcacctgtt gagcgaccgt gcttccgcgc gagttcctgc ggagtgacac    110220
     cagcgtcgaa atccgccagc agccggacgt cttcctccag tggccatgcg cgcccggcgt    110280
     tcgtcggctt gggcttaccg actacgtttc gctcagacgt cgcgcccgcc gtgcggagtg    110340
     cattcgcagc ttcgaagagc gctcgaatga ctgacggatc attaaacggc ccatgctcag    110400
     acagtatttc accggtgcgc ggatcgattc ccttcgcgag actctcgata atttccaggg    110460
     cggccatagt gctatggttg gttcgtgcaa attggccgcg gcactctgcc acggccgcgg    110520
     tcggatacta cagcgtggga gcctgtttcg ccttgaaacg ggtttctgcg cgacgcccaa    110580
     cgatcatagc gaaggcaacg cctatcgcca gcactacgcc ggcgcgggcg agattataag    110640
     gggtggctgc tgtcgaccac cctagtgtgc gagtgaagat caagtcgcat gcgatcgacc    110700
     agataatgaa gaaggcgatt gcacgacgaa ggccataccg ggaggcctta atgtcgacaa    110760
     gattcttgga tcttttaagt atcaatttgg atctccgtag gtggcgggcc gattgcccgg    110820
     aaactgcttt taggattttt gaagcatcac ctgcctcgta gactgggcgg cgcatttttt    110880
     cccatgtcgt ccaatagccg atggcgccgg tctaaacgcg acgcacatac ctgcgcggta    110940
     ccctacgccg cccatggctg gtcgggactg gagtgtacga gacgaggacg ttgctccgca    111000
     cgtacgcgcg cggctgcgga cggcggaatg ctgggccctc cctcgatcac tgcaagaaga    111060
     cgtcgtctca ttcgcatcgc cttatcttgc gagcatctca ggaaaccacg aatgtccttg    111120
     acggtcggac gaagtcgccc ttctgcaatc gcatgactta agcggaagaa atccgagtcc    111180
     acaatctgcc gcgataacgc ttccctcggc gaaacattcc cggccgcacc gatggagcgt    111240
     cgcggcgtga cagtggcctt cccttgctcg gctgttgtgt gcagtttctg ttgaggaaat    111300
     agcgaatccg tgcccccgac gttactccgg ccggtaacgc cggcgttgag tgcggccaaa    111360
     gtctgcaagt ggctctcagc ataacgccgc cccggatgga gcgcgagtaa ccagccgagg    111420
     cacgccacgc actcgagcac cgcgccatgg accagcgcga ccattaggtc gattgtttcg    111480
     cgagaagcgt tcactaattg tgcggcttga gccgtaactg ggtcgattcg ggcctgctct    111540
     tcgcgcgctt gctgacgttc gatcgtagag cggatatggt cggcggcttc ttcgcgccga    111600
     cgcgcttccc cagcttcgac atccaacgca gctagttgtg ctgcaagcgt ctcacgccga    111660
     atggtctgtt gctcgcatcg attcaagcac ctcatatagc gtgccaccgc gagctgctgc    111720
     ctcacgtgtg cttgatcacg agcgattgcg gctaggctgc ggccgtcagg ctgccgaatt    111780
     tctgctagtt ggctgctgcg atgaaccgtg gtcgctctta cgtcgccagc atggcgctga    111840
     gcagccaaga aaaaggttgc gtggccgtac cctgtgataa ccatgcacac cgcccagagg    111900
     agcaacgccg gcaaccgaat acgagcggcc gtaccgcgcg tcaccgcagg gataaggtgc    111960
     gctgcgacga gcagaactag cccgattgct gcccacactc ctcgctcaat cgaagatccc    112020
     ccgcgttcct ctccggcgac gacggatatc cagagggatg tgccggtcga tagcaccgcg    112080
     agcagcaatc cgaagagtct tgatgaaggg tacgggagac gacggggcaa tgcctgcccg    112140
     gattcaggcg agatgttctt cacggattgg cctctttgat ttgcgatttt ccccgcgccc    112200
     catcgccaaa tggggtgagc gggcacaagg cagggttggc gaaccggaaa tcaaagaaac    112260
     cggcagactc gaaggtctcc ccgccttggc ccgcccatag aaaccggcgc gcaaaggcct    112320
     tcggcacaaa aaagaccgcg ggcgcggtct tgtgcgcttt gattagacgg gtcgccaaac    112380
     ccgacgcctg ctgtctcagg cgcttatcga gtatatcgag aggcgaaggc gtttacaagc    112440
     ccgtttatgt cggtctgctt ggggactcca cacgaattgt gcaactaacg gtcaacgaaa    112500
     ccgatatccg ccctcgtttg ccccgccgcg cctcccacac cctgaagtct ccaacaaaac    112560
     ggccggccca ccgaggggca ttcgaacctt caaaggcgct tgtggaacga gctaacagcg    112620
     ctgttcttta cgcggcaatt gccccgcgag ccgacgcgcg aacaacatgg accaaatcgt    112680
     tcttgtcgat cgtccagctc accaggaagc cttcctttac aagttcatca agcgcctttt    112740
     tcaagttcgc gcgaaagtga aacaactctt tggtctgcga accacactga cgatgaagga    112800
     aacgaacgga atgcgcgtaa ggcactgcat gcgtgtggta gtaggtgtgc agccatttcg    112860
     acaattcata tcgcaaccgt tggcgttgct cgcgcgcgag tcgcgtgtaa tcgtcatcgg    112920
     agaaaagcgc cacgatctcg ggttctacgt acgccaccca cctcgtcttc ccgtcagttc    112980
     ccgtttcagt gccctctttc cacaggaact tccggattaa cgagccgacg aacccctttt    113040
     tgttgccgga gaaacgcact ttcacctgcc ctgcctgcag tcgttccagc gtcgtcacga    113100
     gtcggtcgta acatttcaca gacgtgcccc acccgagaga cttcagtacg ctgtagcccg    113160
     tgaattccac cttctcgttc agctgcgtgt ctctagccaa gtgaagcact tctagaaaga    113220
     cgtccgcatc gtcctgtcta agctcttccc cactgaacgt tatttccacc ccatcaacac    113280
     ttgcaatcag cgctttctcc atcctgctac gcggcgcatt cgacttgttg acgttgaaca    113340
     gagccgagcg cgctagcgcg tttggcatac cacgaacgtt cggcggccac agcggaatct    113400
     gtgtcggatg agattgcgtt tcagcgcccg cgctgctagc gcgggccgca atcgctttca    113460
     cgtggtcgac gatggaattt gccatgcgag aagtatatgt aggtcggtcc cgccatcaag    113520
     acccttgtct cgtctctcca gcgatggttc agcaaaaaaa ctacgggact atcgtccctc    113580
     cagcgaggta tcgcggcgca gtcgttcctg cagcgatgtt cctcgttcct ccagcgtgca    113640
     acctctgtcg ttcctgcagc gttgcccatc gtctctccag cgaggcgtgc atcgtatcgc    113700
     cagcgatgca tctatcgttc ttccagcgag cacgatccgc aaaaaacctc tttgcaatca    113760
     gtgggctacc tatgttttcc acaaagccta atcgtcttta atctttttct aatcatgtca    113820
     tccatcgctg gaagcacgat acctgcagcc caacaatctc acggtggatc cgtcactcat    113880
     cgctccatga acgacagtac cggccgccga gtcacccaca aacatcgctg gaggaacgat    113940
     tctcgacgag aagcatcgct ggaagaacga cccgagatgc gcaaagcaag gtgagcacac    114000
     actctcgcgc tcaagcccgc cgcgtctgca ccatcgctgg aggaacgtca tacaccatcg    114060
     ctccaagcac gagactttct tacaggatgt aaagagaacc catcgctcca gagccgatag    114120
     tttccagatg ctgcagccgt gcacagttgc acagcgcagc acatcccagc tcaacgtcct    114180
     ctagcccctg tgtcggtaac ccgcttgcgc tgcgaagcag cagcgccccc tactccttcg    114240
     ggaaaagagc caagattttt tcactgatct cggccgcgac gtccggtgcc aagcccttca    114300
     gcttcaactc gatccggccg tcctcttcaa aagacttaaa ctcccccttc gctcctcgaa    114360
     aactcagctg ttcccgcgtc gaccgcggcc gccgaaccgg tccttttgca gcggccttac    114420
     ggcgagcggc tacgtcgcga taccccagcc cattcttcgc agcctcggaa atcagctcga    114480
     gagtttcatc gtcccccttc acttcccaga actctcgaat ggcgttcagc attttgagag    114540
     aaagaagttc cgggtgctcc gccgctgctt ggacaagctt gttcggcaat tgggcgagag    114600
     acaatgtgcg gctcacgtgg tcttcgccga gattcagcgc cttagcaagc gccgcttgcg    114660
     tgggatagat cttccgcgcg atcaactcct tccatttgat agcgtcgtcc aacgggcttt    114720
     gatccttccg ctctacgttc gcagcccggg cttcctcata aagctcgcgc tcgcttccgg    114780
     gcttcggacg aatctcgatc cgcagggtcg aaaggccggc agtccgagcg ccgcgaagcc    114840
     gccgctcgcc gtcgatgagc acaatctctg cgtcatcgtt gacatagccg atcgcggctt    114900
     gaccttggcc ccgcgcgagg agagattccg ccatctcgga gacagcagaa gcggtgtaga    114960
     tcgctcttgg attgacagaa tttgatctta ttttgccaat cgggatttca tatacgtgtc    115020
     caacctcata cttcctaggg tcttggctcg agccaaccgc cccgctctca cgctgcgaaa    115080
     ctgagggcat cgtcggtgcc aagcgagggt cgccgacgat cggcgccgac gaagctgcat    115140
     cctcgacggc tgccactcgt tcgatatcaa ccgccttttt ccggaaagta gccattattc    115200
     ctcctcccca ccattgatcc gcttaatgat ttcccggtag accgcttcca tctcttcaat    115260
     cgcttttttg gaacgatcgc ggcctttcag ctcgtgaacc gcgcgtccag tcttgccggt    115320
     cgcgcgccat gcttcccgct ggggaatctg cgaatcaaac aaccggatat cttcgctttt    115380
     gaaatagctt ctcagttccg ccgtcgcctt ggatccttca atcggcgaaa ctcgcgtaag    115440
     aacaacgtag gctgggattt ccccactctc gtgcctgggc cccatgtcct taagggtcgc    115500
     aaaaacgttg agagttgatt caacttcctg ttggtcggga ccacacggaa ctagcacgag    115560
     atcggataaa agtgcgcatt ccagcatggt ccggtagttt tgcgccccga tatcaaccac    115620
     cactagcgtg tacttgtttg ccagattcgc tagctcgcgt gcgggattcg ccgggagcgc    115680
     gagtacaggg atggaaggtg tgacgccttc ctcatttcga attcgcgacc agctcatagc    115740
     ggacccctgt ttgtccgtat cgagaagaac cacgtccact ccctcgctcg cagctaatgc    115800
     cgcgatgtgc gtcgctaatc gtgtcttcgc aacgccgcct ttttccgcac cgatggtgat    115860
     gaccatttaa cctccgctcg aagcatgttt cgacgatcgg attgtcattc gaccaacaaa    115920
     ctatgtcaat caaccgagta aaaatcccga aaaaagactt ataaatgtgg tcgcactaca    115980
     acgcttcggg cccgctatgc gattggctcg agccaagatc accgcagcca cgtctgaatt    116040
     ggcgttgcct gcgcgcatct tggctcgagc caagaccgca aagacgttcc aatgaacgtc    116100
     gctcgccagc cggacatggc acctgcaaga gcgtatcgcg ccagccagat cgtcaaggac    116160
     tcgctcttgt gccgatagcc agcaagacct gcaaatccag agcaggatcg agtatcggct    116220
     gaagcagtgg aagctgaccc cgatggatcg ccgagatctt ggctcgagcc aaggtgcaag    116280
     cctcggtcaa ttgcgaaggc cgtcgggtat atcgattgcg ctcgattgcg cgcattccga    116340
     tcggcaagag ggaggccgta tgcaacggcg tacaacagca caaaagaccc gagcgggggt    116400
     ggtcgtagcc aagaatgcgc gcatgtccga attcattgcg cctgccttgg ccgtgctaat    116460
     gtccgagccg ccgccggcgg gagattgggc ctacgagata aagttcgacg gttaccggat    116520
     gctcgtgcgc gtcgatgatg gtgacgtacg gctctataca aggaatggcc acgattggac    116580
     gagtaagctc ccgcacctga ccgcggtcct gaagaggtta ccggtccaac gcgcgtggct    116640
     tgatgccgag gccgtatgtt tcgcccccga tgggcgccct aacttcagcc gtctgcagga    116700
     agcattcaac agtcggcgta ccaccggtat atgtcttgtg gtcttcgacc ttatgtggat    116760
     agacgacact gaccttcgcc gtcggccatg gcacgagcgc cgatccgctc taacgggaat    116820
     catcggtgaa gttcttcggg aggaggttcg attttccgag gcgatcgagg cagatgcgtc    116880
     cgccatgctg gcatccgcat gtgagctcgg cctcgaaggc atcattggca agcaaatcga    116940
     cgcaccgtat cggtccggac ggtcggatcg gtggatcaaa ttgaaatgtg tcagacgcca    117000
     ggagttcgtg atcggcgggt tttcccgccg gaaaggggcg acagcagggg tgcgggcgtt    117060
     gctgttgggc gtgtacgagg agggtggtcg cctgcgctat gtcggccacg tcgcgccgag    117120
     ctttacgccg cgacaggctc gggaattcga gagtcggctc tcggcgttgg gccgcaaacg    117180
     ctcgccgttt gccagcgccc ccgaccctga ggtcgatcgt gagtttcact ggctgaagcc    117240
     cgacctcgtc gccgaagtgg cgtttctcga gtggacgccg gccggccggt tacggcatcc    117300
     gtctttttgc gggctgcgcg ccgacaagcc ggcacgcaca gtttcccgcg aaaatccggc    117360
     cagcccgaag ggcgcaggta gccgcagata aatgggcgcc ggccggctcg catgtcggcg    117420
     gatatttgcg aattttctgc accttgtata tgctgtggca tatgccgtcg caattgaact    117480
     ggagccgtcc ctatgccaac ccatgacacc cgccacgcac gcctatttcg caacggacgt    117540
     agccaggccg tgcggatccc gcgcgagttc gagctgccgg tctcggaagt cactattcat    117600
     cgtgaaggcc ggcgcctaat catcgaaccg gtcgaagcgc cgtctctacg cgagctattt    117660
     gcgcaatggg cgcccttgga cgaaactttc cctgacatcg aaaacctccc cgctgaaccg    117720
     gtcgatattg aatgagcctc tatctgctcg acaccaatat tttgtcgaac gtgatccgag    117780
     acccacgggg cgcatgcgct tcgcgcatcg gggaaacgcg gcccgagcaa gtgtgcacct    117840
     cgatcgtcgt cgcggccgag ctacggtacg gcgtctgtaa gcgcggctcc tcggcgctcg    117900
     cccagcgtgt cgagcagctg ctcgcgagct tgaccgtatt accgctgcag tccgacgcgg    117960
     atcagtgcta cgggcggctg cgagccgatc tcgagaggca gggtcagttg atcggggcga    118020
     acgacatgct gatcgctgcc cacgcgatgg ccgtcgacgc cgtcttggtc acggacaata    118080
     cggccgaatt cactcgcgtt acaggactcg ccgtcgaaaa ctggctccgg cctgcgtagc    118140
     gaaatgcaag cgcgcacgtc gatctgttcg tgcagcaaca cccggctccg gccgggtttt    118200
     ttcatggtcg gcggcagcgt gcagtagggc aggcggcaaa actgctacat ctgataactc    118260
     tacttatcag atgggcgact tttcgctgtc agatcggccg cattttctcc tatacttgtc    118320
     cagaccccgc cgcgcaaggc cggcgagggc gcctggttcg attcgtcggc gtcggtccgc    118380
     cttcggaccg cgaccggcac aatgatcggc gctacgtttt tcgtggcgtc caacacggct    118440
     cgcggcgcgc gagccccaac cactctgacg gggaattccg gcatgaccag cttcgctgca    118500
     tcgaaccacc aagacatctg ccgctgtgta ggcgggcccc ttcatcgcga tggcctgtcg    118560
     ccgtacggcg gttccgccgg cctcctgttt cgcctgactc acgattttgc gggcgagccg    118620
     gcgcgccaag cgctttatga gggtcggccg ttgacccgtc agaccgacgc cggtcccgag    118680
     acgcgcgatt ttctcgtcct gacgagcgtg acggatcagg acggcaaaca ggtcgacgcc    118740
     gggctttcag acgaccaagc gttggccctg acgctggacg cgcccgcgct gttctggaag    118800
     tgaacccgac ctcgaccctc gaccaggacc taacatgacc cagatcccca gctcgttcgc    118860
     cgccatggcg aactattcga ccgtcgacgt cggaggctac agctggatgc tcctccatcg    118920
     gagcgacggc tcggtcgaac tcagcccgag cggcgagccg cgcctgcccg acgtgacgct    118980
     cgttgaacgg cccggcgcca atgaacgcgc tccaacgttc ctagcgaccg tccgggcgac    119040
     cggcttgtac gagctggctg cccgcaagga cggctttgcc actgcggagg acgcgctcgc    119100
     atgggcgacc gcgttcgaat ttgcgaaacg tcgcagcggc agtgtgacct ggtacgcgct    119160
     cgcggccgat gcgtcccact ggcacgcggt gatcggcacg accgtggcgg agatcgtcgg    119220
     atacgaactg ggcggcaggg ccacctatgc ggtgaagcgg cgcatgaagc tcggcaagca    119280
     ggcagtcgaa ttcgccatca cggatctgtc ttatggcgac gagccgaaga gcatcgtcag    119340
     cttcgagcag gcgtcggcga tcgcgctgac gatgcccgac tacgtgatgg agctgatgcg    119400
     tgtggcggcc gacgtggccc ctccatcggg gcttggcgaa tgagcgctgc ggtcgtcaat    119460
     cacgcgctcg aggcggccgg ccaccacgcg ctggaacggc tcggcctgga tccgcacggc    119520
     acgcaccgtt tccgtggcgg cccagacact gctatggtcc tgatcgacga ccgccaacgg    119580
     agcatcgcag atgagtgaat cacggcaacg cggcacttac gcacaacgtg tcgagcaggc    119640
     gaaagcgcgc aaacaagccg aattggaccg acaccgtgcg gccgccctgg tcggcgttgc    119700
     cgcacccgag ttctttgaac cgcgcttcgc ggacggccga ccagccgatc cggcgaccgt    119760
     agtggtgtcg atgtttcggc gcaccgaaga tggccaggcg atggagatcg tcgggacggg    119820
     cttcttcgtg gcaccgggtg tgttgatcac cgcggcgcat gtggcccagg tcgcatttga    119880
     gtcggaccct cacgggtatc cgcggctgtg gtgcgtgcat gtcctggacg gcggccagta    119940
     tcaacgtcga cccgtggttc atgctgtaac gcatgcggtt accgacatcg cgctctgcgt    120000
     gctggccccg agtgttcatc gggtgaccgg tgcgccgctg cctaacccga tcctgcgatt    120060
     gagtgcccgc gatcccgtga ttggagagca cgtcttcacg tttgcgcttc ccgatgcggt    120120
     attcgaggct caacaaggag gacggaacgc tcggcttgac ctccactcac attactacga    120180
     cggtcatatc gtcgagcatt atccggtgat gcgcgatcgc gtcttgctgc cgtttcccag    120240
     cttcgagaca tcgatgcatc tccacggggg cgccagcggt gggccggtct ttgacgacag    120300
     tggggcggtt gttggcatca acgtgtcgag ccaggaaccg gacacggact gctcgtacat    120360
     cgccaaggtc cgtgacgcgt ttgacctgtc tctgccatgc gaagtcgacg gcgggcaggt    120420
     tgtgcaactg acgctgcgcg agttggctgc tcgaggcttc tcgtgtctgc aggcggattc    120480
     gcccgctgcg cccgcgggcg gtgtcgcatg aacgcacctg ttccaccact gagcgagccc    120540
     gatagcatgc gcctcgcttt gctgaacgac gacgcgactg tacgcaccga attcgccgag    120600
     ccccgcgcac ttgcgagact gcatgcggcg ttaccgcggc acgctgccgg ccgatgtcgt    120660
     gcaggcgctg ctcgacgtcg cgcacgagct cgaggcgacc gaggacgcgt tcgccgtcgt    120720
     ggtcgaccaa aaggacgcgc tgcagcgccg gctcgcgctg gccgaatcga acctgcgcgc    120780
     ggcgctggcg ttgcgcgcta atccctgaag atctgctcat ggccctgacc accacctacg    120840
     tgcgcgcgcg gtttctcgcg ttcgcgcaac agcgctggat cgccgaccag cacgccgcgc    120900
     aggacacgaa caaattcagc gcactgttcg ccggccatcc cgcacacctg cagttcgaga    120960
     cagacggcgc gtggcgcttg tcctacctcg ggttccgctc tgagcggatc ttccacccgg    121020
     ccgacgcgca gtgcgcggca cccgcgttca tgcgcgacgt gctggcgcgc atggccgccc    121080
     tcatcgaggg cgcgccgcgg cgctcggcaa ccggaggcca cgcatgagcg aactacgcgc    121140
     gtcgcgccgc tgctggtcga tcgaacactg gccggagccg ctgcgcatcc tctatcacgc    121200
     gttgctgggc ggcctgctca tcgtgatcgc gtcgacattc gaggccgccg gcgacgcatg    121260
     gcgcaaggcg gcgcaacacg gggacactgc cgcgcgcgcc gcgcgcgcat gggtccgcgc    121320
     ggccgtcggc catcacgatg cgctctccgc gctggagcac gctgccaccg gtgcgggctg    121380
     cgccctgatc ggcttcggga tcctgcaggt cggctacgcg gtgctcgtgt cgggacgcga    121440
     ccggcccgtt gaacccttcg ccgaaccgtt cgtcgcgtgg caatgggcga tcttcgcgct    121500
     cggcgcggcc gccttgagct acggcgtggg gtcggtgatg tatccgggca cgcgggtgct    121560
     gatgggggtg attacggctg cgtacgtgct cgtgccgctg atttatcgac agcaggtcgc    121620
     ccaggccgcg ctcgcggtgc cgcagtggtt caccgccgtt gcggggtcgg gattctggtt    121680
     gtttctcgac gtcatgtgga agatctatca cgcgccgcgc gtgcacgagg cgccggcgtt    121740
     ggtcgccgtg catctcggtc tcggcctcgc tggcctgatg ggcgtcagct ggggcctcgg    121800
     ctggatcgcg cggcgcaccg cgtggctgca cccgacgccg accggaggcc agtgacgtgc    121860
     gtgcttcacc cgctcgcgca acgctgcgcc tgaccccggg ccacttcgcg ctgtaccgag    121920
     cgtacctcga agggctcgac gaagcgacgc tgcatgcgca ctacggcgtg ccggggaccg    121980
     acgtgcgcgt gacgcgccgc acgatcgcga cgctgcgcga tacgctcacg atcgccgcgc    122040
     ggcgcgcgcg cgacgtcgac gccgcgcacc tgctacgcct gaaacctggt agcctgccgc    122100
     gcgacgcgca cgccggcgcc gcggccggcc gggaagtgcc gacgctcgag gagttccggg    122160
     ccgaggtgga tccggacgcg ttctacagcg agcgggagct cgtcgcgctg tatatcgaga    122220
     cctacccgcc ggcgtcgtcg cccgcgctcg atagcaagac cgcgcgcaat cgtcgactac    122280
     gcgatcgcca ggacgccgca ctcgcgcgca tggaggccag tctcgtcgag gcgccgcggc    122340
     ccgaccacac gctcgacggc tggttcgact cgcgcgtggt cgcacggctc gcggcggccg    122400
     gcatcacgac gttcgccgag ctgctcgcgc tgatgcgtac acggcgccaa cggtggtacc    122460
     gcgcgatacc gcgcctgggc gcgatcggcg cgcagcgcat taccgacttc attgcgcaac    122520
     acccggacac gcttgggtac ctttcgcctc tcgccgtcac gccgcgtcgg catttcgcac    122580
     cgggtcaccc ggcgctgcag ccgctaccgg gcgctgctgc cgacgtggcg ccgctcgagg    122640
     cgctgcgcgt gccagccgcc ctcgacggct cggccggcct gaaccgtgca cctgtgcctg    122700
     cgcaccaggc cgaactgaac accgacctgc aggcggtaca tgcctggatc gcgacgcgcg    122760
     gcgcgcgcag cgaagcgacc cgccgcgcgt accggcgcga agccgagcga ttgctgctgt    122820
     gggcgatcgt cgcgaagggc aagccgctgt cgtcgttgaa tacgatggac tgcgcggaat    122880
     atctcgacgt gttcctgcgc gacccgcaac ccgctgcgcg ctggatcggc cgcagccgcg    122940
     tcgagcgttt cgatcccgca tggcgaccgt tcgtcgggcc gctgtccgaa cgcagccgcg    123000
     acaccgcgcg gcggatcctg aatgcgatgg gcgaatggtt ggttgcccag cagtatctgc    123060
     gtgtgaatcc gttcgctgga cttccggccg cgccctcggt accgatcgac gcgaccgggc    123120
     gctcgctcac gcgtgcgcag tggcagtatg tgctgcagac ggtgctgcgc cctacgtcgg    123180
     ccttcgatgg cggcgactcc caactggcga atcggtcagc gaatcaggct gcaaacgcgc    123240
     gcgacgcgtt cctgctgttg tttgcctacg tcaccggact gcgacgggct gaaatcgccg    123300
     ccgcgaccac cggcgcactc acgcgcaccg cgctcgatgg cgcgctcgac gatgcgtgga    123360
     gcctgaaggt gatgggcaag ggccggcgcg cacgcactgt gccgatgccg cggcgactca    123420
     tcgacgcgct gcgcgcgcag ctgcgcgccc gcccgattcc gctgacgctc gaaaccgcgc    123480
     cggccgatac gccgctcatc gcgaacctgg tgaccggcga agcactgcat ccggacgtgg    123540
     tcggacggct ctacaagggg atttttgcgc gggcggcgga tcagttggcc gccacgtatc    123600
     cgaacgcggc ggcggacttg cgccgtgcga gcacgcactg gttgcgccac actttcgcga    123660
     accatggcct ggacgccggc gcggacatac gagacatgca ggagttgctc ggtcatgcca    123720
     gcctagggac caccacgcta tatacaaagg cggatgcggt acgccagttc cagtcggtcg    123780
     aggcgttgtt caacgccgcg ctcgatcgcg cggatccgcc ggcggccatg ggcgtgccgg    123840
     tcgcgtcgcc gcctgcccgg gcggacacgg gcgcagcggc ccaactcgtc gccgtgcacg    123900
     tgaagctgcg ggtcgagccg aagcggccgg gcgggcgtgg tcgcgcacgc gtcctcgagc    123960
     gcgtcgaacg tgaagtactg gccgggttcg ggcggacgcc gatccgagac ggtgtgaccg    124020
     tgctacaggt gccatttgac aaccaagatg cgttcgatcg gcgcgtcgat gacctgcttg    124080
     ttcagatcgc gatgaccgca gaacagcatc ggtgtgcgtc ggagagcgag gcgtgggccg    124140
     aagtggccgg tgagcgctgg acgtggtgac cgacgcagta gcaatcgggc gacatcgttc    124200
     gaggagctgc tcgtcatccc gacatcgttg cgcgcggcgg cgataatggg aaaagtatca    124260
     gagcgtcctt ctgcaggttg cgtaggccaa tgacggctat gcgacgaccg gcccaaacgc    124320
     agcccggccg gcaaccagtg gtgtactacg ccagatgaca catccggata ggtgtgatgt    124380
     actggcgtca gatataaggc cgcgtttgaa tcgggggtga agggccggac acggcgagca    124440
     gaaggaatag aagaacgatt cggtttttcc gacataccgc gccggcatcg cgggcatcgt    124500
     ctctttgaac gcctatacgg agcacatcaa atgaaaatgg atgtgcccgg atgaaactca    124560
     aaacgctgac tctctgactg aactgcgccg ccgccggcgt cgaactgctg tcctggagca    124620
     tcaggctgag tcgactgtac ggacctatgc tccactgaca aggccagccc gccccgagag    124680
     gggcgggcat cgagcagtct atccggtacg cgactgttcc aacagcgctt tgattgaaat    124740
     cgcggttgga aattttcgcg acgctcttaa cgctgaacca aacaatacgg cgagtacgcg    124800
     ccagataaaa acacgaccta tgtttccgaa cgagctgtgg ctgcgtaagg ccatcgaaat    124860
     cgtgcagaag aacccgtcgc ctgatcgcat cccggtaacg ggtgacgagc gcttgaaaca    124920
     acgaaactat ttctacgcgg gactcgacgg tattgaaggg gagggagacg tgctgatcgt    124980
     cggcctgtcg agatccgggg tactgggtcg gccgtggcac gacggtcgat accaaccaga    125040
     cgcagtcgat attccaatgg cgcgcgcagt gcaggcgaaa ccgaccttcg tctactacct    125100
     tcgccgcttt gagtttatcg agcgcgaccc gtttcggttc tggctgaagg tccgaactcg    125160
     ccactacagc cgagttgcac gacgcaagga acggcgagag ggtcgattca accgccgcca    125220
     gttagaacgc aaagagcgca tggacgtctt gcaggcgatc gtcaggcttt cgatggacca    125280
     agatggacgc acgatcgacg ccgtgatgat cgccacgctt ttgtatcagc gcggttggat    125340
     tcgtcacccc gcagccgatg aggtgctcca gcggattcgc gcgctggtcc gcgtattggt    125400
     tgccgagggg ctcgttgaag tagtgcaaca gaacacggct taccgaatgc ttcccaacgc    125460
     tgttcgcgtg ctcgatcaat acttgaccga ggagcgccga cacgctgaca gccaggcact    125520
     gcagcgcaag gtgatgatcc tgggtggagt tgcggccgtt gcaagcgcag tgcaagccgt    125580
     tgtgaacgtg aagcaggaat ggttcgataa gcctaccggc gagactccag ccttccacgc    125640
     gacaaacgaa aacgcgaccg ccacggctcg accggcctct gtcgcgattg cgccgacgcg    125700
     aggtgctcaa taaagagtcg cggtccgatt tcaacagctc ggttgctgcc tctggcacgc    125760
     gaccaggtcc ggagactatc gctgaagcat cgcctcgcgc gtgctgcaag gcagcgcggc    125820
     atcgaatcgc tgtcgtctct gttgaacgtc gtcgacatcc tccggcggac cgagcacgta    125880
     aatgccgcgg tattaggaaa ggcccatgtt gcaatcgatt cctgcgtggc aggcgatggg    125940
     tgctcgatgg ccgtggggcc agctatcggc aatccgggtt agtacctgaa accgctccga    126000
     ttgcactccg ctgccaccgc gttattcacg atcaacggca taagcccttg gtcgatcggc    126060
     tctggatgac ttgcgcgagc atcgaccacg gcggtcactt gagcgagggt cgtccgggtg    126120
     aggcacacat tgtagaaatt tctgagctcg gcggacggcg cgaaaatacg aacggtgtcg    126180
     agcgctcctg caacgtagat ctggcgctgt tcgaccgcaa gcgcttggta ttcggcgggt    126240
     gagaaggctt gggtaaattg cgtgcttggc accgcgatgg cgttgcaaac cgcaccagca    126300
     gcaagggcta tagcgactag cgttgatgca atgaacttct tgcgcatgtg gctcaattcc    126360
     tcctcaaaga tgtccgatat gtgtcgtata tcggcaattg gcgccgcaac ttgagaccgc    126420
     aaccgttgcc gtgggcaccc gttgtggcta ctcgaccgga tgcgttgcgc ccgggcggct    126480
     actggcgcgt ccggacttgg ttcacgcgcg acatccgaaa cgggaacgca taacggttcc    126540
     tggcgggggg catgtgtccg acacgccgag gcccggcgcc gagtcgcgac gccgcatcat    126600
     ccatcgatcg ccttccattg cagacgtcta tagtaatggt acgcaccgcg taccattcag    126660
     gcggagtgcc cgtcaagaag cttctcgatt gcggctctcg caagcatcgg gagtggcctg    126720
     aagtccttcg acgtatccgg catgcggtac gttttcaggg cgcgggcgtt gatctctgca    126780
     gctgctgcaa gttgatccca cgtcattccg agcgttgctt tcgcgaacct caagaattcc    126840
     tgctggctta tcgatgacac gactttgacg ggcggtacgc ggtgcggact atgttgctga    126900
     tcgcgccgcg gcccgtgctt cgtcggctgg ctgcgcgccg atttaggaat cgaggtgtcg    126960
     gctggccgtc gtggactgtc gtcctgctcc aagaactttc tcattgatgt ggcaggggag    127020
     acgccacagg ctcggcacca gtcgacgtag gtcaggaagt cgacgtagcg ctctcctcgt    127080
     tcgatcttgg acaggttcga ttggtcgatg tgcaaacgtt ttgcgagttc agtttgcgtt    127140
     agacctgcgc ggatgcgcat ggtggcaagt tgaacgcgaa ggcgccgata gcgctcactg    127200
     gtaatcggga tggaccgggg catatccgaa tgctcgcccg ttccagtggc tatcccattt    127260
     tgacctagat cggatatgat cccgctgcgg gtgcttacgt ttttaatgtg gccccatttt    127320
     accggaccag cctctttgct ccggcggttt caccgagccg tccgatgcag gatgcggcgc    127380
     ggcttaacgc agcgcaatgt gatgcaggtc ggttggacaa aggggaagtc ggaaatctgc    127440
     gcggcccgag caggccgctt tgtggcgcgg caaacacact tcgagcgctc attctatgca    127500
     ctccagctcg aatgcttgga ggtaagcggt ttcgcatgcg aaaatagatc actgtgataa    127560
     gtgattaaaa ttatatatcg caggcgagcg aaatgctgtc cgccttgggg acctggctct    127620
     cagcgttcaa tttcaacagc ccagagcgtt cgaccgcacg atttcgccag cattcaacct    127680
     agatatgttg accgtcaacg tatctaataa taagatgaaa gaactacgag gtccggcggt    127740
     gtgccaacgc cggaaaaaga gcaaccaaaa aaagatggag aaccaaatgt cgagcaccgt    127800
     gcaatcccgc atctaccgac ttcttgtcga cctcattccg gagctggggg tgagcgcatc    127860
     acgaacacgg tttgctccac cgcgcgtgcc gggggatatg gcggttcatt gcacgatcga    127920
     cgatggagtt gacggccatc tcgagatcga gattgcacag gatattgccg gtgaccaccg    127980
     gcgttcccaa tcccgcattt gcttcgacgt agatctgatg cgaggcacag catgcgtaac    128040
     ccagctggag caaggcggtt acttcagtgt ggcgagcggg cgcgtgaatg tttatgcggc    128100
     gaactggcta gcggtcttcc atacgttggg ccgctcgttt cagccaatcg aagcactggc    128160
     ctgcgcatga gatggtggcc atgaagaaga taagcatcgt gaatgggaag ggcggcaccg    128220
     gcaagacgac tattgttcgg catctggtct acacggcaat cgagcgaggg atccgcgtgt    128280
     tggtggtgga tctggatccg caaggcaatc tgacaaggtc gatgctgtac cgaaagctga    128340
     ccgcgaagtc gggtccgtcg gtgatgggcg cggcacttac atgggagcac ttgggcctac    128400
     cggatgtgac agaaaattcg agtgcgcact tgctctacca gggcaaacgg gacgtcaatc    128460
     caatgcgaat tgtcgacggg gcggcaatga tcggcgcgac gccggagctc gaggacgtca    128520
     tgacttggcc gctcgaatca gcggcgaagg cgcgggaatc cttggatgca ctggcggacc    128580
     aatttgatct gtgcgtgatc gacaccgcgc caacgatgag caacctcgtg ttgggcggga    128640
     tgatctgcgc cgactacgtc gtgattccga ctgatctcgg aattgacagt atgtcgggcc    128700
     ttctcagtac gtcggagaag cttgagctcg tcaagcgcga atggaatccg gatctcgagc    128760
     tggtgggcgt tctgctcaac aaggtcaatc tgcgacgcgc cgatgaccaa tcgatgagga    128820
     cgactgttcg gaatgcgttc gacgacgcag tactcgaaca cgaattgcgc gatcgtgcgg    128880
     gggtccgcct gacaagtttt catccggtgt gggcgcgtcg gaggggcgaa agtgatcggc    128940
     ttgctgcgaa agaaatgcac gccgtgtgcg actccatttt ggagcgcatc ggcctttcgg    129000
     tgagcaacgc ataaagaggg gtcgttgaat gcagcaggcg acaagcggga agtttgcttc    129060
     tatttcggca ctgactcgag cggcaagcgc ggcatcgcgt gtggctgaaa tcgagcaggc    129120
     cacaggggcg gtgacgaggt tcatcgcggt caataaagtt cggatcaaac ctcaagttcg    129180
     cgacgatttc gccgatgtgc aggcgttcgc cgagcggctt cgggcgatcg gtcacgtgca    129240
     cacgccgata ttggtgcgag caatttcgga cagcgacgag tatgagctga tcgccggcga    129300
     gcggcgcatc cgaggcagcc ttttgaacga ctggccggag atacaggcaa agattttccc    129360
     cgccgggacg tcagacttgg caatccggat gtatcaggtg tccgagaaca tcgatcgaaa    129420
     gcaactctcg gtgagagaga cggctatcgg ccttgcgaca gacgtcgagt tgtacgggcg    129480
     agagcaagca gccagcatct gggcggcgcc gagcggcaag gagcgcagcg cgtcatgggt    129540
     ctcgaaacac ttgcggttcc ttcgttatgg tcccacgacc cgagccttgt tcgatgagga    129600
     catgttcgac gacgtcgaag cggccaacaa aatggccgac atcgaggctt gcagtgccgc    129660
     gactgcgcac gaaatcgcaa cggacatgcg ggcaggaaag aagttcggac gcttgacgct    129720
     cgatgcgcga ctgaacctgc tgaagcaggt cgccgctccg tcggtgaaag atgcggtcgg    129780
     cgaggcagct gctatggctc gctcgagcgc gccggccgag gcaccgggtt ctactgcatc    129840
     gcagtccatt gacgatggcc aacaaccgtc acctggtcct gtattcgagg gtcaggcggc    129900
     ccacggcgca gaacatgatg ccgatgtgcc gaatatggcg gacgctcgcc tagctccgag    129960
     cccggcggca tctccggagg ggctgcggca agtacccaaa gcgaagcgtt tgcacgctgc    130020
     cgccgccgat ccgagtgaga cgtcggtttg gcgcgtagag gaaatctacg aaatcggcac    130080
     cggatccgtc gagagagttc gccggttgca cgccgacctt tcggcggctg gcgtgcgtgc    130140
     ggaggacatc gaatggaggt tgtgggtctg ctttgtggac ctggctgcct cggcgcttgc    130200
     tggcatgcca actgaaacag cgggtaaaat aataaacagg ttcaatgatg aaataaattc    130260
     gagtgggccg ctcgagctgc tgaacagatt gcatccgtgc cggcgacccg gcgttctgcc    130320
     agatgacttc ggttacgata ccgaccgcga aattcatcct ctggcgccga acgactggtc    130380
     gctgtaacgc aacggaccga ggcgggcagg cgccagttcg ttgcttgtca acctattcgg    130440
     aaagcaatct tggctacatt ccgcctttca gcgaagcatt tttcagcatt ggactccgcc    130500
     atgcggaagc acgcgcgcga gttcgggaca cgtccgtttg acgaagctac tcgcgatatc    130560
     gcacgcgccg tgatcgtcga cgggcggccg gcggcggacg ttgcgagtga atttggggtt    130620
     tctcgacaac gcgtcagcca gttggtgaag cgctactacg agagcctgac gaactcggaa    130680
     ctgcgaagtg cggaggtcat cgtctggcta aagcaggaat tcgaagtgcc gagcccgctt    130740
     gtcgaaccgc tcgcgcgctt ccttgcgaag gcacaacgat cgaaagatac gaataaagtc    130800
     cagtcggcag tgtctgccct gatcaaacat ctcggcacgc aaacgagcaa gctggaatga    130860
     aatacgggga aagcaggaga gaatgagtac agtcaattcc gagaacagct actcactgag    130920
     gggggcagga gcggcgcagt tgccgatggg cgcacgacca ccattggcac gcagccaagg    130980
     cgctgagcaa tcggaaaact cagccgacgg cgatgatgtc gttcgactgg acgagggcga    131040
     gttcgatcca gagcagctcg aactgttttt cggcgagcaa cttgacttgt cctggaagcc    131100
     ccgcgaggac cttcattctc tcgagttccc ccttttctca ctgcaaaagg gcaaagacac    131160
     gcgggttcgc gtctaccgca acggcgaaca aatcgtcaga atcatcccaa gcggggtggg    131220
     ggcggcaaat atcttcgata aggatctgct cgtctacgcc gctacactga tttgcaaggc    131280
     ggccgactcc gatatcccgg tttcacgccg aatccgattc aaggtccgtg actttctcaa    131340
     atacacccga cgcagtacgg gcggcgcttc gtatgagcgc atcgttgata gctgccgacg    131400
     cttgaaaggc accatcatcg aaacaaattt cgatacgacg cgcccgggtg ccaatgaagc    131460
     cgggatccac gagaccttac gcggatacgg gttgatccag gaatattcgg tgatcacgta    131520
     taccgccaat cggaaagggg cgctggaggt cgagctagta ttgtcgagtt ggacctacga    131580
     tttgttgctg agtcggcgca tcctaaccct acatccgggt tacttcgatt tggggcaagg    131640
     tcttgagcgt cgcctttacg atttggccaa gaagcactgt ggtgacaagc tgtggttcaa    131700
     aatcggcctt gaaaagctct acggcaagtc ggggtccgct caagcactta agtatttccg    131760
     cagagatctc attgcggcca tgaaagcgga caaactgccg gaatttcaca tagcgctcga    131820
     cgacgacaag gcaatggtcg tcttctttcg gtgcgaccgt gacaaccgac ggcaggacga    131880
     gcaactcaca gcgagcattc atcgtgagtt gctggccaag aagctgtcaa agtggtacta    131940
     cgcgctgcgc cgctgggatt cggacgcgcg agacgttggc cagcttgaac tgattgctgg    132000
     gacatagttc gcccgagccg tagcggccgg atccgagcga ttgaactgct tactgcctgt    132060
     cgagggtaga aatggcgagg acgttgcgat tggtttcatt ctcgttaccg gggacttttc    132120
     cgaaggaact ggtgccgaca ccccttgccc gattcgtcgc gtgctgcgag ccgggtctca    132180
     cgaaagagcg cttgatggag tgcgcgaggg cccgcggatg gagcccgact tggaagcagc    132240
     tcccggactg gactcgcgag gggcaagagg cgttcggctt tgcagttacc gtggatggca    132300
     tgggcgttcc actggtcgcg tggatgcgtc gcactgtggc ggtcaagcga tcgccaaagg    132360
     ggccggaatg cgacccgagg caaatgtcgt tgttctaaag cttcgcgtcg ggcgctctgg    132420
     cttgctagag caccatcaac aaaactccct tgccgtcgtc ggcagcgagc cgagcaattc    132480
     gctccggtcg acgagcttgc tcgcgatcaa gtgccgcacc ttcccctcgg cctgccatac    132540
     accgtagacc gcgaggagcg ccgcgcctag cgcctccttg cgaaacttct ccagcagacc    132600
     gggccacagg atcacgttca cctggcccgt ctcgtcctcg agcgtcatga acagcacgcc    132660
     gttggccgtg cccggccgtt gtcgcacggt gaccagtccg catgcgcgcg cgagctggcc    132720
     gctgcgtaac gttgccagct gctcggccga ctgcaaacga tcgagcgtca gacgatcgcg    132780
     cagcagcgcc agtgggtgcc ggccgagcgt gaagcccatc gcgcgatagt cggtcacaat    132840
     ctccttgcct tccgacgcct gcggcagcgc cggcacggcg tcgtcacgct cagtgccgcg    132900
     caacagatcc cgatcgggga tcgccgcggc cgccagccac agcgcggcgc gacgattgcc    132960
     gccggcgagc gagcgcagcg cgttcgcgcg ggcgagtacc tgcaggtcgt gccgatcgag    133020
     ctgcgcccgt cgagcgagat ccgcgacgtc gacgaacggc cgcaccgcgc gcgcgagctc    133080
     gatgcggccg gcgacgtccg cgcgcatgcc gcgcagcagt gagaatccga gacgcaccgg    133140
     cgccgaggtc gtcggcccct cgatgactga atcccacgtg ctcacgttca cgtcgacagg    133200
     taatacttca acgccacggc gtcgcgcgtc ctgcagcagc tgcgatggtg tatagaagcc    133260
     catcggctga ctgttgagca acgaggccag aaacacggcc ggctcgtgcc ggcgcaacca    133320
     cgcgctcgag tagacgagca acgcgaagct ggccgcatgg ctctccggaa acccgtactc    133380
     gccgaagccc ttgatctgcg cgaagatcgc ctcggcgaat tcgcgatcgt agccgcgctc    133440
     gagcatgccg ctcacgagcc gatcgtggta tggctcgagg ccgcccttgc gtttccatgc    133500
     cgccatcgca cgtcgcagct gatcggcctc gccggcggag aagccggccg caagcatggc    133560
     gacctgcatc acctgctcct ggaagatcgg cacgccgagc gtgcgcttca gcgccttttc    133620
     catgccgtct gaagggaacg tgacgggctc aagtccctgc cggcggcgga gatatggatg    133680
     caccatgccg ccctgcacgg ggccgggtcg aacgatcgcg acctcgatca cgagatcgta    133740
     gaagcattgc ggccgtaggc gcggcagcat cgacatctgc gcgcgcgact cgacctggaa    133800
     tacgcccatg ctgtcgccgt cgcacagcat gtcgtaggtc gctttgtctt cggccggtat    133860
     gtcctgcagc tcaaacgttt cgccgcgctt ctccgagatc atgtcgagcg cgcggcgcac    133920
     catcgacagc atgccgagcg cgagcacgtc gattttcagg atgccgagcg cttcgatatc    133980
     gtccttgtcc cactggatga tcgtgcgatc ttccatcgcg gcattctcga ccggcacgag    134040
     tcgcgtgagc ttgccgcggc tgatcacgaa gccacccgag tgctgcgaca gatggcgcgg    134100
     gtagccgagc agctgagcgg cgaacgcggc ccactgctga ttgagcggcg cctcgggatc    134160
     gagaccggct tcggcgaaac gctggagcag atccgcgcgc gagtcgaacc agtggtgact    134220
     tttggcgacc cgatcgacga tcgccggatc cacgccgagc gctttgccgg cctcgcgcaa    134280
     tgcgctgcgc ggtcggtacg tgctgacggc cgcggtcagc gccgcgcgat cgcggccgta    134340
     cttgcggtag atgtactgca tcacctcttc gcgacgctga tgctcgaagt cgacgtcgat    134400
     gtccggcggc tcgttgcgct ccttgctcat gaaccgctcg aacagcatcg actgacggga    134460
     gggatcgacc tccgtcatgc cgaggcagta gcagacggcg gagttcgccg ccgacccgcg    134520
     gccctggcac aagatgccgt tctgacgcgc gaattgcacg atgtcgtaga cggtcaggaa    134580
     atacgcctcg tagttcagtt ccgcgatcaa ctgcagctcg tgttcgatct gcgcctgcac    134640
     gtcgaccgga atgccggccg gaaagcgccg ctgcgcaccg atatacgtct gttcgcgcag    134700
     gtaggtcgcg acgtcgtagc cggctggaac cacctcgtcc ggatattcgt acttcaggtc    134760
     gtcgagtgag aacgtgcagc gccgcgcgac ccgcacggtc tcctcgagcg cgccggccgg    134820
     gtagaggttg gcaagccgca agcgcgatcg caaatgccgc tctgcattcg gcgcgagctc    134880
     gtatccgcac tcggacaccg gccgccccag ccggattgac gtcagaacgt cctgcagcgg    134940
     tttgcgcgat cgcacatgca tcagcggcca gctggttgcg accaccggca cgccgtggcg    135000
     cgcggcgacg cgttcaacga caccgcggtg gatatcgtcc atcgcacgcg catgcagcgt    135060
     gagcgcgacc catgcgcgat cgccgaacac gcgcgcgaac cattcgacct gcgcgtcgag    135120
     ccgctgctca ttggccggga agtcgggcga caggatcgca atgcagtcgg gcaagccgcg    135180
     cagatgcgtg aatggcgcgt ccggctgctc gagatcgcgc ggcgccaacc ggtagctgcc    135240
     tttcttgccg cgcatacggc cgagcgacac cagttcgcag aggttgccgt agccgtcgcg    135300
     attcatcgcg agcgcgctga acgcgatcgc cggcgcgccg tcggcggccg tcagccggaa    135360
     gtgcgagccg atgatcagag gcaggccggc tgccttcgct tcgacgtgcg cgcgcacgac    135420
     gccggcgagc gagcactcat cggtgatcgc gatcgcgctg tagccgagct gtgccgcgcg    135480
     cgccacgtat tcctcggcgc gcgacgcgcc gtgcagaaac gagaagtcgc tggcgacctg    135540
     cagctccgca taggcgggca gggcgccgta gctcgcagcg ctcatcgcga atcaaccgaa    135600
     caggccgtgc agaaagtagc gcgagtcgct ttcgtcgctg gccgtcggcc gctccttgaa    135660
     gatccagtag cagatgccgt tgtcgtcctc ggcaacgaag tagtcgcgcg tcacagtctg    135720
     cccgtcctgc catccgcctt cgatacgctc gccaggcgac accatgcgca gcggtgtacc    135780
     gtagaacggc cggtgttggc gcgtgagcag cggcaccggc ttggcgagca gccaggcggg    135840
     gcgcggcaaa tccgccggca gcggtgccgc cttcggcgcg tcgcgcatcg gcacccatcg    135900
     ggcggccggc tccggacggt agtcggctat gggagccggg accagcacat tctctgcgcc    135960
     gaggcgcgcg gtgagcagtt ccagcaatcg agcgtgatcc tgcggcgtgc cgccgggttc    136020
     cgggaacaac gaatcgctcg gcgcggccgc ttcctgcacg cgtcgcgcga cgagccgcac    136080
     ggcgatcacg ggcccggcga gctcgacatg gccaagccgc tccttgacga gccgggtcag    136140
     gtgctcttcg aagcgcgtgg gggcgcccag cgaaatctcg atctcggtcg gcgcaatcgc    136200
     gtcgcgtccg cgctcgtgct cgagcagcag cgcgaatgct gcgacgtcca gctgcttcgc    136260
     cgtgagccaa ccggtcagct gcaggatcag ccggcgcgcg acaaacaaca gcgcctcggc    136320
     gtgctcgacg cggtccatca gctcgacgcg cgtgtcgaac gacggcggca tgtcgagcca    136380
     gtcataggcc gccggcgcag tgccggccac ctggtcgagc cagtcgagca gctgcgtgcc    136440
     gcaacgcttc ttgagcccgg cgcggggcag gcgctgcagg tccgccagcg tttcgcagcc    136500
     gagctcgtcg aaccacgtcg cgtaccgccg cgcatcaggg gcgaccacga gcggcacgcg    136560
     cgcgagcgcg cggcgcaatg accgggcaga cagcgcgagg ccgccgcgca gcccgcgcgc    136620
     gaccatccat gcggccgggc ctgtcgacgc gacggagatt gccgcggaga cgccgaacga    136680
     cgcgacgacg tcgcgcacgc gccggcgcag cgcgcgaatg ccatggaaaa ggcgcaggct    136740
     ggccgtcacg tcgagcagta ccactgcttc gtcagcgtcg acgacgttcg gcgtgaactg    136800
     cagcagcgcg tacgcgacgc cgagcacgag ttcgcgttct cgcacgacgt cgcgctcgcg    136860
     gatctgtgcg tcgggcgcga gcgacagcac gccggcgcgc cgcatgccga cgacgatgcc    136920
     gagcgcgcgc gcggcacggt ccagcgccac gacacggccg ctctcgagca cgacgagacc    136980
     gcgcgcatcg tcaggcgatg gcgccggcga gcgtggccgg aacgtttcga ggttgaggtg    137040
     cggcagatgc acgccgatcc agacttgcat ggcgattcaa caaaatcggc gaaggggaca    137100
     acgggacgaa caacggcgta tcgcgcgcgg gtccgcggcg cttcacgaac gtgatctcga    137160
     tgccgtcgcg cttgggggcc agcgcgagcc gcaatggcgc cggcgacgcg tcgcgtgcgg    137220
     cggccgccgg ccggaacagg aaaaacagtg cggatccggt ttgcgcggcc aggttcagac    137280
     gccgcagcgc gtccgcgcgc acgtttgact gccacagcag gacagccgcg cacgtgccgg    137340
     cgcgcagcac ctgctcggcg gcccacagtg cgtcggcggt gcgcggggca ggcagcagga    137400
     cgaagctgga cgaatcgaca ccccaatacg acagcgccag cggctgcagc ccgtgcagcg    137460
     gctggatcag catgatcggt cggccgctcg agcgcgccag tacaggcgcg agtagccgga    137520
     gctcgccgat gccggcctgc tgcgtcagca aatcgaccag cgcgcccgcg ggccagccgc    137580
     cgccgggtag ctcggcggtc agctcagcgt gccccgtgtc gacgccgcgc gagctcgagc    137640
     gcgccagctg gctggcacgc cagagcgcgg gatggatggt ttcaggatgg gcaagagcgg    137700
     cttgcatggt cgtggggttc tggcactgta tgtttataca gtatatgcca ttccccatgc    137760
     cgactccaat ccctacccga attacgccgc cagttggtgc tcgtagtagg gccgttcgcg    137820
     atcggcgagg atctcgcgca gctgcgcgcg gcgagacgga tccggcgcca gccatgcgtc    137880
     gacgttcgac gatttgatcg gcacgatgca tcggtacgaa tacctcgttt tgttagtaat    137940
     aaatgggttg acagacatcg tcctgtgtac tgctattcaa tttcttgaag tcgagtagcg    138000
     ggatggaatt cgggggagat ttggcaacct atggatgatc cggaaatagg gcggctgcat    138060
     tgcctcgcgg cgcgcgcgat tgctgacggt gccgacgacc tcgtgatgcg ccaatggcgc    138120
     gtgccattca agcaagcagc gaagatgttg cgcgaggcca gcgcgtgagg tacgtacgcg    138180
     ccactgatga gtttgtcttc gccggacgcc cgcggccggg attccccttg atcctcgacg    138240
     attcgatgga gccggcgcaa ccgttccatg actacctgct gtaccgattg cttgagagcg    138300
     gaaaggcgct tgatcaaaag acgtgggagg cgtacggtcg ccggctatgg gatttcgctc    138360
     gatttctaca agcgaacgaa tggtgttggg acgatccatt catgtcggtt gggcagagcg    138420
     tcgtcagtgt ttaccgcgat tggcaggccc aagacctcaa gctggacccc gcaaccatca    138480
     acgcccggtt ggaattggtc acggcaatgt accggtgggc acatgaacgc gggcggatcg    138540
     accgcttgcc cttcacctgt tccgacgtcg cagtgtacgg cattgagcat gacctgactc    138600
     atatcaccgg cggtcggaag aggtcgagcc gtccggcagt gctgctcaac gagtggaaca    138660
     aggaacctgc gttcctgaca gccgatcaac tgaagatcgt gcggcaatcg attcgctctg    138720
     cagcgcagcg gctgctgttc gacctgatgg cgcgggtggg tttgcgctca gtcgaggcac    138780
     gtaccttccc gctgtcgtac gtggttgatc cacggaccca aaaggcttgg aagccaggca    138840
     cctttatcga cgtgcgcctc gacccacggg acatggagat caagttcaac aagtcccgcg    138900
     ttgtgcacgt gccatacagc ctgatggagg acatgtacgc atatacgaca ttcgagcgca    138960
     acggtcttgc cgacgcggca gaccgcaagg aactgatcct gacgattcac gggcaacgct    139020
     acagcaagga atccgcggtg aaggtctaca ccgatctcag caacacggtg ggcttccggg    139080
     tgcgcccgct catgctgcgc cacagctacg cgattcatac cctgctgctg cttcgcagcc    139140
     gtcccgagat accgatggag ccgctcatgt acgtccgcga ccgcctcggc cacgcgagtg    139200
     tccagaccac catggtgtat ttgcagcaga tagagcggct gctgggcgca gaggcgctcg    139260
     cgatgatgga cgagtttgac cggctctacg gggttggcaa agcattggcc acggcgccgc    139320
     atgcatccac agtcgatcct cgacactgag cgacgccatg gtcagaaaga agaactacaa    139380
     cgtcagcgag aatcgcgccg caccggtcgg tgtcatatcg gcatcactcg aacggccgaa    139440
     gcccggcgcc gacgacgcct gcatcgacat ggtcgcgctg ttggggctcg aggcacgctt    139500
     tcctcagaga atcaagacgc tcgaccttcg tgactggctg ggccgaggca tcgacgactg    139560
     ggtatgctca tcgggcttct gcctcaaggc gatgctgctc tcgggtgcac gcgcgacagc    139620
     ctccgtcacc acgtacttcg ggcagctgcc ttacctgttc gagtacctcg cgggcagttc    139680
     gcaaaccccg ctgccccagc gacccaagtt gccgtcggac ctttccccga tgcatgtcca    139740
     gcatttcatc ggatggttgc agaagcgagc tcaggctgaa ggctggcgac cgagttcgac    139800
     gcgcaatacc tacagggggg tcaaggccgt actcgccgaa atgttcgcgc agggcttcat    139860
     cgagggcgag ccttctcgct tcttccggcg cggcgcgttg ccctggagca gcgaagacag    139920
     cctgcagact agcctgagtg acgcggagca agagcgcctg gccaaggcga tcaagtccga    139980
     cctcgttgat gttcaccacg gccgcttgca actgaagcaa agtgccgtgc agggactcag    140040
     gctgttgttg gtggcacacc gtcaagggct caacccgacg cccctgctcg aaatgtgccg    140100
     cgatgcctta gcgccgggat ttctgcctgg cacgatccta attcgtactg caaagcaccg    140160
     cagcaagaag attcgttcca atgttggccg ctccgctctt ggacggcacg catcaaatca    140220
     accgaacgag caagctgacg agcagaacct ttgcttcgac ctctccgagg gcgcagtctt    140280
     gcagcaggcc atcgcaagca cccgcgaact ggtgggtgag gcgccatccg cgttcaagac    140340
     acggatctgg ctgtatcgcg ctgaagcaag tgcagggtcg acaaagaggg gcaacatcac    140400
     gtgcctcgac agcaagtccc tcaacagggc aatcgaaggc gtcatcgaac gccgcagtct    140460
     actgggagac ggcggcctgc cgttgcgcgt caacctgagt cgcctgcgta agagccgctt    140520
     cgaccgtgct ctgcgtaccg ccgacggcga catagccatc accgccaacc tgatgggcaa    140580
     cacaccgagg gtcgccggag tgaattaccc gtcgatgaat gaggcgcgca aggccgatgc    140640
     agcgagcttc atgaacggcg actataccgt tttgatgcgg gccgaagcac aggctccgag    140700
     ggggaatgag attcggccag tgcaagtgga acctttcaag gtcggcaaag gcagcataag    140760
     cgccccgcca agcccgacgc ccgtctccgc atgctcggac tcgatcagcg gcgagcatgc    140820
     gccgaatgat ggccgcagcc actgcgatcg ctacgtcatg tgcttgttct gctcgagctt    140880
     cgcgatcgtc ggcaccgtgg acgaactctg gcgcttgttc agctttcaga tgttcgcgca    140940
     ggccgaactc gactaccttg acgaagcctt gggtccggag cgcacgaccg acggactgct    141000
     tgaggacctg cgcgaccgat accgggtggt catcccctac atcgacgact tcacgcaacg    141060
     ccaattcgcg cgcagccggg tcgcgcaggc ccgcgccaag accgtctcgg gcttgcaccc    141120
     ttactggcag caccagatga ccatgagccg ccgcgcacga caccgtgcgt cagcgccgga    141180
     tctgcgcgtt gatggctcgc acggcgatac ggcgataccg cggattcgcg gaacgcagca    141240
     ggcaggaccc agggcatgag aagtacctct gcctcgatcc ttgacacgcc ccaaacgcta    141300
     tctggggctc gcgccgtgcc ggccacatcc ttgcccgccc cacgtgccct gcgggccttc    141360
     gagttgctgg cggctcagcc gatcagcctg gtcggcattc cgccggccga acgtgacgct    141420
     atcgtggtga ctgccgtggc cgatgccgca ggccacgagc atccagtgag tcgtttcggt    141480
     gatcgggtct gggacctcgc gccggagatc gaggcgaaga accgcaaggg ttcggccctg    141540
     aagatcgttt ggccggacga cgtaccgaaa gcactgatcg acgatgccaa ggcggcactc    141600
     tattgtgctc agcgacgcgg cccccacggg cgaaagtggt ccggcagctc gatagcggat    141660
     attggccgct cgggcgtcct ggctctgaga tatctcgcac aattggggct ggccgacttc    141720
     agtcaggtac gagctctgca cctgtctgac cacatcgcgg atttgcggcg tacgctcaag    141780
     cccgtgtcgg tgcgtggtcg gctgcaaatt gtcgacctgg tctggacgtt ccatacggaa    141840
     gtcctgcacc cgttgctcga gcacccgtgg gcggggctcg ccctttggga tgcatgtggc    141900
     ggcaatgaag ataatcggat gccgtcaggg cggaccggca cgacccccgt gatcccgcgg    141960
     tcggtgcagc gcatactttt cgcctactgc gaggccagtc ttgcgcaggc ggacgagctg    142020
     tttcaggctc gagacgcggg cgggctcggg gcgcccaagc gccccgcaat gacttcgatc    142080
     cgcaatgcgg tcctatacct cttgcagatc tcctccggaa tgcgcaactc ggagagcacc    142140
     ggcgtgacca gcggatgttg gcgtaccgaa cagcgcaacg gcgtgacgta tcactgggtg    142200
     cgcacgcgcg aagtcaagac gaccggcgga accgaggtcg actttctggt gccgccggag    142260
     gctattcgcg cgcttgagat cctgcagcgc tacgcccaac cgctccaagc acggttggtc    142320
     ggcgaggcgc gatggctcga agacctgatg gcgcagggcc ccgatctcac cggccacctg    142380
     tgcaacggca tgaaaatggc tgaggccgcg caccgcctga accatgtgcg agagatcggc    142440
     cggcatctgg ttctaggact gaacgtgaaa gcctcggatc atctgggaac cggttcgcgg    142500
     gtcgaggtgc tgagttcagc atcctgcggg taccaattga agcaattggc cgcggccgcc    142560
     gggacagagt ggaacctggc caaccatcag tgccgccgca ccttcgcgta caacgtcgcg    142620
     aactcgcggt tgggccgaat gggcctcgtc ttcctgaagt ggcaactcaa acatgcgtcg    142680
     atgtcgtgga cgcagctcta cgctgccagc ccgcaccagg atcacgccct atatcgcgag    142740
     ttcgaggagg aaatggccga cgcgcggctg gggctgctgg aaagttgggc gcattccgat    142800
     gcgctgctca gcgggggtgc cggcaagaag atcatgcaga cgcgcacgcg tgccgcacgc    142860
     gacctcaagc aactcctgag acaaaccgcc gagtcgatcg aactgcgcag caccggacac    142920
     gcgtggtgca tcagtggtac gcgaggatgt cacggccagg gggtgtacga cccatcaatg    142980
     tgcgcggggt gctcgcaggc catcatcgac caggggcaag catctgcctg gcagatgatt    143040
     cacctggaca acctgcggct agctgcgatc accgactgcg gtcccgcagt ggccgataag    143100
     gcgcggcgcg tggtggagcg ctcgacgcag gtgctgcggg atctcggctg tgcgctgccg    143160
     accgatgacc gggcccgggc gtacactgcc gcgctggagg gagcatgagc agccgtgcag    143220
     gcacctcgcc cgacgatacg cggcccgggt cggcgccccg gcgccgtagc agagggaaga    143280
     cgcgcgaagc gctacagctg gcgatcctcc gggtcaagac gaggggactg aaattgagca    143340
     tctcctccgt cgcggcggag gctggcgtaa gcgccggcct cattcacaat acgtaccccg    143400
     acatcgccga agagatccgc actcaagtcg gccgcggcat tcggcagcag cgcgacgcca    143460
     cggttgcgga ggtcaagaag gtaagagaac agctgaagac cgtccgcgcg gagcgagacg    143520
     ctgcactggc tgatgtcgcg acgctggcgt cgattaatga aacactgcgt caggagattg    143580
     caacgctgca ggcggtagct tctggaaaga tccatgttct gccccctgtg agggacgttt    143640
     aagtcgtatg ctgggatccc tttgatctca ttgcattttc ccggtaaccg acaatcgcca    143700
     aaccggtgtt acggagtcgc cgaccgcact cggagaaacc gttctaccgg tacgacggcc    143760
     acgacgccat cgccgcccga ttgttcgttc gcgaccgtcg taatttcctc gaccagcgcg    143820
     tcgacgctct ctgcgaccgt aaagacttcg atcctgatgt gttccgttgt ccagtcgttg    143880
     ccaaagaagt tgggatgcgc gccgaatccc tttgccttgg tcaccgtcat tccatggatg    143940
     tgcaacgcac ccaatcgctg ctcgagcgcg gtgagcacct cgggccgcag cactgcgaca    144000
     acgcatttca gttccatcac atcctcctgc ttcgaaattg aaacgcccgg cggctatccc    144060
     ttcggcgccc actttgcatc gactgccgct tgaatcttcg ctgcgtcccg gacaccagct    144120
     tgcgtcatct ggtaagcgat ttcggctgtg ccttggcaaa ccgggcacga caccgccatc    144180
     ttgtcctcga agcactgaag gttcgaacga tgctcgccgc ggttctcgca tccgcaccag    144240
     cagtagagct tgttgagcgt cgcggggatc tgggtcgcga cccagtacgc gtgccgcaca    144300
     gcaatgtcgg gaaactgcac cgggttcagt acatgcgagg catccgatac gcccgatgaa    144360
     atgatgcgca gtccatctgg gcgcagcatt ccgactcgcc agccgggtac ctgctggacc    144420
     gtgttctcca gcgtgaccgc agcgcttttt ggaccaaagg cccaatgcac aagtgaaggc    144480
     ccccaaacca acgccgtcga taccgcgaga atcagggcaa gcagagacag cagattcaac    144540
     ttcaccttga cgacacgacc ggagcgctcg ttggcggcgc tgccagactg atgtcgtttg    144600
     tatcgtttca ttttcaatct cccaaactcc cgctcaggtt ccggaacgcg gatacatcgt    144660
     gcttccacac gacagcatgc cgtgcatcat cccgctatgc atcccccaca tcgcggccgt    144720
     gcccagcacc gctagcaggc cgatggccgc gagtaggcca atgatgaaat tgacgattgg    144780
     tttcccagtg aacatatacg ctccgtgaag cggaccggag cggtggcaaa tgccatcgct    144840
     ccggcccgat gtaccgacgt aagtcggcgg gctcagtgtt cggctttgtc cgtcaggcga    144900
     gtgtccacac cggaaccgtc agcgtgagat tgcatgccgc gcatcatgaa aatcatcgat    144960
     agcgggcaga taaacccact ggcgataacg gcgagcgttg caagcgggcc tctgagcgga    145020
     ggaaatgccc agtacccgag ggcgatgacg gcgaccagtg cggacccaac agccaccatg    145080
     gttttccagt tgcatttcat gtgaagtcct tgtcaagcgg aattcaatgc gagtcatgtg    145140
     gtctggcttg cgtcactttg acggtgccgc acccgcctgg tcggaatact tcatcatgat    145200
     gtcgctcatc gcgcgcatca tctcggcgtg cattcgcatt gcggtcttcg agtccagtcc    145260
     ggcgctcccc cccatcatcg ggcaaccacc catcatgccg cccatcatca tcgagccgtg    145320
     accgtgctca cgatcttgcg ccgacgtgcc ggacgctgaa ccagtggcag cgaagctcac    145380
     tgcgctcgct gcaaccaata gtgtggaaag gaccgccatt cgtgcatgac ttgcgttcat    145440
     gtatatctcc atctgcattc aaagaatcga acatgcgacg cttcccggat gaatacgcgg    145500
     gccacgagcg aactcgggcc gcggtacgga accgctgggc aagcgtcgac ggatgagagt    145560
     tacaacgaac gcgggggtgg tgctggcagc tcaggaatga actgctcggc gaggaacggc    145620
     gtgatggccc gatagtcggc cgtagaaacg acgatgccga cgcgatgcga catcggtata    145680
     gccagcatcc cgcacacggc acttcccatg cccgcgtggc acgcagatgg acgatcgctg    145740
     gtaccgagag gcttcgtacc ggacgtgcat ccggtcgctt cgatcgcact tgctgccttc    145800
     atgtgatgct gtaccgctgg catcgacgac atttctggac acaacgccgc ctgtgcgggg    145860
     taaccgagca ttggcaacca cgcaatcaga aagcaggcaa cgagtttgac ccagaatttc    145920
     atgatttcca gtataggcgc cgatcagtcc cgctgcgacc gccggcagct gcgctattgc    145980
     gccacatcgc ccgactgcaa ccgcttcaga tgggccagga acgtgtccgc gccaataaat    146040
     ccgatcaatt gcgcatcggg ctgtggccga ccagtcttgt cgaagaagat cagcgccgga    146100
     gggccgaaca gaccgaaccg ccgcaacatg gccgtgtcgg cctcggtgtt cttcgtcacg    146160
     tcgatgcgca gcaacttcca atgcgtgaac tcgttcatca cgcgcgcatc cgtgaacgtg    146220
     aagcgttcga gttccttgca ggtgatgcac cagtccgcgt agaagtccac catgacaggt    146280
     tgacctcgtg ctgccttgag cgcctcgtcc agcttcgcgt tcgaggttat cgtgtcgaat    146340
     tgcgttgccg cacttgtgcc gccgcccgcc gacgtcgatg tccgagtcaa tccgcccagc    146400
     ggcgtcaaaa tgtcgaagtt gcccgatgcg acgccaacaa actcggcaat accagcgacc    146460
     agcagcaaca caccgagcgc tttgccgact cgcgcgatgc ccgtagcatc cgccggtaac    146520
     gggtcgatcg cccgcagcat cgtcccgcaa gcggtgagca gcaacgcgat cagcgacatc    146580
     agcagccacg cgggcagcag cgaataaacg aaccacagcg cggcggccaa cagcatgacc    146640
     cccagcgtgt tctggacggc gaccatccag tgtcccgact tgggcagcaa gcgcgttccg    146700
     aacgtaccga cgagcaacaa tggaatgccg attccgatac ccatcagata cagcgccagc    146760
     gcaccgcctg agatgtcacg actgtttgcg atgtagagca gtgcgccggc cagcgccggt    146820
     gtggaacacg gccctacgat cagcgcggac aacatgccca tcacgaacac gggcccaaca    146880
     cggccgccgg gcaagcgctt gctccatccc gcaaaccgcg tctgccaacc cgtcggcagt    146940
     tgcaatcgga acacgccgaa cataccgagc gcgaacgcga gcatgagcat gccgaacgtg    147000
     gccagcaacc agggtttctg cgtcagcgcc acgagcggaa tgccgatgac ggccgcgaca    147060
     gttccggctg ccgcatacgt gatcgccagt ccttgcacat aggccaacga cagcgagaac    147120
     ccgcgccata ccggcaaccg ctcgcgagta ccgtcaatga ccgccgtgac gatcggaatg    147180
     agcggataca tgcacacggt acccgccatc agcagacccg ccaacaggaa gccaagcatt    147240
     tcggcgatgc cgataccatt ggccggccgc agcggtagac cgagtacggt ggcctgccgg    147300
     tctttctctg cgacagggaa gtccgccccc ttcgcgctcc ccacgagcgc ggcaggcgtc    147360
     accccaccgt ccgcagcgat ccgaaagcgg cgagtctgag gcggataaca gacaccaacg    147420
     tctgcacatc cctgggatgt caccgtcagc gtggcgcttg acgtgacggc ggcggacagc    147480
     ggaagaagaa ttcggaccgg ctggtgatag acctgcacga caccgaacgt ggggtcgttc    147540
     ttggtttcgg agggaggcat cgcaaccggt tttaccggcg cgccgctcac cgcaaagctg    147600
     aatcggtcac gatacaggta atacccgggc ttcgtcttga agtcgagcac gacctcctta    147660
     tggctcgcaa ggctgacggt caacggaaat gcctgctcgg gcgccagcaa ttcggattcg    147720
     ttgactgcgt atgccgcaaa ggatacaagt ccgaacacca gcacaaggac gaagcgaagc    147780
     atgcgactca acgcgtccgc tgttcgatag acgtaccgat acgtgttaga ggatgtcgtg    147840
     cgcatgttgg tctcctcggc cgcccctttg gcgtaccggc gcgcggacag acgcctgcgc    147900
     gccgggcacc aatgttttcg tcaggaacgc ttttccagtt tcacgatggt cagggtgccg    147960
     ttgacttctt caacgcgcac cttgaccttg tcgccttcct taatctgctt gaccatcgcg    148020
     gcatccttcg ctttgaacgc catcgtcatc ggcggcatgc cgacgttttc gagcgcgccg    148080
     tgcttcaacg tgaccatgcc ggtcgccgtg tcgaccttct tgacctccgc gtcggtgagt    148140
     gcgttgttcg acgacgcctt catcgcggaa gctttggtcg acatgtccat gccagccatg    148200
     tcgttgccgg caaatgcggg cgtgacgaaa gcggctgcga gtgcggcaga tacaacgatg    148260
     agcttcttca ttggacttct ccggtttggt tgactggcac gttcgtgccg gaaggtactg    148320
     cttgggggaa actggcagca ggcgcctgtc gcgcgcgacg gcgctgcaac aggaaccacg    148380
     ctgcgggaat cacgaacatg gacagaagtg gtgcggtcac catgccgccg accatcggcg    148440
     cggcgatccg ctgcatgacc tccgacccgg cgccatgtcc gaccatgatg ggaatgaggc    148500
     ccgcgagcac gacggccacc gtcatggcct tcggccgcac gcgcagcacg gcgccttcgc    148560
     ggatcgcatc gaacagcagc gcctcggtga gcggctcgcc atcctccagc cggcgattga    148620
     gcgcgccttt caggtacagc agcatcacca cgccgaattc ggcagcgacg cccgcgagcg    148680
     cgatgaatcc gactgacgtc gcaaccgaca ccgcatggcc gagcatccag atgagccaga    148740
     acccgccgac cagcgcaaac ggtacggtcg acatcagcag cagcgcatcg gcagccgagt    148800
     tgaaggtcag gaacagcagc acgaagatga cgacgagcgt gacggggacc accgtgcgca    148860
     gcttggccgc cgcgcgttcc aggtactcga actggcccga ccacgcaatc gaataaccgg    148920
     gtggcaattg gacctgctcg gccacaacct tctgcatcgc cttcacggcg gactgcaggt    148980
     cggtgttgcg gatatcgaca tagacatatc cggagagccg tgcgttttcg ctgcgaatca    149040
     tcggtgggcc gtcggcgatc gtgatgtgcg cgacgtcgcc gagctggatt tgcgcgccgc    149100
     ggtcagtgac gaccggcaac tgtcgcaatt tctcgagcga gtcgcgaatt tcgcgtggat    149160
     aacggatgtt gatggggaaa cgctcacgcc ccgcaattac ctcgccgacg ttctcgccgc    149220
     ccaccgccga ggacacgacc gactggatat cggccaccga cagtccgtag cgggccgcgg    149280
     caagccggtc gatatccacg tcgatatagc gtccgccgtt cagccgttcc gcgagtgccg    149340
     acgtcacgcc aggcacacct ttgacggccg tttcgacctg ggtcgcgata cgatcgattt    149400
     gcgtcaggtc cggcccggaa atcttgacac ccaccggcgt cttgatgccg gtcgacaaca    149460
     tgtcgagacg attgcggatc ggcggcaccc atacgttcga cagaccgggc accttgaccg    149520
     tccgatccag ctcatcgacc agcttctccg gcgtcatgcc cggccgccac tggctacgcg    149580
     gcttgaactg aatggtggtc tcgaacatct cgagtggcgc cgggtccgtg gccgtatccg    149640
     cgcgaccaga cttgccgaat accgtctcga cctcgggcac ggtcttgatc aggcgatcgg    149700
     tctgctgcag cagttcgctc gctttctggg ccgaaatgcc cgggagcgcg gtcggcatat    149760
     acaacagatc gccctcgtcg agtggtggca tgaattcgcc gcctagacgc gaaatcggaa    149820
     cgatcgtgag caccaaggca accgccgcga gaccaatggc tgtccacggc cgacgcaacg    149880
     tcgcctcgag caacggacga tacaaccgta tcagcacgcg gttgatcggg ttcgcgtttt    149940
     cgtgcggaat ccgcccgcgg atcagatagc ccatcaacac gggcacgagt gtgaccgaca    150000
     agccggccgc cgccgcgatc gtgtaggtct tcgtgaacgc cagcggcgag aacagcttgc    150060
     cttcctgtcc ttcgagcgag aacaccggaa tgaacgacag cgtgatgatg agcagcgaga    150120
     aaaacaatgc cggcccaacc tcggcggccg aagtcgcgat gagctcccag cgttgagcgg    150180
     cggtcatccg tgtatcggga tgctcatgat cgaacgcttc caggtgtttg tgcgcgttct    150240
     cgatcatcac gatggccgcg tcgatcattg cgccgatcgc gatcgcgatg ccgccaagcg    150300
     acatcaggtt cgcgttgact ccctgatagc gcatcacaat gaacgcggcc agcacgccaa    150360
     gcggcaacga cagaatggcg acgaacgcgc tgcgcaggtg aaacaggaac acggcacaga    150420
     cgagcccgac gatgatgaac tcctcgatga gcttgtcctt caggttgtcc accgctcgtt    150480
     cgatgagttg cgatcggtcg taggtggtga ccacttcgac gccgggtggc agcgagcgct    150540
     tcaggtcggc gagcttcgcc ttgaccgcat cgatggtctt cagcgcattc ttgcccgagc    150600
     gcatcacgat gacgccgccg gcgacctcgc cctggccgtt cagctccgcg atgccgcgac    150660
     gcatctcggg gccgatctgg atgcgtgcga cgtcgcccag cagcaccggc gtgccggcgt    150720
     cgttggtccg caatacgaca tgccggaaat cgtcgagcga gcgcaggtag ccagacgagc    150780
     gcaccatgta ctcggactcg gccatctcca ccaccgagcc gcccgactcc tgattcgcct    150840
     tgccaagcgc atcggccacc gcggcctgcg tgatgccgta cgcgcgcagc ttgtccgggt    150900
     cgagcacgac ctgatactgg cgcaccatgc cgccgatgct ggcgacctcg gagacatccg    150960
     gcactgcttt cagctcgaac ttcaggaacc agtcgttcag cgcgcgcagc tgaccgaggt    151020
     catgccgtcc gctcctgtcg acgagcgcat actcgtacac ccagcccacg ccggtcgcgt    151080
     ccggaccgag cgagaccgtc gcaccttgcg gcaggcggct ttgcacctga ttcaggtact    151140
     cgagcacgcg cgaacgtgcc caatactggt cggtcttgtc gtcgaacagc acatagacga    151200
     acgcatcgcc gaacgacgag tacgcacgga tggtcttcgc ccccggcacg ccgagcagcg    151260
     tcgtcgtgag cgggtacgtc acctggtcct cgatgacctg cggcgccttg cccggatacg    151320
     acgctttgat gatgacctgc gtgtcggaca ggtcgggcag tgcatcgagc ggtgtctcgg    151380
     cgaccgagta caggccccaa cccgttacga gcacggtcgc gagcaacacc aggaagcggt    151440
     tgtggatgga ccagcggatg agccgggcaa tcattgcgcg cctccgaccg gttcgacctt    151500
     cgtcagttgg tagccttcat ccgactgctt gaagacgaag tgcaccatct gtccggcctt    151560
     gatgtcgggg aatgcgctcg gcgccggctt gttgaacgcc atcgtcatcg caccccaacc    151620
     gagcgccggc acgggttgat gagagaacgt aatgtctgcg gcggtcactt tctcgacctt    151680
     gccggtggtc tcataggtct gcgcagtggc gacaggcgcg gacgccggcg cggttgcgct    151740
     tgcccctgag ccaccttcca gccgcggcaa cacggacttc aggctcgctt cggaatcgat    151800
     caggaattgg ccggaagcga cgaccgtgtc gccatcgttc aggccgctca acacctcggt    151860
     ttcgctgcca atgtcattgc caacggtcac tgtcgccggc tgaaggcgcc cgtcaccgtt    151920
     cttcacgatg acgaccgagc gtttgccggt cgtgatgacc gcttcggacg gcaccagcag    151980
     tctcgacaca gccttctgac cggcaacgcg cacgcgcatc agcatgcccg gcgtcagctt    152040
     gagcgaggcg ttgtcgattt cgaggcgcgc ctgcagcgtg cggctggtgg tgctgatgcc    152100
     cggcaggatc tcgcgaatgc gcccggcgaa atgttgtgcc ggatcaccgg cgaacgtcgc    152160
     gtcgaccgtc atgccgggct gtacgctcag cgcgagcgcc tcgggaatct cgacgatgag    152220
     ccagagcttc gacaggccgg caatcttcgc gagcgtctgc ccgggcgcga ccatcgcgcc    152280
     gtcacggacg ttcagttcgc taacgacgcc agcctcgggc gacgtcagta cgacgtgtgt    152340
     ctgggccctc ccggttcggt cgaggctcgc gatgatgccg tccggaatcg acatcgcgcg    152400
     catcctcgca cgcgacgctt cgaggaggct ggcatccatg ccgccgcgct tgagcgcaag    152460
     atattcttcc tgcggcgcga gccagtccgg aacgaacaac gacgcaatcg gcgcaccttt    152520
     cgcgatgcgt tgcatcggcg cactggcata caaccggtcg atgtagcctg taacgcgcga    152580
     ctgcacgaca tccgagcgcg actcgtcgaa ttgcgttgtg ccgaccgcgt cgaatccccc    152640
     cgtcgtttcc tgccggcgca cggtcgcata gcgaattccg aggttctgtt ggaggcccgg    152700
     gtcgatcttg atgccggaag agccgccacc gtcgtccgca tagacaggct ccagttgcat    152760
     gttcatgaaa ggcgacttgc cgggcttgtc gaaatgctgg ttcggcacca tcgggtcgtg    152820
     ccagtacagc accttcctgc cggtcttcgg gtcaatcttt tcgcctgacg aagccgttac    152880
     cgtcgaggcc gcggccgcgg gcgttgctgc atggcgtgtg cccgcaaaat agccagctgc    152940
     gagcaaggcc gcgccggcga atacagtcag caccgcgcgc accagtggtt tttgggtcat    153000
     atcgttctcc ttcactgcgc agcagccatc gtggacggca ccacttgata ttcgagctgg    153060
     gcccaggtct gggacacttc gcgcttgagg tcgagcacct gcagttcggc ctcgagctgc    153120
     gcgcggcgag ccgcgaacgt gtccgcgagc gagccgcttc ccgcgcgata ggcggcgttg    153180
     gcgagttgca cgcgctggtc cgcagcgggc agcaatgact gactcaaatt ggcgatgcgt    153240
     tcgcgtccgc tcgccagcgt ggccgattgc gtgcgaatgt cggcctgaac ctgtcgcagc    153300
     gcgtcctcgt acatcaaccg cgccttcgtg gcgagctcgg ctttctccgc gacgtcgcgg    153360
     ttctggcgat ttttccgatt caatggcaac ggaatggtga cgccgatcga caccatgttc    153420
     gagtacgcac cgccgcgttg ctgatatgcg acctcccaag tccagttcgg gctgcgctcg    153480
     ctgttggcga ctgccgtatc ggcttcggcg accgaaatgt cgtccgcggc agccacgagc    153540
     gttggctgcg acaggcgcag ttcgtcggga gggagcgacg atacgaacga ctcgggcgcc    153600
     ggcggttcgc cagtcacctc ggaaacggga gcggccgtcc agcgcgacag cccaatgagc    153660
     gctgtttgat aagtctgttg cgccttgagc acctgatcct gagtctgcgc aagcatcgcc    153720
     tgcgcttgca ccacatcaga cgcgccggcc ttggcgccgc gatatgacgc cttcgtcgca    153780
     gccagctcgt gatgcatgtg gtcgagcagc gcctgttgca gggcgagcgc ctgtttcgcg    153840
     tacacggcgt tcagccaggc cgtggcggtt tgctgccgca cgttcgcgag ttgcacgagg    153900
     tagccggcgc gctcgcgccc gaccattcgg tcggcgagcg ccgagcgcag ccgccgcttg    153960
     tcgccggaga cccattcctg ctcgatgccg atgcgccgca tcgtcatgaa gtcctggccg    154020
     acggtgaagc gctgaggacc gttgatcggc aggttgtcga tacccgcctt gagcatcggg    154080
     tccggaagtt ggccggcttt gactgccgcc tcggaactgg cgcggacgga cgcctgcgca    154140
     gcctgcatcg atgcggagcg atcggtcgcc gactgtagcg cagcatcaag cgtcatcggt    154200
     gcctgctggg catgaacgac acccgcgagg aatagcgcag aaacaagcgc gtgcgcacgc    154260
     caaggaacac gccgacgcag cggcgtgccg aaaatgaata gcatgttcta accccaatgc    154320
     gaaatcccat agggattcca cgtccggcat aggacgaacc tcaccgcaac tgcggtgaac    154380
     ctgtcagcga gggattagac gagacgcgga gggcgccata acccgttcgg gtcacggacc    154440
     ggaagagact ggacgtaatg gaagatgacg ggcgtaccga ccgcagcggg acggctgatg    154500
     tcggtcttgg cggctggatg atagaggctg ccgaactgac actgggcggt cactttgcag    154560
     aacacgctct tggccttggc tttatcgacg gacgaggact tcatcaaatc gcagcccggc    154620
     atatcgccgg acatgctggc atccgcgccc atggacatgg tttgctgcat cggacattca    154680
     ccggtcaagc cactggctgc cagcccgctg atgggcagca ccgcgcagag cagcgacagg    154740
     atgaaggtcc ggagcaattt catagccagc attatagtcc gccgatgccg gtgattacat    154800
     cggaattgta ctgacgtttc aacgctgaaa cgtccccgcc actggagccg cgtggggcta    154860
     atccggaatg tgggtacaac gcttgcgcga cgagtcgggc ccgatccggg cagtccacga    154920
     taggagagtc aaaatggcac atcaacaata ccagacatgc atctcggcct gcgacgcttg    154980
     cgcgaccgct tgcgatcatt gcgcggccgc gtgtcttgaa gagacccaag tcggccagct    155040
     tattgactgc atcaaactcg acctggattg cgccacgctg tgccgcctcg cttccgcagc    155100
     gatggcgcga ggcagcaagc aagtcaaggc agtttgctcg agttgcgcga ctttgtgcga    155160
     cgcgtgcgca accgaatgcg agaaacatca acatgcgcat tgcaaagaat gcgcacaagt    155220
     ttgtcgacgc tgcgctcagg aatgccggac gatggctcag tagacggtca gctccgtgcc    155280
     acgcccggcg tcggtgatat cgcgcacgca agaggcgtgg cacacgttgc cgtcagcgcg    155340
     gcgggcaatt cgccgaacgc acgtgcagat tttgacacgg ataggacttc ggtaatcggg    155400
     tcgttgcgga acgggagtcc ggcatccgcg tcttcccatc cgtattgccc gtcgcgctcg    155460
     cacatccatc aagagccagg accgtagtaa tcgccgtcac ataaatccat atgccgggta    155520
     tcggtctcat cgcgtgaact cctctatctg gtctggcgag cctacgttcc acatggaata    155580
     tggccggagt cgtgtacgtt caggctgagc aacgcctggc tttccgcaac ggtgcgtgcc    155640
     tcaatgctgt gcggcccact tcggctcact taactgatgg agttccttgt tgcgcgcgat    155700
     agtcgcttcg ctgggcggat agtcatgctt gctcgttggc agcaaaccat cgtgataagc    155760
     ctgaataagt tcctgttgaa cctgctctcg ggtcttgccg cgcgataccg tgttttcaat    155820
     ttgcgccgtt gccggtgcag caacgctttc gttcgatacc acgctgccgt ttcgcgtaac    155880
     gtcgggataa ccgtgcccgc tatcagcgaa tgcagacgcg gacgtggcgg cacaggcgac    155940
     cactatgagg gcggcgacga tttgaagttt catgttttct ctccattgcg aggcatggaa    156000
     ccgcacatgc gactccattg aaagtcattg tggagagcag ccactgatcg agccgtgaca    156060
     tgaatatgat cttttggtca cgcgtccttc atctggaatc gtcgaccaaa cgcaatgcgg    156120
     aatgaaaaaa gagcccggct ggagggccgg gctgcaaaga gatggcccgc tcacgcgcaa    156180
     ctcgcacatg agtgacagac cacctgcgtg gacggaggga ccgacgaatt tatgtggttc    156240
     ccggcaacgg gctcgatacg agcacggccg ctaccatcaa gacaccaagc aaaatcagtg    156300
     actcgacgtg aagcaccgta ctgaatcgtc gaagcggcac ggtcgggact tcttgagcag    156360
     ggttcttcag cgtcgacatt agcgtcggca tttcaaagaa gcgattgtgt ccgcccagcg    156420
     cggcggcgac cagcacgagc acgaacttca gcagtaggat ctgtccatac gtcgatgtcc    156480
     acaaattcgc cggcgtactg acgcctcgcc agccgttgta tgcgccagtg ctgaacaaaa    156540
     tcaccaacgc gtacgtcgag gtgtcggaca gcgattgcac gaatgatgca ctggtctgcc    156600
     gttcgcttcc aggggcatcg agcagccgcg gcatgacgac gtaggtcgtc acgagaacga    156660
     gcccgaccca cgcgctgatg gctagcaaat gcaaccaatc gacccacacc ggaaggctga    156720
     agagtccgga atcgactgga tgtccgccat tgctgcgtgc caatgctacg gcggccaaag    156780
     caagccagat tccggtcggg aaactcccat cgctacccga tcgcagcaat gccagcacga    156840
     ccacgcaaac catgaaaact gcagcgacca gccacgcgtg tccaaagccg gttcccacga    156900
     gcatcgacca caccgcgggc ccggcctcaa gcaacgttga ctcactcatc agcgcgcaat    156960
     gtgcccagaa cgacaacacg ctcgcgagca gagcaagcgt ggacgccatc cggactgtca    157020
     ggacgagccg tcggcccacg tcggcttgcc acgtggagtc accgcgcgcg agccattgac    157080
     tgctgagcaa cgcgcctacg atgacggcga agccaacgtt ctggatcgct acggcgatca    157140
     gacgcaggat gcccaggaac ccgtcgttca ttacttcacc ttgaacgtgt acgtaccctt    157200
     ggtcttgtgc gcgtccgaag tcatgacggc ccactgaacc gtatacgctc ccgacgcgag    157260
     cttcggtacg acgagcgtca tgacgcgcgg attcgacgca tcgatcttcg ccttttcttt    157320
     cgtcaccggc gcacccgtag catcggcgat tttcaccgag ctgaaggtcg actcgaggtc    157380
     ttcattgaag gtcaggcgca atgcgtccgg cgcgacgtcg acggtactgc ccgacgccgg    157440
     cgttgcgctt tccagtttgc cgtgtgcgag cgcggcgatg ggcgcgaacg caacagcact    157500
     agcgacggcg aggccggcaa aatgtctgag ggtcaaaatc ttcatattgt tgctcgtctc    157560
     gaagaatgag acagggaccg cggctgcgcg tccccgtcga ttgtcgtcac tgcttctgca    157620
     gcttgacgac cgtcagtgcg ccgttgactt cctcggcgac gaaatcgatc ttgtcgccga    157680
     ccttcacctg cgacagcatc gccggatcct tggccttgaa caccatcgtc atcgcttcca    157740
     tgccaaggtt ttcgagggga ccgtgcttga tggtcagctt gcctgcagtc gtgtcgactt    157800
     tcttgatctc gccgtgcgac atgctgctct tcgcgtcggt actttgcttt gtgccaccgc    157860
     tcatgtccat gttgcccatg tcgcctgccg cgtacgtcga cgcagagaac gccagggcgc    157920
     agcctattgc aatcgagaac agtgctttct tcatcgtgct tctccagagt tgaggtgatg    157980
     aaaccgacgg tcgggcgtgc cccgaccttg ttgtgtaaat caactgtccg gcagttcacc    158040
     ggtgtattcg tatgcgacgg tgcctttggg atgcttgaac cagcccgggt cgcgatagtc    158100
     gttccgcccg agcccttgcc ggaccttggc gactgtgaac atgccgccca tctccaacgg    158160
     cccgaatggg cccgtaccgg tcatcatcgg cagtgtgttg tcgggtagcg gcatctccat    158220
     ctcgcccatt gcgccaccgg tgctgcccat ggccatgtag tcgggaacga gcttgttgat    158280
     gcgtttggcc aagtccttct gcggcacgcc gatcatgttc ggaacgctat ggcccattgc    158340
     gttcatcgtg tggtgcgact tgtggcaatg gaacgcccag tcgccaggac gatcggcggt    158400
     gaactcgatt gcgcgcatct ggccgacggc gacgtcggcc gtcacctccg gccaacgagc    158460
     ggccggcggg atccagccgc cgtccgtacc cgccacttcg aagtggtagc catgcaggtg    158520
     aatcgggtga ttcgtcatcg tcagattgcc gaaccggatg cgcacgcggt cgccggcccg    158580
     aattggcaac ggatcgatgc cagggaatac gcgtgagttg aacgtccaca tgttgaagtc    158640
     ggtcatctcg ttcacacgcg gcgtgaagct gcccgggtcg atatcatagg cggacagcag    158700
     gaacacgaaa tcgcggtcga ccggcatcac gctgcggtcc ttcgggtgca cgataaacat    158760
     gcccatcatg cccatcgcca tctgaaccat ctcgtccgcg tgcgggtgat acatgaacgt    158820
     gccatgcttc tcgagctgaa actcgtagac gaacgtcttg ccgggcggga tgtgcggctg    158880
     cgtcaagccg ccgacgccgt ccatgccgtt cggtagcagc atcccgtgcc agtggatcgt    158940
     ggtgtgctcc ggcagcttgt tggtgacgaa gatgcggacc ttgtcgcctt cgacggcctc    159000
     gatcgtcggg ccaggcgact gaccgttata accccacaga ttggccttca tcccgggagc    159060
     catttcgcgc acgacgggct cggctgtcag gtgaaactcc ttccagccgt tcttcatgcg    159120
     ccacggcagc gtccagccgt tcaacgtcgc gaccggtgtg tatggccgac cgttgggtgg    159180
     cacgagcggc ggctgcatcg tcgcctttgc catggtcggt gcttccggca acgaagccgc    159240
     gccggccttg ctgaccatcg cggcgccgag gattgcggcc cccgagccgc tgagaaattg    159300
     tcgacgggac accatgttat ttaccttccg aatgcgtttc atgcgccggt tgcgcggtcg    159360
     aggcaggctc cggccgggct gccggtctcg gggcggactg cggtgcggaa ttcggccccg    159420
     gaggcgtctg ctcggtttgc tcggccccag ccctcggtaa acgtccgccc agcgcttgct    159480
     ggagatccgt ttcggcgagc cagtagtcct tcagcgcgtc gatgtagctg ttcaccgcgc    159540
     cgacttgctc gcgcgagtcg gcgagcagtt cgaagacact ggcgagcatg ccgttgtagc    159600
     ggagcagaag ttcgtcagaa atcgtcttgc gaatcggcac aacctcgtcg cgatagtgtt    159660
     tcgcgacgtc gtagctgttc acgtacgcgg aatacgcctc gcggacctcc gatcgtgcat    159720
     caatcgccgt ttgggcaagg cggttcgccg actgcatgta gatggcttcc gcgcgggcga    159780
     ccttggcgct gccgaaatcg aaaatgggaa tctcgatact gatttcgtag ccgtgctcgt    159840
     gacccttgtc ggtttcgtag ttgttttggt aaccaacatc gattgcgttg atgaaccgcg    159900
     ttgccttgct gaggcccaac gacgatgcga cgccttgcgt ctgcagcttc gctgcctgga    159960
     tgtcgagccg gttctgcatc gcaaaccgct caagatcttt cagttccggg cggtcctttg    160020
     gcaagtccgg taaacgctca ggcaaggtgt actgcgtacc agtgccccat acgcccatcg    160080
     tgcgcgtgag tttctccctg gccgatacgg cttgctgccg ggccttggcg gcctgggcga    160140
     ccgagtccgc gtagaaggct tgctctcgcg cataatcgag tttgctgaag tttccggcct    160200
     gccgcatgcg tgaagcgagt tcggcgcctg cgtcggccga atcttttacc tgttccgcgt    160260
     acttggcagc ctgctccgcg gccaccgcgt tgacgtacgc ccgccgcgcc tcggcggcga    160320
     gcttcagcat cgtatcggca gtctcgagct tcgtctgttc gaagcgtcgg ccctcgatgt    160380
     gggcagcgaa aggcagcgtc agaatactga gtacgttcgc ggagaatgtg cggccgatgc    160440
     tcaggtcgcc gttgcccgct cgcgtgcggc tgaaggtgaa gcctggattc ggcagtcgcc    160500
     cggcctggac caaatcggct tccgacagcc ccaattccgc atacgaggcc tgcagtcctc    160560
     ggttgttcag cagggcgacc tgtacggcat cgtccatcga cagcggcttg gcgagcaatt    160620
     cctgcgttcg cttcgccact gcatcccgat cggcatcggt tttgacgata accgcgtcct    160680
     taccgagccg ctccgtagcc gtcgacgaca ccgtaccgaa tccaccgtcc ttcgagaagg    160740
     tggtgcagcc agccagaaac accatgatgg aaacgcccgc acccatgcgc gttgaaacga    160800
     gtcgcttcat catttggcgg gctccccatg ctgcgaatga ttcgactgat ggtcgccagc    160860
     gggcttgttc atggcgccgc cgtggcccat tgcgccgccg tgcgtcatgc cgcccttggc    160920
     cggcttctcc tggaccgctt gattgagttg ttgccaggtc gggttgtcgg cgtcgttgta    160980
     ggggcgatag ccgttgaagg ccgacggcgc cgaaatcgcc gggaccgagg ccgcggcatc    161040
     cgtcgggtcg ggaatcgttg tggtggcgtg cacgagcgtc ggcaatgaag ccgccgcgcc    161100
     gagcagcgcc gcagaaatca gtcgcataaa ttttctcgtc gtgaatcatc tgacgggtcc    161160
     acgcaagacc gtcagtacga atggcacatc gcgggcatta cccgcggtgg agaatcagac    161220
     gagggtgtgg cgaggaggtc gctcgatgcc gtcggtcagg aaagacacga caccggcaga    161280
     aggcggaatc gaggtggtga cgcgtgttac gtccgacgat acgacgacgg agggaaccgc    161340
     gggtaatccc gtgccgaagc agcaggctgc gcatgtcgaa catgaatgcg cgtgatgacc    161400
     gccgccgtgg tgataagtgt gatggtcgtc ggccgcgagc gccgctccat gcatgtcgcg    161460
     atgatgcccg gacatggact gcccggcatg cacgatcggc gtttcgctgg cttcggcatg    161520
     cgaagcgacg caattcatcg agatagccgc gaacgactga accggcaggc tcagtgccaa    161580
     cagcacgacg acgaagagtt tgcgccaata tgacatgggt gcggagtcta gcacgagcag    161640
     ttcgaaacga taacatcgag aacgtgtccg ggtgtaacca caagcggtat agccggtatt    161700
     tagcttaacg gccgatgcgt gacgacggcg tggtcgaaag atgaccattt tttcatccag    161760
     cggcggtgga cggctctcgc tgttccggcg ctcggagatt catgaaaaaa ttgtcatccg    161820
     gccgtcattt tttgcgcgct ttcgcggccg tatgctgagc gcagcgctcc ccgcgtcgaa    161880
     cccgttgaca gtcctactgc actcccatgc ggatactgat agtcgaagac gaaccgaaaa    161940
     tggcgtcata tctccgaaag ggactgacgg aagcgagcta taccgtcgat gttgccgaga    162000
     acggcaaaat cggattgttt ctcgcgctgc atgaaaattt tgacctcgtc gtgctcgacg    162060
     tcatgctccc ggagctggac gggttcgagg tgctgaagcg cctccgcgcg gaaaagcaga    162120
     cacccgtgct gatgctgacc gcccgcgaag caatcgagga caaggtcgct gggcttgaac    162180
     ttggtgcaga cgactatcta cacaaaccgt tcgcctacgc ggaatttctc gcacgcatcc    162240
     gttcgttgct acggcgcgca ccgcggagca ttcgggacat tctgctcgtt gcggacatgg    162300
     agattgacct cctcaagcgg cgagtgcgtc gcggcgacaa tcgcatcgac ctgaccgcac    162360
     aggagttcgc attgttgcaa ctcctggctg aacgagaggg cgaggttttg acgcgtactt    162420
     tcattacctc gcagatctgg gatatgaatt tcgatagcga tacgaacgtg gtcgatgccg    162480
     cgatcaagcg cctgcgcgcc aaagtcgaca acgcgtacga taagaaactg atccatacca    162540
     tccggggcat gggatacgtg ctcgaggacc gttcatgacg gggaaggcgg caccttactc    162600
     actgctcact cggttgaccg tcgccttcgc tgtcgtcgca ggactagcgt ttgcgctgac    162660
     tggagcttac ctgtatcggt ccctgtcgat tgaactgcag cgccgcgacg acatcgaaat    162720
     cggtggcaag ctgagccagt ttctgcagtt ggctcacgcc agcggttcgg tacaggccat    162780
     tcgtgcaacg cctgcggtat ttcacgaggt actgctctcg catcccggtg tgtatcttgg    162840
     gatctacgac gggcaaaaca attcgctgat cgagcacacg gccgcgccgg gcgtgacgtt    162900
     gaagtcgatc gcctcgagcg accgtccgcc tcgtattcca tacacgtgcg atccgacggg    162960
     aatcgggcca tcacgctgtg ttttcgcgcg cgacaggctg ccgtcaggcg aagatgtacg    163020
     gatcgccctt gtacggaccg cgaccgaccg gcagtcgctt ctgaaaagct atcgcgtcga    163080
     catctggctg gcggtcgccg tcggcgcgat attgctcggt ggcttgggct atgcgatcgc    163140
     acgtcgaggc cttcgtccag tggaaagtct gggccgccag acgtcaatta tcgaagcgca    163200
     caatttgagc gagcgactcg acattcgcgg cggtccgatg gagctccgcg aactcgcgtc    163260
     gtcggtcaat cgaatgctgg atcgacttga acgtgcgttt gtgcgccttt ctcagttctc    163320
     ctccgacctc gcccacgata tgcgcacccc gcttgccaac gtgatcagct cgtcgcaggt    163380
     cacgttgtcg cgaccgagaa cgagcgacga atatgaggcg ttgatcgatt cgaacatcga    163440
     agaatgcgaa cgtctgcaac ggatgatcga gaacatgctg ttccttgcac gtacagagaa    163500
     tgcacacctg cacctgaagg tatcggacct tgatactgag atggaactgc aacgactggc    163560
     gtcctattat cagagcattg cggacgaaaa gggggtcaat tttgtcgtcg tcggcgacgc    163620
     gcatgtggtc gcggatgcaa cgctttttcg acgagcggtg agcaacctca tatccaacgc    163680
     tttggaccat gcgttcgcag gcacggcaat caaactcgcc tcgtctcgct cgctgcaata    163740
     cgtcgtcgtt gaagtgacca accacggacg gcctatcgcg ccggaacatc ttgatcgaat    163800
     ctttgagcgc ttctaccgtg tcgacgcgtc acgtcatgga tcctcgaaga atgccgggct    163860
     gggactcgcg atcgtgaaat cgatcatgga actgcaccgg ggacaagtcc aggtttcgag    163920
     taacgacgtc agtacgacgt tccacttgca attcccgcgg gaacgatgag gattctcctc    163980
     gaaggggtac tagtgcgcgg cacaggagcg tggattgcgc cgtcatgaag cctcgaatca    164040
     gtgtcgaaag tggaaaaagt tcgaccagca aaaattgttc gtttcccgaa agcataattt    164100
     ttatgcatca ggaggtaaat atgcaaacgc gaatttccat cccgtggttc gtcatcaacg    164160
     taattgcaac gctcggcctg atgatcggta caacgagtgc tcagcaagcc acgtccatgc    164220
     cagacatgaa tatggggcag tcgactaaag ctaattcggc gtctgtacaa gccttcaagg    164280
     gtgcagacca gaggatgatg cgaaggatgc aaggacagac ctacaccggc gacgctgaca    164340
     aagattttgt ttcccacatg attccgcacc atcaaggcgc aatcgatatg gcggcagccg    164400
     aactgaagta cggcaaggat cctgagatga gaaggcttgc ccgaagcatc gtcaaagcac    164460
     aaaaggaaga aattacgaag atgaagcgct ggcaagcgaa atacggcagc caataatctt    164520
     tgaccggggg cgaccaccgg taaatcgcat cgaaggcaag cagatccccc ttgtcggacc    164580
     gatcccttgg tgctcccgtc aatggctaca gaactcgcaa catcgagacg gccgatcccg    164640
     gacatacgcc ttggaattgg ctcgacgcca acaccaaggg cattacgtcg ccacgcgcaa    164700
     cgcgcacgaa ccctagacgg gtgaaatagt gctccgcggt cgtggtgagc agcacaagcg    164760
     accgaacttg tagcgcatga cactcggcga cgagccgcga cacgatacgt tgccccggac    164820
     cagaatcgcg tgcacgttca gctaccgcaa tagagcgcac aagtgcggcg tcaccatagt    164880
     gctcaaggcc accgcatccg cacatcattg aaccttccgt cgcgactacg aagttccgca    164940
     agtggtcgct gacgccaacg acgggaaggc cacattgacg cagcagcgtt tcgatcgacg    165000
     ctaggtcgtc gacagtggcg gggcggatct ccatccttac tccttggacc ggattctaga    165060
     tacttcgctg gttcacgcgc ttcgacagtt cctcggcgct ttcctttcgc tcgctgtacc    165120
     ggtcgaccag atacgggccg atatctcggg tcagcagagt gaacttgacc agctcttcca    165180
     tgacatcgac aacacgatcg tagtagggcg atggtttcat ccgacccgct tcgtcgaatt    165240
     ccgcgaacgc cttggccacc gacgactggt tcgggatggt cagcatgcgc atccagcgtc    165300
     cgagcacgcg catctggttc acggcgttga acgactgcga accgccgctg acttgcatca    165360
     ccgcaagcgt cttgccctgc gtcggccgga ctgcgccgac cgacaacgga atccagtcga    165420
     tctgcgattt catgatcccc gtcatcgcgc cgtgtcgttc cggcgagcac cacaccatgc    165480
     cttccgacca tatcaccagc tcgcgcagct cgaccacctt cggatggctt tccggcgcat    165540
     catcgggcag cggcaagccg ctcggattga acacacggac ttcggccccc atcgccgtga    165600
     gcaaatgctc ggcttcctcg accagcagac ggctgaacga acgctcgcgc agcgagccgt    165660
     acagaagcag gagtcgaggc ggatgcgtcg acggtgtcgc cggccgcaat tgagcggcgt    165720
     ccggcacgcg gaacagcgtg gcgtcgagct gcggcatgtc gttcaattgc tcagacacgc    165780
     ttgccctccg catcgatcac gacttcgcca tcttccttgg tgaaaggccc cgtctgcggg    165840
     ttcggcagga tatccagcac ggcttcggac ggccggcata gcttcgtgcc gatcggcgta    165900
     accacgatcg gccggttcat caggatcgga tgctgcccga tgaagtcgag cagttgctca    165960
     tcggtccact tcggatcgcc cagaccgagt tccgcataag gcgtgccttt ctcccgcagt    166020
     aactcgcgta cggtcaggcc ggcatcggcc agcagcttga ccagcgtttc ccgcgacggg    166080
     ggcgtcctga gatactcgat gacgacaggc tcctcgccgc tgttgcggat cagggccagc    166140
     gcgttgcgcg acgtgccgca atccgggttg tgatagatcg tgatgttgct catgtcgaga    166200
     ttccttgctt cgatagaggg acagcgtgat ggcgcaaatg caagatcgcg tagcggaaca    166260
     ggatcgcacc tgtcgcgccg atgccggcca gggccaatag cgtgccggga tagccgttcc    166320
     cggcgacata caggagtgat gcaacgaacg gaccggcggc gatggcaatc tgcacgggcg    166380
     tcgccatcgc cccgctgatc gcgccatagg cggttcgccc gtacagttcc gcaggcaatg    166440
     caccgcggac aatcgtcatg acgccgttgc cgatgccata cagcgccgcg aaaacaacgt    166500
     acacgggcag ccacgtcccg gacgcaaaga gcaggaccag cgaaagcggc agcaacgcca    166560
     tcgcggccat gccgacctgg cgcgtgctcg cgcgtttgcc gatcgtcgtt tccagcacgc    166620
     ggccgagaac ctgcatcggc ccaaccagcg cccccaccca tgccgcgttc gcggcggaaa    166680
     tgccatgcgc ctgcaagacc gcgatcatgt gcagcgacat cgcggcgaac accagcgcat    166740
     tgagcgtgac cgccgcggtc accagataga aggccgggtc gcgcaggaca gcgccaaggt    166800
     tagcggccgg ctgttccgtt tgcgttggcg tcacgccatg cggtgcgtgt gaacgacttg    166860
     gcagcgcgac atgcacgggc acgcagatcg ccagattcgc gccggcatag agctgccatg    166920
     tgtcgcgcca tccgacgtgc tgcaacagcg tttgcgtcag cggccagaac accgtgctgg    166980
     cgaaaccgcc gaacaaggtc aggtgcgtga tcgcgcggcg gtagtcgtta ccgaatatct    167040
     gcgtgatgac ggtgaacgca ggctggtaga gagttgcgct catcgcaacg ccgatgccgg    167100
     cccacacgag atacagcccg accacgttat tcacccgtga caagcagaca agcatcagcg    167160
     ccgccagcaa cgatccgccc gccatcaggg cgcgcccgcc gacgcggtcg atgatgctgc    167220
     cggccgacgt ggacaacagc cccgagatca gcagcgccac cgaataggcg ccgacgacga    167280
     ctggcttcga cagacccagc tcgtcctgca tcggttgcat caggacgccg tacgcgtaaa    167340
     acatggaacc ccagccgacg atctgcgtca gcccgagcga cggcgtcagc catgcgtgcg    167400
     ggcggggtgc atgcgtggac at                                             167422
//

If you have problems or comments...

PBIL Back to PBIL home page