(data stored in SCRATCH3701 zone)

EMBL: CP000872

ID   CP000872; SV 1; circular; genomic DNA; STD; PRO; 2105969 BP.
XX
AC   CP000872;
XX
PR   Project:PRJNA20243;
XX
DT   01-DEC-2007 (Rel. 94, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Brucella canis ATCC 23365 chromosome I, complete sequence.
XX
KW   .
XX
OS   Brucella canis ATCC 23365
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae;
OC   Brucella.
XX
RN   [1]
RP   1-2105969
RA   Setubal J.C., Bowns C., Boyle S., Crasta O.R., Czar M.J., Dharmanolla C.,
RA   Gillespie J.J., Kenyon R.W., Lu J., Mane S., Mohapatra S., Nagrani S.,
RA   Purkayastha A., Rajasimha H.K., Shallom J.M., Shallom S., Shukla M.,
RA   Snyder E.E., Sobral B.W., Wattam A.R., Will R., Williams K., Yoo H.,
RA   Bruce D., Detter C., Munk C., Brettin T.S.;
RT   "Brucella canis ATCC 23365 whole genome shotgun sequencing project";
RL   Unpublished.
XX
RN   [2]
RP   1-2105969
RA   Setubal J.C., Bowns C., Boyle S., Crasta O.R., Czar M.J., Dharmanolla C.,
RA   Gillespie J.J., Kenyon R.W., Lu J., Mane S., Mohapatra S., Nagrani S.,
RA   Purkayastha A., Rajasimha H.K., Shallom J.M., Shallom S., Shukla M.,
RA   Snyder E.E., Sobral B.W., Wattam A.R., Will R., Williams K., Yoo H.,
RA   Bruce D., Detter C., Munk C., Brettin T.S.;
RT   ;
RL   Submitted (16-OCT-2007) to the INSDC.
RL   The Pathosystems Resource Integration Center (PATRIC), Virginia
RL   Bioinformatics Institute at Virginia Polytechnic Institute and State
RL   University, Bioinformatics I, Washington Street, Blacksburg, VA 24061, USA
XX
DR   MD5; 4d2b2d0881599dcd460aa9a3634dcef8.
DR   BioSample; SAMN02604295.
DR   EnsemblGenomes-Gn; BCAN_A0024.
DR   EnsemblGenomes-Gn; BCAN_A0036.
DR   EnsemblGenomes-Gn; BCAN_A0200.
DR   EnsemblGenomes-Gn; BCAN_A0250.
DR   EnsemblGenomes-Gn; BCAN_A0260.
DR   EnsemblGenomes-Gn; BCAN_A0277.
DR   EnsemblGenomes-Gn; BCAN_A0521.
DR   EnsemblGenomes-Gn; BCAN_A0652.
DR   EnsemblGenomes-Gn; BCAN_A0734.
DR   EnsemblGenomes-Gn; BCAN_A0736.
DR   EnsemblGenomes-Gn; BCAN_A0793.
DR   EnsemblGenomes-Gn; BCAN_A0813.
DR   EnsemblGenomes-Gn; BCAN_A0815.
DR   EnsemblGenomes-Gn; BCAN_A0912.
DR   EnsemblGenomes-Gn; BCAN_A0948.
DR   EnsemblGenomes-Gn; BCAN_A0975.
DR   EnsemblGenomes-Gn; BCAN_A0976.
DR   EnsemblGenomes-Gn; BCAN_A0979.
DR   EnsemblGenomes-Gn; BCAN_A1065.
DR   EnsemblGenomes-Gn; BCAN_A1094.
DR   EnsemblGenomes-Gn; BCAN_A1101.
DR   EnsemblGenomes-Gn; BCAN_A1273.
DR   EnsemblGenomes-Gn; BCAN_A1276.
DR   EnsemblGenomes-Gn; BCAN_A1277.
DR   EnsemblGenomes-Gn; BCAN_A1301.
DR   EnsemblGenomes-Gn; BCAN_A1302.
DR   EnsemblGenomes-Gn; BCAN_A1363.
DR   EnsemblGenomes-Gn; BCAN_A1475.
DR   EnsemblGenomes-Gn; BCAN_A1511.
DR   EnsemblGenomes-Gn; BCAN_A1639.
DR   EnsemblGenomes-Gn; BCAN_A1642.
DR   EnsemblGenomes-Gn; BCAN_A1654.
DR   EnsemblGenomes-Gn; BCAN_A1674.
DR   EnsemblGenomes-Gn; BCAN_A1675.
DR   EnsemblGenomes-Gn; BCAN_A1677.
DR   EnsemblGenomes-Gn; BCAN_A1679.
DR   EnsemblGenomes-Gn; BCAN_A1680.
DR   EnsemblGenomes-Gn; BCAN_A1681.
DR   EnsemblGenomes-Gn; BCAN_A1695.
DR   EnsemblGenomes-Gn; BCAN_A1889.
DR   EnsemblGenomes-Gn; BCAN_A1899.
DR   EnsemblGenomes-Gn; BCAN_A1900.
DR   EnsemblGenomes-Gn; BCAN_A1902.
DR   EnsemblGenomes-Gn; BCAN_A1903.
DR   EnsemblGenomes-Gn; BCAN_A1904.
DR   EnsemblGenomes-Gn; BCAN_A1905.
DR   EnsemblGenomes-Gn; BCAN_A1994.
DR   EnsemblGenomes-Gn; BCAN_A2037.
DR   EnsemblGenomes-Gn; BCAN_A2085.
DR   EnsemblGenomes-Gn; EBG00000627674.
DR   EnsemblGenomes-Gn; EBG00000627675.
DR   EnsemblGenomes-Gn; EBG00001170656.
DR   EnsemblGenomes-Gn; EBG00001170657.
DR   EnsemblGenomes-Gn; EBG00001170658.
DR   EnsemblGenomes-Gn; EBG00001170659.
DR   EnsemblGenomes-Gn; EBG00001170660.
DR   EnsemblGenomes-Gn; EBG00001170661.
DR   EnsemblGenomes-Gn; EBG00001170662.
DR   EnsemblGenomes-Gn; EBG00001170663.
DR   EnsemblGenomes-Gn; EBG00001170664.
DR   EnsemblGenomes-Gn; EBG00001170665.
DR   EnsemblGenomes-Gn; EBG00001170666.
DR   EnsemblGenomes-Gn; EBG00001170667.
DR   EnsemblGenomes-Gn; EBG00001170668.
DR   EnsemblGenomes-Gn; EBG00001170669.
DR   EnsemblGenomes-Gn; EBG00001170670.
DR   EnsemblGenomes-Gn; EBG00001170671.
DR   EnsemblGenomes-Gn; EBG00001170672.
DR   EnsemblGenomes-Gn; EBG00001170673.
DR   EnsemblGenomes-Gn; EBG00001170674.
DR   EnsemblGenomes-Gn; EBG00001170675.
DR   EnsemblGenomes-Gn; EBG00001170676.
DR   EnsemblGenomes-Gn; EBG00001170677.
DR   EnsemblGenomes-Gn; EBG00001170678.
DR   EnsemblGenomes-Gn; EBG00001170679.
DR   EnsemblGenomes-Gn; EBG00001170680.
DR   EnsemblGenomes-Gn; EBG00001170681.
DR   EnsemblGenomes-Gn; EBG00001170682.
DR   EnsemblGenomes-Gn; EBG00001170683.
DR   EnsemblGenomes-Gn; EBG00001170684.
DR   EnsemblGenomes-Gn; EBG00001170685.
DR   EnsemblGenomes-Gn; EBG00001170686.
DR   EnsemblGenomes-Gn; EBG00001170687.
DR   EnsemblGenomes-Gn; EBG00001170688.
DR   EnsemblGenomes-Gn; EBG00001170689.
DR   EnsemblGenomes-Gn; EBG00001170690.
DR   EnsemblGenomes-Gn; EBG00001170691.
DR   EnsemblGenomes-Gn; EBG00001170692.
DR   EnsemblGenomes-Gn; EBG00001170693.
DR   EnsemblGenomes-Gn; EBG00001170694.
DR   EnsemblGenomes-Gn; EBG00001170695.
DR   EnsemblGenomes-Gn; EBG00001170696.
DR   EnsemblGenomes-Gn; EBG00001170697.
DR   EnsemblGenomes-Gn; EBG00001170698.
DR   EnsemblGenomes-Gn; EBG00001170699.
DR   EnsemblGenomes-Gn; EBG00001170700.
DR   EnsemblGenomes-Gn; EBG00001170701.
DR   EnsemblGenomes-Gn; EBG00001170702.
DR   EnsemblGenomes-Gn; EBG00001170703.
DR   EnsemblGenomes-Gn; EBG00001170704.
DR   EnsemblGenomes-Gn; EBG00001170705.
DR   EnsemblGenomes-Gn; EBG00001170706.
DR   EnsemblGenomes-Gn; EBG00001170707.
DR   EnsemblGenomes-Gn; EBG00001170708.
DR   EnsemblGenomes-Gn; EBG00001170709.
DR   EnsemblGenomes-Gn; EBG00001170710.
DR   EnsemblGenomes-Gn; EBG00001170711.
DR   EnsemblGenomes-Gn; EBG00001170712.
DR   EnsemblGenomes-Gn; EBG00001170713.
DR   EnsemblGenomes-Gn; EBG00001170714.
DR   EnsemblGenomes-Gn; EBG00001170715.
DR   EnsemblGenomes-Gn; EBG00001170716.
DR   EnsemblGenomes-Gn; EBG00001170717.
DR   EnsemblGenomes-Gn; EBG00001170718.
DR   EnsemblGenomes-Gn; EBG00001170719.
DR   EnsemblGenomes-Gn; EBG00001170720.
DR   EnsemblGenomes-Gn; EBG00001170721.
DR   EnsemblGenomes-Tr; BCAN_A0024-1.
DR   EnsemblGenomes-Tr; BCAN_A0036-1.
DR   EnsemblGenomes-Tr; BCAN_A0200-1.
DR   EnsemblGenomes-Tr; BCAN_A0250-1.
DR   EnsemblGenomes-Tr; BCAN_A0260-1.
DR   EnsemblGenomes-Tr; BCAN_A0277-1.
DR   EnsemblGenomes-Tr; BCAN_A0521-1.
DR   EnsemblGenomes-Tr; BCAN_A0652-1.
DR   EnsemblGenomes-Tr; BCAN_A0734-1.
DR   EnsemblGenomes-Tr; BCAN_A0736-1.
DR   EnsemblGenomes-Tr; BCAN_A0793-1.
DR   EnsemblGenomes-Tr; BCAN_A0813-1.
DR   EnsemblGenomes-Tr; BCAN_A0815-1.
DR   EnsemblGenomes-Tr; BCAN_A0912-1.
DR   EnsemblGenomes-Tr; BCAN_A0948-1.
DR   EnsemblGenomes-Tr; BCAN_A0975-1.
DR   EnsemblGenomes-Tr; BCAN_A0976-1.
DR   EnsemblGenomes-Tr; BCAN_A0979-1.
DR   EnsemblGenomes-Tr; BCAN_A1065-1.
DR   EnsemblGenomes-Tr; BCAN_A1094-1.
DR   EnsemblGenomes-Tr; BCAN_A1101-1.
DR   EnsemblGenomes-Tr; BCAN_A1273-1.
DR   EnsemblGenomes-Tr; BCAN_A1276-1.
DR   EnsemblGenomes-Tr; BCAN_A1277-1.
DR   EnsemblGenomes-Tr; BCAN_A1301-1.
DR   EnsemblGenomes-Tr; BCAN_A1302-1.
DR   EnsemblGenomes-Tr; BCAN_A1363-1.
DR   EnsemblGenomes-Tr; BCAN_A1475-1.
DR   EnsemblGenomes-Tr; BCAN_A1511-1.
DR   EnsemblGenomes-Tr; BCAN_A1639-1.
DR   EnsemblGenomes-Tr; BCAN_A1642-1.
DR   EnsemblGenomes-Tr; BCAN_A1654-1.
DR   EnsemblGenomes-Tr; BCAN_A1674-1.
DR   EnsemblGenomes-Tr; BCAN_A1675-1.
DR   EnsemblGenomes-Tr; BCAN_A1677-1.
DR   EnsemblGenomes-Tr; BCAN_A1679-1.
DR   EnsemblGenomes-Tr; BCAN_A1680-1.
DR   EnsemblGenomes-Tr; BCAN_A1681-1.
DR   EnsemblGenomes-Tr; BCAN_A1695-1.
DR   EnsemblGenomes-Tr; BCAN_A1889-1.
DR   EnsemblGenomes-Tr; BCAN_A1899-1.
DR   EnsemblGenomes-Tr; BCAN_A1900-1.
DR   EnsemblGenomes-Tr; BCAN_A1902-1.
DR   EnsemblGenomes-Tr; BCAN_A1903-1.
DR   EnsemblGenomes-Tr; BCAN_A1904-1.
DR   EnsemblGenomes-Tr; BCAN_A1905-1.
DR   EnsemblGenomes-Tr; BCAN_A1994-1.
DR   EnsemblGenomes-Tr; BCAN_A2037-1.
DR   EnsemblGenomes-Tr; BCAN_A2085-1.
DR   EnsemblGenomes-Tr; EBG00000627674-1.
DR   EnsemblGenomes-Tr; EBG00000627675-1.
DR   EnsemblGenomes-Tr; EBT00001737319.
DR   EnsemblGenomes-Tr; EBT00001737323.
DR   EnsemblGenomes-Tr; EBT00001737329.
DR   EnsemblGenomes-Tr; EBT00001737332.
DR   EnsemblGenomes-Tr; EBT00001737337.
DR   EnsemblGenomes-Tr; EBT00001737342.
DR   EnsemblGenomes-Tr; EBT00001737343.
DR   EnsemblGenomes-Tr; EBT00001737348.
DR   EnsemblGenomes-Tr; EBT00001737350.
DR   EnsemblGenomes-Tr; EBT00001737354.
DR   EnsemblGenomes-Tr; EBT00001737355.
DR   EnsemblGenomes-Tr; EBT00001737357.
DR   EnsemblGenomes-Tr; EBT00001737360.
DR   EnsemblGenomes-Tr; EBT00001737361.
DR   EnsemblGenomes-Tr; EBT00001737363.
DR   EnsemblGenomes-Tr; EBT00001737365.
DR   EnsemblGenomes-Tr; EBT00001737367.
DR   EnsemblGenomes-Tr; EBT00001737369.
DR   EnsemblGenomes-Tr; EBT00001737371.
DR   EnsemblGenomes-Tr; EBT00001737375.
DR   EnsemblGenomes-Tr; EBT00001737378.
DR   EnsemblGenomes-Tr; EBT00001737380.
DR   EnsemblGenomes-Tr; EBT00001737382.
DR   EnsemblGenomes-Tr; EBT00001737385.
DR   EnsemblGenomes-Tr; EBT00001737391.
DR   EnsemblGenomes-Tr; EBT00001737395.
DR   EnsemblGenomes-Tr; EBT00001737401.
DR   EnsemblGenomes-Tr; EBT00001737402.
DR   EnsemblGenomes-Tr; EBT00001737404.
DR   EnsemblGenomes-Tr; EBT00001737406.
DR   EnsemblGenomes-Tr; EBT00001737409.
DR   EnsemblGenomes-Tr; EBT00001737410.
DR   EnsemblGenomes-Tr; EBT00001737414.
DR   EnsemblGenomes-Tr; EBT00001737416.
DR   EnsemblGenomes-Tr; EBT00001737420.
DR   EnsemblGenomes-Tr; EBT00001737423.
DR   EnsemblGenomes-Tr; EBT00001737428.
DR   EnsemblGenomes-Tr; EBT00001737432.
DR   EnsemblGenomes-Tr; EBT00001737435.
DR   EnsemblGenomes-Tr; EBT00001737440.
DR   EnsemblGenomes-Tr; EBT00001737442.
DR   EnsemblGenomes-Tr; EBT00001737447.
DR   EnsemblGenomes-Tr; EBT00001737452.
DR   EnsemblGenomes-Tr; EBT00001737453.
DR   EnsemblGenomes-Tr; EBT00001737454.
DR   EnsemblGenomes-Tr; EBT00001737459.
DR   EnsemblGenomes-Tr; EBT00001737463.
DR   EnsemblGenomes-Tr; EBT00001737467.
DR   EnsemblGenomes-Tr; EBT00001737470.
DR   EnsemblGenomes-Tr; EBT00001737473.
DR   EnsemblGenomes-Tr; EBT00001737476.
DR   EnsemblGenomes-Tr; EBT00001737480.
DR   EnsemblGenomes-Tr; EBT00001737483.
DR   EnsemblGenomes-Tr; EBT00001737488.
DR   EnsemblGenomes-Tr; EBT00001737491.
DR   EnsemblGenomes-Tr; EBT00001737492.
DR   EnsemblGenomes-Tr; EBT00001737493.
DR   EnsemblGenomes-Tr; EBT00001737494.
DR   EnsemblGenomes-Tr; EBT00001737495.
DR   EnsemblGenomes-Tr; EBT00001737496.
DR   EnsemblGenomes-Tr; EBT00001737497.
DR   EnsemblGenomes-Tr; EBT00001737498.
DR   EnsemblGenomes-Tr; EBT00001737499.
DR   EnsemblGenomes-Tr; EBT00001737500.
DR   EnsemblGenomes-Tr; EBT00001737501.
DR   EnsemblGenomes-Tr; EBT00001737502.
DR   EuropePMC; PMC2698832; 19439075.
DR   EuropePMC; PMC2953035; 20802081.
DR   EuropePMC; PMC3430308; 22933762.
DR   EuropePMC; PMC4176087; 24176078.
DR   EuropePMC; PMC5323635; 28232424.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000872.
DR   SILVA-SSU; CP000872.
DR   StrainInfo; 102640; 1.
XX
CC   Draft sequencing of Brucella canis ATCC 23365 was performed at the
CC   Joint Genome Institute (JGI) production genomics facility in Walnut
CC   Creek, CA using a combination of 3 kb and 8 kb DNA libraries. Two
CC   rounds of genome finishing were performed by the JGI at Los Alamos
CC   National Laboratory, Los Alamos, NM. The completed genome sequences
CC   of Brucella canis ATCC 23365 contain 40301 reads, achieving an
CC   average of 10-fold sequence coverage per base with an error rate
CC   less than 1 in 100,000. Annotation and database submission were
CC   carried out by the Pathosystems Resource Integration Center,
CC   Blacksburg, VA (PATRIC http://patric.vbi.vt.edu), a Bioinformatics
CC   Resource Center supported by the NIH/NIAID.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2105969
FT                   /organism="Brucella canis ATCC 23365"
FT                   /chromosome="I"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:483179"
FT                   /culture_collection="ATCC:23365"
FT   gene            634..2274
FT                   /gene="dnaA"
FT                   /locus_tag="BCAN_A0001"
FT   CDS_pept        634..2274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BCAN_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006270 - DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61108"
FT                   /db_xref="GOA:A9M6A7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6A7"
FT                   /protein_id="ABX61108.1"
FT                   /translation="MTSSRTMARTNVKAGETMAMMTGKSTATIGDNAHANRIHGSSATG
FT                   NDKSLMKMDSAVSEEAFERLTAKLKARVGGEIYSSWFGRLKLDDISKSIVRLSVPTAFL
FT                   RSWINNHYSELLTELWQEENPQILKVEVVVRGVSRVVRSAAPAETCDNAEAKPAVTPRE
FT                   KMVFPVGQSFGGQSLGEKRGSAVVAESAAATDAVLGSPLDPRYTFDTFVDGASNRVALA
FT                   AARTIAEAGSSAVRFNPLFIHASVGLGKTHLLQAIAAAALQRQEKARVVYLTAEYFMWR
FT                   FATAIRDNNALSFKEQLRDIDLLVIDDMQFLQGKSIQHEFCHLLNTLLDSAKQVVVAAD
FT                   RAPSELESLDVRVRSRLQGGVALEVAAPDYEMRLEMLRRRLASAQCEDASLDIGEEILA
FT                   HVARTVTGSGRELEGAFNQLLFRQSFEPNISIDRVDELLGHLTRAGEPKRIRIEEIQRI
FT                   VARHYNVSKQDLLSNRRTRTIVKPRQVAMYLAKMMTPRSLPEIGRRFGGRDHTTVLHAV
FT                   RKIEDLVGADTKLAQELELLKRLINDQAA"
FT   gene            2503..3696
FT                   /gene="dnaN"
FT                   /locus_tag="BCAN_A0002"
FT   CDS_pept        2503..3696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BCAN_A0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="GO_component: GO:0009360 - DNA polymerase III
FT                   complex; GO_function: GO:0003887 - DNA-directed DNA
FT                   polymerase activity; GO_process: GO:0006260 - DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61109"
FT                   /db_xref="GOA:A9M6A8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6A8"
FT                   /protein_id="ABX61109.1"
FT                   /translation="MRLIDKGRLPLGCSRPGPSERVRFKMRVTLERSNLLKSLNHVHRV
FT                   VERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAMVEQAGATTVPAHLLYDIIR
FT                   KLPDGAEVMLSTNPDGGSMSVISGKSSFRLQCLPQSDFPELTAGAFTHSFRIEAQALKR
FT                   LIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDGHRLARAELEAPSGTEGMP
FT                   GIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQRVIPS
FT                   GNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAAD
FT                   YDGDPLDIGFNSKYLLDITGQLSGTDAVFMLADAGSPTLVRDTGDEDVLYVLMPMRV"
FT   gene            3878..5032
FT                   /gene="recF"
FT                   /locus_tag="BCAN_A0003"
FT   CDS_pept        3878..5032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BCAN_A0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61110"
FT                   /db_xref="GOA:A9M6A9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6A9"
FT                   /protein_id="ABX61110.1"
FT                   /translation="MEAKDHIERRPDRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGEN
FT                   GSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEGGFAIHAALDCMIYGDAEIGTGTAG
FT                   GGEGGRKVRINGIAASADDLLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAH
FT                   GKRVLDYEKAMRSRNRLLNDGSNDDQWLDAIENQMAELGTAIAAARAQAMRLIAAMIER
FT                   LPAEGPFPKADCFLEGALESRIGVEAALDLEEDFRRTLRDGRARDRAAGRTLDGPHRTD
FT                   LIVQHRPKSMPAALCSTGEQKALLIGLILAHARLTAELSGMAPILLLDEIAAHLDMGRR
FT                   AALFGILDELGGQAFMTGTDRALFDALAGDAQFFNVSAGQLTGI"
FT   gene            5070..5852
FT                   /locus_tag="BCAN_A0004"
FT   CDS_pept        5070..5852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0004"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61111"
FT                   /db_xref="GOA:A9M6B0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B0"
FT                   /protein_id="ABX61111.1"
FT                   /translation="MFAGMNASSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVV
FT                   GAGGLGAPALQYLAAAGVGTLGIVDDDTVSLSNLQRQIIHDTDSIGQPKVESALASIAR
FT                   INPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTGAMG
FT                   RFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPLPGTVPSCAEAGVLGVLPGVIGSLQAM
FT                   EVIKLVTGIGEPLVGRLLLYNALNVRFETIRYKARKPK"
FT   gene            complement(5869..6825)
FT                   /locus_tag="BCAN_A0005"
FT   CDS_pept        complement(5869..6825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0005"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="GO_function: GO:0016616 - oxidoreductase activity,
FT                   acting on the CH-OH group of donors, NAD or NADP as
FT                   acceptor; GO_process: GO:0006564 - L-serine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61112"
FT                   /db_xref="GOA:A9M6B1"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B1"
FT                   /protein_id="ABX61112.1"
FT                   /translation="MSDTKGNILLATTDWDPEIWLKTFKESASNRKVVTERAENDPSIE
FT                   YALVWKQKPGSLANLPNLKVIFSLGAGVDHVFRDPQVPDVPLARIISDDLTMRMTEYVV
FT                   WQVLDHHRLGSRYRKQQQNHVWHEDRRQPAAHEVTVGIMGLGVLGRDAAEKLKILGFNI
FT                   TGWSRRPQKIDGVKTYHGGDGFTEFLKTADIFVCLLPLTPDTKGILSMSMFAQLKSDGP
FT                   LGEPVLINAGRGSLQNEPDILAALDRGLLSAVTLDVFNQEPLPANSPLWDHPKVTITPH
FT                   VAAISSATVLVPQIIRQIEAFERDGTLEHVVDRSTQY"
FT   gene            complement(6822..8447)
FT                   /locus_tag="BCAN_A0006"
FT   CDS_pept        complement(6822..8447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0006"
FT                   /product="ABC transporter related"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61113"
FT                   /db_xref="GOA:A9M6B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B2"
FT                   /protein_id="ABX61113.1"
FT                   /translation="MNNVLLSVRDLSVAFHQDGEDRIAVNRISFDIAEGETVALVGESG
FT                   SGKSVSALSVLKLLPYPAASHPSGEILFNGTDLMRASEPELRRVRGNDITMIFQEPMTS
FT                   LNPLHTIERQVSEILRVHQGMGEQAARARTLQLLHEVGIREPEKRLNAFPHQLSGGQRQ
FT                   RVMIAMALANKPKLLIADEPTTALDVTVQAQILNLLAELKAAQGMSMLFITHDLGIVRK
FT                   IADKVCVMNKGEIVEAGRTRDIFDNPQHPYTKHLLAAEPKGEPPLADPTAKVVMEGKDI
FT                   RVWFPIKKGFMRRTVDHVKAVDGINVNLRAGQTLGVVGESGSGKTTLGLALSRMISSRG
FT                   EIRFEGRDIARFSFKDMRPLRREMQIVFQDPFGSLSPRMTIADIIAEGLLVHEPRLSAD
FT                   DRDARVIAALNEVNLDPETRFRYPHEFSGGQRQRIAIARAMVLNPKFVMLDEPTSALDM
FT                   SVQAQVVDLLRALQKKHDLAYLFISHDLKVVRALANDVLVMRNGKMVEYGPAKDIFANP
FT                   QTDYTKALMAAAFHMETREGGIKQ"
FT   gene            complement(8471..9610)
FT                   /locus_tag="BCAN_A0007"
FT   CDS_pept        complement(8471..9610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0007"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61114"
FT                   /db_xref="GOA:A9M6B3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B3"
FT                   /protein_id="ABX61114.1"
FT                   /translation="MTDTALTPAAKPVKRPWLSPLNKRRWQNFKAHRRGYWSLWIFLFL
FT                   LAAALCSEFIANDRPILVSYKGELLMPVFVDYPEDKFGGFYAITDYRDPVIQDEINAHG
FT                   WAIWPPVRYSYNTVNNEIPEAAPSKPFWLYSPQVRCQRYPLGINDPNCRFGNFNLLGTD
FT                   DQARDVFARALYGFRISVLFGLILTFFSAIIGVTAGAVQGYFGGWVDLLFQRFIEIWSS
FT                   IPVLYLLLIIAAILPPGFWVLLGIMLLFSWVAFVGVVRAEFLRARNFEYVNAARALGVK
FT                   NGTIMWRHLLPNAMVATLTFLPFILNGSITTLTSLDFLGFGLPPGSASLGELLAQGKNN
FT                   LQAPWLGITGFVVISAMLSLLIFIGEATRDAFDPRKAFL"
FT   gene            complement(9610..10707)
FT                   /locus_tag="BCAN_A0008"
FT   CDS_pept        complement(9610..10707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0008"
FT                   /product="Hypothetical protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61115"
FT                   /db_xref="GOA:A9M6B4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B4"
FT                   /protein_id="ABX61115.1"
FT                   /translation="MGAYILRRLLLMIPTLLGIMAISFAVVQFAPGGPVERVIAQLSGQ
FT                   GGDALDRLSGAGSDFGQSAIDSGSVSSKYRGAQGLDPQFIADLEKQFGFDKPPLERFGQ
FT                   MLWNYMRFDFGRSYFRDISVIDLIKEKMPVSISLGLWLTFLSYMISIPLGIRKAIKDGS
FT                   RFDTWTSAVIIIGYAIPSFLFAILLIVVFAGGSFFDWFPLRGLTSPDFAQMTWFEKIKD
FT                   YLWHMVLPVTALVLSAFATTTLLTKNSFLEEIRKQYVTTARAKGLTENQVLYRHVFRNA
FT                   MLIVIAGFPGAFISAFFTGSLLIETIFSLDGLGLLGYQSVINRDYPVVFANLFIFSLIG
FT                   LLVGLLSDLTYTWIDPRIDFDRRDV"
FT   gene            complement(10819..12666)
FT                   /locus_tag="BCAN_A0009"
FT   CDS_pept        complement(10819..12666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0009"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61116"
FT                   /db_xref="GOA:A9M6B5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6B5"
FT                   /protein_id="ABX61116.1"
FT                   /translation="MTFLCMNRRHFMGLSGSAALVACLPGQAFADQPTGKALHGLSAFG
FT                   DLKYGPDFSHFDYANPDAPKGGCFTLAPSGWIWNQNTLTFNTLNTLTLKGDAPPRMELT
FT                   FDSLMVSALDEPDSVYGLIAESVTLSKDRKTCTFKLRKEARFHDGSPIEASDVAFTYKT
FT                   FKEKGHPTLRQSLAGLQKVEATAKHEVQMHFAAGRGPNAILDAVTLPIISEKWFKGRNF
FT                   EATSMEPVLGSGAYKVGNFSAGHFIEYDRVEDYWAKDLPVQKGSNHFDRIRIEFFHDRQ
FT                   PAFEAFKKGSIDFREENVAKNWATAYDFPAIHQKKVIRRTFPREKRPLMQAWAVNQRRE
FT                   RFRDPRVREAIGLCFDFEWSNKNLFYEAYTRSQSCFNGSDFQANGLPSPDEMKILARYR
FT                   GKLPEAVFGEAVLVPVSDGTGRDRKQLTQAIKLMEEAGFERRHGHFHDHDGSNFALEIL
FT                   CNSEAVTRIYNPFAQKLRAIGIDTSLRLVDASQYQARLQDFQFDMVGVALQFSATPTKE
FT                   SLAGIFGSDSAKIPGSHNLPGTNDPLIDALIEDAGKAESREELVATLRVLDRYLRIRRD
FT                   WIPNWTAANHFVAYWDRFGFKEPKPDYGFPVETLWWIKA"
FT   gene            complement(12680..14548)
FT                   /locus_tag="BCAN_A0010"
FT   CDS_pept        complement(12680..14548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0010"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61117"
FT                   /db_xref="GOA:A9M6L6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6L6"
FT                   /protein_id="ABX61117.1"
FT                   /translation="MKAFWVSAFAVAMLASAMPASRADNAEPQWRYSSSLLDEPKYPAD
FT                   FKHYDYVNPDAPKGGTLNLVAVGTFDNLNPYVVQGVSAAGLSDFGGGMLYDTLMADSQD
FT                   QGSTQYPLIASALQYPDDFSWVKFKLNPDAKWHDGQPITVDDVIWSFNVLKKQSPMYNK
FT                   YYSDVESAEKTGEHEVKFTFSRKGNRELPQIMGQLAILPKHWWTAKDARGKQRDITRPT
FT                   LEIPLGSSAYKIESMKPGHSIIWARVEDYWGKDLPVNVGRNNFDHVAYEYYFNEDATWE
FT                   AFKKGGQYDYRNENRAQRWAEQYNFPAVQRGDVVKASFPFHAVGRMQGYFLNTRRDKFK
FT                   DPKVREALTYAFDFESMNRLMFYNQYKRINSYFAGNELALSGPPTPAEQAILETVKDAL
FT                   PADALTKEFKLPVYDTPQATRENLRTALKLFSQAGWTLKGNTLVDAKGNPFTIEFLGQD
FT                   PTDERIYNPFAASLRKIGINATVRIVDAAQYQARVNDFDYDVITAVIAQTASPGNEQRD
FT                   MWGSKAADFKGSRNYAGIRNPAIDKLIDLVVYAKDHEELEAAAHALDRALLWNYYVIPQ
FT                   WYSDHINVAYWNKFGMPEKQPDYLGIDPYSWWIDPAKEAKLKTGGA"
FT   gene            complement(14779..15102)
FT                   /locus_tag="BCAN_A0011"
FT   CDS_pept        complement(14779..15102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0011"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61118"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6L7"
FT                   /protein_id="ABX61118.1"
FT                   /translation="MLEFLRQSPKGGATETVSASTILLLLRSSGQFGATELFGICHISE
FT                   MQRSYLGQQIGIYSRFHLEFSLEGSDHGCTGATRVKAEGRVAPRPFSFSERASFTAGIF
FT                   SPA"
FT   gene            complement(15148..15348)
FT                   /locus_tag="BCAN_A0012"
FT   CDS_pept        complement(15148..15348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0012"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61119"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6L8"
FT                   /protein_id="ABX61119.1"
FT                   /translation="MQRYRFDDKRILTEAIVELLNQGIELEDLDLVLSRIGPVDLDLMQ
FT                   ECLIEVWNYNHPELAATQMAA"
FT   gene            complement(15388..15546)
FT                   /locus_tag="BCAN_A0013"
FT   CDS_pept        complement(15388..15546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0013"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61120"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6L9"
FT                   /protein_id="ABX61120.1"
FT                   /translation="MKSRILLLLHKYFTFILGALPKMFNLDFSYFQMVRAKPHRLSRLK
FT                   LRLTMID"
FT   gene            complement(16003..17109)
FT                   /gene="livJ"
FT                   /locus_tag="BCAN_A0014"
FT   CDS_pept        complement(16003..17109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ"
FT                   /locus_tag="BCAN_A0014"
FT                   /product="Leu/Ile/Val-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61121"
FT                   /db_xref="GOA:A9M6M0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M0"
FT                   /protein_id="ABX61121.1"
FT                   /translation="MNLKLLSSLAFAATIGFASAAYADITIGVIAPLTGPVAAFGDQVK
FT                   KGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGPVTTGVA
FT                   VPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDDQQAEVMADYVLKNMKDKKV
FT                   AVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFG
FT                   GYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAK
FT                   DAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGT
FT                   LTYSETGDLSSPSFDIFKWDDGKIVGLE"
FT   gene            17381..17581
FT                   /locus_tag="BCAN_A0015"
FT   CDS_pept        17381..17581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0015"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61122"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M1"
FT                   /protein_id="ABX61122.1"
FT                   /translation="MQAPSTRNYNENRLLPKSESLFQKPPCRSANGAFQRSGAHVRSVH
FT                   SAPVLENHHFRLGLPLFDSDS"
FT   gene            complement(17578..18372)
FT                   /locus_tag="BCAN_A0016"
FT   CDS_pept        complement(17578..18372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0016"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61123"
FT                   /db_xref="GOA:A9M6M2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M2"
FT                   /protein_id="ABX61123.1"
FT                   /translation="MNDFETLHIAVDQRGVARLTLNRPEQHNALSGRMIDELTTAALHL
FT                   ADNEAVRIVILTGAGTSFCAGGDLGWMREQVNATRAQRIEEARKLALMLKALRDLPKPL
FT                   IGRINGQAYGGGVGLISVCDAAISISGARFSLTETKLGLIPATISPYVVARIGEANALR
FT                   TFTSARLFDAEEGRRIGLLHDVVEAERLDAAVEAEIKPYFSTAPAAVAASKRLVHALGA
FT                   PIDEAVIDMTLTRLADTWETPEAAEGIAAFFAKRAPAWKGGD"
FT   gene            complement(18369..19231)
FT                   /pseudo
FT                   /locus_tag="BCAN_A0017"
FT                   /note="Hydroxymethylglutaryl-CoA lyase"
FT   gene            complement(19224..21245)
FT                   /locus_tag="BCAN_A0018"
FT   CDS_pept        complement(19224..21245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0018"
FT                   /product="Methylcrotonyl-CoA carboxylase"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61124"
FT                   /db_xref="GOA:A9M6M3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M3"
FT                   /protein_id="ABX61124.1"
FT                   /translation="MRKSVKRFSARIPRGKNAMFQKILIANRGEIACRVIRTACKLGIA
FT                   TVAIYSDADARALHVEMADEAVRVGPAASAQSYLNVDAIIKAAKETGAEAIHPGYGFLS
FT                   ENPAFVDAVEEAGLIFIGPSAKAIRAMGLKDAAKALMEKAGVPVVPGYHGDNQDGAFLK
FT                   SEADRITYPVLIKARAGGGGKGMCRVDSAADFAAALESARREAEASFGDGAVLVEKYMA
FT                   KPRHIEVQVFGDNHGNAVHLFERDCSLQRRHQKVIEEAPAPGMTEEMRAAMGEAAVKAA
FT                   LTIGYSGAGTVEFIADVSEGLRPDRFFFMEMNTRLQVEHPVTEAITGRDLVEWQLRVAS
FT                   GEALPKRQDELSINGWAFEARLYAEDPARDFLPATGKLALFVPPENARVDSGVRTGDTI
FT                   TPFYDPMIAKIITHGATRDEALNRLDAALNKTRIAGLVTNRQFLSALCNLEAFRTGDVD
FT                   TGLIGRETAALFTDAQPSDIAFALAALGALDLLDAPEKSDPWSGLRGFRLWGEASRSVL
FT                   IEHHGERRTVSFTARGDRHFGFAFGTMDIRAHKNGLVRFAIDGRVSEASVSRIGHDVTV
FT                   QIEGHDTIFHHVLATGAEEDASSESRILSPMPGLVRLVSVVEGASVAKGDPLVTMEAMK
FT                   MELSLTAPRDGKVASVTVAAGDQVNEGALLVELEEQHG"
FT   gene            complement(21257..22864)
FT                   /locus_tag="BCAN_A0019"
FT   CDS_pept        complement(21257..22864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0019"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61125"
FT                   /db_xref="GOA:A9M6M4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M4"
FT                   /protein_id="ABX61125.1"
FT                   /translation="MPVLKSEISTRSASFEANRKAMLAAIDVVAEASRIAIDGGGEKAR
FT                   DRHVSRGKLLPRERVAQLLDPGSPFLELGLTAAHGTYGGAAPAAGIITGIGRVSGRECM
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEIAGENRLPCIYLVDSGGANLPNQDEVFPDRDHF
FT                   GRIFYNQAQMSAAGIPQVAVVMGSCTAGGAYVPAMSDETVIVRGQGTIFLAGPPLVKAA
FT                   TGEVVSAEDLGGGDVHTRLSGVADHLANDDAHALQIARAIAANLASEKRSFIPRGDGAA
FT                   PLYDPEELLGVVSADTRIPYDVREVIARLVDGSDFDEFKARYGTTLVCGFASVYGMPVG
FT                   IIANNGVLFSEAALKGAHFIELCCQRNIPLVFLQNITGFMVGRKYEAEGIAKHGAKLVT
FT                   AVATANVPKITMLIGASYGAGNYGMAGRAYSPRFLWTWPNSRIAVMGGEQAAGVLATVK
FT                   RDGIERTGGTWSAEEEAEFKRPTLEMFERQSHPLYASARLWDDGIVDPRKSREVLGLPL
FT                   SATLNAPVEPTRFGIFRM"
FT   gene            complement(22864..24042)
FT                   /locus_tag="BCAN_A0020"
FT   CDS_pept        complement(22864..24042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0020"
FT                   /product="Isovaleryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61126"
FT                   /db_xref="GOA:A9M6M5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M5"
FT                   /protein_id="ABX61126.1"
FT                   /translation="MFALGQNGGGMNFGLGEEIEALRDTVRRFAESRIAPLAAETDRNN
FT                   QFPMHLWREFGELGVLGITAPEDYGGAGMGYLAHCIAMEEISRASASIGLSYGAHSNLC
FT                   VNQITRNGSPEQRAKYLPKLISGEHVGALAMSEPGAGSDVVSMKLAAEKRGDRYVLNGN
FT                   KMWITNGPDADVLVVYAKTDLSAGPRGISAFIIEKGFKGFSTAQKLDKLGMRGSNTCEL
FT                   VFEDCEVPAENLLGTEGKGVNVLMSGLDYERVVLAGGPLGIMAACLDVVVPYVHERKQF
FT                   DQPIGEFQLMQCKLADMYVTFNASRAYVYAVAAACDRGETTRKDAAGCILYSAENATQM
FT                   ALQAIQSLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFQETR"
FT   gene            complement(24189..26177)
FT                   /locus_tag="BCAN_A0021"
FT   CDS_pept        complement(24189..26177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0021"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="GO_function: GO:0030729 - acetoacetate-CoA ligase
FT                   activity; GO_process: GO:0019287 - isopentenyl diphosphate
FT                   biosynthetic process, mevalonate pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61127"
FT                   /db_xref="GOA:A9M6M6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M6"
FT                   /protein_id="ABX61127.1"
FT                   /translation="MSTEAISRQSSHDNPLWQPDGARIAASNLEQFRIRAERHTGLSLP
FT                   DYAALHRWSVEDRAGFWQLVWDFCSVIGERGNTALTDRGHMRAAKFFPEARLNFAENLL
FT                   RHKGDGEAIVFRGENKVERRLTWNDLHALVSKLQQFMLSEGVQPGDRVAGMMPNMPEAV
FT                   ALMLAASSIGAVWSSCSPDFGVQGVLDRFGQIEPKLFFACDGYWYNGKRIAVADKVAEV
FT                   TAKLPGLKRAVIVTYLGEAEAVADKAEKGIALYAALEPFKAKPVEFTQLPFDHPLYILF
FT                   SSGTTGIPKCIVHRAGGVLLQHLKEHRLHADLRDGDRFFYFTTCGWMMWNWLASGIASG
FT                   ATLMLYDGSPFYPDGNVLFDYAAAEGMTYFGTSAKFIDAVLKAGLKPGETHDLSALRTI
FT                   SSTGSPLSPEGFAFVYDAIKKDVHLASISGGTDIVSCFVLGVPTEPVWQGEIQGAGLGM
FT                   AVDVWNDDGKPVRGEKGELVCTKAFPSMPLQFWNDAQGEKYQAAYFERFDNIWCHGDFA
FT                   EWTEHGGIVIHGRSDATLNPGGVRIGTAEIYNQVEQMPEIAEALCIGQDWDRDVRVVLF
FT                   VRLAEGVVLDDDLKARIRTKIRTGATPRHVPAKIIAVRDIPRTKSGKIVELAVRDIVHG
FT                   REVKNREALANPEALEFYRDIAELQQD"
FT   gene            complement(26362..26796)
FT                   /locus_tag="BCAN_A0022"
FT   CDS_pept        complement(26362..26796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0022"
FT                   /product="CHRD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61128"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M7"
FT                   /protein_id="ABX61128.1"
FT                   /translation="MKYRFILLLGIASVFTMPAMAEVLHFKAELTPQAEVPAVHNSRGK
FT                   GSVEVHFDTRTRRLVWQSEQSGLSGPATMAHFHGPADPTKNANVQIPVSAGQLGHKGRG
FT                   DVKLTNEQAKQLMDGLWYFNYHTKAHPGGEIRGQVLRVKQ"
FT   gene            complement(26973..28094)
FT                   /gene="mdmB"
FT                   /locus_tag="BCAN_A0023"
FT   CDS_pept        complement(26973..28094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdmB"
FT                   /locus_tag="BCAN_A0023"
FT                   /product="Acyltransferase mdmB"
FT                   /note="GO_function: GO:0016747 - transferase activity,
FT                   transferring groups other than amino-acyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61129"
FT                   /db_xref="GOA:A9M6M8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M8"
FT                   /protein_id="ABX61129.1"
FT                   /translation="MKRLPDFDGLRFVLCLGIACFHYSFRIPVKNEALQGFILTFAYFT
FT                   DVFFIVSGLFLARRRNYIWDARHYVAFVGKRLARIYPLHVAAFSCYALLSILTAKGLLH
FT                   PSTPPNMSWWDGLTQLLLIHDWGMGKTFSYNYVSWSLSALFFMYLAFPFFDLLCRRLGN
FT                   GVLAVVVVAALGGEYLAGLLGASTITRIQLADIGVFRTLPSFLFGMWIAHSQPTRMPKW
FT                   SIRAGLAICLAIFLFCHPANSPDGNGTLEGPWRLGFLYCCTYLLYAASTQNISTPFRWN
FT                   IFVKNARYSFTIFILHPLVALFFFKATPEQWGETTAGALMLIGAGAFASVLTAIAAYHL
FT                   FENPVHRWLVTRIDQWLNREEPQPAVLSHTGSA"
FT   gene            complement(28319..28391)
FT                   /locus_tag="BCAN_A0024"
FT   tRNA            complement(28319..28391)
FT                   /locus_tag="BCAN_A0024"
FT                   /product="tRNA-Ala"
FT   gene            complement(28617..29000)
FT                   /locus_tag="BCAN_A0025"
FT   CDS_pept        complement(28617..29000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61130"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6M9"
FT                   /protein_id="ABX61130.1"
FT                   /translation="MAKAELGTKRIDPETGKKFYDLNRDPIISPYTGISYPRSYFEATV
FT                   ESRAAEEEAEEEELDTALEKPEFVSLEDADDETKGSDDLPDLDDDVDLGDDDDDTFLEE
FT                   EEDEDDDVSGILGGGVGGDDEEG"
FT   gene            29385..30737
FT                   /gene="aroA"
FT                   /locus_tag="BCAN_A0026"
FT   CDS_pept        29385..30737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BCAN_A0026"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="GO_function: GO:0003866 - 3-phosphoshikimate
FT                   1-carboxyvinyltransferase activity; GO_process: GO:0009423
FT                   - chorismate biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61131"
FT                   /db_xref="GOA:A9M6N0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6N0"
FT                   /protein_id="ABX61131.1"
FT                   /translation="MSHSACPKPATARHSQALTGEIRIPGDKSISHRSFMFGGLASGKT
FT                   RITGLLEGEDVINTGRAMQAMGARIRKEGDVWIINGVGNGCLLQPEAPLDFGNAGTGAR
FT                   LTMGLVGTYDMKTSFIGDASLSKRPMGRVLNPLREMGVQVEAAEGDRMPLTLIGPRTAN
FT                   PIAYRVPMASAQVKSAVLLAGLNTPGVTTVIEPVMTRDHTEKMLQGFGADLTVETDKDG
FT                   VRHIRIVGQGKLTGQTIDVPGDPSSTAFPLVAALLVEGSDVTIRNVLMNPTRTGLILTL
FT                   QEMGADIEIIDPRLAGGEDVADLRVRASKLKGVVVPPERAPSMIDEYPVLAIAASFAEG
FT                   ETVMDGLDELRVKESDRLAAVARGLEANGVDCTEGEMSLTVRGRPGGKGLGGGTVATHL
FT                   DHRIAMSFLVMGLASEKPVTVDDSTMIATSFPEFMGMMAGLGAKIAESGAE"
FT   gene            30734..31393
FT                   /gene="cmk"
FT                   /locus_tag="BCAN_A0027"
FT   CDS_pept        30734..31393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BCAN_A0027"
FT                   /product="cytidylate kinase"
FT                   /note="GO_function: GO:0004127 - cytidylate kinase
FT                   activity; GO_process: GO:0015949 - nucleobase, nucleoside
FT                   and nucleotide interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61132"
FT                   /db_xref="GOA:A9M6N1"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6N1"
FT                   /protein_id="ABX61132.1"
FT                   /translation="MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYRA
FT                   VAKALLDKGLSLDDEALATDAALSLDLLAMDKAVLSAHAIGEAASKVAVMPAVRRALVE
FT                   AQRHFANALPSSVLDGRDIGTVVCPDAAIKLFVTASPEVRARRRFDEVLARGDTADFAE
FT                   ILADLKKRDERDMNRTDSPLRPAEDAHLLDTSEMSIEAAFLAAKKLIDHALAQHRG"
FT   gene            31609..33309
FT                   /gene="rpsA"
FT                   /locus_tag="BCAN_A0028"
FT   CDS_pept        31609..33309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BCAN_A0028"
FT                   /product="ribosomal protein S1"
FT                   /note="GO_component: GO:0030873 - cytosolic small ribosomal
FT                   subunit (sensu Archaea); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - translation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61133"
FT                   /db_xref="GOA:A9M6N2"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N2"
FT                   /protein_id="ABX61133.1"
FT                   /translation="MSQSNPTRADFESLLAESFAEHDLAEGYVVKGRIVAIEKDMAIID
FT                   AGLKVEGRVPLKEFGAKGKDGTLKPGDEVEVYVERIENALGEAVLSREKARREESWVKL
FT                   EQKFANGERVDGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVTPLMHVPQPFEIL
FT                   KMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVEGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILTIGQTVKVQIIRINQETHRISLGMKQLESDPWDGIGAKYP
FT                   IGKKITGTVTNITDYGAFVEIEPGIEGLIHVSEMSWTKKNVHPGKILSTTQEVEVVVLE
FT                   VDPVKRRISLGLKQTLDNPWTTFAQKYPVGTVVEGEVKNKTEFGLFIGLDGDVDGMVHL
FT                   SDLDWNRPGEQVIEEYNKGEVVKAVVLDVDVEKERISLGIKQLSGDKVGEAAASGELRK
FT                   NAVVTCEVTAVTDGGLEVRLVDHDLDSFIRRSDLSRDRDEQRPERFTVGQKVDARVIAF
FT                   DKKTRKLQVSIKALEIAEEKEAVAQYGSSDSGASLGDILGAALKKQEKN"
FT   gene            complement(33727..34737)
FT                   /locus_tag="BCAN_A0029"
FT   CDS_pept        complement(33727..34737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0029"
FT                   /product="hypothetical protein"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61134"
FT                   /db_xref="GOA:A9M6N3"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N3"
FT                   /protein_id="ABX61134.1"
FT                   /translation="MTYSKIQNILPGLGLSVAITAAAMVLEKIEEHYAGRAWLEALVIA
FT                   ILLGTAVRSLARPGPRFNKGINFSAKLLLEIAVALLGASISASAVIEAGSGLIFGIAAV
FT                   VAVAITLSYGIGRLLKLPHRMAVLVACGNSICGNSAIAAMAPVIGAESEDVAASIAFTA
FT                   ILGVIVVLTLPLLVPLLGLSFTQYGILAGLTVYAVPQVLAATAPVSLLSVQLGTLVKLV
FT                   RVLMLGPVILVFALISGNKNADVKPGFFQLVPWFIIGFLAMMALHSLHLIPEAILPAIQ
FT                   YASMLLTIISMAALGLGVDIRSVASAGGRVTLTAILSLIALCCISLGLIHMLGVA"
FT   gene            34853..35752
FT                   /locus_tag="BCAN_A0030"
FT   CDS_pept        34853..35752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0030"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61135"
FT                   /db_xref="GOA:A9M6N4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N4"
FT                   /protein_id="ABX61135.1"
FT                   /translation="MTLEQLRIFIEVAEREHLTRASEALHLTPSAVSSAIRNLEERYGA
FT                   TLFNRIGRRIELTGDGRMFLDEARATLARAHSAERMLSELGGGKRGFLAIHASQTIASY
FT                   WLPPFLARFHAAFPLIDVRLTLGNTESVTGATQEGAADIGFVEGSVQVPSLSIAKVATD
FT                   RLILVTRPDHAWSRSGKLTWDRLFEGNWILREQGSGTRSVFEDAIRASGYDPARLNVAL
FT                   ELPSNEAICSAVRSGHYVTAISELVAAPHLIAGALVKADFALPQRQFLMLMHNDRYKTK
FT                   AIEMLSRYIMEDRVDFHY"
FT   gene            complement(35746..36321)
FT                   /locus_tag="BCAN_A0031"
FT   CDS_pept        complement(35746..36321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61136"
FT                   /db_xref="GOA:A9M6N5"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N5"
FT                   /protein_id="ABX61136.1"
FT                   /translation="MSSSVDVAINANDTFNHIRIVNGIGVGLCFSMFLLFCAEFIQHPK
FT                   KHKISLIHFGWLFFSFTMVIAYWWSILNESSNSLYGPPLYIVSLLNIFCLYFIIVILTP
FT                   EDIDEYGGYERYFISRRLWIFSFIILFIIPNDVYEVINRNDDYYAPTYIIFNAILLFII
FT                   IRIKNKYIHISLLFLLNIIYIVDLIFNQ"
FT   gene            complement(36357..37640)
FT                   /locus_tag="BCAN_A0032"
FT   CDS_pept        complement(36357..37640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0032"
FT                   /product="lytic murein transglycosylase"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0009253 -
FT                   peptidoglycan catabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61137"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N6"
FT                   /protein_id="ABX61137.1"
FT                   /translation="MAAGHWKHSLKIVLGLVAGLALSLAISPALSPAIAAPSKAQVESQ
FT                   YRHWLETDIWPEAKAAGVSRAAFDQAFAGVSINWKLPDLVIPGEKPSTPKEQKQAEFGA
FT                   PGKYFNTKTIASVTSGGKARYGQYASLLKRIEQKYGVPGPILLAVWGRESGFGTVRIPY
FT                   NAFEVLGTKAFMATRKDMFRKELIAALQIASKGYIDETAMKSSWAGALGQPQFMPTSYL
FT                   KHAVDFDGDGKRDIWNSVPDALASIANYLKLHGWRKGRDWGFEVNVPQNVSCSLEGPDQ
FT                   GKTIAEWARLGITRANGKPFPASEMKGEGYLLMPAGRYGPAFIVTPNFYVLKDYNMSDL
FT                   YALFIGHVGDRIAYGAGDFSHGWDDVGSMYRSDIGAMQKRMQAQGYDVGKPDGLPGFKT
FT                   RRSIGIWQAKNGSPSTCFPLSNMLNRIK"
FT   gene            complement(37656..38261)
FT                   /gene="recR"
FT                   /locus_tag="BCAN_A0033"
FT   CDS_pept        complement(37656..38261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BCAN_A0033"
FT                   /product="recombination protein RecR"
FT                   /note="GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61138"
FT                   /db_xref="GOA:A9M6N7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6N7"
FT                   /protein_id="ABX61138.1"
FT                   /translation="MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVP
FT                   LGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERAGTMN
FT                   VRYHVLGGRLSPLDGIGPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYITDQL
FT                   SNFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL"
FT   gene            complement(38392..38715)
FT                   /locus_tag="BCAN_A0034"
FT   CDS_pept        complement(38392..38715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61139"
FT                   /db_xref="GOA:A9M6N8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6N8"
FT                   /protein_id="ABX61139.1"
FT                   /translation="MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSG
FT                   KGTLSALKIDPSLMKEDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFK
FT                   LPF"
FT   gene            complement(38740..40548)
FT                   /gene="dnaX"
FT                   /locus_tag="BCAN_A0035"
FT   CDS_pept        complement(38740..40548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BCAN_A0035"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="GO_component: GO:0009360 - DNA polymerase III
FT                   complex; GO_function: GO:0003887 - DNA-directed DNA
FT                   polymerase activity; GO_process: GO:0006260 - DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61140"
FT                   /db_xref="GOA:A9M6N9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6N9"
FT                   /protein_id="ABX61140.1"
FT                   /translation="MDTQSADGAYRVLARKYRPQNFDDLIGQEPMVRTLRNAFETGRIA
FT                   QAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLSTPGEHCQAIMEGRHVDVIEM
FT                   DAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTAAFNGLLKTLEEPPPHVKF
FT                   IFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEAEKIEVDDASLAMIARAGE
FT                   GSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLFEMLMRGDVAGALTEFRA
FT                   QYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERVRGREFAQTLSIRALSR
FT                   TWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIRGLDNGSVSAPRPQPSA
FT                   TPRPNGGSAPQAHGAADAVGSSALAPAAGGPATAMRIVETPPIQVSAPKPSEAAPQPSV
FT                   PINSLQDIVALADKYRDMQFKILVKNCVRPASIAPGRLEIGLTDDAPKSLPSDIAQHLL
FT                   NWTGIRWVVTVARDVAGQTIAEAEAERRDNLVTDARADPDVAAILAAFPGAKIIDVRIA
FT                   VPDKSEDEDIDLDAVAEVPDVLPEDD"
FT   gene            complement(40655..40760)
FT                   /locus_tag="BCAN_A0036"
FT   ncRNA           complement(40655..40760)
FT                   /locus_tag="BCAN_A0036"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            40830..41234
FT                   /locus_tag="BCAN_A0037"
FT   CDS_pept        40830..41234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0037"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61141"
FT                   /db_xref="GOA:A9M6P0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P0"
FT                   /protein_id="ABX61141.1"
FT                   /translation="MEQFVLDKRLHADTFYVARLGLCELRLMNDRRWPWLILVPRRPGL
FT                   TEIHQMTPLDQTMLTFEAGIVAHALKTVTACRKINTGALGNVVRQLHVHVIARNEGDAG
FT                   WPGPVWGHGVRETYDEKDAQKLIAEVRAAL"
FT   gene            41263..42210
FT                   /locus_tag="BCAN_A0038"
FT   CDS_pept        41263..42210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0038"
FT                   /product="Peroxisomal NADH pyrophosphatase NUDT12"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61142"
FT                   /db_xref="GOA:A9M6P1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P1"
FT                   /protein_id="ABX61142.1"
FT                   /translation="MAFRLYDLPEMEPSRFVGFAGNRIERLSEKRPDDSAFTALELPET
FT                   RIMILGDHKLLLDYGQEDAPRALFSLEEAHQFVLDLCEPVLLGLQDGTPLVALTATLYP
FT                   EALPAPFRLQDYRSVYTEGLVPADLLGALAQAAALTAWHESHRFCGRCGTKTEMRAGGA
FT                   KRLCPQCGAEHFPRTDPVAIMLPVRGEKCILARGPHFVAGSYSCLAGFIEHGETIEAAV
FT                   RRESFEEMKLAIGRVAYHASQPWPFPYSLMIGCHAEVLSDDFTVDRSELEDGRWFSKAE
FT                   VRTMLEGTHENGLRVPPCGAIATHLIKAWAYDAG"
FT   gene            complement(42211..43074)
FT                   /gene="pheA"
FT                   /locus_tag="BCAN_A0039"
FT   CDS_pept        complement(42211..43074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="BCAN_A0039"
FT                   /product="P-protein"
FT                   /note="GO_function: GO:0004664 - prephenate dehydratase
FT                   activity; GO_process: GO:0009094 - L-phenylalanine
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61143"
FT                   /db_xref="GOA:A9M6P2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P2"
FT                   /protein_id="ABX61143.1"
FT                   /translation="MKTNRISFQGEAGANSDTACRNMFPDMEPLPCPTFEDAFNAVETG
FT                   AADLAMIPIENTLAGRVADIHYLLPLADMHIVGEYFLPIHFQLMVLPGVRREEIKTVHS
FT                   HIHALGQCRNVIRQNGWKGVIAGDTAGAARLVADVKDRSMAALAPRLAADLYGLDILEE
FT                   NVEDSENNVTRFVVLSKNKQWAARPENDERIVTTFVFRVRNVPAALYKALGGFATNGVN
FT                   MTKLESYQLGGRFIATQFYADIEGHPEERSVQLALEELRFFTKEVRILGVYKGSDIRGT
FT                   QLLAAE"
FT   gene            complement(43163..43918)
FT                   /gene="kdsB"
FT                   /locus_tag="BCAN_A0040"
FT   CDS_pept        complement(43163..43918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="BCAN_A0040"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /note="GO_function: GO:0008690 - 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase activity; GO_process: GO:0009244 -
FT                   lipopolysaccharide core region biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61144"
FT                   /db_xref="GOA:A9M6P3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6P3"
FT                   /protein_id="ABX61144.1"
FT                   /translation="MLQTMKTLTLIPTRLGSTRLPNKPLADICGKPMIVHVADRAAAAK
FT                   LGRTVIATDSEEIFKVVAAHGHEAIMTRGDHESGSDRIYEALAKLDPSGEIDAVVNVQG
FT                   DLPTIDPDTIRRALLPLEDGPADIATLGVEITVEEEKTNPNVVKIVGSPLAGNRRLRAL
FT                   YFTRATAPYGEGPLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLRALEAGMRIDV
FT                   EIVKTVPLGVDTQADLDRARTFCSQAGTI"
FT   gene            44296..44904
FT                   /locus_tag="BCAN_A0041"
FT   CDS_pept        44296..44904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0041"
FT                   /product="Cytochrome c"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61145"
FT                   /db_xref="GOA:A9M6P4"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P4"
FT                   /protein_id="ABX61145.1"
FT                   /translation="MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEV
FT                   AQGSGGGESAAAPAKEEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWG
FT                   VVGRPAASVEGFSYSAAMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNE
FT                   RADLIAYLRTLSDNPVPLPAADAAPADSDKKPAEAAPAN"
FT   gene            complement(44949..45914)
FT                   /locus_tag="BCAN_A0042"
FT   CDS_pept        complement(44949..45914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0042"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61146"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P5"
FT                   /protein_id="ABX61146.1"
FT                   /translation="MIFGELPLDRAEDAILAHTINIDALSLRKGTVLARSDIAALRQAG
FT                   IDRVLAARLESGDIGEDAAALAIGRLLACNGIEPGPATTGRVNLFASPDGVFCTDTAGI
FT                   DAINMHDPRISVATIRNHARVEAGQMVATIKIIPFAVPGVLIEEIRAVVHGRPLLQVEK
FT                   FRNMQVGLIQSRLPSIRETVLDRTLELMHKRVTRNGGAVVTQERVAHHDEALATAIAKV
FT                   GSACDLIVIFSASAVADEADIVPRAIRRAGGEILRIGMPVDPGNLLVLGKMGRKYIIAA
FT                   PGSARSARENSLDRVLDRLMAGMELDATHLARMGVGGLLL"
FT   gene            45970..46278
FT                   /locus_tag="BCAN_A0043"
FT   CDS_pept        45970..46278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0043"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61147"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P6"
FT                   /protein_id="ABX61147.1"
FT                   /translation="MFESRLTHILAGGFLDSKICSMPEPRDANVGIRHPSQSRFFPGLP
FT                   LQKGGGGRIEPPRLGALHIVFWCVQPDFGLTYRPPNASHAVFLDLETGDTLQKDRFD"
FT   gene            46453..47466
FT                   /gene="cyoA"
FT                   /locus_tag="BCAN_A0044"
FT   CDS_pept        46453..47466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="BCAN_A0044"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0008827 - cytochrome o ubiquinol oxidase
FT                   activity; GO_process: GO:0006119 - oxidative
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61148"
FT                   /db_xref="GOA:A9M6P7"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P7"
FT                   /protein_id="ABX61148.1"
FT                   /translation="MKHGTPRTIVSFAVLALSAFLAGCQNQVLLDPKGQVGLEERDLIL
FT                   FATGIMLLVVVPVILATLFFAWKYRATNEKADYQPDWHHSTKIELAVWLIPMAIIVVLG
FT                   TVTWISTHKLDPYRPLESNVKPINVEVVALDWKWLFIYPDQGIATVNEMAMPVNVPVNF
FT                   KLTSSNLMNSFFIPQLGSQVYTMRSMQTKLHLIANQEGDFAGISANYSGQGFAQMRFKA
FT                   HAFDQAGFDKWVADVKAQAAAKGEDLDRARYASLVQPSEKHAVQYFNYGDKALFHDIVN
FT                   RCWDGKSVCLDDEMHRQQMIREARASLRKSSPIDFSQWANDIICTVQPPRLSQLEN"
FT   gene            47546..49525
FT                   /gene="cyoB"
FT                   /locus_tag="BCAN_A0045"
FT   CDS_pept        47546..49525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="BCAN_A0045"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0008827 - cytochrome o ubiquinol oxidase
FT                   activity; GO_process: GO:0015990 - electron transport
FT                   coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61149"
FT                   /db_xref="GOA:A9M6P8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P8"
FT                   /protein_id="ABX61149.1"
FT                   /translation="MFGKLTLEAIPYHEPIIMVTLAAVAGGALAILAAITYYRKWVPLW
FT                   NDWLTSVDHKRIGVMYIVLALVMLFRGFSDAVMMRAQQALASGANEGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFIVGLMNFVVPLQIGARDVAFPYLNSLSFWLTVAGAILVNISLGVG
FT                   EFAKTGWLAYPPLSGKAFSPDVGMDYYLWALNISGMGTLLSAVNLITTIIKMRAPGMGM
FT                   MQLPVFTWTALCSNVLIVAAFPILTVTLSLLTLDRYLDFHFFTNDAGGNPMMYVNLIWI
FT                   WGHPEVYILVLPCFGIYSEIIATFSGKRLFGYTSMVYATVAITVLSFLVWAHHFFTMGG
FT                   GASVNSFFGVATMIISIPTGAKVFNWLFTMYKGRVRMETPVMWTIGFMCTFVIGGMTGV
FT                   LLAVPPADFVLHNSVFLIAHFHNVIISGVLFGCFAGVVYWWPKAFGFKLNERLGKSAFW
FT                   CWLVGFMLAFMPLYVLGLMGMTRRLNHTENPAWHIYLIIAAIGVAVILCGIVCQILQIM
FT                   VSIRDRDKLRDTNGDTWGSGRTLEWSISSPPPFYNFAETPTVRDHDAWWDMKQNGYVRR
FT                   TEKFARIHMPKNTATGFLVGILSIPFGFAMIWHIWWLAIASALAMFVVAIAHSFNNDRD
FT                   YYVSADEVQRVEDARTRQLTAQEA"
FT   gene            49529..50158
FT                   /gene="cyoC"
FT                   /locus_tag="BCAN_A0046"
FT   CDS_pept        49529..50158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="BCAN_A0046"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0008827 - cytochrome o ubiquinol oxidase
FT                   activity; GO_process: GO:0015990 - electron transport
FT                   coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61150"
FT                   /db_xref="GOA:A9M6P9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6P9"
FT                   /protein_id="ABX61150.1"
FT                   /translation="MSAIQHTAAPYLGGNDHPAHEDHHDAGSTTLVGFWIYLMSDCILF
FT                   SGLFATYAVLAHQFAGGPTGRELFDLQFVLVETMLLLVSSLTYGLATLSMYKNNRSGVL
FT                   GWLGVTFLLGAAFLAMEIYEFHHLIVEGAGPDRSSFLSAFFTLVGTHGLHITSGLIWIL
FT                   VLSAMLLRDGLTERNRTRVMCLSLFWHFLDIIWIGVFTLVYLLGVL"
FT   gene            50158..50523
FT                   /gene="cyoD"
FT                   /locus_tag="BCAN_A0047"
FT   CDS_pept        50158..50523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="BCAN_A0047"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0008827 - cytochrome o ubiquinol oxidase
FT                   activity; GO_process: GO:0015990 - electron transport
FT                   coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61151"
FT                   /db_xref="GOA:A9M6Q0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q0"
FT                   /protein_id="ABX61151.1"
FT                   /translation="MSSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPA
FT                   TTAVIVLAIAAVQILVHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLD
FT                   TNMMPMYMTPDNVRNLP"
FT   gene            50993..51478
FT                   /locus_tag="BCAN_A0048"
FT   CDS_pept        50993..51478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0048"
FT                   /product="SH3 type 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61152"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q1"
FT                   /protein_id="ABX61152.1"
FT                   /translation="MVSASVNVRSGPGAHFTRLAAIPAWTRVNAGPCRNGWCRIGNGSG
FT                   YGWISARYVRFASYAGGYAAQPPATVIVNNGGYDDWGPALGWGLGIGWASSNWGPYWGP
FT                   GWGGYRGGPNYIHGCIGRNCQSGWGPGRRGWNPHWGRGPQRRAQWGRGWPQHVNRPF"
FT   gene            52074..53993
FT                   /locus_tag="BCAN_A0049"
FT   CDS_pept        52074..53993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0049"
FT                   /product="surface antigen (D15)"
FT                   /note="GO_component: GO:0019867 - outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61153"
FT                   /db_xref="GOA:A9M6Q2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q2"
FT                   /protein_id="ABX61153.1"
FT                   /translation="MLLLAAHFSSFALSPALAFEIFGIHLWGKDKKQDPDIIDPKTYSV
FT                   DVTTTGDRKNADGKEADLKSVIEGASGLVSDADKPASGSAGLLVKARGDYRRILSALYG
FT                   EGRYGGTISIKVDGREANDIPPDTEIPNNAKVAITVDPGPQFLFSRTAISNIAPPPGNR
FT                   RDKVQTPEEAGFAPGQEAKSGTILKAERLAVEAWRQEGYAKARVTGEDVVADHADNRVS
FT                   ADIALDPGRKAYYGPVSVVGTARMDPQFVAWMTGLKPGQEYDPDDIENAKKRLGRMEVF
FT                   RAMTFEEADKIEPDGSLPITLNVQERKPRRFGFGAEYSTIDGFGVTSYWMHRNLFGRGE
FT                   RLRFDAKVSGIGGSQDNSFDPKNYTYLLGASFAKPGVYTPDTDFVATLDAKREVLDAYT
FT                   ETSINAKTGFTQIFSDELSGALYANASQGHFVDDVFGKRDFTTAGLEGNLLYDSRNNKP
FT                   DPSSGFYLVGNIQPFYEFHYGNFATRFTAEGRTYHGFGQTDRVVLAGRLKVGSIVGGSI
FT                   ADLPPSQLFLAGGGGSVRGYGYRNIGVSAGNGNIIGGRSLVEANGEVRTRITDSIGAVA
FT                   FVDAGYVGEKSFPDFSEQMRVGVGGGLRYLTSLGPIRLDVAVPLNRRSGDPNYGFYVGI
FT                   GQAF"
FT   gene            53990..58729
FT                   /locus_tag="BCAN_A0050"
FT   CDS_pept        53990..58729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0050"
FT                   /product="protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61154"
FT                   /db_xref="GOA:A9M6Q3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q3"
FT                   /protein_id="ABX61154.1"
FT                   /translation="MTRLFAIIAFFVFVVAAAVFAWPEQKVQMPAQAQAQTDTQAQGAA
FT                   QPADDQPQAEEEKSYFLSFVENKLSAPNRRISISGISGVLSSEATVGSITVADREGVWL
FT                   RIENVKLDWSRTALFLGRLSVQSLTAERIDVIRKPLPDKGLPSPESSSFSLPELPISIN
FT                   LEQLDVARLHFGPTIFGLESDVSLKGSLSLADGSLNSNFDIKRLDGPGGNFALRAAYAN
FT                   ADQKLDLDLKVSEPANGIVANLLKIDGRPPVDLTLTGAGTLDDLKVALALDTNGSRTLT
FT                   GEFTLDRQGKGPDGGRVFAARFNGPIAVLVPPVFRDFFGAETVLSADGLVKDGGGFRLD
FT                   DLALTSAALKLKASAETDNDHFLDKLRIDAAIADESKGRVLLPVKGAETYIDNARFQVA
FT                   YGDRPTNDWTGMLSINGLKNATLSASAIALDMGGLAENLNDPASRHITFSVNGGMDGIS
FT                   SPRADIAEALGSKITLAVNGAWRAGSPVELAQADIEGNGLSLDLKGKINDFAFNGDIAA
FT                   KVASLAPFGALANRNLAGSIDVKATGMVRPISGAFQLDFDGTAENVRTGTEAVDRILDG
FT                   AVNLSGALGRSSEGFSARNFRIGNALSEITANGSLASDKADFDFGVMLSDLKLLSDKAS
FT                   GPMTVKGSARGDDKLIALALRADVPQGTLAGRKLSNGGLDFNALLDGNATTGVALSGKL
FT                   DGGALLNGERVDLGSLIDIAHDEKRLTNLMFNAGGAHLSGNVTQSAKGLLSGALKLDAP
FT                   DISTAAALFLADATGAANADITLDASDGRQNATVTANASGIRINGNHIASADIALTAKD
FT                   LLGVPVVDGNAAARDIMVGTFGIDSFDASANASGSKTDFTANTRLKIGTVANAAGSLEP
FT                   KDGGFELALATADVKQGALSAHLAAPATISMKGDEITFGDIVVNTGDGQVRINGLVDGR
FT                   LDLSVALTNLPLALANTFKPELGLGGTVNGTARITGTKEAPDIAFDMTARDVMAAELKK
FT                   QGLGALNAEAKGTSANERLNIDARVTGGAASGTGIDVRANGAVPLGKGDLALDVNLTNL
FT                   PLVLLNGVVKGQDLAGNVTGTARITGPLTNPAANFNLRGSGLAAKPLRESGLAPLTLQA
FT                   AGKYAAKAVDLSSLQLDGPGGLNVTANGKIPFSGQGLGVNVNGNVPLALANRFLADRGA
FT                   QASGTLSLTANVSGGFQKSQLRGMFSTNGATFVDPETNLRFVNINVMGSMEGETITLRQ
FT                   VNANLSSGGSLSASGTISTNAVANFPANIEVKFNRARYADGKLVVATIDGGVSITGPLM
FT                   RDPLISGRIDVDKAEITVPENLGGGAAYVPVHHKNTPKNVQVTLDRARVETRKNKVPTP
FT                   VARPTVPRLDVVVSAPNQIFVRGRGLDTELGGRVRLTGPITNIRPVGSFDLIRGRISIL
FT                   GQRITFDEGHVTLVGDLNPQLNFVARSEGDGITAIVTVTGTVDDLNIVFSSSPELPQDE
FT                   VLAQLIFKRSIGELSAFQIAQLAAAAAELAGGSNNSLINKLRQGTGLDDLDVVTNSKGE
FT                   TSVRAGRYIRDNIYLGVEAGARGTTKGTVNLDISRNLKVKGAFGAEDDSSGGIFYEKDY
FT                   "
FT   gene            58874..59599
FT                   /locus_tag="BCAN_A0051"
FT   CDS_pept        58874..59599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0051"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61155"
FT                   /db_xref="GOA:A9M6Q4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q4"
FT                   /protein_id="ABX61155.1"
FT                   /translation="MSKLNDDLSRRRFLLGTGAVLLTGAAGCSQTMDMSAFQMNIDPMS
FT                   TGGISPMRPQISVDKAITTPDVMYASVTEGPYALPAIPYEKVPKQFRRQIVPDPTGQAP
FT                   GTIVVSLKDHFLYYVLPGGEALRYGVGIGKAGFEWQGRANVEYKKQWPRWTPPPEMIQR
FT                   KPELEKYRNGQEPGPTNPLGARALYIYQNGRDTGYRIHGSPEWWSIGQSMSSGCIRLMN
FT                   QDIIDLYNRVQGKAPIIVG"
FT   gene            complement(59650..59865)
FT                   /locus_tag="BCAN_A0052"
FT   CDS_pept        complement(59650..59865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0052"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61156"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q5"
FT                   /protein_id="ABX61156.1"
FT                   /translation="MQARTERNLGFVAALLLTAAAFAAPGLSTQIAHNDMAYEEQIQLA
FT                   LTGDMPIELRHFVDLNETMPEQPYRD"
FT   gene            complement(59935..60444)
FT                   /locus_tag="BCAN_A0053"
FT   CDS_pept        complement(59935..60444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0053"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61157"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q6"
FT                   /protein_id="ABX61157.1"
FT                   /translation="MNMRISQLNGANSTGYFDRVPEKLVLEGYRRWTAGFETGSIIPWE
FT                   MTWSLYLEELGPSEATRAVAELSQFIRVLRHCAACPLRAFPFDSHHVCREECLTLGLIS
FT                   GMQNQDALLIDTCLQAIACVRRCDNVAWAARNFADALADFGQTLLPIPIHAIDAALNRV
FT                   HCATFH"
FT   gene            complement(60775..60981)
FT                   /locus_tag="BCAN_A0054"
FT   CDS_pept        complement(60775..60981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0054"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61158"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q7"
FT                   /protein_id="ABX61158.1"
FT                   /translation="MGGWLSRHEKPDAGSGLTTGFQADRHRLALSRSTGPECAIFSPLI
FT                   DASLRPFAATAAACDGCVPSMLL"
FT   gene            complement(60992..61996)
FT                   /locus_tag="BCAN_A0055"
FT   CDS_pept        complement(60992..61996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0055"
FT                   /product="protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61159"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR021174"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q8"
FT                   /protein_id="ABX61159.1"
FT                   /translation="MKNHRLFASAISVFALCASAGIASAHCSLDQKEAKAGTFYKAALR
FT                   IPHGCEGKATTKVTVDLPEGFIMAQPQAKAGWKIETTKGDYAHGYKLHGKEVTSGVKQI
FT                   SWSDGNLPSDFYDEFVVVGQLAPFDKDTTLSFPVTQFCGDAASVAWTEIAKDGQNPHDL
FT                   KHPAPQLRVLAAASTDEHAGHDAMSEHMNHAAMPTKVGDLVITDPSVRAMVPGAKVAGG
FT                   FLTIANDGKKADKLVSVSAPGVKRVEIHEMTMQDQIMKMRKLEGGLDLPAGKTMQLKSG
FT                   SYHLMFIEPEHPYEEGETVPVTLEFKKAGKVEINFPVTAKKGQTKDHSEHSSH"
FT   gene            complement(62131..62529)
FT                   /locus_tag="BCAN_A0056"
FT   CDS_pept        complement(62131..62529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0056"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61160"
FT                   /db_xref="GOA:A9M6Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6Q9"
FT                   /protein_id="ABX61160.1"
FT                   /translation="MKLSARQLRTRLAIRILSVLALVFVGFAHKPIDLTAPDSYLIAQY
FT                   KLPDGSYSALRIGNRSSDATDHGSDQHPNKNGCDACRLSSAFLCPAPANSTGAMPLIAM
FT                   VDGSIPPQPILRQNVYPPSAPPQAPPFA"
FT   gene            complement(62838..63233)
FT                   /locus_tag="BCAN_A0057"
FT   CDS_pept        complement(62838..63233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0057"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61161"
FT                   /db_xref="GOA:A9M6R0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R0"
FT                   /protein_id="ABX61161.1"
FT                   /translation="MAKAIHTMIRVLDADKSVAFYNQAFGLDIAERIDFETFTLIYLRN
FT                   EEADFEVELTVNKGRTEPYNLGDGYGHLAVAVDDVDAEHARFRELGFKVGNLVDFRNNG
FT                   ALLARFFFVEDPDGYKIEVLQRAGRYV"
FT   gene            63430..64593
FT                   /locus_tag="BCAN_A0058"
FT   CDS_pept        63430..64593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0058"
FT                   /product="Nucleotide-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61162"
FT                   /db_xref="GOA:A9M6R1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R1"
FT                   /protein_id="ABX61162.1"
FT                   /translation="MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFSI
FT                   TVPAERAEALEPMRLAAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARPAA
FT                   ASQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGILDA
FT                   DIYGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMSAL
FT                   TQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGLNM
FT                   FRKVDVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLHMDVRAY
FT                   SDNGTPITVKEPDSEHAKIYRDIARKVWENMKSGKGAGKPAPEIVFD"
FT   gene            complement(64790..66421)
FT                   /gene="pgm"
FT                   /locus_tag="BCAN_A0059"
FT   CDS_pept        complement(64790..66421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BCAN_A0059"
FT                   /product="Phosphoglucomutase"
FT                   /note="GO_function: GO:0016868 - intramolecular transferase
FT                   activity, phosphotransferases; GO_process: GO:0005975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61163"
FT                   /db_xref="GOA:A9M6R2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R2"
FT                   /protein_id="ABX61163.1"
FT                   /translation="MTVKTIATTPYQDQQPGTSGLRKKVPVFQQPNYAENFIQSIFDVL
FT                   EGFKGKTLVVGGDGRFYNREVIQKLIKIAAANGFDRIMVGQGGILSTPAASNMIRKYKA
FT                   FGGMILSASHNPGGPTQDFGIKYNIGNGGPAPEKITEAIFARSKVIDQYKIADAADIDI
FT                   DKIGTSKIGDTEVVIFDPVADYAELMESLFDFAAIRAMIKGGFQMKFDAMHAVTGPYAK
FT                   EIFERRLGAPEGSVVNFVPLPDFGGHHPDPNLVYAKDLYDLLMSSHAPDFGAASDGDGD
FT                   RNLILGRGIFITPSDSLAMLAANAHLAPGYKGGIKGIARSMPTSAAADRVAEKLGIGMY
FT                   ETPTGWKFFGNLLDSGKVTICGEESSGTGSDHVREKDGLWAVLLWLNILAVRKESVKAI
FT                   ADDHWARFGRNYYTRHDYEAVDSDIATKLVADLRGKLAGLPGTSVNGLRIEKADDFAYH
FT                   DPVDGSTSEHQGIRIYFEGGARIVLRLSGTGTSGATIRIYIERYEADPAKHNLDTQATL
FT                   APLIDAAEQIAEVKKRSGRTEPSVVT"
FT   gene            complement(66477..66662)
FT                   /locus_tag="BCAN_A0060"
FT   CDS_pept        complement(66477..66662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0060"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61164"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R3"
FT                   /protein_id="ABX61164.1"
FT                   /translation="MRHYAIANKAHPENRRHFRETCFRANRTCVSSAIQDFFGKQSPMC
FT                   TLCYFQTTSLIYLVLQ"
FT   gene            complement(66637..67530)
FT                   /locus_tag="BCAN_A0061"
FT   CDS_pept        complement(66637..67530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0061"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61165"
FT                   /db_xref="GOA:A9M6R4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R4"
FT                   /protein_id="ABX61165.1"
FT                   /translation="MQNENLRDLNAFVAVAETGSFTRAAAQLGVSQSALSQTIRNLEER
FT                   VGIRLLNRTTRYVSPTEAGERLLAQVGPALAEIASGFAQIGELRERPSGTVRLSADEYA
FT                   IQSVLWPALERFLAEFPDIHIELTTDYGRSDVVRERQDAGVRRGKLVSRDMIALRISPD
FT                   IPMATVATPAFLEKGGKPKRPQDLSDHDCINLRLPTHGEFFAWTYSRHGKDIRITTQGR
FT                   LVFTSIAQVLQACLAGFGLAYLPRDYAARHIESGALVEVLADWRKTFEGYHLYYPNRRQ
FT                   HPPALAALIEALRYRE"
FT   gene            67655..68578
FT                   /locus_tag="BCAN_A0062"
FT   CDS_pept        67655..68578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0062"
FT                   /product="hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61166"
FT                   /db_xref="GOA:A9M6R5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R5"
FT                   /protein_id="ABX61166.1"
FT                   /translation="MKSVTFKNKNWDIAAHLHTPAGFDEAKKYPAIVVAHPISSCKEQT
FT                   AAIYAAKLAELGYVALAFDASTQGASGGLGKYLEDPASRVEDFRCAADYLVTLDFVDEN
FT                   RIGVLGICGGGGYAVNAAMTDRRFKVVSTVVGANYGRLLREGDMSPDAAIKAMEAISQQ
FT                   RTAEARGGEVAITSYIPQSVDALKASGITDIDVTEAVDYYTTPRGQKPGSPNKLNVTST
FT                   GAAFNWDAFHLADQLLTQPLQIIIGGGQPGIFGSFRDGYELFDKARSQTKNLFIVPGAT
FT                   HYDLYDKPEYVDQAVARLKEFYSEYL"
FT   gene            68651..69349
FT                   /locus_tag="BCAN_A0063"
FT   CDS_pept        68651..69349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0063"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61167"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R6"
FT                   /protein_id="ABX61167.1"
FT                   /translation="MPLIKGQDESRKPDMTPFDMRPIEREALPSEILARLAKTEGRLIV
FT                   AIAGPPGAGKSTLSDYLLHAINKGGNAPSIIVPMDGFHIDDVILEQRGLLDRKGSPPTF
FT                   DCAGFSSLLQRLKGAEEEIFIPVFDRSLEFSRAAASVVGPEHRILLVEGNYLLLDREPW
FT                   SRLAPFFDMTVYLDVPFAVLERRLTDRWLGFGFDAETARNRALSNDIPNAELVAAQSRK
FT                   AGFVVTFDAR"
FT   gene            69449..70138
FT                   /locus_tag="BCAN_A0064"
FT   CDS_pept        69449..70138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0064"
FT                   /product="Fumarylacetoacetate hydrolase domain-containing
FT                   protein 1"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61168"
FT                   /db_xref="GOA:A9M6R7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R7"
FT                   /protein_id="ABX61168.1"
FT                   /translation="MTTYVFAPRPQTFLPVKGTDARFPVHRIYCVGQNYADHAIEMGGD
FT                   PTRNPPFFFQKNPDCLVIEGGDFPYPPKTEDVHHEIELVVALKSGGSDIPVEKALDHVY
FT                   GYAVGIDMTRRDLQAVAKKAGRPWEVAKAFEHSAPCSAVVPAAETGHPEQAAISLAING
FT                   EMRQSGNLNQMIWKVPETISYLSSLFDLQPGDLIFTGTPAGVGPVKRGDRLEGKVDGVG
FT                   ILSVTVV"
FT   gene            70158..70349
FT                   /locus_tag="BCAN_A0065"
FT   CDS_pept        70158..70349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0065"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61169"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R8"
FT                   /protein_id="ABX61169.1"
FT                   /translation="MSTYLPEDVHDALERFIAERYSGLNQTEAITLILRKWLTHERYLS
FT                   AEPEQGTPPEELNATNDD"
FT   gene            70411..70626
FT                   /locus_tag="BCAN_A0066"
FT   CDS_pept        70411..70626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0066"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61170"
FT                   /db_xref="GOA:A9M6R9"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6R9"
FT                   /protein_id="ABX61170.1"
FT                   /translation="MTMAKQPQNGAGRKTALGRRLLILMIVAILLVIALVWMSIYLFDP
FT                   DGGINFDDLGIFAYDFNALIEWVARI"
FT   gene            70792..70980
FT                   /locus_tag="BCAN_A0067"
FT   CDS_pept        70792..70980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0067"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61171"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S0"
FT                   /protein_id="ABX61171.1"
FT                   /translation="MAFEDIKAEIALLFEQMVNQPQDAHEIRETVREKLNELKAAGLPL
FT                   PEDLVELEKRIEQDFDS"
FT   gene            70995..71858
FT                   /locus_tag="BCAN_A0068"
FT   CDS_pept        70995..71858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0068"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61172"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S1"
FT                   /protein_id="ABX61172.1"
FT                   /translation="MRFALSSSSAAFARKGFMLVGCAVALSACNTTNDGNAVKTALITQ
FT                   TDNKAAASGEQPSSAPLAAASDEAAPQTQTVAALPDPVLPDVVPIPGIRGQSEPMMAYA
FT                   GAQAAASPASIAANMAFETPESAPKDLDALITKYSVAYDVPERLVRRVVHRESRFNLGA
FT                   RNGPYWGLMQISHPTARGMGYTGSAKGLLDAETNLKYAVRYLSGAYKVAGGDESQAVRY
FT                   YARGYYYDAKRKGLLQETGLDGSWKRNGPTREAAASIQPASLPEGAAIPIPGVAPIQAF
FT                   YAAAGQ"
FT   gene            72044..72700
FT                   /locus_tag="BCAN_A0069"
FT   CDS_pept        72044..72700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0069"
FT                   /product="Hemolysin-3"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61173"
FT                   /db_xref="GOA:A9M6S2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S2"
FT                   /protein_id="ABX61173.1"
FT                   /translation="MNVRLPHPVKWKYDRAELWADGVIHVLGVGLALAGAIAMLFYFLP
FT                   NMPAVTSISSGVYLASLVAALGISAVYNIWPVSPTKWFLRRFDHSAIYLLIAGTYTPFA
FT                   IHMGDRALPLLLFVWSVAFVGIMLKLFMPGRFDRLSILLYLALGWSGVMVYDTMVQSLP
FT                   PAVFWLIAAGGMVYSLGVIFHVWERLRFQNAIWHGFVVVGAALHYCAVFFVGAWN"
FT   gene            complement(72841..76078)
FT                   /pseudo
FT                   /gene="dnaE"
FT                   /locus_tag="BCAN_A0070"
FT                   /note="DNA polymerase III, alpha subunit"
FT   gene            complement(76075..77661)
FT                   /locus_tag="BCAN_A0071"
FT   CDS_pept        complement(76075..77661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61174"
FT                   /db_xref="GOA:A9M6S3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S3"
FT                   /protein_id="ABX61174.1"
FT                   /translation="MKPSNLAPANGTAERLFLALWFPFLPTDRLRRAVPPDGKERLPLV
FT                   VTERTANALRLTAVDGEAAKLGLFPGMALTDARARVERLDVAAAAPEHDTALLKRLAQW
FT                   CERYTPLVAFDEPHGLMLDITGCAHLFGGPAAMRADALCRFERAGLHVQAAIADNSFAA
FT                   RLLARGTKGGVFSQAEADRLLPRLPLSALELAQAAETGLKRAGLKRIGDVMALPRSALT
FT                   ARFGTDLATRLDRLARRERAPISPLRILPLRTVERRLSEPVTAMELVEHILRELAQALF
FT                   AQLEMEGKGALLLEASFFRVDGEVRHIRIETGQPLRDDRIFLRLARERLGALTDPLDAG
FT                   FGFDMIRLAALRSSTVAQRQTGPDQHEEDEAGFSQLIDRLSARLGQDRVLVSFPRDTHM
FT                   PERAYGLAPALHGSRKTEADYRSQAELPGDSPARPIKLFRPPQLIETVAEVPDSPPSFF
FT                   LWRRVRHQVRLAEGPERIEPEWWCAIGQDVPELRDYYRVEDENGQRFWIFREGLYDGAN
FT                   HPRWFLHGLFA"
FT   gene            complement(77552..78415)
FT                   /locus_tag="BCAN_A0072"
FT   CDS_pept        complement(77552..78415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0072"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61175"
FT                   /db_xref="InterPro:IPR017026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S4"
FT                   /protein_id="ABX61175.1"
FT                   /translation="MSGINIAALRRMVTGIEGNDPQGSFANGRGRETGSGKGSGFGRAR
FT                   SFTLGFAPADAAFPHGLAGDALHEIFAENPGAHMVATGFALAFAARAAKPQRPIIWIEE
FT                   ESAAQEYGWLYPPGLHAFGIDPARLLIVRCPTAQDVLKAANDALEAGSGGKASHLVSGI
FT                   VASITGQPKCLDLTVSRRLLLATEAAQLPVILLRSHRTAVQSAAVSRWRVAPAPSRSSG
FT                   ANAPGKPAFSAVLERNRHGTCGQWIMEWNNETLEFGARERDGRTLVSRPLVSVSADRPA
FT                   SPRRSA"
FT   gene            78934..81156
FT                   /locus_tag="BCAN_A0073"
FT   CDS_pept        78934..81156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0073"
FT                   /product="Hypothetical protein"
FT                   /note="GO_component: GO:0019867 - outer membrane;
FT                   GO_process: GO:0009405 - pathogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61176"
FT                   /db_xref="GOA:A9M6S5"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S5"
FT                   /protein_id="ABX61176.1"
FT                   /translation="MFGLSVNHAYAGPGIFINDGTDDGCIWTFDKEDYSPIGDYFGNTA
FT                   PADKDSAGRNSPASVKYHIPSIQQLGGAATLKCLSKDRDTQTDRVLFYGNSKEQGSISL
FT                   TLGGELFVNNGNLGLGGGTDTKAMRIGSMATLTGPSGLRSLAIGAGEIATVASGDDAIA
FT                   IGTAAQAAHVGSIALGLQSTTELPSLVKDVTINGIKLSAFAGSNPASVLSIGNDTLKRS
FT                   ITNVGAGRVSKDSTDAVNGRQLFAVSEQAASGWSLTVNGMDKSRVGPGDTVDLSNSDGN
FT                   LVLSKKGKDVTFNLASDLKVTSLVAGNTFLDTNGLVITGGPSMTVSGIDAGQLKISHVA
FT                   DGAVTVTSTDAVNGSQLHRVAHTIAEHLGGDAHVNADGSVIGPQYTVQKKRYKTIYDAF
FT                   GGVDENLANINDILHDIESGGGIKYFHANSIGADSRALGTNSIAVGSDSVASGEGSISV
FT                   DNGAQASAHGSVALGENAAAPDANSVALGAGSKTSEVVATKGTTINGQYYDFAGDAPSG
FT                   TVSVGDKGAERTITNVAAGRISVESTDAVNGSQLNAVNQAIENLVAGVTENDKFSVKYD
FT                   RHSDGTKKNSMTLQGWDSATPVVLANVADGVHKNDAVNVSQLKAGLSTTLGEAKAYTDQ
FT                   TALQTLDQANAYTDKKFGKLNEDIVATRIEARQAAAIGLAAASLRYDDRPGKISAAIGG
FT                   GFWRGEGAVALGLGHTSEDQRMRSNLSAATSGGNWGMGAGFSYTFN"
FT   gene            81176..81913
FT                   /locus_tag="BCAN_A0074"
FT   CDS_pept        81176..81913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0074"
FT                   /product="Invasion associated locus B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61177"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S6"
FT                   /protein_id="ABX61177.1"
FT                   /translation="MIRSVLEHNPTAAKRGRSRLCFGKKSLERRSVSIRLKRALKRLVG
FT                   PASAFLALAFSHGSVDAAMRKNKQPPAPPSVYTQTPGFAVKSTEIMVPDGVSAGEYRRI
FT                   THPFPNWTLVCDENLKAKKRVCNITQTIMHEKGLVVFSWSLAAAENGKPYMIMRIPAVV
FT                   GARQEIRLDYGDGTPIIVSKTHGCEGAVCIAYLPVGPRLRVYIAKGSVPKVSYPVPDIR
FT                   RGSADWLMFYAPLSGLAHALAAI"
FT   gene            complement(81992..83212)
FT                   /gene="argG"
FT                   /locus_tag="BCAN_A0075"
FT   CDS_pept        complement(81992..83212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BCAN_A0075"
FT                   /product="argininosuccinate synthase"
FT                   /note="GO_function: GO:0004055 - argininosuccinate synthase
FT                   activity; GO_process: GO:0042450 - arginine biosynthetic
FT                   process via ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61178"
FT                   /db_xref="GOA:A9M6S7"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6S7"
FT                   /protein_id="ABX61178.1"
FT                   /translation="MSKWKDVKKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQG
FT                   EELEPARKKAEMLGIKEIFIEDVREEFVRDFVFPMFRANAVYEGVYLLGTSIARPLISK
FT                   HLIDIAKKTGADAIAHGATGKGNDQVRFELSAYALNPDIKIIAPWRDWSFKSRTQLLEF
FT                   AEQHQIPVAKDKKGEAPFSVDANLLHSSSEGKVLEDPSQEAPEYVHMRTISPETAPDKA
FT                   TIIKIGFEKGDAVSINGERLSPATLLAKLNDYGRDNGIGRLDLVENRFVGMKSRGVYET
FT                   PGGTILLAAHRAIESITLDRGAAHLKDELMPRYAELIYYGFWFSPEREMLQAAIDHSQR
FT                   HVEGEVTLKLYKGNVMVIGRESAKSLYSDKLVTFEDDQGAYDQKDAAGFIKLNALRLRT
FT                   LAARDRK"
FT   gene            83234..84058
FT                   /pseudo
FT                   /locus_tag="BCAN_A0076"
FT                   /note="Hypothetical protein"
FT   gene            complement(84062..84565)
FT                   /locus_tag="BCAN_A0077"
FT   CDS_pept        complement(84062..84565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0077"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61179"
FT                   /db_xref="GOA:A9M6S8"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6S8"
FT                   /protein_id="ABX61179.1"
FT                   /translation="MNDTFDYIMRFAIVVFSYCCAVLAVGWFLAAILFRNLGIDSMMND
FT                   FVFMANDAGVGPFWAETSFWSSVFVSGFVMATIAGGFSFIPAVIIIILAEARGYRESLF
FT                   YCVAGALIGLAAAGAAVPFSSSSGLPEMSIWIAATTGAGIVGGFVYWLLAGRNAGRLLS
FT                   RPTD"
FT   gene            complement(84599..85834)
FT                   /locus_tag="BCAN_A0078"
FT   CDS_pept        complement(84599..85834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0078"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61180"
FT                   /db_xref="GOA:A9M6S9"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6S9"
FT                   /protein_id="ABX61180.1"
FT                   /translation="MSISFDLTIDDTRDQLARHARASLEAKPSLIGMSREEMAAALIAA
FT                   GVPERQVKMRISQLWHWLYVRGVSDFADMRNISKDLRAMLAQHFTIARPEVVEEQISQD
FT                   GTRKWLFRFPPRGAGRPVEIESVYIPEEGRGTLCISSQVGCTLTCSFCHTGTQKLVRNL
FT                   TSEEILAQLLTARDRLGDFPDKDTPDGAMVPAEGRKITNIVMMGMGEPLYNFEEVKKAL
FT                   LIASDGDGLSLSKRRITLSTSGVVPEIYRTGDEIGVMLAISLHAVRDELRDILVPINKK
FT                   YPLAELIKACREYPGLSNAKRITFEYVMLKDINDSLDDAKLLVKLLQGIPAKINLIPFN
FT                   PWPGTNYQCSDWEQIEKFADYVNAAGYASPIRTPRGRDILAACGQLKSESERLRKSERL
FT                   ALEAMMIAGHGE"
FT   gene            85778..85969
FT                   /locus_tag="BCAN_A0079"
FT   CDS_pept        85778..85969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0079"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61181"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T0"
FT                   /protein_id="ABX61181.1"
FT                   /translation="MAGKLVARIINGKVERNGHLFSTIAGRPRSRAPIKLPDYLGRLHE
FT                   YMGSIIFPCEMRTRWRGS"
FT   gene            85954..86148
FT                   /locus_tag="BCAN_A0080"
FT   CDS_pept        85954..86148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0080"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61182"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T1"
FT                   /protein_id="ABX61182.1"
FT                   /translation="MARLLAQNNPLVIPHEIWRVVQDCGDGRKRKKPGTKPGFEVLPDL
FT                   LDYLHFWIAASAAEMPFRE"
FT   gene            complement(86094..86597)
FT                   /locus_tag="BCAN_A0081"
FT   CDS_pept        complement(86094..86597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61183"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T2"
FT                   /protein_id="ABX61183.1"
FT                   /translation="MLGKSIVAASVFTIAMAGSALAQTPSQIKQFDAWGAYSYQSGNGK
FT                   VCYALSVPTQKAPANVDHGDNFFLVSQKPGQNVSFEPQFMAGYELNPNAKVIVTIGNRN
FT                   FTMFVNGKSGWIENAAEEPQLVAAMRGGADMKVQAQSKRGTKTSYTYSLKGISAALAAI
FT                   QKCK"
FT   gene            complement(87053..87436)
FT                   /locus_tag="BCAN_A0082"
FT   CDS_pept        complement(87053..87436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0082"
FT                   /product="protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61184"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T3"
FT                   /protein_id="ABX61184.1"
FT                   /translation="MDDVKIGEILEPGDESRFRKRSERVKQGFWKAVRRAGRMVPFMDE
FT                   VVAAYYCALDQKTPMRVRMTLMAALAYFVLPFDAIPDILAGIGFTDDVAVLMAALTAVR
FT                   AHITPAHRLAARQALEDEAAVGQ"
FT   gene            complement(87524..87817)
FT                   /locus_tag="BCAN_A0083"
FT   CDS_pept        complement(87524..87817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0083"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61185"
FT                   /db_xref="GOA:A9M6T4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6T4"
FT                   /protein_id="ABX61185.1"
FT                   /translation="MARNRLTESEMNEALRALDGWQKVDGREAITRSFKFKDFSTAFGF
FT                   MAQAALYAEKLDHHPEWFNAYNRVDVTLATHSENGVTELDIKMARKMNAIAG"
FT   gene            88044..88649
FT                   /locus_tag="BCAN_A0084"
FT   CDS_pept        88044..88649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0084"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="GO_function: GO:0004725 - protein tyrosine
FT                   phosphatase activity; GO_process: GO:0006470 - protein
FT                   amino acid dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61186"
FT                   /db_xref="GOA:A9M6T5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T5"
FT                   /protein_id="ABX61186.1"
FT                   /translation="MCRNALVKINFTAVVSPVQKQNTLAPNHMLIRHYSLAPTSVLFVC
FT                   AGNICRSPLAEGVMGYVLEKRGIRHVLIDSAGTNGYHTGEEPDERSIQVAAHHGLDISA
FT                   QRCRQLTMADFSRFDLILGMDRYNMRMITQRQPARITARIGLFTEVAEGKPVEIPDPYY
FT                   GEIGDFELVYRMVLTASTALADQFWPERAIKGQASSTI"
FT   gene            complement(88559..89149)
FT                   /locus_tag="BCAN_A0085"
FT   CDS_pept        complement(88559..89149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0085"
FT                   /product="2'-5' RNA ligase"
FT                   /note="GO_function: GO:0008664 - 2'-5'-RNA ligase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61187"
FT                   /db_xref="GOA:A9M6T6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T6"
FT                   /protein_id="ABX61187.1"
FT                   /translation="MPRLFTALEIPRDAALSLSLLRGGLPGARWIDVENYHITLRFIGD
FT                   VEGHMADEIANALDRVRRPEFMLNLSGVDAFGSKKPHSIYAGVSPSPGLNALQAEIERI
FT                   CQRLRLPADPRKFTPHVTLARLKNARIEDVVHYLSGRANFATLPFKVGRFVLMSSRDSV
FT                   GGGPYIVEEAWPLMARSGQNWSASAVEAVRTIR"
FT   gene            complement(89330..90055)
FT                   /locus_tag="BCAN_A0086"
FT   CDS_pept        complement(89330..90055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0086"
FT                   /product="Arylesterase precursor"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61188"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T7"
FT                   /protein_id="ABX61188.1"
FT                   /translation="MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDALP
FT                   TEQLSQVKIVGFGDSLMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTGGL
FT                   SRIDWSIPDGTNLVILELGANDALRGIQPDITEKNLDEMLAKLKARSISVILAGMVAPP
FT                   NMGKDYAGKFNPIYPRLARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETIVANF
FT                   MPSVEKALKNLQNTGTSGG"
FT   gene            90202..90930
FT                   /locus_tag="BCAN_A0087"
FT   CDS_pept        90202..90930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0087"
FT                   /product="ABC transporter related"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61189"
FT                   /db_xref="GOA:A9M6T8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T8"
FT                   /protein_id="ABX61189.1"
FT                   /translation="MTEKLVGPIIELEDVHLTLGHAASSVHVLKGVSLHIAPGQSVGIV
FT                   GPSGSGKSTLLMVLAGLEHVDNGIVKIAGETISQMSEDQAAAFRGANIGIVFQSFHLIP
FT                   NMTALENVAVPLELAGRRDAFDVAERELRAVGLGERLTHYPSELSGGEQQRVAIARALA
FT                   PSPKILIADEPTGNLDTATGRQIADLLFAKQRENGLTMVLVTHDPSLAARCDREIPVRS
FT                   GRIAEPVQGAGIPETQAVRA"
FT   gene            90927..93476
FT                   /locus_tag="BCAN_A0088"
FT   CDS_pept        90927..93476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0088"
FT                   /product="protein of unknown function DUF214"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61190"
FT                   /db_xref="GOA:A9M6T9"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6T9"
FT                   /protein_id="ABX61190.1"
FT                   /translation="MNSARSFSLALRFALREMRGGLSGFYIFLACIALGVAAIGGVNSV
FT                   ARSVSSGITAQGQSILGGDISFALNQREVTPAERAFIEKQGKMAASATMRSMARMPDGS
FT                   DQSLVEVKAVNDAYPLYGTLKVSPQQSLADMTREKDGAYGAAVSRDFLDRMGLSLGARV
FT                   LLGSQTFELRALIENEPDLLSSGFNFAPRFLVSLEGLHAAGLVQPGSLVNHIYKVALPD
FT                   GAPDAAIANVRRQAATGFPDAGWNIRTRANAAPALSANVERFSRFLTLVGLTALIVGGV
FT                   GVANAVRAYLDGKRGVIATFKSLGAPARFAVLVYLIQIMVIGLIGIAIGLVLAAIIPYA
FT                   TGAALAAYLPVAAGGGFFPGALALAAIFGLVTTLAFAIIPLGRARDIPATALFREQGGE
FT                   QRGRPALFYLGLAILLIAALAGLALYVAYDRHIAAIFIVSAIAAFGVLRLVADGIRWLA
FT                   RRAPRVRSTALRLAVGNIHRPGALTPSVVLSLGLGLTLMVAIALIDGNLRRQVTENIPA
FT                   QAPDFFFVDIQNKDMGDFTKLVRGIVPDGKLTSGPMLRGRIVAFNGQNVRDMKIPPEAA
FT                   WVLRGDRGITFAEKVPENATLSEGAWWPADYSGEPLVSFSGREGKELGLKLGDRVTVNV
FT                   LGRNITAKIASFREVQWETLAMNFVMVFSPNTFAGAPATWLATLTIPDGEKNLAPDVLR
FT                   QVTKTWPAITTVSVSDALDVANNLLSQLATAIRAAASIALAASVLVLGGALAAGNRARV
FT                   HDAVVLKTLGATRATLIAAYVMEYMLLGLATAIFALVAGGVAGWYVVVEIMKLKAIFLP
FT                   DVALMTVVIALVLTVGFGLAGTWRVLGQKPAQVLRSL"
FT   misc_feature    93617..93692
FT                   /note="ybhL leader; BCAN_A0089"
FT   gene            93711..94448
FT                   /locus_tag="BCAN_A0090"
FT   CDS_pept        93711..94448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61191"
FT                   /db_xref="GOA:A9M6U0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U0"
FT                   /protein_id="ABX61191.1"
FT                   /translation="MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVT
FT                   GLAAFGTAVLAQSNPAFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWG
FT                   YAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFG
FT                   LILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMG
FT                   ALRLYLDFINMFMFLLQFMGNRE"
FT   gene            94563..95102
FT                   /gene="pat"
FT                   /locus_tag="BCAN_A0091"
FT   CDS_pept        94563..95102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat"
FT                   /locus_tag="BCAN_A0091"
FT                   /product="Phosphinothricin N-acetyltransferase"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61192"
FT                   /db_xref="GOA:A9M6U1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U1"
FT                   /protein_id="ABX61192.1"
FT                   /translation="MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFA
FT                   AFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRE
FT                   LIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQL
FT                   PLNGGRSTEPGPSPLS"
FT   gene            complement(95122..95523)
FT                   /locus_tag="BCAN_A0092"
FT   CDS_pept        complement(95122..95523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0092"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61193"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U2"
FT                   /protein_id="ABX61193.1"
FT                   /translation="MDISSAANEDSSSLSSHTSETAKVVPLDRPRPTPSTISFDRHELG
FT                   KILNIYGRMVATGAWRDYAIDHLSDRAVFSIFRRASEVPLFRIEKNPKLQQKQGAYSVI
FT                   AASGLIMKRGHELERVLRVFDKSLKLVET"
FT   gene            complement(96073..96807)
FT                   /locus_tag="BCAN_A0093"
FT   CDS_pept        complement(96073..96807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0093"
FT                   /product="protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61194"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U3"
FT                   /protein_id="ABX61194.1"
FT                   /translation="MGLTFTSCVFIQGSARAQDGNKATAVLELYTSQGCKSCPPADKNF
FT                   AKYADDPNVLALSFHVNYWDYMGWRDTLATQDNTDRQNSYRNAFHAKMIYTPQAIINGA
FT                   VEANGRNGAAINAKIAANKLDVPVSIQQLNDGRLSIDIGAGKKPRDPVHVVLFYFRDSA
FT                   TIPITEGENAGKAVTYRNTVSDIDTIGMWDGKPLKIELPASELKRKDVTGCAVVLQETR
FT                   SDNSLGPMHGAAMFKQKRPVSF"
FT   gene            complement(96960..97100)
FT                   /locus_tag="BCAN_A0094"
FT   CDS_pept        complement(96960..97100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0094"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61195"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U4"
FT                   /protein_id="ABX61195.1"
FT                   /translation="MTSSLNQTRNKNGEPPEKSGGFSFGAPNMGTTMAIAARPAPSLTA
FT                   T"
FT   gene            complement(97084..99771)
FT                   /gene="acnA"
FT                   /locus_tag="BCAN_A0095"
FT   CDS_pept        complement(97084..99771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="BCAN_A0095"
FT                   /product="aconitate hydratase 1"
FT                   /note="GO_function: GO:0003994 - aconitate hydratase
FT                   activity; GO_process: GO:0006099 - tricarboxylic acid
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61196"
FT                   /db_xref="GOA:A9M6U5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U5"
FT                   /protein_id="ABX61196.1"
FT                   /translation="MSQIDSFKCRKTLSVGGKEYVYYSLTEAEKNGLAGISSLPFSMKV
FT                   LLENLLRFEDDRSVKKSDIENVAKWLADRGKAGAEIAYRPARVLMQDFTGVPAVVDLAA
FT                   MRDGIKALGGDPEKINPLVPVDLVIDHSVIVDDFGNPLAFQHNVDLEYQRNGERYRFLK
FT                   WGQQAFKNFRVVPPGTGICHQVNLEYLAQAVWTKEEDGVTLAYPDTCVGTDSHTTMVNG
FT                   LGVLGWGVGGIEAEAAMLGQPVSMLLPEVIGFRLTGKLKEGVTATDLVLTVTQMLRKKG
FT                   VVGKFVEFFGAGLDNMSLADRATIGNMGPEYGATCGFFPVDQETLKYMNMTGRDEHRLE
FT                   LVEAYCRAQGMWRDSSSADPVFTDVLELDMGDVVPSMAGPKRPEGRIPLENIGSGFATS
FT                   LETEYKKTTGQSTRYPVEGENFDLGHGDVVIAAITSCTNTSNPSVLIAAGLLARNAVAK
FT                   GLKTKPWVKTSLAPGSQVVAAYLEDAGLQKDLDALGFNLVGFGCTTCIGNSGPLPAPIS
FT                   KTINEKGLIAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAHALAGTVTKDLTKEPLGE
FT                   DKDGNPVYLRDIWPSTQEIQDFIAKNVTRKLFSEKYADVFKGDANWQTVQVPAGQTYAW
FT                   DDNSTYVQNPPYFVGMGKTAGMIGDVKGARILGLFGDKITTDHISPAGSIKAQSPAGKY
FT                   LLDHGVAVADFNQYGTRRGNHEVMMRGTFANIRIRNHMLGENGREGGYTIHYPSKKEMS
FT                   IYDAAMEYKAEGVPLVVFAGVEYGNGSSRDWAAKGTNLLGVKAVIAQSFERIHRSNLVG
FT                   MGIVPFVFEEGTSWQSLGLKGDEIVTIEGLADVRPRQRVEASITYADGTVKKVPLICRI
FT                   DTLDELDYMKNGGILQTVLRDLVA"
FT   gene            100115..100762
FT                   /gene="ccmA"
FT                   /locus_tag="BCAN_A0096"
FT   CDS_pept        100115..100762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="BCAN_A0096"
FT                   /product="heme ABC exporter, ATP-binding protein CcmA"
FT                   /note="GO_function: GO:0015232 - heme transporter activity;
FT                   GO_process: GO:0015886 - heme transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61197"
FT                   /db_xref="GOA:A9M6U6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U6"
FT                   /protein_id="ABX61197.1"
FT                   /translation="MRLEAENLAGERGGETIFSHLSFTIGTGQALVVTGPNGSGKSTLL
FT                   RIICGLLAPEAGEVKLTEGTQIVPVRAACHYLGHQNAMKPALSVRENLLFWQKFNGGEA
FT                   LDIGAALEAVDLAGVEHLPFGYLSTGQKRRVSIAKLLVSHRPLWIVDEPTACLDKASEA
FT                   RFAELMREHMRQDGMIIAATHIPLGLDGAISTTGNALVRSLDMAAFSVEDIA"
FT   gene            100762..101427
FT                   /gene="ccmB"
FT                   /locus_tag="BCAN_A0097"
FT   CDS_pept        100762..101427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="BCAN_A0097"
FT                   /product="heme exporter protein CcmB"
FT                   /note="GO_function: GO:0015232 - heme transporter activity;
FT                   GO_process: GO:0015886 - heme transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61198"
FT                   /db_xref="GOA:A9M6U7"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U7"
FT                   /protein_id="ABX61198.1"
FT                   /translation="MLALFLRDMRLGLRAGGGALIGILFFLAVISVMPFGVGPDLNLLA
FT                   RIGPAMLWIGALLATLLGLDRLFQADREDGSLDLLLIGADRHMLAFTVFVKCAAHWVAS
FT                   VLPLVVASPMLGLFMNMDATAIGATALTLLVGTPAIAFIGAVGAALAVALPRGGLLVSV
FT                   IVLPLTIPVLIFGVSASYGATDAVAPFFAPFLILAALTLFFAVLGPLAASAALKNSAD"
FT   gene            101485..102270
FT                   /gene="ccmC"
FT                   /locus_tag="BCAN_A0098"
FT   CDS_pept        101485..102270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="BCAN_A0098"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61199"
FT                   /db_xref="GOA:A9M6U8"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U8"
FT                   /protein_id="ABX61199.1"
FT                   /translation="MKDAAKTASWLDLANPTRFLAFAGRVVPWLGLASAIFLAVGLYMV
FT                   FLSPDDYQQGSTVRIMYIHVPFAWLSMMCYSIMAVSSLGTLVWRHPLADVSVRAAAPIG
FT                   AVFTALALATGSLWGKPMWGTWWVWDARLTSVFVLFLMYLGIIALSRAMDDPARSAKPV
FT                   AVLTLVGFINVPIIKFSVDWWNTLHQPASVFRLDGPTIDGSMLRPLFVMAIGFTLLFFT
FT                   LHMMAMRNEIWRRRVASMKKLAARNVDRNRAGQVEEGAL"
FT   gene            102267..102440
FT                   /locus_tag="BCAN_A0099"
FT   CDS_pept        102267..102440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0099"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61200"
FT                   /db_xref="GOA:A9M6U9"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6U9"
FT                   /protein_id="ABX61200.1"
FT                   /translation="MSNHLGFIIASYGITVAALAVTIGWILIDQRIQKNELKRLEAQGV
FT                   RRRSAKAPGKAQ"
FT   gene            102437..103048
FT                   /gene="dsbE"
FT                   /locus_tag="BCAN_A0100"
FT   CDS_pept        102437..103048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="BCAN_A0100"
FT                   /product="periplasmic protein thiol:disulfide
FT                   oxidoreductase, DsbE subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61201"
FT                   /db_xref="GOA:A9M6V0"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V0"
FT                   /protein_id="ABX61201.1"
FT                   /translation="MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSI
FT                   IPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSEDLKTGPGGKLTLVNVWGSWCVPCRQ
FT                   EHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGVYGV
FT                   PETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR"
FT   gene            103235..103354
FT                   /locus_tag="BCAN_A0101"
FT   CDS_pept        103235..103354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61202"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V1"
FT                   /protein_id="ABX61202.1"
FT                   /translation="MVVQLSGAVQWAGLLLFLIIDQSGSFRTAPLAALVAIAA"
FT   gene            complement(103297..105132)
FT                   /gene="ilvD"
FT                   /locus_tag="BCAN_A0102"
FT   CDS_pept        complement(103297..105132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BCAN_A0102"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="GO_function: GO:0004160 - dihydroxy-acid dehydratase
FT                   activity; GO_process: GO:0009097 - isoleucine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61203"
FT                   /db_xref="GOA:A9M6V2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M6V2"
FT                   /protein_id="ABX61203.1"
FT                   /translation="MPPYRSRTTTHGRNMAGARGLWRATGMKDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIESAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVVWEDSVKKLD
FT                   LVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTL
FT                   ATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIATFSAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEAEIDFTMADIDRLSRRVPVLCKVAPAVSSVHMEDVHHAGGIMGILGQLD
FT                   NAGLLTTSIPTVHSETLAKALDHWDVTRTNSEMVHKFYSAAPGGVPTQVAFSQERRFDK
FT                   VDTDREKGVIRSKEHAFSQDGGLAVLYGNLAEDGCIVKTAGVDDSILKFSGPARIFESQ
FT                   DSAVLGILNGKIKPGDIVLIRYEGPRGGPGMQEMLYPTSYLKSKGFGKACALITDGRFS
FT                   GGSSGLSIGHVSPEAAEGGTIGLVREGDIIDIDIPNRKIHLAVDDATLAERRAEQDAAG
FT                   WKPAEERKRKISTALKAYAAMATSAARGAVRKLPD"
FT   gene            105314..105451
FT                   /locus_tag="BCAN_A0103"
FT   CDS_pept        105314..105451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0103"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61204"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V3"
FT                   /protein_id="ABX61204.1"
FT                   /translation="MSHCPTHQGGIRNQSNGLISPRRRFALLLEMLQRAAVLQTPASAI
FT                   "
FT   gene            complement(105532..105963)
FT                   /locus_tag="BCAN_A0104"
FT   CDS_pept        complement(105532..105963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0104"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61205"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V4"
FT                   /protein_id="ABX61205.1"
FT                   /translation="MPDDFATVLKQVEEASDAVVHPRAPHMPFACAVFSADFGAPIKNS
FT                   FSPRNPSLLFDIDPPEQQQAEQGNEGIALRMACQSPDAIRMELGLGPELKRADLQRCRR
FT                   RFAAQNHPDRLPPQFREAAEQRMKTANALLDAAMLLAHA"
FT   gene            complement(105990..106367)
FT                   /locus_tag="BCAN_A0105"
FT   CDS_pept        complement(105990..106367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0105"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61206"
FT                   /db_xref="GOA:A9M6V5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V5"
FT                   /protein_id="ABX61206.1"
FT                   /translation="MMNDLEHRRILVVEDEVFVALDVAATVEDANGTVVGPVGTVRQAI
FT                   DLINRQEVDAAILDVNLADGDVEPVLDRLKSRNIFVVIHTGGGLPPRLAARYPEMPVFQ
FT                   KPIPPSVLTRTLATAFSSSVA"
FT   gene            complement(106542..106778)
FT                   /locus_tag="BCAN_A0106"
FT   CDS_pept        complement(106542..106778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0106"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61207"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V6"
FT                   /protein_id="ABX61207.1"
FT                   /translation="MKPVFLQLQCAPGKTYEVADTLFQREIVSELYSTSGEFDLLAKIY
FT                   IAENEDIGKFINENVLDIPNIVRSLTTLTFTAF"
FT   gene            107431..107835
FT                   /locus_tag="BCAN_A0107"
FT   CDS_pept        107431..107835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0107"
FT                   /product="protein of unknown function DUF930"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61208"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V7"
FT                   /protein_id="ABX61208.1"
FT                   /translation="MKFLPVLSPFAILLSLAAMTLPSVAMNASEKAQLERLDPATRLEQ
FT                   RCDVEAMERISHDQAKFSVDKVLAYAFSDPVTKKNTIRADGAAFRSREHWYRLSYNCKT
FT                   DDEHINIQSFSYGIGSEVPQDQWDKHYLVP"
FT   gene            complement(107921..108625)
FT                   /locus_tag="BCAN_A0108"
FT   CDS_pept        complement(107921..108625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0108"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61209"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V8"
FT                   /protein_id="ABX61209.1"
FT                   /translation="MRPGSGLRGQVFSPGLGQSCDRHLQNAANGKSLQGPAAIFGASLI
FT                   TGKPATCADKAMAYAWPCDSRTSEKRLPMIDFKAIPVFSELLNRTSHLFYRIIRRNAVS
FT                   RFWPENAVGKKMTASALLAVALMPVSAHAQADEEQPPIERVDYICERSVVVPVTYIRSN
FT                   GAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRWADRGGQATLSHLEADHTAKEVT
FT                   LLSACRADTAEE"
FT   gene            108697..109515
FT                   /locus_tag="BCAN_A0109"
FT   CDS_pept        108697..109515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0109"
FT                   /product="protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61210"
FT                   /db_xref="GOA:A9M6V9"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6V9"
FT                   /protein_id="ABX61210.1"
FT                   /translation="MFTFRKSGHVTLNLITALLVLGVFLWWGKWRKTGVLLIALAVISY
FT                   GAIVSTWLPNFLMSRLQEPYSSKLAEPLEDNTVFVVFGLGTQTVNEQGHNTVEPLTFSY
FT                   GSIFAAAHFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDR
FT                   PHNAWTTARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGS
FT                   THFSTSLSFLAMDLALNEEIGAWRYVTYNLMDWNAPKAFVQTVPAPRSTQ"
FT   gene            109793..110821
FT                   /locus_tag="BCAN_A0110"
FT   CDS_pept        109793..110821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0110"
FT                   /product="sulfate ABC transporter, sulfate-binding protein"
FT                   /note="GO_component: GO:0030288 - outer membrane-bounded
FT                   periplasmic space; GO_function: GO:0015419 -
FT                   sulfate-transporting ATPase activity; GO_process:
FT                   GO:0008272 - sulfate transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61211"
FT                   /db_xref="GOA:A9M6W0"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6W0"
FT                   /protein_id="ABX61211.1"
FT                   /translation="MRLSKFSFALSAFVAVASLAGMIEVGHADQTLLNVSYDPTRELYK
FT                   DYNAAFAEHWKAQTGENVTIRSSHGGSGKQARSVIDGVRADVVTLALESDIDAIAEFSG
FT                   KISKDWRKRLPNNSAPHTSTIVFLVRKGNPKGIKDWGDLVKDDVEVITPNPKTSGGARW
FT                   NYLAAWAWAYRQYGGDEQKIKDYIAELFRHVPVLDTGARGATTTFVQRQLGDVLLAWEN
FT                   EAYLSVAEFGDDAFDIVVPPQSILAEPPVAVVDRNAEENGTTKLATAYLEYLYSPEGQA
FT                   IAAKHFYRPSRPEIIPANQQRKFPDLTLVTIDDPIFGGWAKAQPYHFGDGGTFDQIYKP
FT                   GK"
FT   gene            110916..111782
FT                   /gene="cysT"
FT                   /locus_tag="BCAN_A0111"
FT   CDS_pept        110916..111782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="BCAN_A0111"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015419 - sulfate-transporting
FT                   ATPase activity; GO_process: GO:0008272 - sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61212"
FT                   /db_xref="GOA:A9M6W1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6W1"
FT                   /protein_id="ABX61212.1"
FT                   /translation="MSSLPAQARAGWHFRKPSVIPGFGLTFGFSVAYLTLIILIPLAAL
FT                   VLRSSDVGLAGFWRIVTDERTLKALETSFGTAFIAALVNVVFGVILAWVLVRYRFAGRR
FT                   FVDAIVDIPFALPTAVAGISLAAIYAPNGWIGGLLSPYGIRIAFTRMGIVIALIFIGLP
FT                   FVVRTVQPIIEEISREVEEAAATLGASRFQTIWRVLLPGLQPAIITGFALAFARGIGEY
FT                   GSVIFIAGNTPYKSEIAPLLIVIKLEEYDYAGATALATVMLALSFAMLLFINLIQTRIR
FT                   RKYGHGA"
FT   gene            111772..112638
FT                   /gene="cysW"
FT                   /locus_tag="BCAN_A0112"
FT   CDS_pept        111772..112638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="BCAN_A0112"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015419 - sulfate-transporting
FT                   ATPase activity; GO_process: GO:0008272 - sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61213"
FT                   /db_xref="GOA:A9M6W2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6W2"
FT                   /protein_id="ABX61213.1"
FT                   /translation="MAHEAACTRHGAVTESPPVRIALIALALAFLALFLILPVVAVFVE
FT                   AFRKGMSEYIAALVEPDAWAAIKLTLTVAAIAVPLNVVFGIAAAWAIAKFEFKGKALLT
FT                   TLIDLPFSVSPVISGLVFVLLFSSHSLLGPWLSRHGIEILFAVPGIVLATVFVTFPFVA
FT                   RELIPLMQEQGTGDEEAAISLGASGWQAFRYVTLPNIKWGLLYGVLLCNARAMGEFGAV
FT                   SVVSGHIRGLTNTMPLHVEILYNEYNFVGAFAVASLLAFLALLTLAIKAVLELRYGDEL
FT                   AGSGNGH"
FT   gene            112736..113815
FT                   /gene="cysA"
FT                   /locus_tag="BCAN_A0113"
FT   CDS_pept        112736..113815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="BCAN_A0113"
FT                   /product="sulfate ABC transporter, ATP-binding protein"
FT                   /note="GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_function: GO:0015419 - sulfate-transporting
FT                   ATPase activity; GO_process: GO:0008272 - sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61214"
FT                   /db_xref="GOA:A9M6W3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6W3"
FT                   /protein_id="ABX61214.1"
FT                   /translation="MEVRVAGVRKEFARFPALHNVSLTIQSGELIALLGPSGSGKTTLL
FT                   RLIAGLETPTEGMIFFGDEDASQKSVQERNVGFVFQHYALFRHMTVADNIGFGLKVRPG
FT                   GTRPSTAEIRRRALELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPRVLLLDEP
FT                   FGALDAQVRKELRRWLREIHDKTGHTTVFVTHDQDEALELADRVVVMSQGRIEQVGTPD
FT                   EVYDKPNSPFVYGFIGESSTLPVRVENGEVWLADRNIGLGAENMPDGDAQLYFRPHDVE
FT                   LLDGCGGCIAGTVIASRRSGGKRRVELEVGGARERIEIEIPAEHPAAEKSRIAFRPRYW
FT                   TLFRAGDSELPAPKAAATT"
FT   gene            114201..122804
FT                   /locus_tag="BCAN_A0114"
FT   CDS_pept        114201..122804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0114"
FT                   /product="glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61215"
FT                   /db_xref="GOA:A9M6W4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:A9M6W4"
FT                   /protein_id="ABX61215.1"
FT                   /translation="MPELSSSLSNSSTEHKTSEQIPPEQPSPIRAHYKTEEELSVLAAA
FT                   VARGEDIPLPGYLAFPFDQRLSENGKLILHAYRASDAASRAGETITPAAQWLLDNHYQI
FT                   DKNVQQARRDLPRRFIRQLPLYKVPLEQYEGMPRIFALAWLYVAHTDSNFSLKMLTAMV
FT                   KGFQTVEPLKIGELWALPSAVRYFLIENARRLAMRVDRAREMRNLANTAADRIVVAAEG
FT                   AELDGILAQYASAACDSTFATHLLYRLRSSSTDTTAAASWLERILEQDGSNPEDAIIEE
FT                   HARQSTGGVTMGNVIRSLKSIDDVDWETWFETVNEVDAILRDHSDFELLDFRSRNAYRV
FT                   TIEKLARYSDMSEIDITWAALKLAEDGSRAEKAGHPEAEGKGAISYYLSGEGRRDLEKV
FT                   CGYRAPFGVKALRLYRGLGLWGLFVPTAIFTVLTLLLVNYCMMRAGLSTDLRTLFTLLA
FT                   IFPAMDASYSLFNVLVPWFVQPTRLIGFEYKDGLPPEARTLVAVPTFITSRDSIDEQIR
FT                   NLEVHYLTNPRGEIYFALVSDWTDASQEIVPADMEIYEYARDEIAKLNEHYTGDDQPRF
FT                   FLLNRRRLFNEKQGCWMGWERKRGKLHELNLLLRGDQDTSFFPADERLPKDIKYVMTLD
FT                   ADTRLTPEAVTHLAGKLNHPMNRPVIDEKTGKVVRGYGILQPRVTPSLTTGDEASFLQR
FT                   VFSVNRGIDPYVFAVSDTYQDLLGEGTFTGKGLYDIDAFEAALKGRVPENTLLSHDLLE
FT                   GGYARSALVSDVEVVEDYPTGYNVDVSRHHRWARGDWQLLPWLFTTGRGVSAITRWKMV
FT                   DNLRRSLNPILWLIAAIVGWSVLPLGAAAVWQGFLILSMFVAPTFGIVTNLIPASMDYS
FT                   LKGHAQSVLTDIALGTADVALRTTFIAHSAFLMADAIARTIYRLFISRRNLLEWRTAAQ
FT                   ARTSPDTLLFYFQLMWPAMAIAGLAIFFPLAAESHAALIAAPFVVIWFASPLIAWLVSR
FT                   SAKPQDTLEVLSSDKADLRHYARRTWRYFAEFANEENNHLPPDNFQEDPAPIVAQRTSP
FT                   TNIGVYLLSVIAARDFGWIGFDETLDRVEATLGSLDKMEKYQGHLYNWYETNTLNPMRP
FT                   LYVSAVDSGNLAGHLVTLSSALEEWAEAPSVYVQGDLDGIIDVNDILEETIARIPDDRR
FT                   VLRPLRRRLEERIANFRRAVTSIKDEPETASFRTINLSLFASDIVRLMDELDSEVETVA
FT                   SAEAREWARILVDTCKAHTDDAIGEHDTDALRERLRDLATRARQLAFDMQFGFLERKER
FT                   RLLSIGFRVQENELDESCYDLLASEARLASLFAIAKGDVPVEHWFKLGRLLVPVGWKGA
FT                   LLSWSGSMFEYLMPPLVMSEPLGSLLDQTNKLVVQRQIDYATSRGLPWGISEAAFNARD
FT                   AHLNYQYSNFGVPNLGLQRGLSRNAVIAPYASLLAAQYQPAAAVANLKRLAKLGALGRY
FT                   GFHDSVDFTPSRIREGETCAVVKNYYAHHHGMSIIAVNNVIFEGRMRERFHNDPVIEAA
FT                   ELLLQEKAPREIPMIYAKTENPMRVDSGGFDDAPMRIIDKPFRAPRTTHMMSNGQYALM
FT                   VTANGSGYSRWHNWDITRFHADASEDMQGTFLFLRDMESGYWWSATGEPVRNPDEETKT
FT                   VFTEDKAEFYKTAGDIKTVMEVIVASEADGEGRRLDIINTSPRDRMIEVTSYAELVLND
FT                   SDSDAAHPAFAKMFVETEIADSGSTIYAKRRKRAPSDPDIHAAHFVTDLSGALREIEVE
FT                   TDRRAFIGRGRSLRNAAAFDPGAKFTGSQGCVLDPIVSVRTRVRVPAHKKVSLVFWTFA
FT                   GGSRDAVEHAVTMHRHPETFAREYSLSWTSSQVQLYHIGIKPAEAADYQKVAAYLLYPE
FT                   RTLRQPPETIASGLGKQSDLWPMSISGDYPIFALRIDNEADLDVLRGVLRAQEYWRLKG
FT                   LIVDVVAVNERAFSYAQDTQRAIDWIVEGFRARGGGQPHIFAVRRDQMSEESYNTLLAS
FT                   ARIVMHAQNGSLAEQLRRSEEITVDLAARSDARTATNGQASVQGLGAAGLAPVAIERGA
FT                   EERRPVVKPPVDRPRPSGDDLRFWNGYGGFAEDGSYVVRINGRTSTPHPWINVIANPSF
FT                   GFHVSAEGSAFTWAGNSRDYQLTPWANDPVTNRPGEAIYILDRETGRSFAPTANVLRDE
FT                   AVTYEARHGHGYSAFSAQHGELALELTHIVDAEKPVRLSRLTITNKGRSKRKLRVYGYV
FT                   EWVLGNARARNVPFIVPSQDEELGALFAGNPYHPDKSGQVAFFAASEKPQSVTADRGEF
FT                   IGTAGSVDRPEIVLAGKVLSGTVEAGRDPCAALALDIEVGPGEAREIVFLLGNTADQKQ
FT                   AKALIADMRTASFEEKLVAARHQWESFFNRVQVKTPDPAFDLMVNGWLPYQAVACRIWA
FT                   RAAFYQASGAFGFRDQLQDTLSLLLVDPSLAREQILNAASRQFREGDVQHWWLPATGAG
FT                   VRTLISDDVVWLGYGASLYVETTGDRSILDEKLPFLEGRKLEEGEHDAFYEPEISKETA
FT                   SLYEHCALALDLAVARTGKHGLPLILGGDWNDGMNLVGVKGKGESVWLGWFLAYTLKAF
FT                   IPLAEARKDQKRADLWKAHVESLTAALDRDGWDGEWYRRGFYDNGRPLGSKNSDECQID
FT                   AIAQSWSVLSGVADPKRAEKAMASLEKYLLDEDNALLRLFTPPFDVTPQEPGYIKGYPP
FT                   GVRENGGQYTHGATWAILALARMGKAAEAWRLFSLISPVSHGRNPDVYRVEPYVIAADI
FT                   YSVAPRCGQGGWTWYTGSAGWFYRVATEGILGVTKRGDRLHFQPALPPEWEGYEAELRF
FT                   GEALYRVKVVAGAKAGTIRLNGRKLAKPDEGVALKPDGEHEIVVELPKQ"
FT   gene            122894..124198
FT                   /gene="pncB"
FT                   /locus_tag="BCAN_A0115"
FT   CDS_pept        122894..124198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BCAN_A0115"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /note="GO_function: GO:0004516 - nicotinate
FT                   phosphoribosyltransferase activity; GO_process: GO:0019358
FT                   - nicotinate nucleotide salvage"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61216"
FT                   /db_xref="GOA:A9M757"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M757"
FT                   /protein_id="ABX61216.1"
FT                   /translation="MAKTDLARRVYNHTWKLDPIIRSLLDTDFYKLLMLQMIWGLYPRV
FT                   DATFSLINRTSSVRLADEIDEGELRAQLDHARTLRFSKKEMIWLAGNTFYGRKQIFQPE
FT                   FLAWLHDFHLPEYELRRKDGQYELHFHGPWTHTTMWEIPALAIINELRSRAAMKNLGPF
FT                   SLDVLYARAKAKMWSKVERLRQLPDLKISDFGTRRRHSFLWQRWCVEALKEGIGSAFTG
FT                   TSNVLLAMDTDLEALGTNAHELPMVLAALAKTDDELRSAPYRVLQDWNRYYGGNLLIVL
FT                   PDAFGTAAFLRNAPDWVADWTGFRPDSAPPIEGGERIIEWWKSKGKDPREKLLIFSDAL
FT                   DVDTIEETYRHFEGRVRMGFGWGTNLTNDFAGCAPQSIDGLKAISLVCKVTDANGHPAV
FT                   KLSDNPQKATGDPKEVARYLRFFGNEERVEQLVRV"
FT   gene            complement(124240..125070)
FT                   /locus_tag="BCAN_A0116"
FT   CDS_pept        complement(124240..125070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0116"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61217"
FT                   /db_xref="GOA:A9M758"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A9M758"
FT                   /protein_id="ABX61217.1"
FT                   /translation="MDVLRIAAFSQGDKGGNPAGVMIADRLPSPQDMQKIAKDVGFSET
FT                   AFAAPDGESWRVRYFAPEMEVPFCGHATIALGAALAMREGDGRFALRLNHDEISVEGRK
FT                   EGELFAASLQSPRTRNRAATEAEIGQALALFNYEPDDLAHGISPALIHAGADHIVLPLR
FT                   SREKLASMHYDLSRGRGTMSRQGWTTILLIYSETPRRFHARNPFASGGVYEDPATGAAT
FT                   AAFAAYLRDIGWPHGGSIEVFQGEDMGSPSHLHAEIGTERGGSIRVSGTARLME"
FT   gene            complement(125180..125968)
FT                   /locus_tag="BCAN_A0117"
FT   CDS_pept        complement(125180..125968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0117"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61218"
FT                   /db_xref="GOA:A9M759"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M759"
FT                   /protein_id="ABX61218.1"
FT                   /translation="MAQNIYDRDDFFTAYSQLPRSVHGLEGAPEWPVVRSLLPDLTGRD
FT                   IADLGCGFGWFCRFAREQGAASVTGYDLSQNMLERARRDTQDDAVCYIQADMERLELPE
FT                   ASFDLVYSSLAFHYIRDFPRILKTIHAALRPDGRFVFTIEHPIFMASLAPGWIEEGNGQ
FT                   KRWPVDHYAVEGERQTDWLAEGVIKYHRRLSTTVNALIEAGFAINRLEEWYPSPEQIAA
FT                   WPALSEEMERPMLLLVSASVVDLNPKSVHGAAPGAFPAKM"
FT   gene            complement(125991..126917)
FT                   /gene="frk"
FT                   /locus_tag="BCAN_A0118"
FT   CDS_pept        complement(125991..126917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="BCAN_A0118"
FT                   /product="Fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61219"
FT                   /db_xref="GOA:A9M760"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9M760"
FT                   /protein_id="ABX61219.1"
FT                   /translation="MILCCGEALIDMLPRETTGGETAFQPFAGGSVFNTAIALGRFGVP
FT                   TGFFSGISSDFFGDVLRDTLARSNVDYSFAAISNRPTTLAFVRLVDGQARYAFYDENTA
FT                   GRMLSRNDMPYVDETISAMLFGCISLISEPCGSVYETLLAREAPNRVMFLDPNIRANLI
FT                   TVRETHLTRMKRMIALADIVKLSDEDLDWFGEKGSHDEIAAEWLKLGPKLVVITKGAHG
FT                   AVAYTNHATVPVPGVKVDVVDTVGAGDTVNAGILASLHSQGLLTKDALANLSEDQIHSA
FT                   VALGVRAAAVTVSRAGANPPWAHEMRD"
FT   gene            complement(127008..127814)
FT                   /locus_tag="BCAN_A0119"
FT   CDS_pept        complement(127008..127814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0119"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61220"
FT                   /db_xref="GOA:A9M761"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M761"
FT                   /protein_id="ABX61220.1"
FT                   /translation="MSPDSNTDNSRPGVSSSEIPRTDTERKTLVLTGASRGIGHATVKR
FT                   FSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSKLH
FT                   ALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGSVVN
FT                   VTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILSPGT
FT                   DKLVEQLPMRRLGKTSEVAETIYFLCTEASSYVTGSEIHINGGQHV"
FT   gene            complement(127935..130226)
FT                   /locus_tag="BCAN_A0120"
FT   CDS_pept        complement(127935..130226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0120"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61221"
FT                   /db_xref="GOA:A9M762"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9M762"
FT                   /protein_id="ABX61221.1"
FT                   /translation="MASRDDRNRRIEPSFGGEEKREDEVFQVDEEDRMARSQQRRQKQS
FT                   ADRAPRSSRGGKRKQRGFFGFLRRSIYWFLVLGLWGGIAFAGLLVYFAAKMPPTTAWAI
FT                   PDRPPNVRIVDVNSNLIANRGTTGGEAVSLHEMSPYIPQAVIAIEDRRFNSHFGIDPIG
FT                   LARAIVTNVVSGRAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVMLALWLEHKYTKDQI
FT                   LEMYLNRVYLGSGAFGVDAASRRYFNKSAKDVNLMEAATLAGLLKAPSRLSPARDPEAA
FT                   AARARLVLGAMREEGMIDDRQVAIAESEPPTRAPSYWQGSENYVADKVVAELPELIGEA
FT                   KDDIIVQTTIDLNLQRAGEEAIKDQIEQNGKKMNASQGALVSIDNTGAVRAMVGGVDYA
FT                   ASQFDRVTDAHRQPASSFKPFVYLSALEQGRTPDSVRNDAPVRIGKWTPSNDNGKYMGP
FT                   VTLATALSHSLNSVAAQLVMEVGPQTVIDTAHRLGVQSKLEPNASLALGTSEVTLLELT
FT                   DAYVPFANGGYRAPVYFITKMTDSDGNVLYQKEDGVGPRVIDERNVGMMNAMLRRTVED
FT                   GTAKRAAFGWPAAGKTGTSQNFRDAWFIGYTANLTTGVWFGNDDGKGMKRVFGATLPVA
FT                   AWKSFMKEAHKGVPIAELPGHYDIQNVLPGGSDGIDPNAPYDPGMMQQDNYGNQPMAGT
FT                   GDDGYWPPAPDLPGRSGIQQGETGQPLASSARNNGDYRPMPAGNVGEQPQAQPARKSTT
FT                   LLDIIMGNSQ"
FT   gene            complement(130431..131123)
FT                   /gene="ropB"
FT                   /locus_tag="BCAN_A0121"
FT   CDS_pept        complement(130431..131123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropB"
FT                   /locus_tag="BCAN_A0121"
FT                   /product="22 kDa outer membrane protein precursor"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0015288 - porin activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61222"
FT                   /db_xref="GOA:A9M763"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A9M763"
FT                   /protein_id="ABX61222.1"
FT                   /translation="MTFKNLLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAGA
FT                   YFGGQVGYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNN
FT                   LKKSRDFITSGNPVQTTGETQLRWSGAVRARAGYAIDRFMPYIAGGVAFGGIKNSLRIG
FT                   GEESSKSKTQTGWTVGAGIDYAATDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDI
FT                   RLGVAYKF"
FT   gene            complement(131390..132076)
FT                   /gene="ropB"
FT                   /locus_tag="BCAN_A0122"
FT   CDS_pept        complement(131390..132076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropB"
FT                   /locus_tag="BCAN_A0122"
FT                   /product="22 kDa outer membrane protein precursor"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0015288 - porin activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61223"
FT                   /db_xref="GOA:A9M764"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A9M764"
FT                   /protein_id="ABX61223.1"
FT                   /translation="MKLKALLFASTVVLVAATGANAADAVIEQEPAPVVVAPTFTWNGA
FT                   YLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYNDV
FT                   SKNIDFLDENNAAATFENRLRWSGAVRARAGYAVDRFLPYIAGGVAFGSLRNRGEFEGT
FT                   GFSQSKTLTGWTIGAGMDYAATDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTNDIRF
FT                   GVAYKF"
FT   gene            complement(132308..132925)
FT                   /locus_tag="BCAN_A0123"
FT   CDS_pept        complement(132308..132925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0123"
FT                   /product="Hypothetical protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003676 - nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61224"
FT                   /db_xref="GOA:A9M765"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9M765"
FT                   /protein_id="ABX61224.1"
FT                   /translation="MTIRFHRNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPG
FT                   DGTADVIQIEADQKKAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTKIA
FT                   SKLTRTYTDRHGLKEICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHRLKA
FT                   VLEQRLERDGRTKQAEACFKFLPTRSELDLMGWAESDIFAHS"
FT   gene            complement(132964..134379)
FT                   /locus_tag="BCAN_A0124"
FT   CDS_pept        complement(132964..134379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0124"
FT                   /product="Cytosolic nonspecific dipeptidase"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61225"
FT                   /db_xref="GOA:A9M766"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A9M766"
FT                   /protein_id="ABX61225.1"
FT                   /translation="MSTLSLDKVLNHLDANLNKSLDRLFNLLRIKSISTDPAYKADCRK
FT                   AAEWLVEDLKSIGFDASVRDTPGHPMVVAHHEGATADAPHVLFYGHYDVQPVDPLSLWE
FT                   NDPFDPAIKDVSDASNGGRKILTGRGTSDDKGQLMTFVEACRAYKAVNGSLPVKVTLLF
FT                   EGEEESGSPSLKPFLEANRQELKADVALVCDTAMWDAETPAISVGLRGLVGEEIVIKAA
FT                   DRDLHSGFFGGAAANPIHILTKILADLHDETGRITIPDFYEGVEETPTQILKSWESLGR
FT                   TAESFLGPIGLSIPAGEKGRSVLELTWARPTAEVNGIIGGYTGEGFKTVIAAEASAKVS
FT                   FRLVHKQDPVKIREAFRAFVKERVPADCSVEFHPHGGSPAIQLPYDSPLVSKAKNALSD
FT                   EWPKPAVLIAMGGSIPIVGDFNTFLGMESLLVGFGLEDDRIHSPNEKYELNSFHKGQRS
FT                   WARILAAIAAKQG"
FT   gene            134610..134858
FT                   /locus_tag="BCAN_A0125"
FT   CDS_pept        134610..134858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0125"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61226"
FT                   /db_xref="UniProtKB/TrEMBL:A9M767"
FT                   /protein_id="ABX61226.1"
FT                   /translation="MSLHSGSPERGMRLPLPSGFRRGTGRKTGDRRSVDDRNLAFQLWL
FT                   FKGIEDYKYVTNPLSGRDGFLSRGRSNLLTRGRFPLL"
FT   gene            134940..137879
FT                   /gene="polA"
FT                   /locus_tag="BCAN_A0126"
FT   CDS_pept        134940..137879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BCAN_A0126"
FT                   /product="DNA polymerase I"
FT                   /note="GO_function: GO:0003887 - DNA-directed DNA
FT                   polymerase activity; GO_process: GO:0006260 - DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61227"
FT                   /db_xref="GOA:A9M768"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9M768"
FT                   /protein_id="ABX61227.1"
FT                   /translation="MKKGDHLFLVDGSGYIFRAYHALPPLTRKTDGLPVGAVSGFCNML
FT                   WKLLKDARNTDVGVVPTHFAVIFDYSSKTFRKEIYPDYKANRTAPPEDLIPQFGLIRQA
FT                   TRAFNLPCIEKEGFEADDLIATYARLAEKAGGDVTIISSDKDLMQLVTPSVSMYDSMKD
FT                   KQISIPEVIEKWGVPPEKMIDVQSLTGDSTDNVPGIPGIGPKTAAQLLEEFGDLDTLLA
FT                   RASEIKQNKRRENILAFADQTKIARELVTLKTDVPLDIDLDGLVLEPQNGPKLIGFLKA
FT                   MEFTSLTRRVAEATDTDASSVEPCHVETDWGADAHGPDVDVPEKADAAAASQLLSAPTA
FT                   AEPDQGYTPKALAEGRAAQAIAQKIDTSAYVCIRDIATLEQWLAEAAETGILAFDTETT
FT                   SLDPMQAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMVENQIPLDMALAALKRVLE
FT                   DASILKIAQNMKYDWLVMRRHGINAVSFDDTMLISYVLDAGTGSHGMDPLSERWLGHTP
FT                   IAYKDVAGSGKSAVTFDMVDIDRATAYAAEDADVTLRLWQVLKPRLAAEGLMSVYERLE
FT                   RPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYALAGEKFTIGSPKQLGDI
FT                   LFGKMGLPGASKTKTGQWSTSAQVLEDLAAEGHPLPRKIVDWRQLTKLKSTYTDALPGF
FT                   INPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVRTAEGRKIRTAFIAEPGNKLISADY
FT                   SQIELRVLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINFGII
FT                   YGISAFGLANQLSIPREEAGQYIRTYFERFPGIKDYMEATKAFAREHGYVETIFGRRAH
FT                   YPDIRASNPQVRAFNERAAINAPIQGAAADIIRRAMIRMEDALAKENLAARMLLQVHDE
FT                   LIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAAHNWDEAH"
FT   gene            138021..139901
FT                   /gene="ydbR"
FT                   /locus_tag="BCAN_A0127"
FT   CDS_pept        138021..139901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbR"
FT                   /locus_tag="BCAN_A0127"
FT                   /product="DEAD-box ATP-dependent RNA helicase ydbR"
FT                   /note="GO_function: GO:0004386 - helicase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61228"
FT                   /db_xref="GOA:A9M769"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M769"
FT                   /protein_id="ABX61228.1"
FT                   /translation="MSLPDTIAPALSGALTARGYNTLTAVQNAVLAPETLASDLLVSAQ
FT                   TGSGKTVAFGLAMANTILEDELRFGDAGAPLAMIIAPTRELALQVRRELEWLYADTGAR
FT                   IASCVGGMDIRTERRALERGSHIVVGTPRRLRDHITRNALDMSQLRAIVLDEADEMLDM
FT                   GFREDLEFILGEAPEDRRTLMFSATVPKPIAQLAKRFQNNALRITVQSETSQHADIDYV
FT                   AMPVPPHERDHAIINTLLYYDSQNSIIFCSTREAVKHMASRLSNRGFAVVALSGELSQA
FT                   ERNNALQAMRDGRARVCVATDVAARGIDLPNLDLVIHADLPTNPDTLLHRSGRTGRAGR
FT                   KGTCVLVVPFSRRRSAERLLHMAKLDAQTVPAPSIAAVQAKTNERILNAEVFNQPVEEE
FT                   YQELLKALAERYTPEQIASAFLNREVASYPAAEEVSDAPVHPVGGKKPRSDRFEKGDRY
FT                   ERGERRERGEPGERFDRNARFDGVWFSVSAGRKHRADPKWLLPLICKAGDVSKRDVGSI
FT                   KIFDNETRFEIAASKADEFRQSVAERGTGEKSLVIRTAVAGAGGDAAARESRGSFKPRS
FT                   DKFKEGGFRDGHKSDKPRDFSRGDDFKKDGFKKGGKKPEDGGYSKKRRGE"
FT   gene            complement(139997..142438)
FT                   /gene="gyrB"
FT                   /locus_tag="BCAN_A0128"
FT   CDS_pept        complement(139997..142438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BCAN_A0128"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="GO_component: GO:0009330 - DNA topoisomerase complex
FT                   (ATP-hydrolyzing); GO_function: GO:0003918 - DNA
FT                   topoisomerase (ATP-hydrolyzing) activity; GO_process:
FT                   GO:0006265 - DNA topological change"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61229"
FT                   /db_xref="GOA:A9M770"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M770"
FT                   /protein_id="ABX61229.1"
FT                   /translation="MSEMPEMNSEAPAEYGADSIRVLKGLDAVRKRPGMYIGDTDDGSG
FT                   LHHMVYEVVDNAIDEALAGHATLVTVTLNADGSCTVTDNGRGIPTDIHKEEGVSAAEVI
FT                   MTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSIWLKLKIRRAGKIHEMSFTHGVADAP
FT                   LVVTGDAGSETGTEVSFLPSPDTFSMVEFDYETLERRLRELAFLNSGVRIKLADRRHAD
FT                   VKEQELHYDGGLVEFVKYIDQSKKSLLEEPIYIRSEKDGMTVEVAMWWNDSYHEKVLCF
FT                   TNNIPQRDGGTHLAGFRGALTRQITGYADSSGMTKKEKVQLTGDDCREGLTAVLSVKVP
FT                   DPKFSSQTKDKLVSSEVRPVVEGLVNEALSTWLEEHPAGGKIVVEKVIQAAAAREAARK
FT                   ARDITRKSNLSVTSLPGKLADCQERDPAKSEIFIVEGDSAGGSAKSGRSRQNQAILPLR
FT                   GKILNVERVRFDRMISSDQVGTLITALGTSIGKDETHGFNADKLRYHKIIIMTDADVDG
FT                   AHIRTLLLTFFFRQMPELIERGHIYIAQPPLYKVTRGKSSQYIKNEAAFEDFLIETGLE
FT                   ETTLELVTGEMRAGPDLRSVVEDARMLRQLLHGLHTRYDRSVVEQAAIAGLLNPDASRD
FT                   NATAQHSADTVAKRLDMISEETERGWSGHVMEDGGYRFERMVRGVKDIAILDMALLGSA
FT                   DARQVDRVAGRMAEIFMEPPVLRRKDKVESLSGPVALLDAVFATGRKGLTLQRYKGLGE
FT                   MNAEQLWETILDPNVRSLLQVKVNDATDADSLFSRLMGDEVEPRREFIQDNALNVANLD
FT                   V"
FT   gene            complement(142489..142656)
FT                   /locus_tag="BCAN_A0129"
FT   CDS_pept        complement(142489..142656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0129"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61230"
FT                   /db_xref="UniProtKB/TrEMBL:A9M771"
FT                   /protein_id="ABX61230.1"
FT                   /translation="MRPADQIWTPIMAAPESQSGHHAQIGAKQPESPANLPLKFGKIAV
FT                   STYIKAMFVA"
FT   gene            complement(142760..143596)
FT                   /gene="fghA"
FT                   /locus_tag="BCAN_A0130"
FT   CDS_pept        complement(142760..143596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA"
FT                   /locus_tag="BCAN_A0130"
FT                   /product="S-formylglutathione hydrolase"
FT                   /note="GO_function: GO:0018738 - S-formylglutathione
FT                   hydrolase activity; GO_process: GO:0046292 - formaldehyde
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61231"
FT                   /db_xref="GOA:A9M772"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M772"
FT                   /protein_id="ABX61231.1"
FT                   /translation="METISTARCFDGTQGVYRHKSEACQCDMTFALFLPPQAKDGPVPV
FT                   LWYLSGLTCTHQNVMDKGEYRQLASELGIAVICPDTSPRGDSIADEPDNWQFGKGAGFY
FT                   VDAMQAPFAQNYRMYSYITQELSALVARQFPLDMERQAITGHSMGGHGALTIALKNPDR
FT                   FKSVSAFAPIVQPSTAGWSRPALEKYLGPDEQAWRAYDATLLIEDGHRFPEILVDQGTA
FT                   DGFLDDGLRPWLLEEACRKAGIALTLNMREGYDHSYFFISTFMGDHLRWHSERLRS"
FT   gene            complement(143604..144260)
FT                   /locus_tag="BCAN_A0131"
FT   CDS_pept        complement(143604..144260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0131"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61232"
FT                   /db_xref="GOA:A9M773"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A9M773"
FT                   /protein_id="ABX61232.1"
FT                   /translation="MFLLRRHISFYIGAIGGVVAFTIAWALKSPLAPVIGANCFFVIYL
FT                   LLAVSVLPRLTPSFLKKHAASADEPVWIIFLVTFAAVLIGIASLFILINSASKVDTFSL
FT                   VVTLASVPLGWFTIHMMTAIHYAHVYWQPREPAGNDPKRASRYRGGFDFPGTPEPSGWD
FT                   FAYYAYVIGMTAQTSDTNVTTPAMRRTTLLHSIVSFFFNTVLVAAAVNVVVALGS"
FT   gene            complement(144260..144727)
FT                   /locus_tag="BCAN_A0132"
FT   CDS_pept        complement(144260..144727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0132"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61233"
FT                   /db_xref="GOA:A9M774"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A9M774"
FT                   /protein_id="ABX61233.1"
FT                   /translation="MNASLLTSHWAEIDDLAPRALYAMLKLRVDVFVVEQTCPYPEIDG
FT                   KDIGAFHLRILDGDTLAAALRVLPPEGEKSVKIGRVVVAPAYRGYKLGQRLMMEAIAFA
FT                   QARFPGSPLELGGQSHLQKFYASFGFVAISGEYLEDGIPHVDMRLEPSETD"
FT   gene            complement(144727..145839)
FT                   /locus_tag="BCAN_A0133"
FT   CDS_pept        complement(144727..145839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0133"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="GO_function: GO:0051903 -
FT                   S-(hydroxymethyl)glutathione dehydrogenase activity;
FT                   GO_process: GO:0006113 - fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61234"
FT                   /db_xref="GOA:A9M775"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M775"
FT                   /protein_id="ABX61234.1"
FT                   /translation="MKSRAAVAWEAKKPLTIETVEIGGPKAGEVPVEIMATGVCHTDAY
FT                   TLSGLDSEGKFPAILGHEGAGIVREVGAGVTSVKPGDHVIPLYTPECRQCKTCLSQRSN
FT                   LCTAIRATQGQGLMPDKTSRFSCDGGEVFHYMGCSTFSNFTVLPEIAVAKVREDAPFDK
FT                   ICYIDCGVTTGIGAVIYTAKVRPGSNVVVFGLGGIGLNVIQGARMVGADKIIGVDINPA
FT                   KVEMARKFGMTDFINPREIGNDKVVQAIQDLTDGGADYSFDATGNTDVMRQALECCHRG
FT                   WGESIIIGVAEAGKEIATRPFQLVTGRVWKGTAFGGARGRTDVPKIVDWYMEGKINIDD
FT                   LITHAMPLDEINTAFDLMHEGKSIRSVVIY"
FT   gene            145736..145885
FT                   /locus_tag="BCAN_A0134"
FT   CDS_pept        145736..145885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0134"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61235"
FT                   /db_xref="UniProtKB/TrEMBL:A9M776"
FT                   /protein_id="ABX61235.1"
FT                   /translation="MISTGTSPAFGPPISTVSMVSGFFASQATAARDFMVVRPSGYILR
FT                   AYFR"
FT   gene            complement(145873..146157)
FT                   /locus_tag="BCAN_A0135"
FT   CDS_pept        complement(145873..146157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61236"
FT                   /db_xref="GOA:A9M777"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M777"
FT                   /protein_id="ABX61236.1"
FT                   /translation="MPHSPEDKKRALTRLRRIKGQAEALERAVEAGTECAALLQQIAAL
FT                   RGAANGLMAEVLESHFRETFGQARETMAQKDDPNTQIDEIMRILRTYLK"
FT   gene            146284..148738
FT                   /pseudo
FT                   /gene="hrpB"
FT                   /locus_tag="BCAN_A0136"
FT                   /note="ATP-dependent helicase HrpB"
FT   gene            148833..150125
FT                   /gene="regB"
FT                   /locus_tag="BCAN_A0137"
FT   CDS_pept        148833..150125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regB"
FT                   /locus_tag="BCAN_A0137"
FT                   /product="Sensor histidine kinase regB"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61237"
FT                   /db_xref="GOA:A9M778"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M778"
FT                   /protein_id="ABX61237.1"
FT                   /translation="MHAEFENRASNLSRRPRLTTLVRVRWLAIAGQTAAVMFVALYLQF
FT                   PFSVGICFALIACSAWLNLYLAFRFPANHRLNPTAASLVLAFDVLQLAGLLYLTGGLQN
FT                   PFIVLMIVPVIISATSLSARDTIVLALLVVACTSFLTIHYDPLPWYPGETLNLPLLFVI
FT                   GIWCAIISALGFTGVYAYRIAEEARQLGDALSAAELILQREQHLSALDGLAAAAAHELG
FT                   TPLATIALVVKEMQRAHTKDPGLEEDIALLHSQTQRCREILQRLTSLSSEGEEHMSRLP
FT                   LSSLIEEVIAPHRNFGIMIEVQKEEGPKPEPVTRRNPGLLYGLGNLVENAVDFARGEVT
FT                   VTWGWTDGHVSVTIQDDGEGFRPEILDRIGEPYMTSRDNTRNGGGLGLGLFIAKTLLER
FT                   SGAQISFRNRSNPGQGAEVKVTWPRSAFSAS"
FT   gene            150195..150563
FT                   /locus_tag="BCAN_A0138"
FT   CDS_pept        150195..150563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0138"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61238"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9M779"
FT                   /protein_id="ABX61238.1"
FT                   /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAAN
FT                   AAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHALADTPDFEYVLIDSTISKVHADA
FT                   AGAKGGLKLPASVARAVD"
FT   gene            150217..150528
FT                   /locus_tag="BCAN_A0139"
FT   CDS_pept        150217..150528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0139"
FT                   /product="IS711, transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61239"
FT                   /db_xref="UniProtKB/TrEMBL:A9M780"
FT                   /protein_id="ABX61239.1"
FT                   /translation="MSNGTGSKHIFRGELVRPAAVASITDYLSTPSCGWLPMQRTGAIC
FT                   LRPSANGQRFMPAFGDGRTPVYGKGFSMPWLIRRTLNMSSLIAPYRKSTQMRRAQKGG"
FT   gene            150560..150970
FT                   /locus_tag="BCAN_A0140"
FT   CDS_pept        150560..150970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0140"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61240"
FT                   /db_xref="GOA:A9M781"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A9M781"
FT                   /protein_id="ABX61240.1"
FT                   /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHVI
FT                   ADAAYDADHLRAFIASNLKATAQIKVNPTRSSVPTIDWRLYKERHQIECFFNKLKRYRR
FT                   IALRCEKTLTAFMGFVHSRMRYDLVTLNADTP"
FT   gene            151019..151357
FT                   /locus_tag="BCAN_A0141"
FT   CDS_pept        151019..151357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61241"
FT                   /db_xref="UniProtKB/TrEMBL:A9M782"
FT                   /protein_id="ABX61241.1"
FT                   /translation="MTRIFSENRFTPFGMRSNIPAAQSGGSDSFCRAIRRFRAPFSLRA
FT                   ELNRLKRPFYSCRAMTRETQSLHKNHNLSHDTAIASVVAALYVHHDQQISGILLATLSS
FT                   QMRDYWRI"
FT   gene            151553..152116
FT                   /gene="regA"
FT                   /locus_tag="BCAN_A0142"
FT   CDS_pept        151553..152116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regA"
FT                   /locus_tag="BCAN_A0142"
FT                   /product="Photosynthetic apparatus regulatory protein regA"
FT                   /note="GO_function: GO:0030528 - transcription regulator
FT                   activity; GO_process: GO:0045449 - regulation of
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61242"
FT                   /db_xref="GOA:A9M783"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9M783"
FT                   /protein_id="ABX61242.1"
FT                   /translation="MEDLKQEDTEAIGNDPTLLLVDDDKPFLQRLARAMESRGFQVTTA
FT                   ESVEEGIAAVKTSAPAYAVVDMRLGDGNGLDIIEAIRSRRADTRAIVLTGYGNIATAVN
FT                   AVKLGAIDYLSKPADADEVFAALTRRPGEKVAPPENPMSADRVRWEHIQRVYEMCERNV
FT                   SETARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(152122..152424)
FT                   /locus_tag="BCAN_A0143"
FT   CDS_pept        complement(152122..152424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0143"
FT                   /product="protein of unknown function DUF1052"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61243"
FT                   /db_xref="GOA:A9M784"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A9M784"
FT                   /protein_id="ABX61243.1"
FT                   /translation="MEIKSSIEDWKADHKWPEYRAYCDRLFFATHPAVPREIFPEECGF
FT                   ILSDGYGAEILREAPEHRLAGATRKALMLRFARAGAARLMAAELAGLDVPGTEID"
FT   gene            152886..153506
FT                   /locus_tag="BCAN_A0144"
FT   CDS_pept        152886..153506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0144"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61244"
FT                   /db_xref="GOA:A9M785"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M785"
FT                   /protein_id="ABX61244.1"
FT                   /translation="MDSRVLKLTAALFLGAALAGCSTAGGSFYTASYSSVSDAGYAIPA
FT                   IPSEKIPAQYRRQVVKYATDEKPGTIIVDTREKFLYLIMSEGKAVRYGIGVGRRGFEWS
FT                   GTARVAMKREWPTWTPPSAMIKRQPELAKYRNGMDPGLRNPLGARALYLYNKGGDTGYR
FT                   LHGTPEWWSIGKAMSSGCIRLMNQDIIDLYNRVEQGAKVVVKQ"
FT   gene            complement(153596..154168)
FT                   /locus_tag="BCAN_A0145"
FT   CDS_pept        complement(153596..154168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0145"
FT                   /product="HIRA-interacting protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61245"
FT                   /db_xref="GOA:A9M786"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A9M786"
FT                   /protein_id="ABX61245.1"
FT                   /translation="MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAAK
FT                   LFAVPGVTGVFFGYDFITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAAAA
FT                   HGEEEFFDEADTEIVETIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACSGCP
FT                   SSTATLKHGIQNLLRHFVPEVQQVEQI"
FT   gene            complement(154277..154816)
FT                   /locus_tag="BCAN_A0146"
FT   CDS_pept        complement(154277..154816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0146"
FT                   /product="UspA domain protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61246"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9M787"
FT                   /protein_id="ABX61246.1"
FT                   /translation="MEGCPLAGSFPRWHIAAMVSRRLSREAGHRRKFLAVIDETPECGR
FT                   AVAYAARRARNTNGSLVMLFVIDNSEFQQILGVGEIMRAEAEERARTALEKFAANVRAE
FT                   QGIDPELIIREGRTAEELLSLVEEDQDIAILVLAAGASKEGPGPLVQSLAGRAQFPIPV
FT                   TVVPAGLSDDDIDALT"
FT   gene            complement(154823..155980)
FT                   /gene="trpS"
FT                   /locus_tag="BCAN_A0147"
FT   CDS_pept        complement(154823..155980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BCAN_A0147"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004830 - tryptophan-tRNA ligase activity; GO_process:
FT                   GO:0006436 - tryptophanyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61247"
FT                   /db_xref="GOA:A9M788"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A9M788"
FT                   /protein_id="ABX61247.1"
FT                   /translation="MKACHASAKTRRIIITLRSPPAQVNLQEPIMSTFKPLVFSGVQPT
FT                   GNLHLGNYLGAIKRWVEVQKTEECIYCVVDMHALTVSPDPVELMQSTREVTAAFLAAGI
FT                   DPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRENASLGLFAYPSL
FT                   MAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGVDMKVGDEQVSG
FT                   FFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITKKIRKAKTDSDG
FT                   LPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLADLAVARLSPI
FT                   THEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVGWLQN"
FT   gene            complement(155987..157576)
FT                   /gene="mviN"
FT                   /locus_tag="BCAN_A0148"
FT   CDS_pept        complement(155987..157576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="BCAN_A0148"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61248"
FT                   /db_xref="GOA:A9M789"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A9M789"
FT                   /protein_id="ABX61248.1"
FT                   /translation="MSLVKKFATVASGTLMSRIFGFTREMFMAAALGTGPVADAFNAAF
FT                   RFPNTFRRLFAEGAFNSAFVPLFAKEIEKNGMDGARRFSEEVFGVLFTVLLFLTIAMEL
FT                   SMPFIVRTVIAPGFTDDPVKFSNTVRLAIIMFPYLACMSLAAMMGGMLNSLHRYFAAAI
FT                   APVFLNIILIGVLAVAWMQGYDALAVGYGLSWGVMAAGLVQLAIVWIAVRHAGIKIGFR
FT                   RPRLTPNVKRLLVLALPAAITGGITQINLLINTNIASGMQGAVSSLVYADRIYQLPLGV
FT                   VGIAVATVLLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAVALLVMSEPIVRLLF
FT                   ERGKFSPDSTLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVS
FT                   LAITLFPHFGPTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLTRIPRLLIAAGIM
FT                   AFGIHYAIGHFTYELSSAAPLAARAGTVAVMVITAMIVYFALAFGLGGANTGMIRRNLK
FT                   RGGGKNQPESEA"
FT   gene            complement(157590..160394)
FT                   /gene="glnD"
FT                   /locus_tag="BCAN_A0149"
FT   CDS_pept        complement(157590..160394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BCAN_A0149"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /note="GO_function: GO:0008773 - [protein-PII]
FT                   uridylyltransferase activity; GO_process: GO:0018177 -
FT                   protein amino acid uridylylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61249"
FT                   /db_xref="GOA:A9M790"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A9M790"
FT                   /protein_id="ABX61249.1"
FT                   /translation="MSAHDLKLEEIVNAKTLRRKLNELADTADESYTSLPMRKVVLQTL
FT                   KDALASGRANAEDMLMKDGGGTLCAKRLCYLMDTLIDILFEFATTRAYPTRNPSKAENM
FT                   ALVAVGGYGRGGLAQGSDIDLLFLLPYKQTPWGEQVVEYTLYMLWDMGLKVGHSTRNID
FT                   ECIRLAREDMTIRTALLDARFLTGDKDLFRTLEIRFEEEIVKGTEPEFIQAKLAERDAR
FT                   HRKAGETRYLVEPNVKEGKGGQRDLHTLFWITKYFYRVKTKEELVKLGVLSRAELKLFN
FT                   KAEDFLWAVRCHMHFATLKAEERLSFDIQPEIAQRLGYTAHPGQNYVERFMKHYFLVAK
FT                   DVGDLTRIICAALEEQQAKHVPGFNRIFLTFSRRKRKLSDDGAFISENHRINIARPDIF
FT                   RQDPVNMIRLFHLADRHGLEFHPEAMQSLTRSLKLINADLRENPEANRLFLEILTSPRN
FT                   PELILRRMNESGVLGKFIPDFGKIVAMMQFNMYHHYTVDEHLLRCIAVLSEIEHGELKT
FT                   EHPLSNHLITTIKRDRNLLYVTLLLHDIAKGRPEDHSIAGARIARRLCPRFGLTPSETE
FT                   TVEWLVREHLTMSMVAQSRDLNDRKTIIDFADTVQTMERLKLLLILTVCDIKAVGPGIW
FT                   NGWKGQLLRTLFYETELVLTGGFSELSRAARDKQAREALAERLSDWPKEERDAYLALPY
FT                   TNYFLTVSLDDQVRHAHFIRDADQQGRALVTMAKPHAFETVTEITVLAPDHPRLLSVIT
FT                   GACAAAGGNIVDAQIFTTSNGRALDTILISREFDTDDDERRRAERVGKVIEDVLSGKAH
FT                   LPDMLAKRTKPKKAARAFKVEPRVEINNTLSNKFTVIEVEGLDRPGLLSELTGLISDLS
FT                   LDIASAHITTFGEKVIDSFYVTDLVGHKISNATRQGNIKRKLLALLGAENGARTNGRSP
FT                   QAAA"
FT   gene            160460..160555
FT                   /locus_tag="BCAN_A0150"
FT   CDS_pept        160460..160555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0150"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61250"
FT                   /db_xref="UniProtKB/TrEMBL:A9M791"
FT                   /protein_id="ABX61250.1"
FT                   /translation="MDMVNIEKQRPGETPGPTLSCYFLIFQFVAL"
FT   gene            complement(160537..162827)
FT                   /pseudo
FT                   /locus_tag="BCAN_A0151"
FT                   /note="Hypothetical protein"
FT   gene            162966..165698
FT                   /gene="mutS"
FT                   /locus_tag="BCAN_A0152"
FT   CDS_pept        162966..165698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="BCAN_A0152"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006298 - mismatch repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61251"
FT                   /db_xref="GOA:A9M792"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M792"
FT                   /protein_id="ABX61251.1"
FT                   /translation="MEAKVEEKEPEPVENAGPDAPVRLTPMMEQYIEIKAANVDSLLFY
FT                   RMGDFYELFFDDAVAASAALGITLTKRGKHLGEDIPMCGVPVHAADDYLQKLIAKGYRV
FT                   AVCEQVEDPAEAKKRGSKSVVKRDVIRLVTPGTLTEEKLLDPAQANFLMAMGRTRGDGA
FT                   LALAWIDISTGTFRVAETTPDRLFADIMRVDPRELVVADSAFHDEELRPVFDLIGKAVT
FT                   PQPATLFDSAAAQTRIQHYFNVATLDGFGQFSRPELSAISGAIAYIEKTQISERPPLMR
FT                   PEREHEGGTLFIDPATRASLELARTMSGNRDGSLLKAIDRTVTGGGARLLAERLTAPLT
FT                   SPKEIALRLDSVSWCLSEQTLCEALRLELKGVPDMPRALSRLAVGRGGPRDLGALACGF
FT                   EAAGGIASLLDGALLPDELAAAREAIEKMPAGFAAHLDRALADELPLLKRDGGFVREGY
FT                   NSELDEMRALRDQSRRVIAGLQADYIEETGIKSLKIKHNNVLGYFIEVTANNSGAMTDT
FT                   DEAKSRFIHRQTMANAMRFTTTELAELESKIANAADRALSIELAIFEELTAEAVAHADS
FT                   IRAAASALSVFDVSTALAVLAEERGYCRPHVDDSLSFNIVAGRHPVVEQALRRQAANPF
FT                   VANDCDLSPQRDGGDGAIWLLTGPNMGGKSTFLRQNALIAILAQMGSFVPAGSAHIGVV
FT                   DRLFSRVGASDDLARGRSTFMVEMVETAAILNQAGEHSLVILDEIGRGTATFDGLSIAW
FT                   AAVEYLHEKNRCRALFATHFHEMTALSEKLERLSNVTMRVKEWDNDVIFLHEVAKGAAD
FT                   RSYGVQVARLAGLPEAVVNRARDVLHQLEAGETSGKADRLIDDLPLFSVMLQQEKPKPQ
FT                   IQAKDSELANAVAAISPDELTPREALDLIYKLKELAGKA"
FT   gene            complement(166004..166897)
FT                   /locus_tag="BCAN_A0153"
FT   CDS_pept        complement(166004..166897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0153"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61252"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9M793"
FT                   /protein_id="ABX61252.1"
FT                   /translation="MTVLLGMGQQIIDDTVMSGLEAQQALFASNGDAIILGRIGSLEVR
FT                   LANSRAAIEAAQELRFRVFFEEMGARKETIEAVEQRDADRFDTICDHLLVYDTALPVPE
FT                   HQQIVGTYRLMRNEQAEKALGFYSADEYDVQRLKLSRPNLRLLELGRSCVKPEYRSKRT
FT                   VELLWQGAWAYCRRHSIDVMFGCASFHGAVPAAHALGLSFLHHNCRATDDWDVRALPHR
FT                   YQAMDLMPKEAINNKVALFSMPPLVKGYLRLGAMIGDGAVIDEAFGTTDVFIILPIERI
FT                   SSRYISYYGAEANRFV"
FT   gene            complement(167172..167654)
FT                   /gene="lspA"
FT                   /locus_tag="BCAN_A0154"
FT   CDS_pept        complement(167172..167654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="BCAN_A0154"
FT                   /product="signal peptidase II"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0009005 - signal peptidase II
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61253"
FT                   /db_xref="GOA:A9M794"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M794"
FT                   /protein_id="ABX61253.1"
FT                   /translation="MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLAL
FT                   FRTHNEGIAFSMLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIG
FT                   NLIDRVMHGYVVDYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH"
FT   gene            complement(167656..168549)
FT                   /locus_tag="BCAN_A0155"
FT   CDS_pept        complement(167656..168549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0155"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61254"
FT                   /db_xref="GOA:A9M795"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A9M795"
FT                   /protein_id="ABX61254.1"
FT                   /translation="MSRNDEFSRSGGSRPEHRSEHPKVGQVKEVTSLANPIVKDLRSLA
FT                   LKKFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVAARTFAKGGLVL
FT                   EVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRDPGNLGTVIRT
FT                   ADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKGFSGLVVGTH
FT                   LKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSLNLAIATGV
FT                   MLYEIRREALTLDERG"
FT   gene            complement(168546..169691)
FT                   /locus_tag="BCAN_A0156"
FT   CDS_pept        complement(168546..169691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0156"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61255"
FT                   /db_xref="GOA:A9M796"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M796"
FT                   /protein_id="ABX61255.1"
FT                   /translation="MKTPKGKGKKPSGGKQERGFERRKQDAPRTENKFESRTEGKGAFK
FT                   KPRPQFAKAAPKPAEEKAPGPLREIRPYTGPRPAERLPLILETEPSPDYALLDSGNGLK
FT                   LEQYGPYRIVRPEGQAIWLPALPQREWDQADAIFTGNTDEEGMGRWAFPKTPLDETWPM
FT                   QHDGISFHGRFTSFRHVGVFPEQAAHWSFMDGLIRDAVKTGRTVKVLNLFGYTGVASLV
FT                   AARAGAEVTHVDASKKAILWARENQEMAGLSDKPIRWICEDAMKFVQREERRGSFYDII
FT                   LLDPPAYGRGPSGEVWQLFEHLPAMVDTCRAILSAKPLAVILTAYSIRASFFAIHELMR
FT                   DRFTGLGSTVESGELILRERSADQSGGRALSTSMFSRWVAK"
FT   gene            complement(169804..170127)
FT                   /locus_tag="BCAN_A0157"
FT   CDS_pept        complement(169804..170127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0157"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61256"
FT                   /db_xref="GOA:A9M797"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A9M797"
FT                   /protein_id="ABX61256.1"
FT                   /translation="MLAKRIVTIVILVPLAVILIALSVANRASAILTIDPFNPGNPALS
FT                   YSAPLFIWLFGALLFGVVIGSAVTWLTQGKYRRKARNSSREAARLLERAESAEKRNIPL
FT                   ANS"
FT   gene            complement(170137..170421)
FT                   /gene="ihfB"
FT                   /locus_tag="BCAN_A0158"
FT   CDS_pept        complement(170137..170421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="BCAN_A0158"
FT                   /product="integration host factor, beta subunit"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0019047 - provirus integration"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61257"
FT                   /db_xref="GOA:A9M798"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M798"
FT                   /protein_id="ABX61257.1"
FT                   /translation="MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVEL
FT                   RGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV"
FT   gene            complement(170468..171451)
FT                   /gene="sppA"
FT                   /locus_tag="BCAN_A0159"
FT   CDS_pept        complement(170468..171451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="BCAN_A0159"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="GO_function: GO:0008981 - protease IV activity;
FT                   GO_process: GO:0006465 - signal peptide processing"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61258"
FT                   /db_xref="GOA:A9M799"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9M799"
FT                   /protein_id="ABX61258.1"
FT                   /translation="MAHDAEAMIERRRLRRKLTSWRLAFLVLLAALIAGFAFYSLRSAK
FT                   FNQPHIAKVRIEGTIFENEELLKRLDKIAGDDAVKGVILLLDSPGGTTVGGEAIYDAVR
FT                   KIATKKPVVTQVGTLAASAGYMIASASDHIVARQTSIVGSIGVLFQYPDLSKLLDTLGV
FT                   KVETIKSSPLKAEPNYFSPASEEAKNMIRSMIMDSYDWFVGIVQERRAFTHEQALALAN
FT                   GAVFTGRQALDKKLIDGLGGEAEAVAWLQTKGLSDKLPRLEWKPVGSETGFSLRDLIIH
FT                   AGARLLGLPQEADGAIKEIVRDRIFLDGLLSVWHVDGIAGANPANQ"
FT   gene            171913..172635
FT                   /locus_tag="BCAN_A0160"
FT   CDS_pept        171913..172635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0160"
FT                   /product="protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61259"
FT                   /db_xref="GOA:A9M7A0"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A0"
FT                   /protein_id="ABX61259.1"
FT                   /translation="MTADIPHIHVPQNAAPSGRGAGGMRFGASEKADSLFHAAQRHSVC
FT                   VRVLKTALPVAAIALAAVFSWYTFLATPASPVKVEVNTGGETGKLVMKSPHLNGYTKDN
FT                   RPYSMTAAKATQDVKNSGAITLEGISARLPVGEKGHATVEAASGVYDNANGRLQLDKDF
FT                   TVTTDNGLRAQLHSADVNLKSGQIATDKPVDIRNGTTHILADSMQVKDNGKVLIFENNV
FT                   HMTVDGNTLSANKTPEGG"
FT   gene            172958..173572
FT                   /locus_tag="BCAN_A0161"
FT   CDS_pept        172958..173572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61260"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A1"
FT                   /protein_id="ABX61260.1"
FT                   /translation="MVRTLRIGFSVLALAAFAAPGASWAQQAGDGSVPGLKLSNSKDPV
FT                   KIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGVGG
FT                   IGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQGQKVVLTDGDNIVTGCKL
FT                   TAHLDTGRANVESCKGQTKGRVSIIMAPKDQQQGGAAPKRN"
FT   gene            173584..174417
FT                   /locus_tag="BCAN_A0162"
FT   CDS_pept        173584..174417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0162"
FT                   /product="Probable ABC transporter ATP-binding protein in
FT                   ntrA/rpoN 5'region"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61261"
FT                   /db_xref="GOA:A9M7A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A2"
FT                   /protein_id="ABX61261.1"
FT                   /translation="MGLFWNKKAGEVQSPSHDVAASGVDAISGQPNMASRLKGTLVARG
FT                   LCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGLVPADSGSIEIDGFDV
FT                   TSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRARRASELDALLEEFHI
FT                   AHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAVSDIQQLVRHLTSR
FT                   GIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRLYLGDQFTL"
FT   gene            174713..176215
FT                   /gene="rpoN"
FT                   /locus_tag="BCAN_A0163"
FT   CDS_pept        174713..176215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="BCAN_A0163"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="GO_function: GO:0016987 - sigma factor activity;
FT                   GO_process: GO:0006352 - transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61262"
FT                   /db_xref="GOA:A9M7A3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A3"
FT                   /protein_id="ABX61262.1"
FT                   /translation="MALSPKLDIRQSQSLVMTPQLMQSIKLLQMTHIELDQFLDMEIEK
FT                   NPLLDRIEADSDDLAGGEPASGADDPTESADNDDWFQTEGAGAAENLSATFDNSLENIF
FT                   PDDLGSSQEQWKLSAGEGAFSGNGYDIDQVTAGRLSLSDYVAEQIVLGFSKAADRFIAT
FT                   ALADALDESGYLRIDIVGLAHNLGIETAEIGRILGVLQGFDPPGLFARDLRECLAIQLR
FT                   LKDRFDPAMEALIANLDLLARRDFATLQKICGVDQADLIDMLAEIRALDSKPGARFEVS
FT                   VADTIVPDVLVFSARDGGWAIELNPATMPRLIVNNEYYAEVSGSVKTEEKAFLTDCMQT
FT                   AGWLVRSLDQRARTILKVAQEIVRQQDGFLRHGVAHLKPLNLRMVADAVGMHESTISRV
FT                   TANKFMATPRGVFELRYFFTASLASSEGGEAHSSESVRHRIRQVIEAEKPDEVLSDDAI
FT                   VDALKKDGVDIARRTVAKYREAMNIASSVQRRREKKARFSTP"
FT   gene            complement(176364..176729)
FT                   /locus_tag="BCAN_A0164"
FT   CDS_pept        complement(176364..176729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0164"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61263"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A4"
FT                   /protein_id="ABX61263.1"
FT                   /translation="MPRTRLFLSFKQTDIVHFIPKCRMHYHVAPKDCPEILDFQPRPAT
FT                   RAGLLLTETIFVNCSSCQLASLGRPCFHRSRLTFSDRTAAQVQNFRAFSLYFQRSEKAA
FT                   IERLTDIPIWSIPNFPA"
FT   gene            176965..177558
FT                   /gene="yfiA"
FT                   /locus_tag="BCAN_A0165"
FT   CDS_pept        176965..177558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="BCAN_A0165"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="GO_component: GO:0005840 - ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61264"
FT                   /db_xref="GOA:A9M7A5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A5"
FT                   /protein_id="ABX61264.1"
FT                   /translation="MTLRVSGKHMDVGEAFTSRIVDRVNDAVGKYFDHGFSGQVTVAKS
FT                   GSRFSADCTLHLDSGATLQSAGEAQDPQLAFDMAADKIETRLRRYKRRLKSRAPAQQNA
FT                   IYDDVAYRVMAPLPEEEEDLPADYAPTIVAESSVALRTMSVASAVVELDLTEHPVLVFR
FT                   NAGNDEVNIVYRRADGNIGWVDPSTVTRQAAPRA"
FT   gene            177661..178125
FT                   /gene="ptsN"
FT                   /locus_tag="BCAN_A0166"
FT   CDS_pept        177661..178125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="BCAN_A0166"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61265"
FT                   /db_xref="GOA:A9M7A6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A6"
FT                   /protein_id="ABX61265.1"
FT                   /translation="MDLSDLIQPGAIIPALKASSKKQLLQILSEKAAVLTGLPEREVFE
FT                   TVLQRERLGSTGVGNGVAIPHGKLASINKIAGIFARLETPVDFEALDDQPVDLVFLLLA
FT                   PENAGADHLKALSRIARLLRDPDMVAKLRGTHDAQALYSFLTAHPTSNAA"
FT   gene            complement(178206..178451)
FT                   /locus_tag="BCAN_A0167"
FT   CDS_pept        complement(178206..178451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0167"
FT                   /product="protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61266"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A7"
FT                   /protein_id="ABX61266.1"
FT                   /translation="MNKHVFTDNEFAHLGEGEIAYVRKIRSDDLARSFPSLPPIAPGLE
FT                   LWALFGASGEPIVLSDVRATALQGAHDHELRTVTLH"
FT   gene            complement(178557..178979)
FT                   /gene="hspD"
FT                   /locus_tag="BCAN_A0168"
FT   CDS_pept        complement(178557..178979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspD"
FT                   /locus_tag="BCAN_A0168"
FT                   /product="Small heat shock protein hspD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61267"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A8"
FT                   /protein_id="ABX61267.1"
FT                   /translation="MTRMTPFSSPLLLGFDTMEKTLERIAKSGDGYPPYNIERLRGDTG
FT                   SERLRITLAVAGFASEDLEVMTEDNQLVIRGRQTDDTEREYLHRGIAARQFQRVFVLAD
FT                   GMRVLACELRNGLLAIDLDRPEPERLIKRIDIAVKD"
FT   gene            complement(179070..179270)
FT                   /locus_tag="BCAN_A0169"
FT   CDS_pept        complement(179070..179270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0169"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61268"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7A9"
FT                   /protein_id="ABX61268.1"
FT                   /translation="MPKPGVEAAPFPQNLPGYSIGPKIDIGFQKARCFEKLKHVSQKAG
FT                   NAREVSNHGFTIAMREFGLHP"
FT   gene            complement(179251..179865)
FT                   /locus_tag="BCAN_A0170"
FT   CDS_pept        complement(179251..179865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0170"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61269"
FT                   /db_xref="GOA:A9M7B0"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B0"
FT                   /protein_id="ABX61269.1"
FT                   /translation="MSLAFLVYTRFHLRKTISSLTQSPILRRPSRPELQGQKRMHHPDG
FT                   AEPERFETPIFEALLTPYRSLGRTGFYNLMSALTGCWMFVGILFWSIGAWPIFGFFGLD
FT                   VLLIYLAFRWNYRAARAREEISVSRAALQVRKYAASGKMTTHHFNPFWARFKVARKPDI
FT                   GITAMRIESRENSIVIGSFLNPDERESFATAFGAALAEARR"
FT   gene            179853..180599
FT                   /gene="nth"
FT                   /locus_tag="BCAN_A0171"
FT   CDS_pept        179853..180599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BCAN_A0171"
FT                   /product="endonuclease III"
FT                   /note="GO_function: GO:0003906 - DNA-(apurinic or
FT                   apyrimidinic site) lyase activity; GO_process: GO:0006281 -
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61270"
FT                   /db_xref="GOA:A9M7B1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B1"
FT                   /protein_id="ABX61270.1"
FT                   /translation="MQETKIKSAVNGSTSPVRRPRRVAGTLYTADEIHEIFRRFSIQRP
FT                   EPKGELEHVNAFTLLVAVVLSAQATDAGVNKATRALFAVADTPQKMLALGEEKVGEYIR
FT                   TIGLWRNKAKNIILLSEALIRDYGGEVPGDRDELVKLPGVGRKTANVVLNMAFGQPTMA
FT                   VDTHILRIGNRIGLAPGKTPEAVEAILVRVIPREYMLHAHHWLILHGRYVCKARKPECE
FT                   KCVIADLCKYPAKTCDIPAALVPLAP"
FT   gene            complement(180640..181353)
FT                   /locus_tag="BCAN_A0172"
FT   CDS_pept        complement(180640..181353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0172"
FT                   /product="protein of unknown function DUF540"
FT                   /note="GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_process: GO:0019344 - cysteine biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61271"
FT                   /db_xref="GOA:A9M7B2"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B2"
FT                   /protein_id="ABX61271.1"
FT                   /translation="MIIDAAWKALNRLLTPQFRTVFWKTLGVTLLLLVGLWVAIRQVFF
FT                   SFAWPWMEQLLPGMPQWAGWLGIVAAIVAGLGLALVLALMIAPVTALIAGFFLDDVAEI
FT                   VEREDYPADPPGTPLPLGRSVIASLKFLGVVILGNGVALILLFVPGINLIAFFVINAYL
FT                   LSREFFEFAAMRYRSEAEAKALRSQYGVTVFLAGLVIAGFMAIPIVNLLTPLFAATMMV
FT                   HLHKAISKRAIKTYS"
FT   gene            complement(181350..181610)
FT                   /locus_tag="BCAN_A0173"
FT   CDS_pept        complement(181350..181610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0173"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61272"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B3"
FT                   /protein_id="ABX61272.1"
FT                   /translation="MPLKLPFVSGFTADAAETPAGAAAMREPVYPFTVLLASLITSRLV
FT                   GSAACARLRPYLFPLQISQFRHLRRNERRSEPYAIPQKGGK"
FT   gene            181613..182605
FT                   /locus_tag="BCAN_A0174"
FT   CDS_pept        181613..182605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0174"
FT                   /product="Fructokinase-2"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61273"
FT                   /db_xref="GOA:A9M7B4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B4"
FT                   /protein_id="ABX61273.1"
FT                   /translation="MATFDVLCIGNAIVDILARTDDVFLETNGIIKGAMNLIDAERAEL
FT                   LYSRMGPATEMSGGSAGNTAAGIASLGGRSAYFGKVATDHLGRVFAHDIRAQGVAFDTR
FT                   PLEKGSPTARSMIFVTPDGERSMNTYLGACVELGPEDVETSKVADARVTYFEGYLWDPP
FT                   RAKEAIVMASKIAHESGRQMAMTLSDPFCVDRYRDEFLQLMRSRTVDIVFANEDEAKAL
FT                   YKTKSLETAIAAMRMDCRLSVITRSEKGAVVVTPDQTLTVPAIEIDDLVDTTGAGDLYA
FT                   AGFLYGYTKDRSLEDCARLGSLAAGLIIQQMGPRPQISLEAAASQAGLI"
FT   gene            complement(182624..183280)
FT                   /locus_tag="BCAN_A0175"
FT   CDS_pept        complement(182624..183280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61274"
FT                   /db_xref="GOA:A9M7B5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B5"
FT                   /protein_id="ABX61274.1"
FT                   /translation="MTIIQFLNYAGVFVFAATGALAASRRQLDIIGFIFLANITAIGGG
FT                   TMRDLVLASPVFWVVQPLYLFVGTLAAIAVYFTAHKVESRYRTLLWLDAIGMAAYTVMG
FT                   AAKGLALGFGPSVAIVTGIFTATFGGILRDIVVGEPSVLMRREIYVTAAVAGACLYVVL
FT                   EYLGINPVISAGAAAFAAFFVRGGALYFGWTLPVYKSKPGRTEEELQRDQIIRPE"
FT   gene            complement(183413..184105)
FT                   /gene="grpE"
FT                   /locus_tag="BCAN_A0176"
FT   CDS_pept        complement(183413..184105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BCAN_A0176"
FT                   /product="Protein grpE"
FT                   /note="GO_function: GO:0000774 - adenyl-nucleotide exchange
FT                   factor activity; GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61275"
FT                   /db_xref="GOA:A9M7B6"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7B6"
FT                   /protein_id="ABX61275.1"
FT                   /translation="MADEKNKPENPDLDQRDINNPRDREALKQAADDFLKARRAEARAE
FT                   AAADEAEGEVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAITN
FT                   FARDMLSVSDNLRRALDAIPADALEADSNLKSLSEGVEMTERAMLLALERHGVKKLEPE
FT                   GQKFDPNFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVSAENG
FT                   ASTSEDNA"
FT   gene            complement(184211..185281)
FT                   /gene="hrcA"
FT                   /locus_tag="BCAN_A0177"
FT   CDS_pept        complement(184211..185281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BCAN_A0177"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0016566 - specific transcriptional repressor activity;
FT                   GO_process: GO:0009408 - response to heat"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61276"
FT                   /db_xref="GOA:A9M7B7"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7B7"
FT                   /protein_id="ABX61276.1"
FT                   /translation="MMRPPEHQLLSSLDQRSRDIFRLIVETYLNDGDPVGSRNLSRLLP
FT                   HTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIE
FT                   AQVRAAGTSNSVESVLTEASQVLSGLSRGAGLVLTNKTDVALKHIEFVRLEPMRALAVL
FT                   VMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGHTLSEAKSELRKLSEETRRELDQ
FT                   LSQELVAKGLAVWSGAGADQPARLIVRGRANLLENVHAQEDIERLRHLFDDLETKDGMV
FT                   QLLDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYRDSEQRVIGALGVIGPTRLNYARI
FT                   VPMVDYTAQIVSRLLR"
FT   gene            185503..186219
FT                   /gene="rph"
FT                   /locus_tag="BCAN_A0178"
FT   CDS_pept        185503..186219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="BCAN_A0178"
FT                   /product="ribonuclease PH"
FT                   /note="GO_function: GO:0004549 - tRNA-specific ribonuclease
FT                   activity; GO_process: GO:0008033 - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61277"
FT                   /db_xref="GOA:A9M7B8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7B8"
FT                   /protein_id="ABX61277.1"
FT                   /translation="MRPSKRAADEMRAISFERGVSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KVPGWMRNTGKGWVTAEYGMLPRSTGERMRREAAAGKQGGRTQEIQRLIGRSLRAVVDM
FT                   QALGEMQITVDCDVIQADGGTRTAAITGGWVALHECLRWMEARQMVRVEKVLKDHVAAI
FT                   SCGIYEGVPVLDLDYAEDSVAETDSNFVMTGKGGIVEIQGTAEGVPFSEEEFGALMKLA
FT                   RSGIDRLVSLQKMAVA"
FT   gene            186393..186797
FT                   /locus_tag="BCAN_A0179"
FT   CDS_pept        186393..186797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0179"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61278"
FT                   /db_xref="GOA:A9M7B9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7B9"
FT                   /protein_id="ABX61278.1"
FT                   /translation="MRAAHILETALYVRDVAEAIGFYRDVMGLEPVGKVSERNAFFRCG
FT                   DGILLLFRAQETLKPPLPGYLPVPPHGTSGPGHVCFAASRAEIEGWRKHLEKHGIAIEA
FT                   DFDWPNGAHSIYFRDPSGNSLEIAEPKLWN"
FT   gene            186800..187462
FT                   /gene="rdgB"
FT                   /locus_tag="BCAN_A0180"
FT   CDS_pept        186800..187462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="BCAN_A0180"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="GO_function: GO:0016462 - pyrophosphatase activity;
FT                   GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61279"
FT                   /db_xref="GOA:A9M7C0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C0"
FT                   /protein_id="ABX61279.1"
FT                   /translation="MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPD
FT                   ETGTTFEENAYIKALAAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFD
FT                   MAMQKVENLLQEKGATTPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGF
FT                   GYDPVFLPDGYGKTFGEMTAEEKHGWKPGDASALSHRARAFKLFAEKALNVVSAPAE"
FT   gene            187459..188673
FT                   /locus_tag="BCAN_A0181"
FT   CDS_pept        187459..188673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0181"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="GO_function: GO:0004109 - coproporphyrinogen oxidase
FT                   activity; GO_process: GO:0006779 - porphyrin biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61280"
FT                   /db_xref="GOA:A9M7C1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C1"
FT                   /protein_id="ABX61280.1"
FT                   /translation="MNKLFPPLQAKNAASTYPVMHADGETAFGIYVHWPFCLAKCPYCD
FT                   FNSHVRHKPVDQARYGAAFRREMETLRERTGPRTVTSIFLGGGTPSLMQPETVGALLDG
FT                   IASYWSVAPDIEVTLEANPTSVEADRFRGYRAAGVNRVSLGIQALNDPDLRRLGRMHSV
FT                   AEAKAAIRLAREIFPRLSFDLIYARPDQTIEAWREELKEAIGLAADHLSLYQLTIEEGT
FT                   QFYNLWKAGKLTTPEPDLAAALYEETQRVTAEHGLPAYEISNHAVPGRESQHNLVYWRY
FT                   GQYAGIGPGAHGRFVENDVRTVTMTEKHPETWLDHVERRGHGIIEEEYLDGGQEGDEFL
FT                   MMGLRLREGIDLARYARLSGHAIDDKRLAKLIAEGMIEPMGGSLIRATPDGALVLDALV
FT                   ADLAA"
FT   gene            188685..189596
FT                   /locus_tag="BCAN_A0182"
FT   CDS_pept        188685..189596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61281"
FT                   /db_xref="GOA:A9M7C2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C2"
FT                   /protein_id="ABX61281.1"
FT                   /translation="MTDETGEERREYVVGGTTMRARPLEPALYIVSTPIGNLGDMTLRG
FT                   LETLASADILACEDTRVTRVLLDRYGISRRPISYHEHNAAEAGPKLIAALAAGKSVALV
FT                   SDAGTPLVSDPGFRLVGDAREAGIRVVPVPGASAVLAALAASGLPTDAFMFCGFLPAKH
FT                   GQKQSRLESLKGIDATLVFYESPNRAAATLSDMVEVFGTGRQGALCRELTKAYETIVTA
FT                   PLGELAKTFDGEDRIRGEVVLLVGPPTGEAVAQSEEDIDRLLLSLVAEMPPSKAAGEAA
FT                   RMTGGQKSVLYQRLLQLKSDGR"
FT   gene            189593..189973
FT                   /locus_tag="BCAN_A0183"
FT   CDS_pept        189593..189973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61282"
FT                   /db_xref="GOA:A9M7C3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7C3"
FT                   /protein_id="ABX61282.1"
FT                   /translation="MTDLREKKRIAFFRGHSAERLAAFALMLKGFRIVARRYRTRLGEI
FT                   DLIARRGDLVLIVEVKARASFEAAQFAVTPQAMRRIEAAADLWLQRQTDRARLSLRFDM
FT                   VAVLPRRWPKHVPAFFTAGHYG"
FT   gene            190199..191626
FT                   /gene="cobA"
FT                   /locus_tag="BCAN_A0184"
FT   CDS_pept        190199..191626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="BCAN_A0184"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="GO_function: GO:0004851 - uroporphyrin-III
FT                   C-methyltransferase activity; GO_process: GO:0019354 -
FT                   siroheme biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61283"
FT                   /db_xref="GOA:A9M7C4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C4"
FT                   /protein_id="ABX61283.1"
FT                   /translation="MSLSQTRLLADFPAFFRVSGEVVAVVGGGEEALNKARLVAQTAAR
FT                   LRIIAEKAEPHLAAFIESHGVEHIASPFAPELLDGAKLVFVATGDEAGDRAAAAAARAR
FT                   KIPVNVVDRPALCDFLTPAIVNRAPVTIAIGSQGTAPVLAQMVRARIDAAFSPRLGELA
FT                   HFAESWRPLVERALPKGLARRGFWRTFFSGKVARAVESGDHEAAHRAAAELIGQGQDAS
FT                   GHVWLVGAGPGAEDLLTLRAQRVLMEADVIVHDALVPEGVIAMGRRDAERLPVGKRKGC
FT                   HSKSQDEINRLLVKLGQEGKRVVRLKSGDPLVFGRAGEEMAALRAAGIGFEVVPGITSA
FT                   FAAAADMELPLTLRGVASSLVFTTGHDMTGDVLPGWAKLAVSGATIAVYMGSTVAASVA
FT                   SRLIAAGLHEDTAVAVVENASRSNKRMFHGTLKDLPQLENRKELSGPVMVVIGDAVAGA
FT                   AIGRAQALSLKPVPVAA"
FT   gene            191644..191946
FT                   /locus_tag="BCAN_A0185"
FT   CDS_pept        191644..191946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0185"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61284"
FT                   /db_xref="InterPro:IPR021270"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C5"
FT                   /protein_id="ABX61284.1"
FT                   /translation="MIVKVLTANRLIDGQAVWLGADGSWQETIDGALVARHAEAVNALE
FT                   EAGRLAARANLVVDVNVIDVEERGADLYPIRLRERIRLSGPTIVTMGHAFPAPAS"
FT   gene            191967..193637
FT                   /locus_tag="BCAN_A0186"
FT   CDS_pept        191967..193637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0186"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /note="GO_function: GO:0016664 - oxidoreductase activity,
FT                   acting on other nitrogenous compounds as donors,
FT                   iron-sulfur protein as acceptor; GO_process: GO:0042128 -
FT                   nitrate assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61285"
FT                   /db_xref="GOA:A9M7C6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C6"
FT                   /protein_id="ABX61285.1"
FT                   /translation="MYRYDEFDRDFVAARVAQFKDQVARRLSGELTEDQFKPLRLMNGL
FT                   YLQLHAYMLRVAIPYGTLSSRQLRKLGSIARTYDRGFGHFTTRQNIQYNWPALKDVPQI
FT                   LAELAEVEMHSIQTSGNCIRNVTADHFAGAAADEVTDPRPLAEILRQWSSLHPEFSYLP
FT                   RKFKIAIVGSEHDRAAIQVHDIGLQLKKNEAGELGLAVYVGGGQGRTPMVAKKIRDLLP
FT                   IEDMLTYVTAIVRVYNLHGRRDNKFKARIKILVHETGIEQLTREIDAEWEEIRHGELKL
FT                   PQRDIDVIESYFRMPDLPQRPEGWEILAVAQKADAEFASWVARNVTAHKHPDYAVVTIS
FT                   LKPVGGIPGDASAEQMELVADVAQTCSFDEIRVSHEQNLVLPHVAKADLPAVYDRLQSG
FT                   GLVTPNAGLITDIIACPGLDYCALANARSIPVAQRISERFADLDRQLEIGDLKIKISGC
FT                   INACGHHHVGHIGILGVEKKGEELYQITLGGSADENSAIGEITGRGFSSEEVVDAIETI
FT                   VDTYLGLRESAEETFLAAYRRVGMEPFKRALYGEIRSAA"
FT   gene            193627..194385
FT                   /gene="cysH"
FT                   /locus_tag="BCAN_A0187"
FT   CDS_pept        193627..194385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="BCAN_A0187"
FT                   /product="phosophoadenylyl-sulfate reductase"
FT                   /note="GO_function: GO:0004604 - phosphoadenylyl-sulfate
FT                   reductase (thioredoxin) activity; GO_process: GO:0019379 -
FT                   sulfate assimilation, phosphoadenylyl sulfate reduction by
FT                   phosphoadenylyl-sulfate reductase (thioredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61286"
FT                   /db_xref="GOA:A9M7C7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C7"
FT                   /protein_id="ABX61286.1"
FT                   /translation="MLPDADIADADERAAAQARLLEASHGASAPHEIIALVTHELFEGR
FT                   VAVVSSFGAESAVLLHMISQIDRATPVLFLDTGKHFRATLDYRHQLVGRLGLADVRDIL
FT                   PVADSLAKEDPFGALSMTDKDRCCFIRKVEPMARAVAPYRAWMTGRKQFQASTRNGLPV
FT                   FESVGPRIRINPLARWRAEDLRAYAEKYSLPPHPLTAQGYRSIGCMPCTRPVSEGEDQR
FT                   AGRWAGSEKTECGIHLSGLADSLKGIPKAV"
FT   gene            194438..194962
FT                   /locus_tag="BCAN_A0188"
FT   CDS_pept        194438..194962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0188"
FT                   /product="uncharacterised conserved protein UCP030820"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61287"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C8"
FT                   /protein_id="ABX61287.1"
FT                   /translation="MSSTNETKLWSRDGFREDDYIFADDLEAAGDAPAIVLPLAVWLEL
FT                   GEEHRRSSNRRIGVSVSPGEKIDPLLGHLDSIALIALQFPVFNDGRSYSKAEILRREGF
FT                   AGELRAVGDVLIDQAVLMLRAGFDTLQVANEVALRRLGENRLVDTPGYYQPGRGSLPQE
FT                   GAFAWRRVKAG"
FT   gene            195030..195323
FT                   /locus_tag="BCAN_A0189"
FT   CDS_pept        195030..195323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0189"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61288"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7C9"
FT                   /protein_id="ABX61288.1"
FT                   /translation="MIRHIVFFSVKEGQDIETVRKGLEQLATIPYSDVFEVLANSKVDP
FT                   MCERIDLVVYAEFKDEEALYAFKNHPTYDATTQLVRPMRELRFSADVVTDKN"
FT   gene            complement(195324..195902)
FT                   /locus_tag="BCAN_A0190"
FT   CDS_pept        complement(195324..195902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0190"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /note="GO_function: GO:0003908 -
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61289"
FT                   /db_xref="GOA:A9M7D0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D0"
FT                   /protein_id="ABX61289.1"
FT                   /translation="MESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRER
FT                   FAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTPLALDSVPDLNRRVYEIILELKPGE
FT                   TTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVPCHRVLGSNGKVGGFSAAGGTATKLR
FT                   LLNIERARTTSEPNLFGGLPLQERPQTGW"
FT   gene            196160..196405
FT                   /locus_tag="BCAN_A0191"
FT   CDS_pept        196160..196405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61290"
FT                   /db_xref="GOA:A9M7D1"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D1"
FT                   /protein_id="ABX61290.1"
FT                   /translation="MDDYERYATGLMIVFGALIIGGLMAANLYHGDKPGFLFALGAAVV
FT                   GWFSAFAVLFDKPRVYGVMIAIAIGLVAASIGAYVT"
FT   gene            complement(196458..196847)
FT                   /locus_tag="BCAN_A0192"
FT   CDS_pept        complement(196458..196847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0192"
FT                   /product="BA14K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61291"
FT                   /db_xref="GOA:A9M7D2"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D2"
FT                   /protein_id="ABX61291.1"
FT                   /translation="MKRFGYSLFAACLSIGMGLSAMSANAAQPLLPLASAAASQDADAV
FT                   QRVQYYDYRGDRRYWRHQRYWRHHHPRYRPYYRYYRHWGPPPRAYRGGNPHVRWCYNRY
FT                   RSYRAYDNTYQPNYGPRRQCYSPYL"
FT   gene            197161..200946
FT                   /gene="metH"
FT                   /locus_tag="BCAN_A0193"
FT   CDS_pept        197161..200946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="BCAN_A0193"
FT                   /product="methionine synthase"
FT                   /note="GO_function: GO:0008705 - methionine synthase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61292"
FT                   /db_xref="GOA:A9M7D3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D3"
FT                   /protein_id="ABX61292.1"
FT                   /translation="MASSLDDLFGATAAKPDGSEVLAALTQAARERILILDGAMGTQIQ
FT                   GLSFHEEHFRGDRFATCDCQLQGNNDLLTLTQPKAIEEIHYAYAMAGADILETNTFSST
FT                   SIAQADYGMEAMVYDLNRDGARLARRAALRAEQKDGRRRFVAGALGPTNRTASLSPDVN
FT                   NPGFRAVTFDDLRIAYSEQIRGLIDGGSDIILIETIFDTLNAKAAVFATEEVFAEKGVR
FT                   LPVMISGTITDLSGRTLSGQTPTAFWYSLRHARPFTIGLNCALGANAMRAHLDELSGIA
FT                   DTFICAYPNAGLPNEFGQYDETPEAMAAQIEGFARDGLVNVVGGCCGSTPDHIRAIAQA
FT                   VAKYEPRKPAKVPPLMRLSGLEPFTLTKDIPFVNIGERTNVTGSARFRKLVKAGDFAAA
FT                   LDVARDQVANGAQIIDINMDEGLIDSEKAMVEFLNLIAAEPDIARVPIMLDSSKWEVIE
FT                   AGLKCVQGKAVVNSISLKEGEEAFLHHARLVRAYGAAVVIMAFDETGQADTQARKIEIC
FT                   TRAYKILTEQVGFPPEDIIFDPNIFAVATGIEEHNNYGVDFIEATREIVRTLPHVHISG
FT                   GVSNLSFSFRGNEPVREAMHAVFLYHAIQAGMDMGIVNAGQLAVYDTIDAELREACEDV
FT                   VLNRPTKTGESATERLLEIAERFRDSGSREARTQDLSWREWPVEKRLEHALVNGITEYI
FT                   EADTEEARLAAERPLHVIEGPLMAGMNVVGDLFGSGKMFLPQVVKSARVMKQAVAVLLP
FT                   FMEEEKRLNGGEGRQSAGKVLMATVKGDVHDIGKNIVGVVLACNNYEIIDLGVMVPSQK
FT                   ILQVARDEKVDIIGLSGLITPSLDEMAHVAAEMEREGFDIPLLIGGATTSRVHTAVKIH
FT                   SRYERGQAVYVVDASRAVGVVSNLLSPEGKQAYIDGLRNEYAKVAAAHARNEAEKQRLP
FT                   IARARANPHQLDWENYEPVKPAFTGTKVFETYDLAEIARYIDWTPFFQTWELRGRYPAI
FT                   LEDEKQGEAARQLWADAQAMLRKIIDEKWFTPRAVVGFWPANAVGDDIRLFTDESRKEE
FT                   LATLFTLRQQLTKRDGRPNVAMADFVAPVESGKQDYVGGFVVTAGIGEIAITERFERAN
FT                   DDYSAILVKALADRFAEAFAELMHERVRKEFWAYAPDEAFTPEELISEPYKGIRPAPGY
FT                   PAQPDHTEKTTLFRLLDATANTGVELTESYAMWPGSSVSGLYIGHPESYYFGVAKVERD
FT                   QVEDYARRKDMDVEAVERWLTPILNYVPGASKDEAA"
FT   gene            complement(200910..201077)
FT                   /locus_tag="BCAN_A0194"
FT   CDS_pept        complement(200910..201077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0194"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61293"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D4"
FT                   /protein_id="ABX61293.1"
FT                   /translation="MKIEYLFGRKIKPEDSTAKLEANSPRGGLLHEGCFAVSSRTIGCQ
FT                   AASSFDAPGT"
FT   gene            201258..201974
FT                   /gene="solR"
FT                   /locus_tag="BCAN_A0195"
FT   CDS_pept        201258..201974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="solR"
FT                   /locus_tag="BCAN_A0195"
FT                   /product="Transcriptional activator protein solR"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61294"
FT                   /db_xref="GOA:A9M7D5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D5"
FT                   /protein_id="ABX61294.1"
FT                   /translation="MSAMKWETFYDAMQSADSADQLFEIVKNYAHDLGFEYVSYVMSIP
FT                   SLNGSLKWVRFGAFPDGWEQRYLAQNYAEIDPLLRRGVNSIDPLIWSQNFFASAPQIWA
FT                   DAVKYGLKVGISQPCWAAQGVFGLLSFVRSGPALTPGEISMLRRQLQMVTNLLHLSMYE
FT                   RVDVPAISCIGDVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVA
FT                   VNKVQAVAKARTFGLL"
FT   gene            202089..203459
FT                   /locus_tag="BCAN_A0196"
FT   CDS_pept        202089..203459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0196"
FT                   /product="aminotransferase class-III"
FT                   /note="GO_function: GO:0030170 - pyridoxal phosphate
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61295"
FT                   /db_xref="GOA:A9M7D6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D6"
FT                   /protein_id="ABX61295.1"
FT                   /translation="MTAQPNSLEARDIRYHLHSYTDAVRLEAEGPLVIERGDGIYVEDI
FT                   AGKRYIEAMSGLWSVGVGFSEQRLAEAAARQMKKLPFYHTFSYRSHGPVIDLAEKLVAM
FT                   APVPMSKAYFTNSGSEANDTVVKLIWYRSNALGEPERKKIISRKRGYHGVTIASASLTG
FT                   LPNNHRSFDLPIDRILHTGCPHHYHDALPGESEEQFATRLANELEQLILAEGPHTIAAF
FT                   IGEPVMGAGGVVVPPKTYWEKVQAVLGRYNILLVADEVICGFGRTGNLFGCQTFDIKPD
FT                   ILVMSKQLSSSYLPISAFLINERVYAPIAEESHKIGTLGTGFTASGHPVAAAVALENLA
FT                   IIEERDLVANARERGARMQKRLRELQDHPLVGEVRGVGLIAGVELVIDKEAKTGLEQPG
FT                   ALGARANAALQERGVISRAMGDTLAFCPPLIINDQQVDTMVSALEAALNDVQASLGK"
FT   gene            203865..204767
FT                   /gene="cysD"
FT                   /locus_tag="BCAN_A0197"
FT   CDS_pept        203865..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="BCAN_A0197"
FT                   /product="sulfate adenylyltransferase, small subunit"
FT                   /note="GO_function: GO:0004781 - sulfate
FT                   adenylyltransferase (ATP) activity; GO_process: GO:0000103
FT                   - sulfate assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61296"
FT                   /db_xref="GOA:A9M7D7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7D7"
FT                   /protein_id="ABX61296.1"
FT                   /translation="MKNLTHLQRLEAEAIHVFREVAATFSNPVMLYSVGKDSSVMLHLA
FT                   MKAFYPAPPPFPFLHVDTTWKFREMIEFRDAQAREKGFELLVHVNEQGVRDGIGPFTHG
FT                   SNVHTHIMKTVGLRQALDKYRFDAAFGGARRDEEKSRAKERIFSFRNAQHGWDPKNQRP
FT                   EMWKIYNTRVSKGESIRVFPLSNWTELDIWQYILQENIPIVPLYFAARRPVVERDGMLI
FT                   MVDDDRMKLRPGEQVENRLVRFRTLGCYPLTGAIPSSAANLSDIVEEMLIARTSERQGR
FT                   AIDRDEAGSMEKKKREGYF"
FT   gene            204767..206701
FT                   /gene="cysN"
FT                   /locus_tag="BCAN_A0198"
FT   CDS_pept        204767..206701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="BCAN_A0198"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /note="GO_function: GO:0004781 - sulfate
FT                   adenylyltransferase (ATP) activity; GO_process: GO:0000103
FT                   - sulfate assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61297"
FT                   /db_xref="GOA:A9M7D8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D8"
FT                   /protein_id="ABX61297.1"
FT                   /translation="MNVVMKPSQKNTAVADFLADQEHKSLLRFLTCGSVDDGKSTLIGR
FT                   LLYDTKLIFEDQLASLKNDSRKFGTTDDDFDFALLVDGLEAEREQGITIDVAYRFFSTP
FT                   RRKFIVADTPGHAQYTRNMATGASTADLAVVLVDARQGVLTQTRRHSFIAAALGIRHIV
FT                   LAVNKIDLVDFSQDRFDGIVADYLSFAQDLGFTSIQPIPLSARFGDNVTASSPRIGWYE
FT                   GPHLLEHLETVRIDTEAAAKPFRFPVQYVNRPNLDFRGFSGTVASGSIHVGDPVVVAKS
FT                   GKQSRVKRIATYDGDLQRASERQAVTLVLEDEIEVSRGNMLAGVELRPEVADRFAADIV
FT                   WFGEDPLLPGRSYLLRTETDQTPVTVNAIRHRTDVNTFIQEETARLDLNEIGRCHLQTV
FT                   DPIAFDPYGENRATGAFVLIDRLTNATVGAGMIDAALRQATNVHLQAFDLNKQARAAQK
FT                   FQKPAVLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFSDADRV
FT                   ENIRRVGEVARLMADAGLITLVSFISPFREERDQVRARLPEGEFIEIFIDTPIEECMAR
FT                   DPKGLYAQALRGEIKAFTGIDSPYEPPVAPELRLNTAGRTVDELIAEVENYLAERGVIG
FT                   SYGSDSWSI"
FT   gene            206704..207549
FT                   /gene="cysQ"
FT                   /locus_tag="BCAN_A0199"
FT   CDS_pept        206704..207549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="BCAN_A0199"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="GO_function: GO:0008441 - 3'(2'),5'-bisphosphate
FT                   nucleotidase activity; GO_process: GO:0006790 - sulfur
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61298"
FT                   /db_xref="GOA:A9M7D9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7D9"
FT                   /protein_id="ABX61298.1"
FT                   /translation="MKISASPKAGLDGTALRAVLRDAALEAGRSIMKHYVNGCAVQSKK
FT                   DASPVTEADHAAEAIILAALSSACPDVPVVAEEEVAAGRLPDHLGRKFLLVDPLDGTRE
FT                   FLLRNGDFTVNIGLVEEGAPVLGIVYAPARNLLFIGSDAGAWAMETTPDHGAGQDQRIF
FT                   ARVSPAEKVAVCSRSHLTPETERFLAENRIASSVSVGSSLKFCILAKGEADIYPRFGPT
FT                   MEWDTAAGDAVLRAAGGMTATLDGRPMIYGQRLRAGAAGFANPDFVAYGAGEAPVFTTA
FT                   "
FT   gene            207682..207755
FT                   /locus_tag="BCAN_A0200"
FT   tRNA            207682..207755
FT                   /locus_tag="BCAN_A0200"
FT                   /product="tRNA-Pro"
FT   gene            complement(207811..208617)
FT                   /locus_tag="BCAN_A0201"
FT   CDS_pept        complement(207811..208617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0201"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61299"
FT                   /db_xref="GOA:A9M7E0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E0"
FT                   /protein_id="ABX61299.1"
FT                   /translation="MKDIGSISFVGCGLEMQSGRQNTTSSTDALIGLLEAAPILAKLEA
FT                   REIDALATLDIIENNFAADAIIIEQGARVRSIHLVRSGWGCIYRDLSSGQRQIIDFPMR
FT                   CDFVGLRTSNGYSYNTIAAITPMSIFEIPLNSLENAIKHAPRLSFILIELLSRQRSFLI
FT                   EHLTNVGCRNAFVRTAHLLLELSDRVKSCGIGEPDSFYCPLTQYQLADALGLTPIHLNR
FT                   MLRELREEGLVLFRSNRVEILNREQLAALAEYDGEFMRMAVFARHE"
FT   gene            208814..209550
FT                   /pseudo
FT                   /gene="moaR"
FT                   /locus_tag="BCAN_A0202"
FT                   /note="Monoamine regulon transcriptional regulator"
FT   gene            209878..210669
FT                   /locus_tag="BCAN_A0203"
FT   CDS_pept        209878..210669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0203"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61300"
FT                   /db_xref="GOA:A9M7E1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E1"
FT                   /protein_id="ABX61300.1"
FT                   /translation="MQLTPRHHAIVELARRKGQVLVDDLAVAFDVTPQTVRKDLNDLCR
FT                   ARLLRRIHGGALYPSGVENMEYEARRRIAAHEKESIGRATAAIIPDGASLFINIGTTTE
FT                   AVSHALVDHNHLMVITNNINVANTLRVYPSIEVVIAGGVVRASDGGIVGEAAVDFIRQF
FT                   KVDFAIIGTSAIDEDGALLDFDFREVKVAQAIIANARHVILVTDSTKLERTAPVRIGHL
FT                   SQVNTFITDRCTSLQLQDLCREHGVELIETLAGKEPEQKDD"
FT   gene            210751..212262
FT                   /gene="glpD"
FT                   /locus_tag="BCAN_A0204"
FT   CDS_pept        210751..212262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="BCAN_A0204"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61301"
FT                   /db_xref="GOA:A9M7E2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E2"
FT                   /protein_id="ABX61301.1"
FT                   /translation="MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTS
FT                   SRATKLIHGGLRYLEHYEFRLVCEALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWL
FT                   LRLGLFLYDHLGGRKKLPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTA
FT                   RDAADRGAKIATRTSVVAASRDGQGWTITLEDTGTGRRENVHARLLVKAAGPWADKVLQ
FT                   GVEGDRQLHNIRLVQGSHIVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQD
FT                   YKGDPAKVAITDSETDYLCQAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRD
FT                   YVLKEDAPDGLAPLINVFGGKLTTARKLAEHMLQKIEHRLGRKGAPWTHVAPLPGGDFE
FT                   DVAFETELKKLEAAYPFLDARHARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAE
FT                   VRYLVENEWARSAEDILWRRTKLGLRLTAAEVAAVQGFVEPAIAA"
FT   gene            212481..213467
FT                   /locus_tag="BCAN_A0205"
FT   CDS_pept        212481..213467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0205"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61302"
FT                   /db_xref="GOA:A9M7E3"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E3"
FT                   /protein_id="ABX61302.1"
FT                   /translation="MGAPQDRIHADRIQSAIATGGAARSALVASWRRSAELHGLDPTEP
FT                   GSVRTLSENEFRIAFERMDRLVNIAQASMDRLYMAVGGVGCCVLLADNNGVPVERRGAA
FT                   GDDETFYRWGLWTGAVWSEESEGTNGIGTCIVEQRALTIHREQHFHTRNIGLSCTVAPI
FT                   HDHRGHLMAALDVSSCRADLTEAFAQLISVAVIDAARRIEAENFRQAFPDARIMLAPTP
FT                   DRTGGALIAVDKDDLVIGATRAARLALELDDEALAGALPAADLLGMPADPREDMAESER
FT                   GVILRALARAEGNISAAAQLLGISRATLQPQAEPPEDHPFPLMKPLK"
FT   gene            213599..215116
FT                   /gene="thcA"
FT                   /locus_tag="BCAN_A0206"
FT   CDS_pept        213599..215116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thcA"
FT                   /locus_tag="BCAN_A0206"
FT                   /product="EPTC-inducible aldehyde dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61303"
FT                   /db_xref="GOA:A9M7E4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E4"
FT                   /protein_id="ABX61303.1"
FT                   /translation="MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQV
FT                   LCEVARSDAADVEAALDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWD
FT                   NGKPIRETTNADLPLAVDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPW
FT                   NFPLLMATWKLAPALAAGNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEA
FT                   GKPLASSPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDF
FT                   LDKAIEGFVMFALNQGEVCTCPSRALIQESIYDRFMKKALKRVEAIVQGDPLDPATMIG
FT                   AQASSEQLEKILSYLDIGRQEGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQ
FT                   EEIFGPVVSVATFKDDAEALSIANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCY
FT                   HAYPAHAAFGGYKQSGIGRENHLKMLDHYQNTKNMLVSYSPKKLGFF"
FT   gene            215597..216631
FT                   /gene="adhT"
FT                   /locus_tag="BCAN_A0207"
FT   CDS_pept        215597..216631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhT"
FT                   /locus_tag="BCAN_A0207"
FT                   /product="Alcohol dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61304"
FT                   /db_xref="GOA:A9M7E5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E5"
FT                   /protein_id="ABX61304.1"
FT                   /translation="MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTD
FT                   LHAAEGDWPVKPNPPFIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHCLG
FT                   GWETLCEEQLNTGYSVNGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKV
FT                   TDTKPGDWVVISGIGGLGHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVNAKTV
FT                   ADPAAYIRKETDGGAQGVLVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLSIFNMV
FT                   LNGVTVRGSIVGTRLDLQESLDFAADGKVKATIQTGKLEDINAIFDDMRQGNIEGRIVM
FT                   DLTQ"
FT   gene            216653..217054
FT                   /locus_tag="BCAN_A0208"
FT   CDS_pept        216653..217054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0208"
FT                   /product="protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61305"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E6"
FT                   /protein_id="ABX61305.1"
FT                   /translation="MGGELPPFRIMEEDMVEEVSGDGMGQVSATPAALDLIRALQAEYG
FT                   PIMFHQSGGCCDGSSPMCYPQGEFIVGDTDVKLGEIGGAPVYISGPQYAAWKHTELIID
FT                   VVPGRGGMFSLDNGREVRFLTRSRVCSVP"
FT   gene            217116..218137
FT                   /pseudo
FT                   /locus_tag="BCAN_A0209"
FT                   /note="Alanine racemase"
FT   gene            complement(218229..219861)
FT                   /pseudo
FT                   /locus_tag="BCAN_A0210"
FT                   /note="ABC transporter related"
FT   gene            219583..220152
FT                   /locus_tag="BCAN_A0211"
FT   CDS_pept        219583..220152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0211"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61306"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E7"
FT                   /protein_id="ABX61306.1"
FT                   /translation="MMSVSFSRSSAHMPRVTLRTVEPAKAFACQPPGIERGENVGGCRQ
FT                   QHADNHRRQPQGLTSPVAERVAENAAERRPPEIDAKTGHINIPARTAHGCRSFIWKKNY
FT                   SAPEGRDERGFWKWPKGGPMRDERRTFQLAGRDARPMSGNTLSDVERASDSGQAPDLPK
FT                   RTLGIIGNGYCTRISYLLPVLQMVAQ"
FT   gene            220455..221888
FT                   /gene="aldHT"
FT                   /locus_tag="BCAN_A0212"
FT   CDS_pept        220455..221888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldHT"
FT                   /locus_tag="BCAN_A0212"
FT                   /product="Aldehyde dehydrogenase, thermostable"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61307"
FT                   /db_xref="GOA:A9M7E8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E8"
FT                   /protein_id="ABX61307.1"
FT                   /translation="MTFHQNLIAGEWVGGDDIANINPSDTNDVVGTYARATAEDTKAAI
FT                   AAAKAAFPAWSRSGILERHAILRKTADEILARKEELGRLLSREEGKTLVEGIGETIRAS
FT                   QIFDFFAGECLRLAGEVLPSARPGIGVEVTREPVGVVGIITPWNFPIAIPAWKIAPALC
FT                   YGNTIVFKPAELVPGCSWAIADILHRAGLPKGVLNLVMGKGSVVGQTILDSADVNAVTF
FT                   TGSTGTGKRVAAASIEHNRRFQLEMGGKNPVVVLDDADLNVAVESVVNSAFFSTGQRCT
FT                   ASSRIIVTEGIHDKFVAAAIEKLKTVVVDNALKPGTHIGPVVDETQLQQDMDYIELGRK
FT                   EGAKLAFGGERLNRETPGFYLQPALFTEATNQMRISREEIFGPVASVIRVKDYEEALAT
FT                   ANDTSFGLSSGICTTSLKYATHFKRNSEAGMVMVNLPTAGVDFHVPFGGRKGSSFGPRE
FT                   QGRYAAEFYTTVKTAYTLA"
FT   gene            complement(221933..222709)
FT                   /locus_tag="BCAN_A0213"
FT   CDS_pept        complement(221933..222709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0213"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61308"
FT                   /db_xref="GOA:A9M7E9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7E9"
FT                   /protein_id="ABX61308.1"
FT                   /translation="MNDAVPNRSRLKRAADGFLSVAAALAIWQAVVSIGQMPRFILPGP
FT                   LDVVHALVANARLIAENAAATIGEVPGGLVLGSAVGIAAAIGLMMSPLAQRLVMPVMVF
FT                   SQAIPIFALAPILTLWLGYGPASKIAVAVLMIFFPVVSTFFDGMRRTETGLIDAAEILG
FT                   AGRMAILFRIRIPSAFPALASGLSLAAVYAPIGAVVGEWVGASRGLGYLMLFANGRAKV
FT                   DLMFACLFVLAAFTMLLHGLVSYFARKLAAWPKKAA"
FT   gene            complement(222706..223404)
FT                   /locus_tag="BCAN_A0214"
FT   CDS_pept        complement(222706..223404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0214"
FT                   /product="transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61309"
FT                   /db_xref="GOA:A9M7F0"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F0"
FT                   /protein_id="ABX61309.1"
FT                   /translation="MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKAA
FT                   FLHYLRQDYVYLHHYARAFALGVVKANTLQETRLCADIMHSLTHMELPLHVRICAREGI
FT                   SEDALYATREEPENLAYTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATARAGT
FT                   PYQEWIDTYAGSEYQDMCRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASRLEAD
FT                   FWSMGLKAGS"
FT   gene            complement(223401..224369)
FT                   /locus_tag="BCAN_A0215"
FT   CDS_pept        complement(223401..224369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0215"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61310"
FT                   /db_xref="GOA:A9M7F1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F1"
FT                   /protein_id="ABX61310.1"
FT                   /translation="MKKMAFAALFGAVLSFASSAEANDKLKLILDWYVNPDHGPIIIAN
FT                   KLGYFRQAGLDVDIVAPADASVPTKMVAAGQADLAVSYQQQVHLQVHEGLPVIRVGTLI
FT                   DSPLNCLMTRDDGSVNAIADLKGKKIGYSVAGVEETLLGTILGQHGVKLSDVELINVNF
FT                   SLAPALMSKQVDAVIGAYRNVELNQMAVEGVAGKCFFVEEEGVPVYDELVYVANSDKLD
FT                   AAERQKISRFLAATEKAAQYIVNHPEKSYEIFSSYSTELKDELNQRAWKDTVARFSRAP
FT                   ASLDHGRWSRCESYLKEHGLVPSILPVEKLAIDVNAEGSKT"
FT   gene            complement(224393..225004)
FT                   /gene="thiE"
FT                   /locus_tag="BCAN_A0216"
FT   CDS_pept        complement(224393..225004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BCAN_A0216"
FT                   /product="Thiamine-phosphate pyrophosphorylase"
FT                   /note="GO_function: GO:0004789 - thiamin-phosphate
FT                   diphosphorylase activity; GO_process: GO:0009228 - thiamin
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61311"
FT                   /db_xref="GOA:A9M7F2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F2"
FT                   /protein_id="ABX61311.1"
FT                   /translation="MTALDPFYPIFDSADWLERMVPLGIRLVQLRVKDKADAQLRAEIR
FT                   AARDICAAHDCQLIVNDYWKLALDEGCDFIHLGQEDLDGADLDAIRAGGLKLGVSSHDE
FT                   AELDRALSVRPDYIALGPIYPTILKKMKWHEQGLPRLGEWKARIGNIPLVGIGGLSVER
FT                   APGVFAAGADIVSVVTDITLHADPAARVREWIAVTRPFVA"
FT   gene            complement(225001..225771)
FT                   /gene="thiG"
FT                   /locus_tag="BCAN_A0217"
FT   CDS_pept        complement(225001..225771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BCAN_A0217"
FT                   /product="Thiazole biosynthesis protein thiG"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61312"
FT                   /db_xref="GOA:A9M7F3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7F3"
FT                   /protein_id="ABX61312.1"
FT                   /translation="MLEFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRRE
FT                   SGEARAGQDFWALIKALGVAVLPNTAGCHTPREAITTAHMAREVFGTNWIKLEVIGDTD
FT                   TLQPDPFGLVEAARILCDESFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGRGLN
FT                   NPYALKTMRAHFPDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAMARAF
FT                   ALAVEAGRLAYEADPIEARDMASPSTPLLGKAFL"
FT   gene            complement(225773..225970)
FT                   /gene="thiS"
FT                   /locus_tag="BCAN_A0218"
FT   CDS_pept        complement(225773..225970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BCAN_A0218"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0009228 - thiamin biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61313"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F4"
FT                   /protein_id="ABX61313.1"
FT                   /translation="MTIVLNGEAHETASVTLAALLNEIEFDEAVVATALNGEFIPANAR
FT                   EDTHISEGDRIEVLAPMQGG"
FT   gene            complement(225967..226971)
FT                   /gene="thiO"
FT                   /locus_tag="BCAN_A0219"
FT   CDS_pept        complement(225967..226971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BCAN_A0219"
FT                   /product="glycine oxidase ThiO"
FT                   /note="GO_function: GO:0016647 - oxidoreductase activity,
FT                   acting on the CH-NH group of donors, oxygen as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61314"
FT                   /db_xref="GOA:A9M7F5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F5"
FT                   /protein_id="ABX61314.1"
FT                   /translation="MRVTIIGAGVAGLATAAEFTDQGHAVTVIAKSAEIGSNSCSWFAG
FT                   GMLAPWCEGESAEEPVVRLGQDAIGWWERHVSTVRRKGTLVLSHTRDMSELRRFARRTE
FT                   EHETIDQNHLDTLEPDLAGRFRQGLFFADEGHLDPRRTLIELAERLRQQGVVFHLGVDA
FT                   KDISVDADITVDARGLAARDSLQDLRGVKGEMLIVRSRDINLSRPVRLLHPRIPLYIVP
FT                   RGDGIHMIGATMIESDDRRGISVRSTLELLSAAYALHPAFGEAEILEVGVDARPAFADN
FT                   LPRVRRRGDTVYVNGLYRHGFLLSPAVARMAVAVATNAQAEAETMTDFVEDYA"
FT   gene            complement(226971..227846)
FT                   /gene="thiD"
FT                   /locus_tag="BCAN_A0220"
FT   CDS_pept        complement(226971..227846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="BCAN_A0220"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="GO_function: GO:0008972 - phosphomethylpyrimidine
FT                   kinase activity; GO_process: GO:0009228 - thiamin
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61315"
FT                   /db_xref="GOA:A9M7F6"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7F6"
FT                   /protein_id="ABX61315.1"
FT                   /translation="MDQKQSFSPTNPTDNHAASVPICVTIAGSDSSGGAGIQADLKAFS
FT                   ALGVYGASVIAAITVQNTRTVSAVHDVPPQIVAGQIDAVFSDLDVAAVKIGMVSVPETI
FT                   EAIAHGLAHFSGPIVLDPVMVAKSGDRLLSETAISSLRKKLLPLATLLTPNRPEAACLL
FT                   DTGTAGSDAEAEEQGRALLDLGAKAVLMKGGHAEGAICTDLLIRRDRPTLRIEAPRILT
FT                   NNTHGTGCTLSSAIAAGLSRNLSLETALAQAHAYLQGAIRAADSLKVGQGHGPVHHFHA
FT                   LWKQAEREAI"
FT   misc_binding    complement(227933..228039)
FT                   /bound_moiety="thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element), BCAN_A0221"
FT   gene            228275..230386
FT                   /locus_tag="BCAN_A0222"
FT   CDS_pept        228275..230386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0222"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /note="GO_function: GO:0009975 - cyclase activity;
FT                   GO_process: GO:0009966 - regulation of signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61316"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Q6"
FT                   /protein_id="ABX61316.1"
FT                   /translation="MRKRKGAPAEGTMACTSEQDFRILFTTHPTPMWVYDPETLRFIVM
FT                   NDAAYELYGYTADEIPGMTVLDIRPQSERDRMLSAIRDRSDLERPERWQHLRANGEIID
FT                   VLTYGRQVVFDGREAILAIVQDRTELAEANRQASHAQTLLDSLVTNLPVGVFVKDMHDD
FT                   GRYVLYNQAASTASGQPIDEAIGSIDFDIFPEREAAVFAQHDRMVMRRREVLSVERKVE
FT                   RKDGTSRTMRIIKSSIPPVEGNEPRYLIGFVEDITERREIEKRMVHIAMHDSLTGLPNR
FT                   AYFPHHVGSLLKKGSDCDPFALFYLDIDHFKNVNDSISHQAGDQLLQEVALRLRQITTA
FT                   DQFIARLGGDEFAIVYRSGTLAQIAMFADRVLSAFQDPFVLGGNAEFVTCSMGIAQAPL
FT                   HGDNPDVLMRNADLALYASKSGGRRTFRFYQDSLRLAAEKRHVMTSDLRQALAAGQFQL
FT                   HYQPIFNLEGGHISGFEALIRWNHPEHGMIPPLEFISVAEETGLIGPIGDWVLQEACRE
FT                   AARWPEDIKVSVNLSPVQFDQSTLLQSVTDALGAAHLAPERLELEITETVFLSNSKHNI
FT                   ELLFDLRRLGVRIAMDDFGTGYSSLSYLRAFPFDKIKIDRSFVSGIEVDTRDLAIIQAV
FT                   ATLGAGFNIVTTAEGVETAQQLERLKNERFGEVQGYFTGRPMRAGDVHAFIRNSGGLGM
FT                   ARPHNTLAI"
FT   gene            230485..232965
FT                   /locus_tag="BCAN_A0223"
FT   CDS_pept        230485..232965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0223"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="GO_function: GO:0046873 - metal ion transporter
FT                   activity; GO_process: GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61317"
FT                   /db_xref="GOA:A9M7Q7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Q7"
FT                   /protein_id="ABX61317.1"
FT                   /translation="MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNL
FT                   ATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVDLAIEGMSCASCVSKVEKALSGVPG
FT                   VTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAEAQSEKRDAE
FT                   AAELKKSVILAAILTLPVFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGP
FT                   GLRFFKKGVPTLLRGTPDMNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMI
FT                   VTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRDGQAIDVPLEDVRAGDIVQVRP
FT                   GEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDM
FT                   VISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALV
FT                   NAIAVVIIACPCAMGLATPTSIMVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTL
FT                   TEGKPALAHFDTVEGFDKDELLALVAAVEARSEHPIADAIVAAAQEKGLKLAEVSAFEA
FT                   VPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAI
FT                   LTVADPMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVA
FT                   ALKRLSAGGKRIAFVGDGINDAPALAAADVGLAIGTGTDIAIESADVVLMSGDLRGVVN
FT                   AIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPVLAAGAMALSSIFVL
FT                   SNALRLRRLRLAVQ"
FT   gene            complement(232945..233394)
FT                   /gene="cueR"
FT                   /locus_tag="BCAN_A0224"
FT   CDS_pept        complement(232945..233394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="BCAN_A0224"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="GO_function: GO:0016563 - transcriptional activator
FT                   activity; GO_process: GO:0006878 - copper ion homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61318"
FT                   /db_xref="GOA:A9M7Q8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Q8"
FT                   /protein_id="ABX61318.1"
FT                   /translation="MNIGQAAAASGISAKMIRHYETIGLIEAADRTSSGYRIYTQKDVE
FT                   TLRFIRRSRDLGFQVEQIKELLALWRDRNRASADVKKVALGHIEELEAKMRQLQEMADT
FT                   LRYLARNCHGDNRPDCPIIHQLAEPGPEARKPPQPRKGELLHGKT"
FT   gene            complement(233500..234246)
FT                   /locus_tag="BCAN_A0225"
FT   CDS_pept        complement(233500..234246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0225"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61319"
FT                   /db_xref="GOA:A9M7Q9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Q9"
FT                   /protein_id="ABX61319.1"
FT                   /translation="MKLFLSLFPRMVLVAVLLLFLLHPHLFEPVFRPFVDAGTPVIYDR
FT                   ANLMTLTLQHLGLVALATFCSTLIAVTMAIFVTRRQGAEFLPLSRSLVNIGQTFPPVAV
FT                   LALAVPVFGFGDKPTLIALFLYGLLPIFENTLTGLTSLPPPIVEAARGMGMTGMQRLFK
FT                   VEMPLAMPVILAGIRLSAVIGLATATIGSTVAAKTLGEVIIAGLISNNLAFVLEGGLVV
FT                   AALAILIFDAFQAAEHYLMKRTGRTA"
FT   gene            complement(234243..235181)
FT                   /locus_tag="BCAN_A0226"
FT   CDS_pept        complement(234243..235181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0226"
FT                   /product="ABC transporter related"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61320"
FT                   /db_xref="GOA:A9M7R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R0"
FT                   /protein_id="ABX61320.1"
FT                   /translation="MIEFDRITKNYNGRAAVDEVSFTIEPHSIAAIVGTSGSGKTTLLR
FT                   MVNRLEEPTSGEIRIDGQSILDEPGHELRRRIGYVIQQHGLFPHRTVGENIATVPALLG
FT                   WPKQRIEARVDELLELFQLEPGAYRDRYPHELSGGQQQRVGVARALAAGPNILLMDEPF
FT                   GALDPVIRAKAQEDLKAIQRRFGTTILLVTHDMEEAISLGDRIAVMDEGKLLQFGPPAE
FT                   ILARPATEFVERLVGTGERPFRLLSLTDLKTVLQPGDASGEPLPVTASQRDALAELLWS
FT                   GRRALPVLDEDGRSLGRVTLEKLLHQAERPA"
FT   gene            complement(235178..236338)
FT                   /locus_tag="BCAN_A0227"
FT   CDS_pept        complement(235178..236338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0227"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61321"
FT                   /db_xref="GOA:A9M7R1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R1"
FT                   /protein_id="ABX61321.1"
FT                   /translation="MGHIAGRIDKLGLVISVLGVGGLLLPFATFRANRIVQGEPRFLFD
FT                   ALPGAIAGLFVLIIGASLLVALLSQHRLLRLGASLISLAVLLVTIGLAATHLAPEGNNY
FT                   ARISPASGFWLLLFALALYTADGLVRLKVRPLPRIALLVVATGLLALLLSSGLWDDISF
FT                   MKEYHSRAASFWIEARRHIALALGSLLAAAIAGIPLGLICHRLPRLRASVLNSLNIVQT
FT                   IPSMALFGILIAPLSWFAAQFPWAESLGIRGIGAAPAFVALFLYSLLPIVANTVAGLAQ
FT                   VPEPVTDAARGMGMTRLQRLFRTEFPLAFPVILTGIRIVMVQNIGLTTIAALIGGGGFG
FT                   IFVFQGIGQTAMDLVLLGALPTVLLAFAAAVILDAAIEIADRGKPA"
FT   gene            complement(236411..237478)
FT                   /locus_tag="BCAN_A0228"
FT   CDS_pept        complement(236411..237478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0228"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61322"
FT                   /db_xref="GOA:A9M7R2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R2"
FT                   /protein_id="ABX61322.1"
FT                   /translation="MGGTHRALVLSLLPAHCQEGGKRRFPFSARAIVYLHREKTACGMK
FT                   SMSYRNLLKGSAFALALFVGAIQFSSLAEAQVAVSSKIDTEGGVLGNIILTVLNANGIK
FT                   TTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFNKADDPLWKDPAKAYETAKKLDY
FT                   DANKIVWLTPSPANNTWGIAVRKDVANENKLASLSDFGKYIAGGGKVVLAASSEFVNSA
FT                   AALPAFQTAYGFTLKPDQLITLSGGDTAATIAAAANQTNGANAAMVYGTDGGIAPSGLV
FT                   VLEDDKHVQPVYQPAPIIREEVLKKDPKIEELLKPVFEKLDLTTLQDLNGRVQLGGEPA
FT                   KAVAEDFLKKNGFLK"
FT   gene            complement(237511..238176)
FT                   /locus_tag="BCAN_A0229"
FT   CDS_pept        complement(237511..238176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0229"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61323"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014602"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R3"
FT                   /protein_id="ABX61323.1"
FT                   /translation="MRAETMKKFIIASLVGISAALPLPTHAETNKAPENSTIINGMDFG
FT                   PLAKLVGTWKKVEPGGTDVAPGKEGPNVGKGGTAVEPYYEVLTFEPAADATNASDQYLV
FT                   AMYYKHEVFRVRDNGKFHDQRGYLIYDKKNNTVYNTFCIPRAVCVVAEGPAGETMSLET
FT                   KENGIAESSYMAKNDKTMKFSFEIDLSGDQLQYTQVTSLQVYGQPFEHVDTSTLEKVK"
FT   gene            complement(238466..239731)
FT                   /gene="gdhA"
FT                   /locus_tag="BCAN_A0230"
FT   CDS_pept        complement(238466..239731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="BCAN_A0230"
FT                   /product="Glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61324"
FT                   /db_xref="GOA:A9M7R4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R4"
FT                   /protein_id="ABX61324.1"
FT                   /translation="MTTENLLESALVRLDEAASHINIDADVIEKLKFARETMKVRLMIR
FT                   MDDGSRKSFIAWRCRYDDTRGPTKGGIRYHPDSTVEEVETLAFWMTFKCAVMNLPYGGG
FT                   KGAIQVDPRQLSKAELERLSRAYIQAFSGIIGPDRDIPAPDVYTNSMIMGWMADEYSQI
FT                   VGQSSPAVITGKPIALGGSLGRNDATARGGFYLVRHLSHDLGLASVLRVAIQGFGNAGQ
FT                   FMAKLMAGDGHKIVAVSDSAGAVYCADGLDVDLLLAAKADGKSVISTAGHKGHEAISAD
FT                   ELVAADCDVLVPSTMENMIHASNAASIRAKLIVELANGPVTGDADKILAEKGVMVLPDI
FT                   LANAGGVTVSYFEWVQNRQGYYWTLEEIHERLKTIMEREGRAIWNHARERGVTLRTAAY
FT                   VHALERLAQAIEAHGTQNDFAA"
FT   gene            239922..240089
FT                   /locus_tag="BCAN_A0231"
FT   CDS_pept        239922..240089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0231"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61325"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R5"
FT                   /protein_id="ABX61325.1"
FT                   /translation="MVRMSYLWRLVTQACCRLLAGAHKISSKASRMPQWCAGQVKMVVV
FT                   HVPLFFSFSR"
FT   gene            240058..241311
FT                   /locus_tag="BCAN_A0232"
FT   CDS_pept        240058..241311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0232"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61326"
FT                   /db_xref="GOA:A9M7R6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R6"
FT                   /protein_id="ABX61326.1"
FT                   /translation="MSRFSLASVVKNALSGNRNWEPQWPDAQPRAEYDVIIVGAGGHGL
FT                   GAAYYLAKEHGITNVAVIEKGWLGGGNTGRNTTIIRSNYLYDESAHLYEHAMKLWEGLS
FT                   QDLNYNVMFSQRGVMMLAHTVHDVQSFKRHIHANRLNGIDNEWLTKEQAKEYCPPLDIS
FT                   PNARYPVIGATLQRRGGVARHDAVAWGYARGASQRGVDIIQNCPVLAIRRDASGRVSGV
FT                   ETARGFIKAKKVAVSAAGNTSVVMDTASVRMPLESFPLQALVSEPVKPIFPCVVMSNTV
FT                   HAYISQSDKGELVIGSGTDQYVSYSQRGGLPLIEHTLAAICEVFPIFTRMRMLRKWGGI
FT                   VDVTPDRSPIIGKTPVPGLYVNCGWGTGGFKVTPGSAHVFAHTIARDEPHWINAPFTLE
FT                   RFTTGRLIDEAAAAAVAH"
FT   gene            241330..241635
FT                   /locus_tag="BCAN_A0233"
FT   CDS_pept        241330..241635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0233"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61327"
FT                   /db_xref="GOA:A9M7R7"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R7"
FT                   /protein_id="ABX61327.1"
FT                   /translation="MLLIRCPYCEMERPELEFAYAGEAHIARPADPSTLSDEEWRDFLF
FT                   TRSNPRGTHYERWRHIHGCGRFFNAVRDTVSDKFVVTYKAGKPRPVLEQTPAAETK"
FT   gene            241635..244634
FT                   /locus_tag="BCAN_A0234"
FT   CDS_pept        241635..244634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0234"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61328"
FT                   /db_xref="GOA:A9M7R8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R8"
FT                   /protein_id="ABX61328.1"
FT                   /translation="MTDMRIQNKGRVNKAKSVRFTFNGKTYSGFEGDTLASALLANGEH
FT                   LTGRSFKYHRPRGILSAGSEEPNALMGVSRGAGRFEPNTRATALELYDGLKAESQNHWP
FT                   SLKHDVGAINDAFSMFFSAGFYYKTFMWPKSFWNKVYEPFIRGAAGLGKSPSEPDPDTY
FT                   ASRYAYCDVLVVGAGPAGLAAALEAAKSGAKVMLCDEQAELGGSLLSEPEPVINGRASW
FT                   DWLDETLAALAAMPNVTLLPRTTAIGYYHQNMLGLCQRLTDHLPNPPANAPRERMWRVR
FT                   AKQVVLAQGAIERPLVFAGNDRPGVMLAGAGRTYLNRYGVKVGHKAVIVTSHDSAWLAA
FT                   FDLAVAGVKVPAIIDVREHVAGSLVNRAKMLGIETLTGWTVTDTGGRHRVSSVRANPVQ
FT                   GGVAGAPRTIECDVVLMCGGWTPSVHLFSHTKGQLVWDEERQIYLPGARTEESRCAGAG
FT                   NGHFDLEAALREGAQSGAGAASDAGYKASAREYAVAGDFICNGISCRELPTDRDPGKAK
FT                   AFIDFQNDVTAKDIRLAVREGFRSIEHVKRYTTNGMATDQGKTSNINGLAVASDALKRP
FT                   APQVGLTTFRPPYTPTTFGAFCGYNRGKLFEVTRKTPIDAWAEQHGAAFEPVSLWRRAW
FT                   YFPKPGEDMHQAVARECRATRQSLGMFDASTLGKIEVVGPDAAEFMNRMYTNPWTKLGV
FT                   GRCRYGLLLGEDGFIRDDGVVGRLTQDRFHVTTTTGGAARVLNMMEDYLQTEWPQLKVA
FT                   LTSTTEQWAVVAINGPNARKLIEPMVEGLDISDEAFPHMSVAECTFLGVPARLFRMSFT
FT                   GELGFEINVPSRYGLALWKALYEAGQQYDITPYGTETMHILRAEKGYIIVGQDTDGTVT
FT                   PDDASLGWAIGKQKPDFVGKRSLSRPDMLKKDRKHLVGLLTKDPKLVLEEGAQIVADPK
FT                   QAVPMTMLGHVTSSYWSETLGRSIAMALVSGGKDRMGETIYMPMPDGSVHEAFISGTVF
FT                   YDPEGKKLNA"
FT   gene            244645..245199
FT                   /locus_tag="BCAN_A0235"
FT   CDS_pept        244645..245199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0235"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="GO_function: GO:0008115 - sarcosine oxidase
FT                   activity; GO_process: GO:0046653 - tetrahydrofolate
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61329"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7R9"
FT                   /protein_id="ABX61329.1"
FT                   /translation="MLVETNPYSHRRVSIPGRLDVLPAKDGARFILRIAPAKLALAEKT
FT                   LGAKIPAKIGGLAKTGETAVACIGPDEWYIWAGEGEADAIRQAFARLYESEPHSLVEVS
FT                   HRETGIDISGPEAEWLLNAASPLNLAEMLAPGAARTVFDHAQVILLKWDADHYRIEVWN
FT                   SFADHVWTLLETASREVELSI"
FT   gene            complement(245252..246100)
FT                   /locus_tag="BCAN_A0236"
FT   CDS_pept        complement(245252..246100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0236"
FT                   /product="amidohydrolase 2"
FT                   /note="GO_function: GO:0001760 -
FT                   aminocarboxymuconate-semialdehyde decarboxylase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61330"
FT                   /db_xref="GOA:A9M7S0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S0"
FT                   /protein_id="ABX61330.1"
FT                   /translation="MLIDTHLHLIDKNALSYPWLKSAPALNRDFLFDSYRLQAERAGIG
FT                   GALHIEVDVAPHAMQAETDHIRQIARRSGGFIKGAIASCRPEEPGFAAYLERQLSDPFV
FT                   KGLRRVLHVVPDEVSEGALFRENIKRLEGTGLTFDLCVQPHQIGKAIALADLAPDLCFI
FT                   VDHCSAPDIKAGALDGWREGMAEISRRPNVIAKISGLVVYCDAESWTVETLRPYAEQVI
FT                   QSFGWDRVIWGSDWPVCTLASSPDAGLSTWVAATHALLEGCSTTEKSRLFCENARRIWN
FT                   L"
FT   gene            complement(246158..246952)
FT                   /locus_tag="BCAN_A0237"
FT   CDS_pept        complement(246158..246952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0237"
FT                   /product="regulatory protein IclR"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61331"
FT                   /db_xref="GOA:A9M7S1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S1"
FT                   /protein_id="ABX61331.1"
FT                   /translation="MREPTLETDDRYRAPALDKGLDILELLASVDGGLTQAEIAKHLDR
FT                   SPNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGLAQLHAPVRRLASFATPFMRELADR
FT                   SKQANQLAVFDRGSVVVIAQQEAPDYWGISIRVGSHISLFDTGSGHVLLAFRSPEEREM
FT                   MIAAHVKSRDEVNLDQDFYDRLDQIRERGYEMMASAQMAGAYNLSAPILGPDGTCIAAL
FT                   TCPYITLVNPSSAPDITQTISLLQKTVRDLSKLVGADVGVTG"
FT   gene            247110..248429
FT                   /locus_tag="BCAN_A0238"
FT   CDS_pept        247110..248429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0238"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61332"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S2"
FT                   /protein_id="ABX61332.1"
FT                   /translation="MQDFKSHVLAGAALLAMGIAPAYAADLPGKFEGVTVNAKLIGGQQ
FT                   YETLYARIADWEKATGAKVNILSKKNHFELDKEIKSDMASGSINWCVGSNHSSFAPQYG
FT                   DLYTDLKPLLPKEEIDAFVPSVIKASMLNGKLVMLPRAQFDVSALYYQKSLYQDEARKK
FT                   AFKEKYGYDLAPPKTWKEVSDQAIFFADPPNFYGTQFAGKEEAINGRFYEMLVAEGGEY
FT                   LDKDGKPAFNSDAGVRALDWFVNLYKAKAVPAGTTNYLWDDLGAGFASGTVALDLDWPG
FT                   WATYFNDPKSSKVAGNVGIVVQPKGSSGKRTGWSGHHGFSVTEACPTKEAAASLVWFLT
FT                   NEDSQKVEAANGTLPTRTKVWEWDIEQAASDPYKKEVLTVFQEAAKNAFPVPSTPSWIE
FT                   ISNAVYPELQAAILGDKTSKEALDSAAQKATQILEDAGDL"
FT   gene            248490..249413
FT                   /locus_tag="BCAN_A0239"
FT   CDS_pept        248490..249413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0239"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61333"
FT                   /db_xref="GOA:A9M7S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S3"
FT                   /protein_id="ABX61333.1"
FT                   /translation="MRRTQYLGWIMFKRLSPPVLLLLPAFIILAAVVLFPLALSLYSSF
FT                   TPFRLTRPETLFRFIGLRNYERILSDWVFWAAFLRTVVFLTIALNLEMLLGLGLALLVN
FT                   KATWGKRTLRTLIMFPMMFSPVLVGFQFKFMFNDNIGLVNNALQSLGLTDRAIPWLIDG
FT                   NLALVAILTAEVWSSTAVFAILILAGLLAMPQDPVEAARVDGCTPWQTFRYVIWPYLMP
FT                   FAYIAMTIRSLDVARSYDIVKIMTDGGPARRTELIWTLVGRTAYSDAQMGLANAMAYVA
FT                   ILLSILFTVIFFRKLAAARTQIGAEW"
FT   gene            249416..250291
FT                   /locus_tag="BCAN_A0240"
FT   CDS_pept        249416..250291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0240"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61334"
FT                   /db_xref="GOA:A9M7S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S4"
FT                   /protein_id="ABX61334.1"
FT                   /translation="MAQSLSNAQHRMRRRIARVFYLVGLFLAMFVICLPGFWIVLSSLR
FT                   PPVEIMAKPPVWIPQDISLDAYRTMFSGAGAGGVPVWDYFRNSIIVSVTSTVVSLIIGM
FT                   SGGYAFARFRFRGKSATFLGFMLTRSVPGIALSLPLFMVYSRIGIIDTHFGLILTYVAL
FT                   NIPFTIWLIDGFFRQVPKDLAEAAQIDGCTRWQAFWQVEFPLASPGIASAGIFAFLTCW
FT                   NEYALASQLTRSVNSKTLPVGLLDYTAEFTIDWRGMCALAVVMIVPALALTFVIQKHLV
FT                   SGLTFGAVKG"
FT   gene            250299..251390
FT                   /gene="lacK"
FT                   /locus_tag="BCAN_A0241"
FT   CDS_pept        250299..251390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacK"
FT                   /locus_tag="BCAN_A0241"
FT                   /product="Lactose transport ATP-binding protein lacK"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61335"
FT                   /db_xref="GOA:A9M7S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S5"
FT                   /protein_id="ABX61335.1"
FT                   /translation="MAQLSIKNLVKRYGSIEVVHGINLEIADKEFVALVGPSGCGKSTT
FT                   LRMIAGLESISGGTLEIGGKVVNDLPPRDRNISMVFQSYALYPHMSVRENMGFSLKIAK
FT                   QPQAEIDRRVNEAAAVLGLEALMDRRPAQLSGGQRQRVAMGRAIVRNPEVFLFDEPLSN
FT                   LDAKLRTQMRTEIKKLHAKVQSTVVYVTHDQVEAMTLADRIVIMRDGHIEQAGTPDEVF
FT                   KRPATQFVAGFIGSPPMNMAEATVKGDELLFANGDRLPLPARFKARVGEGAKVTFGLRP
FT                   DDIFPKGHGLSTGDGVHEKELRVVITEPLGNETLVFAEFAGREWVARMLNPRPVQPGES
FT                   IAMQFDLAQAHLFDAATGKSLAV"
FT   gene            251393..252511
FT                   /gene="mdlA"
FT                   /locus_tag="BCAN_A0242"
FT   CDS_pept        251393..252511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="BCAN_A0242"
FT                   /product="Mandelate racemase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61336"
FT                   /db_xref="GOA:A9M7S6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S6"
FT                   /protein_id="ABX61336.1"
FT                   /translation="MARIERFELRMVDLPPKAKRTDAIQSFVSQETPIVTITDSDGAVG
FT                   TGYSYTIGTGGSSVMRLLADHLAPLVIGEDADCIEAIWRRLEFATHATTIGAITALALA
FT                   AIDTALWDLRAKKQNLPLWKLAGGARDHCPLYTTEGGWLHIEKEALVEDALQAKAKGFT
FT                   GSKIKIGKPHGAQDYARLSAVRAAVGAAFEIMTDCNQGFTVDEAIRRAERLKELDLAWI
FT                   EEPLPADDLDGHMRLARSTATPVAVGESIYSIRHFREYMHKGACSIVQVDVARIGGITP
FT                   WLKVAHMAEAFDIPVCPHFLMELHVSLVCAVPNGRYVEYIPQLDDLTDKGMEIRDSHAV
FT                   APSQPGIGIAWDWDAVRSRSIGEFTREIVRAP"
FT   gene            252508..252852
FT                   /locus_tag="BCAN_A0243"
FT   CDS_pept        252508..252852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0243"
FT                   /product="protein of unknown function DUF718"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61337"
FT                   /db_xref="GOA:A9M7S7"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S7"
FT                   /protein_id="ABX61337.1"
FT                   /translation="MSKHQGQRMGMVIGLNPEKVAKYKALHAQVWPEILALISECNITN
FT                   YSIFLKELENLLFGYWEYVGSDFAADMRKMAESPKNQEWWSVCMPCQKPLETRKEGEWW
FT                   AMMEEVFHHD"
FT   gene            252845..253924
FT                   /locus_tag="BCAN_A0244"
FT   CDS_pept        252845..253924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0244"
FT                   /product="oxidoreductase domain protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61338"
FT                   /db_xref="GOA:A9M7S8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S8"
FT                   /protein_id="ABX61338.1"
FT                   /translation="MTDAFDPKALRQWWARPSRPKPIVIFGAGSIVGDAHLPAYEKGGF
FT                   PVTGIFDPDLEKARKLAEKWGVTAFASMQEALAVEGAVFDLAIPPSAHVSVLSQLPEGA
FT                   AALIQKPMGSDLAGATEILKVCRARKLKAAVNFQLRFAPMMLALYDAVDKGWLGEVVDF
FT                   DAWLALATPWGLWPFLKGLPRIEIAMHSIHYLDFVRGLLGNPQGVHAKSIGHPDHDVAQ
FT                   TRTAAILDYGERVRCALSINHDHDFGRKFQACEFRICGTQGAAYVKLGVNLDYPRGEPD
FT                   ELWIRPKGGDDWVCVPLEGAWFPDAFLNRMAHLQRFACREDDELVGSVEDAWHTMALVE
FT                   AAYRSSAAPATPLAARPEV"
FT   gene            254029..254763
FT                   /gene="polS"
FT                   /locus_tag="BCAN_A0245"
FT   CDS_pept        254029..254763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polS"
FT                   /locus_tag="BCAN_A0245"
FT                   /product="Sorbitol dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61339"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7S9"
FT                   /protein_id="ABX61339.1"
FT                   /translation="MTIRLDGKTALVTAAGQGIGQASALAFAEAGAKVYATDINADALA
FT                   KLEGIAGIVTRRLDVLDDAAVKALVAEIGQIDILFNCAGFVHNGTILEMKDEELDFAVN
FT                   LNVRSMIRTIRAVLPGMLERKDGAIINMASVASSVKGVSNRFVYGLTKAAVIGLTKAVA
FT                   ADYVGKGIRCNAICPGTVESPSLQDRLRAQGDYEAARAAFIARQPIGRIGQPEEIADLA
FT                   VYLAGATYTTGQAYNIDGGWSI"
FT   gene            254804..255649
FT                   /locus_tag="BCAN_A0246"
FT   CDS_pept        254804..255649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0246"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61340"
FT                   /db_xref="GOA:A9M7T0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T0"
FT                   /protein_id="ABX61340.1"
FT                   /translation="MKFLRYGAAGQEKPGLLDADGTIRDLSAHVSDLSGAALDPDALAK
FT                   LGALDVNSLPKVEGNPRIGPCVAGTGKFICIGLNYSDHAAETGAAVPSEPIIFMKATSA
FT                   IVGPNDDLVIPRGSQKTDWEVELGIIIGKTAKYVSEEDALDYVAGYCTIHDVSERAFQI
FT                   ERQGQWTKGKSCDTFGPTGPWLVTKDEIADPENLAMWLKVNGETMQNGSSRTMIYGVRH
FT                   LVSYLSQFMSLQPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLGSQKQNVRADS
FT                   "
FT   gene            255663..256940
FT                   /locus_tag="BCAN_A0247"
FT   CDS_pept        255663..256940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0247"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61341"
FT                   /db_xref="GOA:A9M7T1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T1"
FT                   /protein_id="ABX61341.1"
FT                   /translation="MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDEA
FT                   LKGHGLTFTIGRGNDICCHAILAMRHLVVGASLDEIRAAPGKFWHHLTGDSQLRWIGPE
FT                   KGAMHLATGAVVNAIWDLLAKQAGKPVWRLVSELSPEEIADIVDYRYLTDVLTRDEAIE
FT                   ILRKAESGKAERIATLEAEGYACYTTSAGWLGYDDAKLRRLCQEAIDEGFNHVKMKVGH
FT                   DLEDDIRRLTIAREVIGPDRYLMIDANQVWEVDQAIEWVRRLAFANPFFIEEPTSPDDV
FT                   AGHRKIRAAIGPVKVATGEMCQNRIMFKQFIAEGAIDVVQIDSCRMGGLNEVLAVLLMA
FT                   AKYDLPVWPHAGGVGLCEYVQHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLDPCIIRNA
FT                   AYMPPSLPGFSIEMKPQSIAQYAFKG"
FT   gene            complement(257339..257890)
FT                   /locus_tag="BCAN_A0248"
FT   CDS_pept        complement(257339..257890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0248"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61342"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T2"
FT                   /protein_id="ABX61342.1"
FT                   /translation="MNAGTAVSRWTEEKAQTKVLLGEIVMLWGDVMASVYRLPSALGLA
FT                   NPEAIQLGLAHLNGDGTRFTYLSKLLRHNPKLADVDEQRIADTIAVLARLNKMNKQRDS
FT                   FVHGLPVLTMKRDQDTRETIRDGCYLIQTRELDEKDRYLKVPEAAETFLTELQEVYDQL
FT                   LQVTVPMLFEDWQQLWDDES"
FT   gene            complement(258719..258856)
FT                   /locus_tag="BCAN_A0249"
FT   CDS_pept        complement(258719..258856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0249"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61343"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T3"
FT                   /protein_id="ABX61343.1"
FT                   /translation="MSDCSMSRHVANQLPWKSTLYRKQRQIRATWNATWIGNLSLKSKG
FT                   "
FT   gene            complement(258906..258978)
FT                   /locus_tag="BCAN_A0250"
FT   tRNA            complement(258906..258978)
FT                   /locus_tag="BCAN_A0250"
FT                   /product="tRNA-Phe"
FT   gene            complement(259163..259378)
FT                   /locus_tag="BCAN_A0251"
FT   CDS_pept        complement(259163..259378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0251"
FT                   /product="protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61344"
FT                   /db_xref="GOA:A9M7T4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T4"
FT                   /protein_id="ABX61344.1"
FT                   /translation="MDEKKNISPACGAKVTPLRPTRPCPECGKPSTREAYPFCSPRCKN
FT                   IDLNRWLSGSYVIAGKPLGEEDENDS"
FT   gene            complement(259388..260014)
FT                   /gene="maf"
FT                   /locus_tag="BCAN_A0252"
FT   CDS_pept        complement(259388..260014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="BCAN_A0252"
FT                   /product="septum formation protein Maf"
FT                   /note="GO_component: GO:0030428 - cell septum; GO_process:
FT                   GO:0000917 - barrier septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61345"
FT                   /db_xref="GOA:A9M7T5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T5"
FT                   /protein_id="ABX61345.1"
FT                   /translation="MNVQHKLVLASGSPRRIELLGQAGIEPDRIHPADIDETPQRAEHP
FT                   RSLARRLSRDKARKAHEQLQGEAGFSGALVLAADTVVAVGRRILPKAEIEDEARECLRL
FT                   LSGRTHKVFTGVCLVLPNGNLRQTLVETRLRFERLSRLQINAYLSSGEWRGKAGGYAIQ
FT                   GLAGSFVVKLVGSYTNVVGLPLQETVGLLADGGYPVYANWGTGKV"
FT   gene            complement(260048..260266)
FT                   /gene="infA"
FT                   /locus_tag="BCAN_A0253"
FT   CDS_pept        complement(260048..260266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BCAN_A0253"
FT                   /product="translation initiation factor IF-1"
FT                   /note="GO_function: GO:0003743 - translation initiation
FT                   factor activity; GO_process: GO:0006413 - translational
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61346"
FT                   /db_xref="GOA:A9M7T6"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7T6"
FT                   /protein_id="ABX61346.1"
FT                   /translation="MAKEEVLEFPGVVTELLPNAMFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRLK"
FT   gene            complement(260378..260851)
FT                   /locus_tag="BCAN_A0254"
FT   CDS_pept        complement(260378..260851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0254"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="GO_function: GO:0004725 - protein tyrosine
FT                   phosphatase activity; GO_process: GO:0006470 - protein
FT                   amino acid dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61347"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T7"
FT                   /protein_id="ABX61347.1"
FT                   /translation="MVAVTRTDAEGGKEAATRLPTSILFVCGKNAIRSPMAELLARTLL
FT                   PANIYIASAGVKRGERDPFVDAVLSEEGLSLDNRQPRGIEELADGYFDLIVTLTPLAHH
FT                   TVLERMRGFSVDVEYWPTPDPTLVTGSREQIMAAYRDVRDRLKRRITLRFGFG"
FT   gene            complement(260858..261340)
FT                   /locus_tag="BCAN_A0255"
FT   CDS_pept        complement(260858..261340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0255"
FT                   /product="uncharacterised conserved protein UCP032146"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61348"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7T8"
FT                   /protein_id="ABX61348.1"
FT                   /translation="MTADVPNARLVDVELDESIGRSTPDVEHERAVAIFDLIEENSFHP
FT                   VGDQKGGPYRLKLSLMESRLIFSITRENGDAVATHILSLTPLRRVVRDYFMICESYYQA
FT                   IRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG"
FT   gene            complement(261347..262639)
FT                   /gene="hisD"
FT                   /locus_tag="BCAN_A0256"
FT   CDS_pept        complement(261347..262639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="BCAN_A0256"
FT                   /product="histidinol dehydrogenase"
FT                   /note="GO_function: GO:0004399 - histidinol dehydrogenase
FT                   activity; GO_process: GO:0000105 - histidine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61349"
FT                   /db_xref="GOA:A9M7T9"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7T9"
FT                   /protein_id="ABX61349.1"
FT                   /translation="MVTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREG
FT                   DSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLP
FT                   KDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPA
FT                   PDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKR
FT                   IVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAV
FT                   EEAVERQLHTLARTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFV
FT                   PRIRNAGSIFIGGYTPEVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSE
FT                   QLRALGPAAIEIARAEGLDAHAQSVAIRLNL"
FT   gene            complement(262714..263154)
FT                   /locus_tag="BCAN_A0257"
FT   CDS_pept        complement(262714..263154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0257"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61350"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U0"
FT                   /protein_id="ABX61350.1"
FT                   /translation="MEMLKLVALDEEDLQVLSAHLQDAVLKVSDLQYLAREKRFLLTAN
FT                   RFVWEEARPKFLRKPSYQRRRTALHFNRVSMAKATGINRQNQDDVLSLLTIRFIPGQTP
FT                   AGTIELTFSANAAIRLDVECIEAQLTDLGAAWETESLPRHNV"
FT   gene            complement(263425..264714)
FT                   /gene="murA"
FT                   /locus_tag="BCAN_A0258"
FT   CDS_pept        complement(263425..264714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BCAN_A0258"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="GO_function: GO:0008760 - UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase activity; GO_process: GO:0009252
FT                   - peptidoglycan biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61351"
FT                   /db_xref="GOA:A9M7U1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7U1"
FT                   /protein_id="ABX61351.1"
FT                   /translation="MDRIKIVGGNKLNGVIPISGAKNAALPLMIASLLTDDTLTLENVP
FT                   HLADVEQLIRILSNHGVDYSVNGRREHQNGPYSRTIHFTARNIVDTTAPYELVSRMRAS
FT                   FWVIGPLLARMGEANVSLPGGCAIGTRPVDLLLDALLALGAEIDIENGYAKAKARNGLV
FT                   GARYKFPKVSVGATHVMLMAATLAKGETIIENAAREPEVANLADCLNAMGAKISGAGSS
FT                   TIHVQGVTNLSGARVRIIPDRIEAGTYAMAVAMTGGDVLLEGAQESQLSCVLETLRQAG
FT                   AEINETNSGLRVVRNGHGIQPVDITTDPFPGFPTDLQAQFMGLMTRAKGTSHITETIFE
FT                   NRFMHVQELARLGAKISLSGQTATVEGVERLKGAQVMATDLRASVSLVIAGLAAEGETI
FT                   VNRVYHLDRGFERLEEKLSRCGADVKRISG"
FT   gene            complement(264937..265116)
FT                   /locus_tag="BCAN_A0259"
FT   CDS_pept        complement(264937..265116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0259"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61352"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U2"
FT                   /protein_id="ABX61352.1"
FT                   /translation="MTEKTTPREKLTEADYRKKRLAEQLRANLMRRKAQSRSRRAGEAD
FT                   ERNDGITAGHGKEE"
FT   gene            265265..265336
FT                   /locus_tag="BCAN_A0260"
FT   tRNA            265265..265336
FT                   /locus_tag="BCAN_A0260"
FT                   /product="tRNA-Thr"
FT   gene            265419..267185
FT                   /locus_tag="BCAN_A0261"
FT   CDS_pept        265419..267185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0261"
FT                   /product="Hypothetical protein, conserved"
FT                   /note="GO_function: GO:0003677 - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61353"
FT                   /db_xref="GOA:A9M7U3"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U3"
FT                   /protein_id="ABX61353.1"
FT                   /translation="MGLPMPAPYKHPKTGVYYLRQRVPADLKDKARGKIVALPISGTLK
FT                   SFTVGDSVKASLETKDPADAKARYREADASLSKFWEAVRNGPLSLTQKEIAERAGLVYK
FT                   FFADTFEDDAEAPELWERAQRINAVVLKKAKLGKRPTYPLTVAQRDILEPRFGGFVDKL
FT                   LIDTGEQVDQESRDKLLVAVAEALQQSTGTILKRADGDYSPDTAIRQRYPEYAPIEKPQ
FT                   AVPRQTEERSGAKLDLYNLLDHKFKDKGKAKTHRDYRSEIDKFVKFIGHSDAERITKDN
FT                   VREWRDALIAQGLSLKTVNDKRLTAIKAVLAHGVAEFSLSQNVADGIRDKRQEAAPVGS
FT                   KGYSPEQAKAILQATFNGTDKELDPHYQRAVFWVPWICAYTGLRVSEVTQLQGKNVRNV
FT                   DGHAIFVITPQDGSTKSGKAWTTGIHPHLIEMGILDMFKAVGDGPAFYRAYPVGTDLQK
FT                   IAGKHRAKESASRVGDWVTATLGETAPGGRPNHAWRHTFTTLSRRVKMDKEARDYMLGS
FT                   RSRTDAREGYGDWTPDVICGEIDKLPRFDVKETDYRPTLRVMKPKPISEPYVRPKKTRG
FT                   GKLVLTPRVPKG"
FT   gene            267280..267702
FT                   /locus_tag="BCAN_A0262"
FT   CDS_pept        267280..267702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0262"
FT                   /product="Uncharacterized protein HI1418"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61354"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U4"
FT                   /protein_id="ABX61354.1"
FT                   /translation="MDHRVRVVLLNGDPWFVAADVVSLLGLATYADGSPNVTHATRVLN
FT                   TTEKLLLRRTTPHLMSGSVEKLFAFRQPSLLSVSESGLYKLIMRSRKPEAKKFQNWVTQ
FT                   VVLPAIRKDGMYVRGEEKVSAGEMDLEELTLITLTD"
FT   gene            267715..267909
FT                   /locus_tag="BCAN_A0263"
FT   CDS_pept        267715..267909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0263"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61355"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U5"
FT                   /protein_id="ABX61355.1"
FT                   /translation="MGQDGERTSWFVAVDLYDILFGLRTGISTRWFLKREETKTLRKAE
FT                   SAQYALSSRSQISSRPRPG"
FT   gene            268501..269118
FT                   /gene="cin"
FT                   /locus_tag="BCAN_A0264"
FT   CDS_pept        268501..269118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cin"
FT                   /locus_tag="BCAN_A0264"
FT                   /product="DNA-invertase"
FT                   /note="GO_function: GO:0000150 - recombinase activity;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61356"
FT                   /db_xref="GOA:A9M7U6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U6"
FT                   /protein_id="ABX61356.1"
FT                   /translation="MNNATVANVAATYRGQLVGYARTSTTDQKAGLAAQERDLQAAGCD
FT                   RIFSEQTSAKDSKRPELQRALDHLREGDTFIVTKLDRLARSVADLVDLTGQLSSKGVSL
FT                   RILAMNLDTATPTGKLMLNLLGSIAEFERELMLERQREGIAAAKAGGKYKGRAPTAQRQ
FT                   ADEIIRLKDEGKTVAEIMAATKAGRSSVFSILKEAGRTERQR"
FT   gene            269676..271040
FT                   /locus_tag="BCAN_A0265"
FT   CDS_pept        269676..271040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0265"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61357"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U7"
FT                   /protein_id="ABX61357.1"
FT                   /translation="MVDYADDVDGVILEDDEQGNDSEPQEEDAETRRYSDMAFNPWRFA
FT                   ATVKAEALVREAVQAVEAAETRQKKRRATDQKVFEDTVEAIICDLMHHRICGHEHGIRV
FT                   SRSNRSLGKSRYRNPIYSKVFPSILDKLEYAGWIEQTVGDRGKVVKGAQTVIYPGLRLV
FT                   SRMDAVDISLADMGIADQSDPIILQRPKKDRRLFGAREEYEDNERTRQFRSEMDQINGW
FT                   LGKADLEVLDASDIAVDDTGAAIIRLHDPAKRKLRRYFTDSDHTFTSGGRLFGGFWQNM
FT                   TKAERRDLLLIEGESCVALDYSGMGLRIAYGHAGIDPGEGDLYLVPGLEDFRSGVKIVT
FT                   SAMLAASTRLRRMPEGTRVKFPRLLKFSTVRDAIEGRHPSIRHLFYSGHGHAVQFTESQ
FT                   IMVDVLLRLMKMEIVALPVHDAVLIAESKADQTKAVMLEAFRDHVGFPGSVTFEN"
FT   gene            271628..271807
FT                   /locus_tag="BCAN_A0266"
FT   CDS_pept        271628..271807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0266"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61358"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U8"
FT                   /protein_id="ABX61358.1"
FT                   /translation="MVLLNGDPWFVAVDLYSILFKRRTGVASRRFLKPEETKTFRRSES
FT                   AQYALSNLFEAKAS"
FT   gene            complement(272281..272565)
FT                   /locus_tag="BCAN_A0267"
FT   CDS_pept        complement(272281..272565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0267"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61359"
FT                   /db_xref="GOA:A9M7U9"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7U9"
FT                   /protein_id="ABX61359.1"
FT                   /translation="MRLWLHLRRLWQTLTFVATCGTMGHTFSRTTVQMLTVGPVTTIPH
FT                   TATSTHTRGAQAHTRLRMEAEATGEAAATAVIHTVATAMAALVFNVFRA"
FT   gene            complement(272679..272939)
FT                   /locus_tag="BCAN_A0268"
FT   CDS_pept        complement(272679..272939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0268"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61360"
FT                   /db_xref="GOA:A9M7V0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V0"
FT                   /protein_id="ABX61360.1"
FT                   /translation="MSEIHQVTGSQIAAARALIRMSQADLAAAAGVSVPTLGRMETSEG
FT                   PASGLRNNVLAVKRALEAAGVVFMAEGELIAGGAGGRLKSA"
FT   gene            273023..273412
FT                   /locus_tag="BCAN_A0269"
FT   CDS_pept        273023..273412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0269"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61361"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V1"
FT                   /protein_id="ABX61361.1"
FT                   /translation="MNAHTNISGSAAFDPNAWHHSQMTIREAIDLSQSGGHPYSSPNVP
FT                   KGFNTVVGFFFDCYDWYPAAYDDEEGNAMKDRELIQYEEWCAKYARKLGLEVKEVEAPA
FT                   ALKVHGIMTLKAYPEALLEIRCLEL"
FT   gene            274004..274846
FT                   /gene="ureD"
FT                   /locus_tag="BCAN_A0270"
FT   CDS_pept        274004..274846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="BCAN_A0270"
FT                   /product="Urease accessory protein ureD"
FT                   /note="GO_function: GO:0016151 - nickel ion binding;
FT                   GO_process: GO:0006807 - nitrogen compound metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61362"
FT                   /db_xref="GOA:A9M7V2"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7V2"
FT                   /protein_id="ABX61362.1"
FT                   /translation="MLIINDNNLSGLSLQRVNGTGELSVQFKDGRSRISRLYQEGAAKI
FT                   RMPQAVTGPLEAILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSGGGEARI
FT                   ATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEGAQMLVVEATVFGRLAMGERVV
FT                   AARFADRWRVRLGGRVIHAEEFRLGPDVGAELQAPAVAGGACAMATVLMVCEQAGRHLE
FT                   TARAIIGEEGGCSLWRVGKASKLVVRLYAPDSYALRRRLCPLVALLNGKAGLPKVWTI"
FT   gene            274999..275301
FT                   /gene="ureA"
FT                   /locus_tag="BCAN_A0271"
FT   CDS_pept        274999..275301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="BCAN_A0271"
FT                   /product="urease, gamma subunit"
FT                   /note="GO_function: GO:0009039 - urease activity;
FT                   GO_process: GO:0019627 - urea metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61363"
FT                   /db_xref="GOA:A9M7V3"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V3"
FT                   /protein_id="ABX61363.1"
FT                   /translation="MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVVE
FT                   GARDGRTVAELMEAGAYVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR"
FT   gene            275468..275773
FT                   /gene="ureB"
FT                   /locus_tag="BCAN_A0272"
FT   CDS_pept        275468..275773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="BCAN_A0272"
FT                   /product="urease, beta subunit"
FT                   /note="GO_function: GO:0009039 - urease activity;
FT                   GO_process: GO:0019627 - urea metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61364"
FT                   /db_xref="GOA:A9M7V4"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V4"
FT                   /protein_id="ABX61364.1"
FT                   /translation="MIPGEIITLEGDIELNQGQPTVTMRVANTGDRPIQVGSHFHFYEV
FT                   NAALSFDREKARGQRLDIAAGTAVRFEPGQERDVTLVPIRGHREIYGFRQMIMGKL"
FT   gene            275792..277504
FT                   /gene="ureC"
FT                   /locus_tag="BCAN_A0273"
FT   CDS_pept        275792..277504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="BCAN_A0273"
FT                   /product="urease, alpha subunit"
FT                   /note="GO_function: GO:0016151 - nickel ion binding;
FT                   GO_process: GO:0019627 - urea metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61365"
FT                   /db_xref="GOA:A9M7V5"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V5"
FT                   /protein_id="ABX61365.1"
FT                   /translation="MPARISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEVK
FT                   FGGGKVIRDGMGQSQLSRAEGAMDTVITNALILDHSGIYKADIGLLDGRIALIGKAGNP
FT                   DTQPGISIIIGPGTEIIAGEGKIVTAGGIDTHVHFISPQQVDEALNAGITCMVGGGTGP
FT                   AHGTLATTCTPGPWHIARLIQSFDGLPMNIGVFGKGNASLPGALEEMVRAGACGLKLHE
FT                   DWGCTPAAIDNCLSVADHFDVQVAIHTDTLNEGGFVEDTLNAFKGRTIHSFHTEGAGGG
FT                   HAPDIIRVCQYPNVLPASTNPTRPYTVNTIAEHLDMLMVCHHLSPAIPEDIAFAESRIR
FT                   KETIAAEDILHDMGAFSIISSDSQAMGRVGEMIIRCWQTADKMKKQRGSLPDDRPGNDN
FT                   YRARRYIAKYTINPAIAHGMAHEIGSVEVGKRADLVLWNPAFFGVKPDMVLLGGWIATA
FT                   PMGDANGSIPTPQPMHTRPMFGSFGKARTNTSITFVSQAAMDEGLREKIGVDKQLVAVV
FT                   NTRGGIGKHSMILNNAMPQMEVDPETYEVRADGELLTCEPVDVVPMAQRYFLF"
FT   gene            277520..278008
FT                   /gene="ureE"
FT                   /locus_tag="BCAN_A0274"
FT   CDS_pept        277520..278008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /locus_tag="BCAN_A0274"
FT                   /product="Urease accessory protein ureE"
FT                   /note="GO_function: GO:0016151 - nickel ion binding;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61366"
FT                   /db_xref="GOA:A9M7V6"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V6"
FT                   /protein_id="ABX61366.1"
FT                   /translation="MFRAIAIIRAHEVIDAVPASHIVLERDERHLRRKAITLENGEKIL
FT                   ADFAEPVVLEHGDRLVLDDGREIEIRAASEELYEIRGRDPRHIAELAWHIGNRHLAAQI
FT                   ETDRIFILRDHVIRVMLEGLGATVTDVVAIFSPLRGAYSGGHQHHHGHDHDHHHPDHE"
FT   gene            277980..278666
FT                   /gene="ureF"
FT                   /locus_tag="BCAN_A0275"
FT   CDS_pept        277980..278666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="BCAN_A0275"
FT                   /product="Urease accessory protein ureF"
FT                   /note="GO_function: GO:0016151 - nickel ion binding;
FT                   GO_process: GO:0006807 - nitrogen compound metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61367"
FT                   /db_xref="GOA:A9M7V7"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7V7"
FT                   /protein_id="ABX61367.1"
FT                   /translation="MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAVHDGL
FT                   VVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAMKGEDLHEIAELAEALAGSRERHME
FT                   TMLQGGAFLAAARSWPCEIFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFCINL
FT                   LQASIRLSVTGQSGVTAIMAALEPVLGETAARAALSSMEDLGSATFIADIMAMKHETQH
FT                   SRLFRS"
FT   gene            278663..279289
FT                   /gene="ureG"
FT                   /locus_tag="BCAN_A0276"
FT   CDS_pept        278663..279289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="BCAN_A0276"
FT                   /product="urease accessory protein UreG"
FT                   /note="GO_function: GO:0016530 - metallochaperone activity;
FT                   GO_process: GO:0019627 - urea metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61368"
FT                   /db_xref="GOA:A9M7V8"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7V8"
FT                   /protein_id="ABX61368.1"
FT                   /translation="MTQKNGPLRVGIGGPVGSGKTTLTEKLCKAMRDKYSVAVITNDIY
FT                   TQEDALILARRQALSEDRIIGVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVFIE
FT                   SGGDNLAATFSPDLADLTLYVISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVHVDL
FT                   EVMEADAMRMRAKRPFGFTDLHRGKGVQEIIDFIVENGGLEPRSN"
FT   gene            complement(279413..279486)
FT                   /locus_tag="BCAN_A0277"
FT   tRNA            complement(279413..279486)
FT                   /locus_tag="BCAN_A0277"
FT                   /product="tRNA-Arg"
FT   gene            complement(279646..281271)
FT                   /gene="luxN"
FT                   /locus_tag="BCAN_A0278"
FT   CDS_pept        complement(279646..281271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxN"
FT                   /locus_tag="BCAN_A0278"
FT                   /product="Autoinducer 1 sensor kinase/phosphatase luxN"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61369"
FT                   /db_xref="GOA:A9M7V9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7V9"
FT                   /protein_id="ABX61369.1"
FT                   /translation="MHAKAGPHRARGPACGRLTDLEPDMAVADKTIDTSGTSPQAASPA
FT                   AADDRTSSTQFTRLRWRNRLSNKLLLLTALAVLIAEVLIFVPSIANMRVRWMNSRLDTV
FT                   GAVSEVLASSDSMEVPRDIQDKVLLATGTKAIALREAGASRLLALTEMPRKIDKVIDLD
FT                   NISEAGAIWDTFDTLFNGGNRTLRIYGTVSPSTSPGRIIEIVTSDAPLRHAMLVYARNV
FT                   ALISLIISVIAASLVYLIIHEMLLRPVRIMHRNMIDFATTPDNPALILVPENRKDEFGV
FT                   AQRQIAHIQSDLQRTLKEQKHLADLGLAVSKINHDMRNILASAQLMSDRLADTNDPMVQ
FT                   RFAPKLIRTLSRAISYSESVIAYGRSQEEPPKPRRVLLHAIITDVQDTLNLSAESGIEF
FT                   QNLVPENFELDVDSEQLFRVLSNLCRNSAQAMERDQSSDAATIKRLTISAGRIGTTAII
FT                   GVEDTGPGLPQKARDNLFTAFKGSTRSDGTGLGLAIAQELIRAHGGTIELREDRPIGAH
FT                   FEIRLPDLPMQRDTRNNQQAEESA"
FT   gene            complement(281288..281593)
FT                   /locus_tag="BCAN_A0279"
FT   CDS_pept        complement(281288..281593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0279"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61370"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W0"
FT                   /protein_id="ABX61370.1"
FT                   /translation="MSRHRAICFQDFIQPSGQGRLVIPDSPRPKPVSLQRRRQFSSPRG
FT                   KTHAGPQTAWIFSRATLHREIYEVELNFGNASIRLGRARFLTPSAKGVGIMLRQHI"
FT   gene            281556..282707
FT                   /locus_tag="BCAN_A0280"
FT   CDS_pept        281556..282707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0280"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61371"
FT                   /db_xref="GOA:A9M7W1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W1"
FT                   /protein_id="ABX61371.1"
FT                   /translation="MKSWKQIALCLLIILAATGGWYVYKNNNGAAQLALSSGDAPGNVS
FT                   QAQPKKQPKNHAAPLVVVAAAGEETINNRLTAIGSARALSTVSVTPYSSGYMTKLHVRA
FT                   GDTVKEGDLIAELDAETEQIAVAKAETALKDAQTTRQRIARLRATNTATEVQAVGAELA
FT                   VANAQLALQDAQLALSRRMVRAPITGIVGILPVNAGNYVTAQTSIARIDDRSTVLIDIW
FT                   VPERFAPQIKVGQPLTAESTAFPGEIYKGRINAVDNMLDEASRTLHVRAEVPNAEDRLR
FT                   AGMSFSVTILFPGDNYPSVDPLAIQWGADGSYVWRIENGIAKKIPVRIVQRSSDNILID
FT                   GPVKRGDMIVTQGVQTVRDDAPVRVKGEQGVSALAPAAMHDEG"
FT   gene            282722..285853
FT                   /locus_tag="BCAN_A0281"
FT   CDS_pept        282722..285853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0281"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61372"
FT                   /db_xref="GOA:A9M7W2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W2"
FT                   /protein_id="ABX61372.1"
FT                   /translation="MSNKNPSSGGSTALFIRRPVFAFVINILIVVAGLAAFTGVDIREL
FT                   PDVDRPVITISTDFSGASAETIDRQVTQVLENAVARVSGVKSISSTSSFERSRVTVEFN
FT                   DGVDLNVAAADMRDAISRVANNLPEEADPSRIIKADSNADPVMRLAVTSDTMAVDDMTV
FT                   LVEDQIEDVLSAVPGVADVQINGDRDKIFRIDIDQARLASYGLTIADISNALSSMGLDA
FT                   PAGSLRSSDQSIVVRATANLEKPEDFENVYIKGRTQIRDVATVTLGPDIESSVVRSNSK
FT                   TAIGLGIVRQAQSNTLDISQGVRAAVANLQKTLPEGVSIAVTSDDANFINGAIHEVEIA
FT                   LIASVIIVVAIIFMFLWDARATLIPALSMPVALIGTIAAIYLVGFSVNILTLLALVLAT
FT                   GLVVDDAIVVLENVVRRRNQGMGPRAAAVLGTQEVFFAVIATTLTLAAVFVPISFLPGQ
FT                   AGGLFREFGFVLAIAVLLSSVVALTLCPMLASRFLKEASATVESEGHGPLFLRRIGGGL
FT                   ANFYRKTLHACLSAPFIVVLVAVLFAGASYVGYGLIRQELTPSEDRAVALLRINGPQGI
FT                   SVEFLQSQLDKIEEAIQPLRDSGEITTTYAIAGSGGSSNNGFVVLTLAPWKERQRSQQE
FT                   IMADITNRIKGITAVRVFTTQPNSLGIRGAGNGLQFAIVGGEYAKLQPAAQAVVAALEK
FT                   DPRFVQPRLSVEPTQAQISVEINRERASDLGIDITGLANAVQAVLDGRKIGSVYVGDRS
FT                   FDVKLVSTTNPINDPTDLENIFMKTADGRYVPMSSIASVVEKAVPPQLNRELRQRSVAI
FT                   TTNLRDDFALGNAFAAAQEIAAPLLPPGSHIIPLAEASTLSETSSGMAIVFGFAIVIIL
FT                   LVLAAQFESFISALIVMATVPLGLGCAVFAMILTGTSLNVYSQIGLVLLVGIMAKNGIL
FT                   IVEFADQLRDKGLNVREAIEEAANIRLRPVCMTMICAVLGGVPLVLASGAGAEARVALG
FT                   WVIVGGLGLATIATLYVTPVAYLLLGRFTKPKVEEEERLERELVRAEALEEKLK"
FT   gene            complement(285976..287445)
FT                   /gene="hydA"
FT                   /locus_tag="BCAN_A0282"
FT   CDS_pept        complement(285976..287445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydA"
FT                   /locus_tag="BCAN_A0282"
FT                   /product="dihydropyrimidinase"
FT                   /note="GO_function: GO:0004157 - dihydropyrimidinase
FT                   activity; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61373"
FT                   /db_xref="GOA:A9M7W3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W3"
FT                   /protein_id="ABX61373.1"
FT                   /translation="MAKTGASKVIKGGTVITADRTFRADILIEDGKIAAIGDSLEGDEV
FT                   IDASGCYVMPGGIDPHTHLQMPFMGTYSSDDFDTGTAAALAGGTTMVVDFVLPDSEGNL
FT                   LDALQEWFQKAGKARTDYSFHMAITGWNERTFNEMAEVVKRGINTFKHFMAYKGALMVN
FT                   DDEMFASFQRCAELGAMPLVHAENGDIVAQLQAKLMAEGNDGPEAHAYSRPPEVEGEAT
FT                   NRAIMIADQAGVPLYVVHVSCEQSHEAIRRARQKGMRVFGEPLIQHLTLDESEYHNRDW
FT                   DYAARRVMSPPFRDKLNQDSLWAGLAAGSLQCVATDHCAFTTEQKRYGIGNFTKIPNGT
FT                   GGLEERMPVLWTRGVRTGRLTPNEFVAVTSTNIAKILNIYPQKGAVVPGADADLVIWDP
FT                   EATKKISAKTQHSSIDYNVFEGFELKGLPIMTLSRGRIAFDKGQVTAKPGDGRFIEREP
FT                   NGAVNRALSQWKEIVAPRKVERSAEHMPIGV"
FT   gene            complement(287497..288744)
FT                   /locus_tag="BCAN_A0283"
FT   CDS_pept        complement(287497..288744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0283"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61374"
FT                   /db_xref="GOA:A9M7W4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W4"
FT                   /protein_id="ABX61374.1"
FT                   /translation="MVLTSNLRVNSDRLWDSLMEMAKIGPGLRGGNNRQTLTDEDGEGR
FT                   RLFQNWCEKAGLSMGVDTMGNMFFTRPGEDSDADPVYMGSHLDTQPTGGKFDGVLGVLG
FT                   GLEVMRTLNDMNIRTKRPIVVVNWTNEEGTRFAPAMLASGVFAGVLDQNWAYERTDAKG
FT                   KTFGEELVRIGWKGDEPVGSRKIHAMFELHIEQGPILEAERKDIGVVTHGQGLWWLQVT
FT                   LTGKEAHTGSTPMRMRKNASLGLGKLLQLVNEIAMAHQPDAVGGVGHIDVSPNSRNVLP
FT                   GQIVFTVDFRSPNHATLDGMKARFEKEAPKIAEELGIGIEIEVAGNFDPVTFDTGCVEA
FT                   IRNAAERLGYSHRNIVSGAGHDACWVNRVAPTAMVMCPCVDGLSHNEDEDISKEWASAG
FT                   TDVLLHAVLETAEIVS"
FT   gene            288963..289646
FT                   /locus_tag="BCAN_A0284"
FT   CDS_pept        288963..289646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0284"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61375"
FT                   /db_xref="GOA:A9M7W5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W5"
FT                   /protein_id="ABX61375.1"
FT                   /translation="MAIAPSDFRNGSTAKEKAEGGTRIQSINRRLILDAALDVFSAYGF
FT                   RGSTIDQIAEKAGMSKPNLLYYFPRKQNIYVTVLEDTLATWLEPFEDIDPDGDPLEELR
FT                   RYIARKLEISASKPEASRLFANEILHGAPAIAGFLKGRLKELVDEKAAVIHRWIAQKRI
FT                   APVDPYHLIFTIWAVTQHYSDFAVQVSAIMGPRAEAANFYDEAARAVSAIILDGIRLRD
FT                   DAPKS"
FT   gene            289643..290032
FT                   /locus_tag="BCAN_A0285"
FT   CDS_pept        289643..290032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0285"
FT                   /product="NUDIX hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61376"
FT                   /db_xref="GOA:A9M7W6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W6"
FT                   /protein_id="ABX61376.1"
FT                   /translation="MKTIRISAAIIRDEAGRFLLVRKRGSEIFFQPGGKIDDGEDPETC
FT                   LLREIEEELGIRIGRSQLRYAAKMAAPAANETDATVEAELYHLTLEEGQVPVASSEIEE
FT                   LRWNPPGDTTRPVALLSQAIQARFA"
FT   gene            complement(290077..291387)
FT                   /locus_tag="BCAN_A0286"
FT   CDS_pept        complement(290077..291387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0286"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61377"
FT                   /db_xref="GOA:A9M7W7"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W7"
FT                   /protein_id="ABX61377.1"
FT                   /translation="MADLSTNFLGIKSPNPFWLASAPPTDKAYNVERAFKAGWGGVVWK
FT                   TLGAEGPPVVNVNDPRYGAIHGADRRLLGLNNIELITDRPLEINLREMKEVKMRWPDRA
FT                   LIASIMVPCEEEAWKAILPLVEETGADGIELNFGCPHGMSERGMGAAVGQVPEYVGMVV
FT                   KWCKQYSRMPVITKLTPNITDIRKPARAAFANGTDAVSLINTINSIVSVDLDTMSPVPS
FT                   IDGRGSHGGYCGPAVKPIALNMVAEIARDAETAGLPISGIGGITTWRDAAEFIALGCGT
FT                   VQVCTAAMTYGFKVVQEMIDGLSDWMDSKGYQTLDDFQGCAVSHVTDWQYLNLNYVTKA
FT                   RINQDLCIQCGRCHIACEDTSHQAITAMVNGARHFEVIDEECVGCNLCVNVCPVENCIT
FT                   MEQISGVDPRTKAPIMPAYANWTTHPNNPAAMKEAAE"
FT   gene            complement(291391..292887)
FT                   /locus_tag="BCAN_A0287"
FT   CDS_pept        complement(291391..292887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0287"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61378"
FT                   /db_xref="GOA:A9M7W8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W8"
FT                   /protein_id="ABX61378.1"
FT                   /translation="MKHTGSAGSSSIDAGSPDIRGARLPAGDYAHVFDDLHPPLSPHEA
FT                   IVESDRCYFCYDAPCMNACPTGIDIPLFIRQINAGNPAGAARTILAENILGGMCARVCP
FT                   TETLCEEVCVREVAEGKPVKIGHLQRYATDMLMATGNHPFTRAAETGRHIAVVGAGPAG
FT                   ISAAHRLAMHGHQVTIFEARPKGGGLNEYGIAAYKTVNNFAQRELDFVLQIGGIHIEYN
FT                   QTLGQDITVEALKAGYDAVFLAMGLPGVNDLGLAGEDAPNVLDAVDYIANLRQARNLST
FT                   LPVGRDIVVIGGGMTAIDVAIQTKKLGANNVTIVYRRGQESMNASAYEQELAQIHGVVI
FT                   RHWLQPHALERSEDGIVHAITFEYTANRDGKLVGTGEYLTLEADQVFKAIGQTFDPEPL
FT                   RGSGIALAKGRISVDAEGRTSVEGIWAGGDCVAGGKDLTVASVEDGKVAALSIHAALTS
FT                   RPEAVEGFAEAVLSGAAHYAPAAPSRHATVQPGSEQGLGD"
FT   gene            292764..293012
FT                   /locus_tag="BCAN_A0288"
FT   CDS_pept        292764..293012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0288"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61379"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7W9"
FT                   /protein_id="ABX61379.1"
FT                   /translation="MRAVDAGRRRHAHNRQQEAARRECLESLHQWTNFLLIPCVSWIAS
FT                   PIFADAAMRVPFAQSCCFSGLRSLLPLMARYRQDDRF"
FT   gene            complement(293075..293527)
FT                   /locus_tag="BCAN_A0289"
FT   CDS_pept        complement(293075..293527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0289"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61380"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X0"
FT                   /protein_id="ABX61380.1"
FT                   /translation="MDLTGEERIAAPRQAVWDALNDIETLKACIPGCDGIERISETEIR
FT                   AALKVSFGILKVRFHGMLELSNMRPPESYTISGHGEGSIAGFAHGVTDVRLHEDGSATV
FT                   LSYVIRGDAGGKVAQLGSRLLGSVARKIADRFFTNIAEAAAKQDVL"
FT   gene            293678..295327
FT                   /gene="pgi"
FT                   /locus_tag="BCAN_A0290"
FT   CDS_pept        293678..295327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BCAN_A0290"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /note="GO_function: GO:0004347 - glucose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006094 -
FT                   gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61381"
FT                   /db_xref="GOA:A9M7X1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7X1"
FT                   /protein_id="ABX61381.1"
FT                   /translation="MARDATKLEATVAKLKKHWAESAPRDMRAAFSADPGRFGRYSLCL
FT                   DDLLFDWSKCRVNDETMALLKELAVAADVEGRRAAMFAGEHINNTEDRAVLHVALRDTS
FT                   SKEVLVDGHNVLPDVKHVLDRMAAFADGIRSGALKGATGRKITDIVNIGIGGSDLGPVM
FT                   ATLALAPYHDGPRAHFVSNIDGAHIADTLSPLDPASTLIIVASKTFTTIETMTNAQTAR
FT                   KWVADTLGEAAVGAHFAAVSTALDKVAAFGIPEDRVFGFWDWVGGRYSVWSAIGLPVMI
FT                   AVGPDNFRKFLAGAHAMDVHFRDAPLEKNLPVMLGLIGYWHRAICGYGSRAIIPYDQRL
FT                   SRLPAYLQQLDMESNGKSVTLDGKPVSGPTGPVVWGEPGTNGQHAFFQLLHQGTDTIPL
FT                   EFIVAAKGHEPTLDHQHEMLMANCLAQSEALMKGRTLDEARAQLQAKNLPASQVERIAP
FT                   HRVFSGNRPSLTLIHDMLDPYALGRLIALYEHRVFVEAQIFGINAFDQWGVELGKELAT
FT                   ELLPVVSGKEGASGRDASTQGLVAHLHARRKA"
FT   gene            295563..296624
FT                   /locus_tag="BCAN_A0291"
FT   CDS_pept        295563..296624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0291"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="GO_function: GO:0016788 - hydrolase activity, acting
FT                   on ester bonds; GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61382"
FT                   /db_xref="GOA:A9M7X2"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X2"
FT                   /protein_id="ABX61382.1"
FT                   /translation="MKTEIIKFAGDVPGNAIELRVLRFEGKDAKAPGAYLQSSLHGAEL
FT                   PGQAALHFLIPMLKQAAEEGRILGNITLVPQANPIGSNQWQAHQHLGRFETFSLINFNR
FT                   AFPLLPDFDTSDLPGPDAPVALAQRLKATLLKLALANDIVLDLHCDDEGENYVYIAEEF
FT                   VEDMKDLAIALNSTAILAWNTTLDAAFDEACAHPVLQLPADKRNMKRRAVTTVEFRGMS
FT                   DVYADMGRGDAEGLYRFLVHRGVVRDENVKLDGEYKGLVTPLSHVEMIRAPEGGMVLFH
FT                   VAPGDVVEAGAKLATVVTRPGEPEGDIAITAPQAGRILTRRSLRYVRRGDDLLKLLADK
FT                   PSAVKKRAGALEA"
FT   gene            296621..297370
FT                   /locus_tag="BCAN_A0292"
FT   CDS_pept        296621..297370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0292"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61383"
FT                   /db_xref="GOA:A9M7X3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X3"
FT                   /protein_id="ABX61383.1"
FT                   /translation="MMAAHLADRVKSIRAVLFDKDGTLIDFDRTWFSISWQLAQWSAQG
FT                   DEVLARALLDAGGYDWLAERFRANSVIAAGTVEDIVSLWHPGLAGPQLRSLIEKYDAYC
FT                   IAEGARSAIAIEAVHETLAVLRGAGYRLGIATNDSEAGARVTAKALGIDHLFDVMIGYD
FT                   TAARPKPFPDPLLYFAEKLGLSPHEIAMVGDNLHDLETAHAAGAGLAVGVLSGNSPREA
FT                   LEPHADLVLESVAGLPAILQPFVLPSA"
FT   gene            complement(297343..298215)
FT                   /locus_tag="BCAN_A0293"
FT   CDS_pept        complement(297343..298215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0293"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61384"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X4"
FT                   /protein_id="ABX61384.1"
FT                   /translation="MSETVEFQAEDGISLSGQLFQGTGGKPLVLVSSATAVPQGFYAAF
FT                   ARHLVDHGARAVLTYDYRGVSASRLTGKSRKPIRFKDWAMLDFPAALRQLQSVEPGHET
FT                   VSIGQSFGGQALGISGQSAAFTRYGMVAAMSGDLRLLNDRWAWPRMNLVGVPVSYFTKN
FT                   MPKWVGGEPIPGTVFRDWARWCRMENYFFDDPHLNARELVAAVRTPIFAIGLDDDPWGT
FT                   RAAVQHFLDYHVNAPIGQRWYSRKMAGNQPIGHLGYFRSRFAETLWPEMTGWLLDGKMP
FT                   DQAEGSTKG"
FT   gene            complement(298241..299986)
FT                   /locus_tag="BCAN_A0294"
FT   CDS_pept        complement(298241..299986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0294"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61385"
FT                   /db_xref="GOA:A9M7X5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X5"
FT                   /protein_id="ABX61385.1"
FT                   /translation="MAKKVTGQSAAAVDSAKVAPTGEARPAVEKIWLKSYPAGVPHDIN
FT                   LSAATSISDMISASCRQFANSPAFTCMGKDISYKELDDHSRALAAWLQSRGLVKGDRVA
FT                   IMMPNILQYPITFTAVLRAGFVVVNVNPLYTPRELEHQLNDAGAKALVVLENFATTVEK
FT                   ALPSINVPNILVASMGDMLGFKGHIVNLVVRRVKKMVPAWNIPGHVRFKDALAQGRAKS
FT                   FNPVPVQGCDIAFLQYTGGTTGISKGAMLTHSNILANVEQMNLWMDVAFRNKGKPKALN
FT                   FVCALPLYHIFALTVNAMIGMKLGARNILIPNPRDIPSFVKELKKYPVHIFPGLNTLFN
FT                   GLMNNPDFQTLDFKPLILTLGGGMAVQRPVAERWQHMTGCHITEGYGLSETSPVACANA
FT                   LDATEFTGTIGLPMPSTDVVIRDDDGSDLPLGKVGEICVRGPQVMKGYWNRPEETARAI
FT                   MADGFFRTGDMGFMDERGYTKIVDRKKDMILVSGFNVYPNEIEEVAAEHPGVLESAAVG
FT                   IPNEHSGEVVKLYVVRRDPELTEDEAKAFCAERLTNYKRPREVEFRESLPKSNVGKILR
FT                   RELRD"
FT   gene            complement(300337..300966)
FT                   /gene="ttgR"
FT                   /locus_tag="BCAN_A0295"
FT   CDS_pept        complement(300337..300966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttgR"
FT                   /locus_tag="BCAN_A0295"
FT                   /product="HTH-type transcriptional regulator ttgR"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61386"
FT                   /db_xref="GOA:A9M7X6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X6"
FT                   /protein_id="ABX61386.1"
FT                   /translation="MRRTKAEAAETREAILLAAEQVFLERGVNQSTLTEIACYAGVTRG
FT                   AIYFHFEDKLDIFQSIIGRARFPQEEIMLQAARFDHPNPLHILEQSIVAALELFATDER
FT                   QQVVFTIINQRCEYVGEMAPVIDRLKEMRSDVLALFIGLLKVAERRGELASEWSAETAA
FT                   QILLAMVGGFLNEWLHGEKGFDLIIHGSRVISTVIQSLRAPANIPQ"
FT   gene            complement(301097..301279)
FT                   /locus_tag="BCAN_A0296"
FT   CDS_pept        complement(301097..301279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0296"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61387"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X7"
FT                   /protein_id="ABX61387.1"
FT                   /translation="MRLDINDENLRRRWRGATRRLCQGGLRRKNNKSGPCRKTPDGTVQ
FT                   SHGGNSPLLSRIATR"
FT   gene            301139..302332
FT                   /locus_tag="BCAN_A0297"
FT   CDS_pept        301139..302332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0297"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61388"
FT                   /db_xref="GOA:A9M7X8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X8"
FT                   /protein_id="ABX61388.1"
FT                   /translation="MTLNRTIRCFAAGAAFIVFAAQPALAQAPGGATPPPPQVFVVDIK
FT                   PHDVPVTYEYAARISAYRNVQVRARVGGILLHRNFVEGTQVKAGEVLFEIDPAPYQAEL
FT                   EKAQAQVAQAEAQYQQSIRDAERAEQLVQQKVQSAAVRDSAFATRDLNKAAVAAAKAQL
FT                   RTAELNLSYTKVTAPISGITSQEQVNEGSLIGTDASSSLLTSVTQLDPVYVNFSFTDTE
FT                   AAEIAKLRAERGATGEDADRLKIKILFGDGKAYDHEGTIDFISSSLDTETGTLGVRAVL
FT                   ENPNHRLIPGQFVRAEILDIQVKDAITVPKAALMQSAQGQFVYVVNKDNVVEVRPVTGA
FT                   RELKNDWLISQGLNSGDRVITEGVIKAVPGRPVQPVVQGVDDKAQAEAGKEQAADKK"
FT   gene            302329..305484
FT                   /locus_tag="BCAN_A0298"
FT   CDS_pept        302329..305484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0298"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0015562 - efflux permease activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61389"
FT                   /db_xref="GOA:A9M7X9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7X9"
FT                   /protein_id="ABX61389.1"
FT                   /translation="MNRFFVDRPVFAAVISIVLVLAGLICIRILPVAQYPELTPPQVVV
FT                   SATYPGASAETVAQTVAAPLEQQINGVENMLYMQFSSLGSGTMQLTVTFALGTDPDQAT
FT                   INVNNRVQRATSSLPQEVQRLGVTVDKRFTTILGMVAMFATTDRYDRTYVGNYALLNVV
FT                   DDLKRLPGVSDVQLLGNIDYSMRVWLRPDKLAQYNLTPSDVSAAIQEQNAQFAAGRFGD
FT                   QPDPHAGPFTYTATTQGRLPDAAAFENIILRSSSQNAATLRLKDVARVELGTESYLVDS
FT                   NLNGTPAVPIAIYLQPGANALNTMELIQNRMNELKASFPAGIDYAIPFDTTKFIKVSIE
FT                   EVVHTFIEAIILVVLVVFIFLQNWRATLIPVIAVPISIIGTFAGMYVLGFSINLLTLFG
FT                   LVLAIGIVVDDAIVVLENVERIMTTEKLSPRKAAIKAMGEVTGPVIAIVLVLCAVFIPV
FT                   AFMGGLVGEMYKQFAVTIAISVTLSGLVALTLTPALCALILKPGHHEPILPFRIFNRAF
FT                   ERVTSGYTRGVRFFLKRATIGLIIFAGLLGSTYYLFERVPGSLLPDEDQGFLFGVAVLP
FT                   PAASLERTTVVLDQVSENIRKNPAVDNVFAVSGFDLLSGGLKTSAGTMFIMLKDWKERT
FT                   TPDADARNLPRTIMGMNAGIKDGMVLAFNPPPIMGLSTTGGFELYVQDRTGGGVESLTQ
FT                   ATKLITEAAAKRPELQGVRTTFDPNVPQYDIQLDREKAKAMGVPINSVFTAMQATFGSL
FT                   YVNDFTLYGRNYQVNLQSEAEFRRDPGDLKHVFVRADSGSMIPLDALVTVKRIVGPDQL
FT                   ERFNAFNAAKVTGNPAPGYTSGDAIKAMQEVAAQVLPQGYQIAWTGSAYQEVSTSGTGS
FT                   QAMIFGLIMVFLILAAQYERWSLPLAVITAVPFAIFGALLATDLRGLTNDVYFQIGLVT
FT                   LIGLAAKNAILIVEFAVLERESGKSAIEAAASAARLRFRPIVMTSLAFILGVVPLAVST
FT                   GAGSASRHSIGTGVIGGMLAATFIATFFIPMFYSLIARKPPKKHEDETADTPETPGGTG
FT                   GGI"
FT   gene            complement(305595..305762)
FT                   /locus_tag="BCAN_A0299"
FT   CDS_pept        complement(305595..305762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0299"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61390"
FT                   /db_xref="GOA:A9M7Y0"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y0"
FT                   /protein_id="ABX61390.1"
FT                   /translation="MFDGIPAQWHKAPEQARRSPNEAAYVFLGIMLAVLSVPAVFLGWA
FT                   IFLSVGLMLQ"
FT   gene            complement(305983..306123)
FT                   /locus_tag="BCAN_A0300"
FT   CDS_pept        complement(305983..306123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0300"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61391"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y1"
FT                   /protein_id="ABX61391.1"
FT                   /translation="MTHFSEIPAETEPSEPLYLFVFSHVLTPKLAPTFGDMLRTRNFRK
FT                   F"
FT   gene            complement(306192..307034)
FT                   /locus_tag="BCAN_A0301"
FT   CDS_pept        complement(306192..307034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0301"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="GO_component: GO:0030288 - outer membrane-bounded
FT                   periplasmic space; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61392"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y2"
FT                   /protein_id="ABX61392.1"
FT                   /translation="MKSCLLSLTISMCLFAPAAHAAGEEPAAPHFFNQKERLPLPSLQG
FT                   LNRLRFITTVDFPPFNRLNERGQLSGYNIDLAKALCQQLKIEDICQIEAVPWAELEERV
FT                   LDGQADAIVAGWEPTDRNREKFTFTRSYMRLPARFATSNAKSFTEPAAKATQDKPVGVI
FT                   AGTAHEALLKNYFPQAKPVPYPNRDAMLTALKDGKIDTVFDDGMSLSAWLDSAEGSACC
FT                   TFTDGPYLAPQYLGSGLSIAVTRQNSALASAFNNALQALQQEGKLTELYLRYFPASFY"
FT   gene            307300..309192
FT                   /gene="bcsA"
FT                   /locus_tag="BCAN_A0302"
FT   CDS_pept        307300..309192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="BCAN_A0302"
FT                   /product="Cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61393"
FT                   /db_xref="GOA:A9M7Y3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y3"
FT                   /protein_id="ABX61393.1"
FT                   /translation="MKVGSNLVDLEICSAISARLKRCGMPQDRIENAFSAAHLHGTGFF
FT                   EEAVHQPGVTERMVYEAIADYLQLPYTEEILPSRIFVSGDENICFAHIRQVMVIGRDGI
FT                   SYLYIAPGERRIARLREHLKAAPQLRERIRICTPSVLKSILRQRHQRDLVMRAHAMTPQ
FT                   LFSAARVLDTPQAFVIAMAVYAFLGCIVNWPMKTMLALHVAMSLFFFGCVLIRLFAAAS
FT                   GKRLQFTEIAPFKPRDLPVYSILVPLYREKDVVAQLIAALNRLNWPRSKLDIKLVCEKD
FT                   DYETIAAIRCNTMPSNFKLVLVPPGGSRTKPKALNYALQFARGEIVAVFDAEDRPHPDQ
FT                   LLEAWQAFRRGGSKLACVQAPLIIGNFRRNLLTRMFAFEYAVLFRGLLPWLARRGLVIP
FT                   LGGTSNHFRRSCLEQVGGWDAYNVTEDADLGMRLARFGYRIDVISRGTIEDAPEEHGVW
FT                   HRQRTRWIKGWMQTWLVHGRQPMSTWRELGWWRFVVSQIYTLGIIGSALLHPLMLLMLA
FT                   GLCLRMAFGPLTPQGLWLLALDVINILMAYMSFHMLGAKTMEPTELGGYAYFLAIPIYW
FT                   VLISLSAWRAVWQLVRQPHLWEKTPHQPNLFYIPLEDASSEFDARNAAPRPIMD"
FT   gene            complement(309120..310079)
FT                   /locus_tag="BCAN_A0303"
FT   CDS_pept        complement(309120..310079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0303"
FT                   /product="protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61394"
FT                   /db_xref="GOA:A9M7Y4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y4"
FT                   /protein_id="ABX61394.1"
FT                   /translation="MGDSSKTANKKKAKKNGTKSAEKPIKIEIANKKRKFDINDPKLPG
FT                   WIDDCALQSGGYPYSSKMKSDEYEATLERLQIELVKLQYWLQNTGERVISVFEGRDAAG
FT                   KGGTIFTIRQFMNPRTARNVALPKPTETERGQWYFQRYVSHFPTAGEFVTFDRSWYNRA
FT                   GVERVMGFCTPQQLETFLTETPDFERMIVTDGIHLFKFWLDIGQEMQLKRFHERRHSPL
FT                   KNWKFSPMDIAGISRWDDYSTALHTMLERTDTGYAPWTIIRANDKRRARLAAIRRILLT
FT                   LPYEGRDIDAIGAEDQSIIGRGAAFLASNSEEASSSGM"
FT   gene            310212..311528
FT                   /gene="phoR"
FT                   /locus_tag="BCAN_A0304"
FT   CDS_pept        310212..311528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="BCAN_A0304"
FT                   /product="Phosphate regulon sensor protein phoR"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61395"
FT                   /db_xref="GOA:A9M7Y5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y5"
FT                   /protein_id="ABX61395.1"
FT                   /translation="MSEDSGRAGPEARTETSLFEPLLRIKGVLFVSMVLAICVMALDLS
FT                   FWFRAILLALVVLGAVWAAAGIGNGEDEKVPLREVASREMAAVSGERLADLLTDPMIVF
FT                   DHTATVRFANVAALEAFQSLQNGTALYLRFRAPEMLALIQGVIADGEPRNIEYFERVPI
FT                   DRWYKAMVKALRDAEGKPELFVLIFRDQSETRRIDRMRSDFIANASHELRTPLASLRGF
FT                   IETLQGPARNDAAARDRFLDIMQKQAERMSRLIDDLLSLSRLEMRAHLAVNESVDVAAT
FT                   LAHVADTLTPLAAGLGVTIERHLPEHPVHVMGARDELIQVFQNLVENACKYGQEGKRVI
FT                   IRLSEEDTGNATEVVASIQDFGPGIAAEHLPRLTERFYRIDVETSRAHKGTGLGLAIVK
FT                   HILARHRGRLVVRSQLGEGSTFMVRLPGQNARSAEAATI"
FT   gene            complement(311658..312200)
FT                   /locus_tag="BCAN_A0305"
FT   CDS_pept        complement(311658..312200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0305"
FT                   /product="GcrA cell cycle regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61396"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y6"
FT                   /protein_id="ABX61396.1"
FT                   /translation="MNWTDERVELLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLKL
FT                   SGRGKTTTAAPRSKKVNTPAAAPRPAVQNNNSGTHTTTMRTATVTKTVGATALQMEYAT
FT                   EVVAETVIKPASDVVVPISRHLTLLQLSERTCKWPIGDPLNEDFHFCGNESGEASPYCS
FT                   YHSRLAFQPTAERRRAR"
FT   gene            complement(312372..312713)
FT                   /locus_tag="BCAN_A0306"
FT   CDS_pept        complement(312372..312713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0306"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61397"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y7"
FT                   /protein_id="ABX61397.1"
FT                   /translation="MQSGGNKKPPSGRHLSGAYIGLCKKNVNQSKQAYGASLRMGSCRR
FT                   PHHTTGTGNPGWSGYMKPGSSPLGGGRARSQARPLHGRLENARHDGRRIKEKPPLQPKL
FT                   GKTTKMESA"
FT   gene            312803..314014
FT                   /gene="argD"
FT                   /locus_tag="BCAN_A0307"
FT   CDS_pept        312803..314014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="BCAN_A0307"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61398"
FT                   /db_xref="GOA:A9M7Y8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y8"
FT                   /protein_id="ABX61398.1"
FT                   /translation="MTDATTVHPLYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIA
FT                   VNSLGHSHPHLVETLKTQAEKLWHLSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEA
FT                   LECAIKTARRYQYVSGHPERFRIITFEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQ
FT                   VPFGDEAALRAAITPETAGILLEPIQGEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQ
FT                   TGVGRTGKLFAHEWAGIRPDIMAIAKGIGGGFPIGACLATAEAAKGMTAGMHGTTYGGN
FT                   PLGMAVGNAVLDVVLADGFMENVQATALVMKQGLASLVDRYPNVVSEIRGRGLLMGLKC
FT                   VVPNTSLIQALRDEHILSVGAGDNVVRLLPPLITTPEEAREALKHIETAVERLSIANPI
FT                   SKTV"
FT   gene            314019..314957
FT                   /gene="argF"
FT                   /locus_tag="BCAN_A0308"
FT   CDS_pept        314019..314957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="BCAN_A0308"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="GO_function: GO:0004585 - ornithine
FT                   carbamoyltransferase activity; GO_process: GO:0042450 -
FT                   arginine biosynthetic process via ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61399"
FT                   /db_xref="GOA:A9M7Y9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Y9"
FT                   /protein_id="ABX61399.1"
FT                   /translation="MANDNGIKHFIDLSTVPATELRAILEDAKARKARLKAGEVEQPYA
FT                   GKVLAMIFEKPSTRTRVSFDVGMRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYVDA
FT                   IMIRTTAHERMLELAEYATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGD
FT                   GNNVLHSLVEAAARFDFNVNIATPKGSEPKSQYIDWARANGAGIMSTTDPEKAASGADC
FT                   IVTDTWVSMGQEDHARGHNVFIPYQVNANLMAKADPKALFMHCLPAHRGEEVTDEVIDG
FT                   PQSVVFDEAENRLHAQKAILAWCLQDRGLGA"
FT   gene            314959..315981
FT                   /gene="hslO"
FT                   /locus_tag="BCAN_A0309"
FT   CDS_pept        314959..315981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BCAN_A0309"
FT                   /product="33 kDa chaperonin"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61400"
FT                   /db_xref="GOA:A9M7Z0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z0"
FT                   /protein_id="ABX61400.1"
FT                   /translation="MSDKTSNEHTEAENIQTGLGGFNFAGDDAVVPFQVEGLDVRGRAV
FT                   QLGPSINAILKRHEYPEEVARLLAEATVLTVLLGTSLKFDGKFIFQTQSDGPVDMLVVD
FT                   FRTPRSVRAYARYDEARLKEAIAANKTRPEELLGNGTLAFTVDQGIYTQRYQGIVALDG
FT                   STLEEIAVTYFRQSEQIPTDLKLSVAKLIERGADGKPVEQWRAGGLIIQFLPESELRAR
FT                   VPDLPGGDGDDSQLIHHPEDDAWDEARSLVGTIESSELTDPQVGSERLLYRLFHERGVR
FT                   VFDSIAVIDECSCSREKIAGVLSGFTAEEIKDSVEDGKISVTCEFCSKLYQFDPAEFTK
FT                   "
FT   gene            complement(316022..316414)
FT                   /gene="apaG"
FT                   /locus_tag="BCAN_A0310"
FT   CDS_pept        complement(316022..316414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="BCAN_A0310"
FT                   /product="Protein apaG"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61401"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7Z1"
FT                   /protein_id="ABX61401.1"
FT                   /translation="MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETV
FT                   QLCSRYWQITDANGHVQEVRGSGVVGEQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMK
FT                   GEDGAQFEIEIPAFSLDVPEQRRTLN"
FT   gene            complement(316783..317979)
FT                   /gene="metZ"
FT                   /locus_tag="BCAN_A0311"
FT   CDS_pept        complement(316783..317979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="BCAN_A0311"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /note="GO_function: GO:0016835 - carbon-oxygen lyase
FT                   activity; GO_process: GO:0008652 - amino acid biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61402"
FT                   /db_xref="GOA:A9M7Z2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z2"
FT                   /protein_id="ABX61402.1"
FT                   /translation="MTTENARKFRPATELVHAGSLRSGFAEMSEALFLTQGFLYPTAEA
FT                   AEARFKGEDPGFIYSRYANPTTDMFEKRMCALEGAEDARATASGMAAVAAAILCQVQAG
FT                   DHVISARAVFGSCRYIVETVLPRYGVEVSIIDGSDVANWKAAVRPNTKVMFLESPSNPT
FT                   LEIIDIAAVAQIANEAGAKLIVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGG
FT                   VVLSDREWIETTLQDYFRHTGPGLSPFNAWIMLKGLETLSVRVRQQTQSAAAIADFLAG
FT                   KPGVKRVIYPGRADHPQADIIAKQMTGGSTLIALELEGGKEAAFKFENALQIFSITNNL
FT                   GDTKSLITHPATTTHKNLSNEAKAELGISDGLLRVSVGLEDTDDLLEDVEVALKVARG"
FT   gene            complement(317969..318064)
FT                   /locus_tag="BCAN_A0312"
FT   CDS_pept        complement(317969..318064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0312"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61403"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z3"
FT                   /protein_id="ABX61403.1"
FT                   /translation="MRFRKAGFLLAAEAFFLPRPTSFRQVGKNDD"
FT   misc_binding    complement(318070..318149)
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (alpha-proteobacteria), BCAN_A0313"
FT   gene            318406..319497
FT                   /locus_tag="BCAN_A0314"
FT   CDS_pept        318406..319497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0314"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61404"
FT                   /db_xref="GOA:A9M7Z4"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z4"
FT                   /protein_id="ABX61404.1"
FT                   /translation="MTQRDAGILADADIAALFESGLLASPRLLDADQIQPASLDLRLGA
FT                   KAYRVRASFMPGPGTPVIDKLERLKLHEIDLTAGAVLETGCVYIVPLLESLALSPELSA
FT                   SANPKSSTGRLDIFTRVIADGAQEFDKVPAGYKGPLYLEVSPRTFPIVVRTGSRLSQIR
FT                   FRKGRAQLDESELGVLHKAETLVASEMPNISGGGIALSVDLSGGEDRLIGYRGKHHTGV
FT                   VDVDKRAAHDVLDFWEPLYDRGAHELVLDPDEFYILVSREAVHVPPLYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHSAAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLGQPK
FT                   ALYGIDLGSNYQAQQLKLSKHFR"
FT   gene            319588..320604
FT                   /locus_tag="BCAN_A0315"
FT   CDS_pept        319588..320604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0315"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61405"
FT                   /db_xref="GOA:A9M7Z5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z5"
FT                   /protein_id="ABX61405.1"
FT                   /translation="MSVVNETGRGLGGKAEATADVPPRRLSVGIVVLPGFTLSALSLFL
FT                   DPFRLAADDRDKSRQIRCAWKICTLSGDPVTSSSGMVIEPTVPLGEIDECDYVAVVGGL
FT                   LAQYRHSQQALIDLIKRADKRGKAVVGLCTAAFLLAEAGVLEDRNCCVSWFHRDDFLEL
FT                   FDGYTADTTSLFHLSGRHYTCAGGLGAAALALSIIQNEISEELARKSASILLIPYELVR
FT                   SEQPALSFNGVRSPMIRKAIRIFEETLEDPVPMIDVARRLGISVRQMERGFRLSLGRTA
FT                   FEVREELRVKKAKELLAETSLSLLEVAVASGFTDTRSMNRSFSRQKQKAPRDYRRQR"
FT   gene            320691..320957
FT                   /locus_tag="BCAN_A0316"
FT   CDS_pept        320691..320957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0316"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61406"
FT                   /db_xref="GOA:A9M7Z6"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z6"
FT                   /protein_id="ABX61406.1"
FT                   /translation="MSDGVNRFLGDTPGRILVKLVLISLVVGVVMSAFHWTPYDILYGI
FT                   RDFFLHLWNMGFSAVARFADYLVLGAAVVIPAFILLRILSYRK"
FT   gene            320994..321476
FT                   /locus_tag="BCAN_A0317"
FT   CDS_pept        320994..321476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0317"
FT                   /product="SCP-like extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61407"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z7"
FT                   /protein_id="ABX61407.1"
FT                   /translation="MQQKHGIRLSRRGFLMLAGGAMALSALPVDWAQAAGNNDPTAIFN
FT                   AIRKANGLPLMATDSRLEQAALYQARRMASYGKIGHSVGWGNGFVSRLKQAGIRGPAAE
FT                   NVAVGQPDTQAVFDAWMKSPGHRKNMLDPTFAHYGLAWATPESNPRRIYWAMMLGL"
FT   gene            321651..323018
FT                   /locus_tag="BCAN_A0318"
FT   CDS_pept        321651..323018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0318"
FT                   /product="MATE efflux family protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61408"
FT                   /db_xref="GOA:A9M7Z8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9M7Z8"
FT                   /protein_id="ABX61408.1"
FT                   /translation="MDQVMQGGGQSIGNVTKPFDVTHRMVMLIAVPMTLAAITTPLLGL
FT                   VDMGVVGQMGQAELIGGLAIGALVFDFLLSLFNFLRSGTTGLVAQAMGAGDAVEEQAIF
FT                   WRAIIIAVAAGGLMILCLPLILGAASTFMHPTPATRAAMATYISIRMLSASVALINYSI
FT                   LGLVLGRGQGILGLGLQVLLNGINIALCIVLGLELGWGVTGVAWATVTGETVAALVGLF
FT                   IVMRHFRKDATLRPDRKRIFQREGIMRMFAVNRDIMIRSLLLLTAFAFFTRAGSDLGPV
FT                   TLAANAVLLNFFLVAGFFLDGMAAAAEQIIGRSIGARYSPAFRRGAKLTFIWGLVMAGL
FT                   VAFFLLVFGDTIISLLSRAEDVHVEAMKYLPWAALTGLTGLLAFHMDGVYIGATWSRDM
FT                   RNMMFLSLIFFLAVLYAAKPVMGNHGLWLAINLFLSVRGITLLAILPRRYRMEFAH"
FT   gene            complement(323020..324114)
FT                   /gene="pyrD"
FT                   /locus_tag="BCAN_A0319"
FT   CDS_pept        complement(323020..324114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="BCAN_A0319"
FT                   /product="dihydroorotate oxidase"
FT                   /note="GO_function: GO:0004158 - dihydroorotate oxidase
FT                   activity; GO_process: GO:0009220 - pyrimidine
FT                   ribonucleotide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61409"
FT                   /db_xref="GOA:A9M7Z9"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M7Z9"
FT                   /protein_id="ABX61409.1"
FT                   /translation="MSGLFETLGRRALFTFDAEQAHGLSITGLKTGIVTCRTPEDPALS
FT                   VKVAGLKFPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVD
FT                   DKAVINRLGFNNEGHEAAFKRLSRRAGKSGIVGVNIGANKDAEDRIADYVAGIRRFYQL
FT                   ARYFTVNISSPNTPGLRNLQAREALHELLSRVLEARDEEGNMCTLKRPVFLKIAPDLTD
FT                   EELDDIAAEADAQKLDGIIVSNTTLSRSGLKNPENSNETGGLSGAPLFERSTVVLARMR
FT                   ERVGPDMPLIGVGGIDSAETALAKIKAGADLVQLYTGLIYRGPGLPGEILRGLSTAIKH
FT                   EGVSSIAELRDRDTKEWAARKLIS"
FT   gene            complement(324111..324464)
FT                   /locus_tag="BCAN_A0320"
FT   CDS_pept        complement(324111..324464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0320"
FT                   /product="protein of unknown function DUF952"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61410"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A9M800"
FT                   /protein_id="ABX61410.1"
FT                   /translation="MSNKIIYKIAPRELWARAEKAGSFAGAPVDIADGYIHFSTAAQVR
FT                   ATAAKHFAGQSDLLLVHVDAQALGQALKYEVSRGGALFPHLYAPLPLTAVVKVEPLPLG
FT                   PDDLHIFPELEDK"
FT   gene            complement(324565..325065)
FT                   /locus_tag="BCAN_A0321"
FT   CDS_pept        complement(324565..325065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0321"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61411"
FT                   /db_xref="UniProtKB/TrEMBL:A9M801"
FT                   /protein_id="ABX61411.1"
FT                   /translation="MLEFLFGRQGGRLAALHLAHGCDLRFKLLHARLQIGNVVLISIAV
FT                   FGSHLADQLALLLRAHRDCAGLCIEPHIAGFRAFQPVAPVFLCQGAGGKKSCAKQGSYR
FT                   QTMRGTCHSAQHYSLSFQSILIIWNVCDKNRMPHTLISEDFPFRAFSSKSVKRLCGEIS
FT                   PLD"
FT   gene            324718..325173
FT                   /locus_tag="BCAN_A0322"
FT   CDS_pept        324718..325173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0322"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61412"
FT                   /db_xref="UniProtKB/TrEMBL:A9M802"
FT                   /protein_id="ABX61412.1"
FT                   /translation="MLGRMAGSAHRLAIASLLGTALFSTGALAQENGRYRLEGTETGYV
FT                   RLDTQTGAISVCTQQKGQLVCKMAAEDRDAYENDIADLQARVKKLEAQVAAMGKVEGSK
FT                   ASALPSEQEFEQSMSYMERFMRRFMDLAKSFESGEEKPAPPTIPGRT"
FT   gene            complement(325264..326214)
FT                   /gene="pip"
FT                   /locus_tag="BCAN_A0323"
FT   CDS_pept        complement(325264..326214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BCAN_A0323"
FT                   /product="proline iminopeptidase"
FT                   /note="GO_function: GO:0016804 - prolyl aminopeptidase
FT                   activity; GO_process: GO:0030163 - protein catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61413"
FT                   /db_xref="GOA:A9M803"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M803"
FT                   /protein_id="ABX61413.1"
FT                   /translation="MTRNTLYPEIEPFKEEMLQVSSLHRIHVEQCGNPDGKPVIMIHGG
FT                   PGGGITPTMRRLHDPKRYRIILFDQRGCGRSTPHAELRENTTWDLVADMEHIRAHLGID
FT                   KWQVFGGSWGSTLGLAYAETHPERVSELVLRGIFMVRRFEVDWMYSNGASIIFPDHFEA
FT                   YQEHIPEAERGDMIAAYYKRLTDRDPRVQLEAARRWARWEGSVISLLPDPARVDAFGED
FT                   QYAIAFARIECHYFQNRGFLESDDQLLRNVERIRHIPGVIVHGRYDICTPFINAWQLKK
FT                   MWPEADLKIVEDSGHAVTEPGIMHELIEATKRFCE"
FT   gene            326444..327085
FT                   /locus_tag="BCAN_A0324"
FT   CDS_pept        326444..327085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0324"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61414"
FT                   /db_xref="GOA:A9M804"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9M804"
FT                   /protein_id="ABX61414.1"
FT                   /translation="MHFIIADDHPLFRGALRQVLSGQSENVEIIEAGDFDTVRKLVGEK
FT                   DDTDLLLLDLTMPGGTGLSGLVALKALQPALPIIIVSATDDPATIHHALELGASGFISK
FT                   SASMETIGEAVGAVLAGDIWTPDDIDLDHPKDPEIESLIARLRTLTPQQTRVLTMLAEG
FT                   LLNKQIAFELGVSEATVKAHVSAVLQKLGVDSRTQAVILLSRIGSDVLGV"
FT   gene            complement(327122..330646)
FT                   /locus_tag="BCAN_A0325"
FT   CDS_pept        complement(327122..330646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0325"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61415"
FT                   /db_xref="GOA:A9M899"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A9M899"
FT                   /protein_id="ABX61415.1"
FT                   /translation="MPAMQGWGIIGFAFLYLLLLFAVASIGDRRTARWSSTPRPYIYAL
FT                   SLAVYCTSWTFFGSVGLSAQRGLEFLGIYIGPILVFTLGNRLLRHIVRLAKSEHITSIA
FT                   DFLAARYGKSFGVASLATCIAAVGSIPYIALQLKAVSGGVGLVMDYYGAAVDPAVFVFG
FT                   DISLPVAAVLATFAILFGTRHTDATEHQNGLILAVALESVIKLCAFLTVGLACAFFLFG
FT                   APSQLIRQISQSPEALEAFHYETSIGTWLVQTALSAAAVIMLPRQFHVTVVESRSEKEL
FT                   RTASWLFPLYLILINIFVFPIALIGVMTLGNSVNGDLYVLALPLSAGAHWLALIAFLGG
FT                   LSAATAMVIVACVALSIMISNHLVLPLIISSFAKRHLAEQRDLTKIILNTRRITIIVIL
FT                   ALAFSYYRLTSNNIHLASIGFVSFAAVAQFTPALIGGLFWRNANGRGAMLGLSAGFIVW
FT                   CYTLLLPTVAPENAAILRDGFLGFTALRPEALFGTNALPLTNGVAWSIAANTLFYILGS
FT                   LSRASTPLERIQASIFLPRTFIGAPTLKRFRTTVTVAELKATMARYLGAERVERAFLRF
FT                   EGREQRRLDPGMTVDTPLIRYAEQLLGTAVGSSSARLVLSLLLQRNDASPRDARQLLDD
FT                   ASAALQQNRDLLQIALDQMDQGITVLDKDLRLTCWNRQFRKLFDLPDEVMQVGIPISEI
FT                   VEHLSQRGDIALNARNSAIRSLGTVRRPWRMTMKSTGKILEINSNPMPDGGLVTTFTDI
FT                   TAAVEADLMRQKASEMLEQRVIDRTAELMHVNDELARAQAAAEEANLGKTRFLAAAGHD
FT                   ILQPLNAARLYSTALAEKLGRSETSEFARNIDSSLEAVEAILGMVLDISRLDTGSLKPE
FT                   TSVFRLDKLLSQIATDFTPLAVKKGLKLRVVPSSIVVKTDRNMLRRLIQNLVSNSIKYS
FT                   RKGGILLGVRRRGNFVDLQVLDTGIGIAPQKLKLVFWEFTRLNEGMREAEELGLGLSIV
FT                   DRIARVLSLPLSLASTPGKGTVFSLRIPVSGEAPPAEEVKNRRGPQRASELDGLGVLCI
FT                   DNDVNILCGMETLLSGWGCNVTTLRSGAELKNFCATGTAAPAVIIADYHLIHENGLDMI
FT                   GFARESFKTEIPAILLTADRSKEVRQRAEDENVTVLHKPLRPAALRSMLSLFHHARQDG
FT                   ASTQGSTR"
FT   gene            complement(330931..331077)
FT                   /locus_tag="BCAN_A0326"
FT   CDS_pept        complement(330931..331077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0326"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61416"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A0"
FT                   /protein_id="ABX61416.1"
FT                   /translation="MALAVNDKMAGKLMGFAQPLRLLVFLQMRNRENPISALAAATGHT
FT                   SSV"
FT   gene            331159..331575
FT                   /gene="mscL"
FT                   /locus_tag="BCAN_A0327"
FT   CDS_pept        331159..331575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BCAN_A0327"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="GO_function: GO:0015249 - nonselective channel
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61417"
FT                   /db_xref="GOA:A9M8A1"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8A1"
FT                   /protein_id="ABX61417.1"
FT                   /translation="MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGL
FT                   ITGGIDFSNMFIQLAGDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMN
FT                   RLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA"
FT   gene            complement(331651..332928)
FT                   /gene="hemA"
FT                   /locus_tag="BCAN_A0328"
FT   CDS_pept        complement(331651..332928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="BCAN_A0328"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /note="GO_function: GO:0003870 - 5-aminolevulinate synthase
FT                   activity; GO_process: GO:0006783 - heme biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61418"
FT                   /db_xref="GOA:A9M8A2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A2"
FT                   /protein_id="ABX61418.1"
FT                   /translation="MDYRRFFEEAIDQLHAEKRYRVFADLERIVGRFPQAIWRNNGTAR
FT                   EITVWCSNDYLGMGHHPDVIKAMCETAGSAGSGAGGTRNISGNNHPLVELESELADLHG
FT                   KEAGLVFTSGFVSNEASISTIARLLPNCLILSDELNHASMIEGVRHSGAEKKIFRHNDV
FT                   EHLEQLLKAADRSRAKLIVFESVYSMDGDIAPIEKIADLADKYNAMTYIDEVHAVGMYG
FT                   AHGGGITERDGLAHRIDIIEGTLAKAFGALGGYITGSRAIIDAVRSYAPGFIFTTSLPP
FT                   AVAAAATAAIRHLKSSQAERDGQQRQAQRAKDVLSAAGLPVMPSQTHIVPILVGDPELC
FT                   KKASDRLLEVHGIYIQPINYPTVPRGTERLRITPSPLHDDKLIDGLKDALLEIWNELGI
FT                   PFAEPSAPQAANSDRIIPLMVSKAGG"
FT   gene            complement(333074..333775)
FT                   /locus_tag="BCAN_A0329"
FT   CDS_pept        complement(333074..333775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0329"
FT                   /product="polysaccharide deacetylase"
FT                   /note="GO_function: GO:0016810 - hydrolase activity, acting
FT                   on carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0005975 - carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61419"
FT                   /db_xref="GOA:A9M8A3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A3"
FT                   /protein_id="ABX61419.1"
FT                   /translation="MPVPILLYHQIAPLPAKNIPFRGLLVHPDRFRSQMRWLKRLGYQG
FT                   LSLRDAMPYIKGEKTGKVAVITFDDGYLNVLENAGPVLAEYGFTATNYFVANQVGGSNV
FT                   WDQPIGVPKTPCMSVAQLREWADLGHEVGAHTLDHVALSKVPEDEARHQIAQSKTVLED
FT                   MLGTQVTNFCYPYGDNTPIHREMVREAGYETATTTVRARARPTDDPFGIPRIYVRRRDL
FT                   WPKFVVRLRVR"
FT   gene            complement(333784..334503)
FT                   /locus_tag="BCAN_A0330"
FT   CDS_pept        complement(333784..334503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0330"
FT                   /product="glycosyl transferase family 25"
FT                   /note="GO_process: GO:0009103 - lipopolysaccharide
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61420"
FT                   /db_xref="GOA:A9M8A4"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A4"
FT                   /protein_id="ABX61420.1"
FT                   /translation="MNVKAFIIHLKRATDRAPQVEKLIKELPVKAEVIEAVDSRALNKD
FT                   EIARIYKRRLHTPRYPFALSRNEIACFLSHRKAWQAIIDRKLDAGFIVEDDIALTENFM
FT                   GAYRAAVDHLEPGGFIRFTFRDDREHGREVFRDEAVRIIIPNPIGLGMVAQLVSYDAAQ
FT                   KLLDITQTFDRPVDTTVQMRWVTGLQPLSVIPGGVKEISSQLGGTTIQHKKNFSDKLAR
FT                   EILRPIYRMRVRAYSSK"
FT   gene            complement(334633..335307)
FT                   /locus_tag="BCAN_A0331"
FT   CDS_pept        complement(334633..335307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61421"
FT                   /db_xref="GOA:A9M8A5"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR038578"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A5"
FT                   /protein_id="ABX61421.1"
FT                   /translation="MFAEHLQPFGKTSGVKAGKMKKTLVIVGNGPLTRDLSSEIDSADY
FT                   VLRFNEPRESIGMSGSKTDLLMLATSSKQMQQWLKYPTFLNSAIFRNAQELLFAFHPAI
FT                   IRQFHHRPNFLSRWLKGRRADWTTKAIEVLGAQGKEIRIMPPQFYLGVCEELGITADKM
FT                   AELFPSTGFFGIWYMLRNFPQSQWNIRICGFSWQGWKHHDWSAERQWIEEKIKSGMITP
FT                   LI"
FT   gene            complement(335399..335632)
FT                   /locus_tag="BCAN_A0332"
FT   CDS_pept        complement(335399..335632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0332"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61422"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A6"
FT                   /protein_id="ABX61422.1"
FT                   /translation="MEPLQLKAIHLCEEAMMEGQVIFYKNDRIIYRHHIDVQEDDYSKG
FT                   VNDAPIAFQRNYAGFDLASDDIHIRFKKPGDV"
FT   gene            complement(335675..336565)
FT                   /gene="oxyR"
FT                   /locus_tag="BCAN_A0333"
FT   CDS_pept        complement(335675..336565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="BCAN_A0333"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61423"
FT                   /db_xref="GOA:A9M8A7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A7"
FT                   /protein_id="ABX61423.1"
FT                   /translation="MNLRSFQAFAEVVRQGGFSAAARTINATQSTVSKAVKQLEEELQL
FT                   VLLDRAVSPPRLTAAGEIVYRRARAMLTEKDDMLAELGELRGLKRGLLRLGLPPIGSSV
FT                   LFAPVFAAYTSLYPDIDIQLVEHGSKRLEELLLAGDVELAASLLPVEESLAWQDVRCEP
FT                   VVALLPASHPVSDDDGVTLREIANLPFILFESGFALNHIILSACQRHGFSPNVAVRSSQ
FT                   IDFIVELVAAGMGIGFLPQMIAKQRHHPGVCIHRVKDADVNWHMAFVWRKGAFLSHAAR
FT                   AWLALCEGASTPAKA"
FT   gene            336687..337106
FT                   /locus_tag="BCAN_A0334"
FT   CDS_pept        336687..337106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0334"
FT                   /product="LrgA family protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61424"
FT                   /db_xref="GOA:A9M8A8"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A8"
FT                   /protein_id="ABX61424.1"
FT                   /translation="MNAPRKAHDLKIRLRYALHNSRLMQIATLVGFWLAGEAVVRLAGL
FT                   PLPGGIVGMALVLALLLSGRISLFSMKRGAEWFLAEMLLFFIPAVLAILEHRELIGMLG
FT                   LKIMAVILLGTLTVMSVTALTVDLCYRWSLRYAAW"
FT   gene            337093..337800
FT                   /locus_tag="BCAN_A0335"
FT   CDS_pept        337093..337800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0335"
FT                   /product="LrgB family protein"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61425"
FT                   /db_xref="GOA:A9M8A9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8A9"
FT                   /protein_id="ABX61425.1"
FT                   /translation="MLPGDPLGNPFVATLFWSAATILLYLAAKRVYRRFPLWWLTPLAV
FT                   TPLLLMALVIGLDENYRVYFSATHWLVALLGPATVAFAIPIYQQRATIRRYWPVLLAGV
FT                   LVGSSAAMASAWGLAHLLGLNEAISLSLMPRSMSTPFAMTVSGDIGGRPDLTAIFVVLT
FT                   GIFGAALGEIMLHWLPVRSALARGALFGMGAHGAGVARAHQIGSEEGSIAGLVMVLVGL
FT                   VNVLAAPLIAHFL"
FT   gene            337974..338309
FT                   /locus_tag="BCAN_A0336"
FT   CDS_pept        337974..338309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0336"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61426"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B0"
FT                   /protein_id="ABX61426.1"
FT                   /translation="MHYWSLLANRASDRYTYIEFASSQNSIRNMALLLPSRIQDQAAHP
FT                   PPARPFSFSGTDFDFSRSALAISASGGLGPCVTHKPQQPDTLLIVDKSGVGRDCSVKDI
FT                   LTANFPV"
FT   gene            338347..339588
FT                   /locus_tag="BCAN_A0337"
FT   CDS_pept        338347..339588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0337"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61427"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B1"
FT                   /protein_id="ABX61427.1"
FT                   /translation="MRRIVLRFAPALLVCFSLLAGCASRPEGVLVPIGETVPQASEVNL
FT                   LVATTHAPSGNPGTLFSGERGKKISLTDIIVSIPPDRNRKVGEVQWPKRLPPNPLKDFA
FT                   TIAVEPLHGDAAAQHWINTHLPRTKRVMIFIHGFNNTFEDSVYRFAQIVHDSGADVAPI
FT                   IFTWPSRASVFDYNYDKESTNYSRDALEHVLRVVANDPQVRDVTIMAHSMGAWLAMEAL
FT                   RQMAIRDRRVNAKITDVILASPDIDVDVFGKQFQAMGSHHPRFTLFTSRDDKALALSRR
FT                   ISGNIDRLGQIDPSVEPYRSKLEKAGIVVIDLTQLKAGDRLNHSKFASSPEVVQLIGRR
FT                   LVAGQTITDSEIGIGDRLGAVALGTAQGVGSAASLVVTAPIAVFDPRTRRTYDEQIDRF
FT                   GRAVGNTVGAVIMP"
FT   gene            339675..340556
FT                   /gene="panC"
FT                   /locus_tag="BCAN_A0338"
FT   CDS_pept        339675..340556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="BCAN_A0338"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /note="GO_function: GO:0004592 - pantoate-beta-alanine
FT                   ligase activity; GO_process: GO:0015940 - pantothenate
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61428"
FT                   /db_xref="GOA:A9M8B2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8B2"
FT                   /protein_id="ABX61428.1"
FT                   /translation="MQIIHTIEELRQALAPARQQGKKIGFVPTMGYLHKGHLELVRRAR
FT                   VENDVTLVSIFVNPLQFGANEDLGRYPRDLERDAGLLHDAQVDYLFAPTVSDMYPRPMQ
FT                   TVVDVPPLGNQMEGEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRMVDD
FT                   MAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQALDEADRLYRSGMDDPDA
FT                   LEAAIRTFISRQPLAVPEVIAIRDPETLERLPALQGRPILVALFVRVGATRLLDNRVIG
FT                   HAAPQITQERAA"
FT   gene            340558..341385
FT                   /gene="panB"
FT                   /locus_tag="BCAN_A0339"
FT   CDS_pept        340558..341385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="BCAN_A0339"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="GO_function: GO:0003864 - 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase activity; GO_process: GO:0015940 -
FT                   pantothenate biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61429"
FT                   /db_xref="GOA:A9M8B3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8B3"
FT                   /protein_id="ABX61429.1"
FT                   /translation="MSAPVTRKRLTPKVIQAMKGECPIVSLTAYTTPVARLLDPHCDLL
FT                   LVGDSLGMVLYGMESTLAVTLDMMIMHGQAVMRGTSHACVIVDMPFGSYQESKEQAFRN
FT                   AARVMQETGCDGVKLEGGEEMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLGRGD
FT                   DEAGKIRRDAQAIAQAGAFAVVIEGTVEPLAREITALIDIPTVGIGASSACDGQVLVSD
FT                   DMLGLFQDFTPRFVKRFAHLAPQVSQAAEAYAEEVRARRFPGPEHVFGAKPGA"
FT   gene            complement(341582..342358)
FT                   /locus_tag="BCAN_A0340"
FT   CDS_pept        complement(341582..342358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0340"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61430"
FT                   /db_xref="GOA:A9M8B4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B4"
FT                   /protein_id="ABX61430.1"
FT                   /translation="MSSNFNQETVTDIHHWTDTLFSFRTTRDPGFRFQSGQFIMMGLEV
FT                   NGKPLTRAYSIASSLYEDGLEFFSIKVPNGPLTSKLQHLKKGDQIIVSKKPVGTLLYDN
FT                   LKPGKHLWLLSTGTGLAPFLSIIRDLEVYERFEKVILVHGVRQVAELAYTDFISNELPQ
FT                   DEFLGEMVKNQLIYYPTVTREPYKNRGRLTDLIRSGQLFKDVGLPEFNHEDDRMMLCGS
FT                   PEMLAETKQILEERGFTEGSQSEPGEFVIEKAFVEK"
FT   gene            342488..342664
FT                   /locus_tag="BCAN_A0341"
FT   CDS_pept        342488..342664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0341"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61431"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B5"
FT                   /protein_id="ABX61431.1"
FT                   /translation="MHPAEASRFDCNQLRALCCLQDGFREFVIGRPVEEALPMVRPVIT
FT                   KIEIIAMLADIKP"
FT   gene            342761..343111
FT                   /locus_tag="BCAN_A0342"
FT   CDS_pept        342761..343111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0342"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61432"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B6"
FT                   /protein_id="ABX61432.1"
FT                   /translation="MEVAIISRNGVSKSGLSGVRSPAAWVMLVPFARRKGGSWLSVSRK
FT                   RGESRQGFQIPLKIDICGATAEGEGSPRQLPGNFPDNAVADLCFCHKLLISLRINSGKA
FT                   SDALSRHASQLC"
FT   gene            343150..344247
FT                   /gene="nspC"
FT                   /locus_tag="BCAN_A0343"
FT   CDS_pept        343150..344247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="BCAN_A0343"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="GO_function: GO:0016831 - carboxy-lyase activity;
FT                   GO_process: GO:0008216 - spermidine metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61433"
FT                   /db_xref="GOA:A9M8B7"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B7"
FT                   /protein_id="ABX61433.1"
FT                   /translation="MIQTPYYLIDKTKLKRNMEKIAYVREKSGARALLALKCFATWSVF
FT                   DLMSEYMDGTTSSSLNEVRLGHEKFGGETHAYSVAYADHEIDEVISHADKIIFNSIGQL
FT                   ERFADKASGIKRGLRLNPGVSSSSFDLADPARPFSRLGEWDVAKVEKVMDRITGFMIHN
FT                   NCENSDFSLFDRMLSDIEEKFGSLLHRVEWVSLGGGIHFTGEDYPVDAFCARLKSFSEK
FT                   FGVQVYLEPGEASITRTTTLEVTVLDTLFNGKNLAIVDSSIEAHMLDLLIYREKAKMAP
FT                   NNGGHSYMVCGKSCLAGDIFGEFTFDKPLAIGDRLSFEDAAGYTMVKKNWFNGVKMPAI
FT                   AVRELDGTVKLVREFDYADFEGSLS"
FT   gene            344428..345669
FT                   /locus_tag="BCAN_A0344"
FT   CDS_pept        344428..345669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0344"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61434"
FT                   /db_xref="GOA:A9M8B8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B8"
FT                   /protein_id="ABX61434.1"
FT                   /translation="MKKNVLIIGAGGVAQVVAHKCAQNSDVLGDIHIASRTVEKCRRII
FT                   DSVREKKSLKTEVKLEAHALDAMDVEATKALIRKTGVQIVINVGSAFLNMSVLRACIDT
FT                   GVAYMDTAIHEDPKKICETPPWYGNYEWKHLKECEEKGITAILGIGFDPGVVNAYARLA
FT                   ADDYLDEVKSIDIVDINAGSHGRWFSTNFDPEINFREFTGTVYSWQNGQWQSNKMFEVG
FT                   QTFDLPVVGPSKAYMTGHDEVHSLSKNYPNADVRFWMGFGDHYINVFTVLKNLGLLSEQ
FT                   PVKTAEGLEVVPLKVVKAVLPDPASLAPDYTGKTCIGDFVKGTKDGKEKEVFIYNVADH
FT                   KDAYNEVGSQGISYTAGVPPVAAAILIASGEWDVKKMVNVEELNPKPFLHILNQIGLPS
FT                   RIKDENGDRALDFA"
FT   gene            complement(345685..345900)
FT                   /locus_tag="BCAN_A0345"
FT   CDS_pept        complement(345685..345900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0345"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61435"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8B9"
FT                   /protein_id="ABX61435.1"
FT                   /translation="MALLTLSTTRLTLRCKAKRRLEGEVQMELETHRWSTAPSFLRPPD
FT                   PSRRPCGPPQDEDRENKKPRRSGVFR"
FT   gene            complement(345925..346953)
FT                   /locus_tag="BCAN_A0346"
FT   CDS_pept        complement(345925..346953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0346"
FT                   /product="proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61436"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8C0"
FT                   /protein_id="ABX61436.1"
FT                   /translation="MRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIANDE
FT                   TLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTVLLDS
FT                   GIIAMQEPVTHMVLEAPGGIIEVEAECRNGKAERISVRNVPSFADRLDAPLDVTGLGTI
FT                   MVDTVYGGDSFVIVDAAQIGMKIEPGQARELAEIGVKITKAANEQLGFRHPERDWRHIS
FT                   FCQITEPVTREGDVLTGVNTVAIRPAKLDRSPTGTGCSARMAVLHAKGQMKAGERFIGK
FT                   SVLGTEFHCRLDKVLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPHGYRLSDTWPR
FT                   DE"
FT   gene            347406..348821
FT                   /locus_tag="BCAN_A0347"
FT   CDS_pept        347406..348821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0347"
FT                   /product="MATE efflux family protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61437"
FT                   /db_xref="GOA:A9M8C1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C1"
FT                   /protein_id="ABX61437.1"
FT                   /translation="MDGTFDAGFREPTISKANRWGREMVVALKLGWPLIFTNLSQAALT
FT                   ATDVIFIGRLGADTLASALLATSFYHTLMIFSMGLVSAVMPMIAIALGKNRHSVRDVRR
FT                   TVRQGFWSAIMIVIPLWVVLWHCEEIFLFLGQRPDIAARSTDFMHTLQWALLPYLFYIV
FT                   LRSFFAAMEKPMWTLLVAALAIGFNALAGWTLIFGHFGFAPMGLHGAGMATTASSTMMF
FT                   LGLAFITLRHPRFRRYHLFGRFWRPDWPRLIELWRIGLPMALTFVFETSIFYAAVVMMG
FT                   RIGPTAMAAHAVAIQIASLSFMVPLGFGQVATVRVGRAYGRGDPKAIAYAGWSAYALGV
FT                   GFMALMGILMVLMPRVFIGIFLNLNDPQNLPVMELAVTFLALAALFQIVDGAQAVAAGM
FT                   LRGLRDTRIPMLLALFGYWGVGLPLGAVLAFQFGMGGVGIWLGLAAGLGMVAVLMTIRW
FT                   RRHLAHVSAVAAA"
FT   gene            complement(348867..349421)
FT                   /locus_tag="BCAN_A0348"
FT   CDS_pept        complement(348867..349421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0348"
FT                   /product="Invasion associated locus B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61438"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C2"
FT                   /protein_id="ABX61438.1"
FT                   /translation="MESNQYRENLYMKNYRAIGLVFTFTALSSLSAFAASLPGGASTLQ
FT                   ETYQDWTVSCQSQKDTTACVMRQEQSNAQTGQRVLTAELRNVAGGKVDGVLLMPFGLDL
FT                   AKGASLKIDDTAGPNLTFSTCLPQGCLAPVSFDAKQVAALKSGTNINVTTTALSPSQPV
FT                   AFKISLKGFGAALDRIQALTK"
FT   gene            349630..351017
FT                   /pseudo
FT                   /gene="degS"
FT                   /locus_tag="BCAN_A0349"
FT                   /note="Sensor protein degS"
FT   gene            351014..351655
FT                   /locus_tag="BCAN_A0350"
FT   CDS_pept        351014..351655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0350"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61439"
FT                   /db_xref="GOA:A9M8C3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C3"
FT                   /protein_id="ABX61439.1"
FT                   /translation="MTNECKIRVLLVDNHPLVLDGLRAVLETYDDIDIAGAASNARVAL
FT                   EMALAVNPDVVLMDINMPLLNGIDAIELFKRQLPNVRILMLSMHDSREYISTSIMRGAS
FT                   GYILKDVSTNEIVTAIHAVASGGTYFSSGVSEALLESGEKRSEGLSARENDVLVLVAEG
FT                   GSNREIAARLGISEATVETHRKNIKKKLGIASTAGLTRYAIENRLCLSSL"
FT   gene            351885..352489
FT                   /pseudo
FT                   /locus_tag="BCAN_A0351"
FT                   /note="Hypothetical protein"
FT   gene            352501..354069
FT                   /locus_tag="BCAN_A0352"
FT   CDS_pept        352501..354069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0352"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /note="GO_component: GO:0031317 - tripartite
FT                   ATP-independent periplasmic transporter complex;
FT                   GO_function: GO:0015556 - C4-dicarboxylate transporter
FT                   activity; GO_process: GO:0015740 - C4-dicarboxylate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61440"
FT                   /db_xref="GOA:A9M8C4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C4"
FT                   /protein_id="ABX61440.1"
FT                   /translation="MVAFFAENLAPLMFLSLVVVLLLGYPVAFAFAFVGFAFGFIGIEL
FT                   GLLPVNLFSAIPDRIFGQMSNETLLAIPFFTFMGLILERSGMAEDLLDTIGQLFGPVRG
FT                   GLAYAVIIVGALLAATTGVVAASVISMGLISLPIMLRYGYDRKVASGTIAAAGTLAQII
FT                   PPSLVLIVLADQLGRSVGDMYKGALVPGLLLVGVYVGFIVVMSILRPNSVPALPLQART
FT                   LKGWKLARRVVLSLVPPLVLIFLVLGTIFIGVATPTEGGAMGAVGALLLAIINDRLNLK
FT                   MLTSALYATTKLSSFVIFILLGARVFSLTFYGVNGHVWVEHLMTSVPGGEVGFLIVTNI
FT                   LVFFLAFFLDYFELAFIIIPLLAPVADSLGIDLIWFGVMLAMNMQTSFMHPPFGFSLFY
FT                   LRSVAPSRPYKDKVTGATIPPVTSGQIYMGSIPFLLIQVVAVGVIIAFPGLVTHYKGNH
FT                   PQVDPASIQINVPMPDAGGGNPFGNAPAPFGAPSLAVEPLPAPSFGSRAPSFGQGADQK
FT                   EKPAQ"
FT   gene            354131..355249
FT                   /locus_tag="BCAN_A0353"
FT   CDS_pept        354131..355249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0353"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="GO_component: GO:0030288 - outer membrane-bounded
FT                   periplasmic space; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61441"
FT                   /db_xref="GOA:A9M8C5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C5"
FT                   /protein_id="ABX61441.1"
FT                   /translation="MKETLSRRSFLTKGAAIGAAAATSGAALATPAIAAELPTLRWRLT
FT                   SGFPNNLDTIYGGAVYMADAVSKMTDGKFQIQVFQAGEIVPAPQAIDAVQANTVEMAHT
FT                   CGYYFTGKNPTFAIGTALPFGMNTRLQNAWLYHGGGNELYNEFLSDYGIVGIVGGNTAA
FT                   QMGGWYRKEIKSAEDLKGLKMRIAGVAGEVMSRLGVVPQQLPGGDIYPSLERGTIDAAE
FT                   WVGPYDDEKLGFYQIAPYYYYPAFWEGGASVHFFINKKQYESLPEAYKVALNTAAEAAT
FT                   QNMIALYDVKNTAAIRSLVSKGVKLQPLPRDVLDAAYKVSFDLYAEYNEKNPAWAKIYP
FT                   AWKKFRDEGFEWFRVAEYTYDSYVYAAQAAGK"
FT   gene            complement(355332..356150)
FT                   /locus_tag="BCAN_A0354"
FT   CDS_pept        complement(355332..356150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0354"
FT                   /product="protein of unknown function DUF861 cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61442"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C6"
FT                   /protein_id="ABX61442.1"
FT                   /translation="MSRNYYAPTGGLPPQTQLLTDRAMFTEAYAVIPKGTFSDIVTSFL
FT                   PFWEKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRAELDEGAEGVLFVVEGEVSVTV
FT                   AGKTHRLDEGGYAYLPPKSGWRLRNEGATTARFHWIRKAYEYVDGLDVPEPLFLNEKDI
FT                   APSPMPDTGGAWATTRFVDPNDLRHDMHVTVVTFEPGGVIPFAETHVMEHGLYVLEGKA
FT                   VYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRHMKLA"
FT   gene            complement(356163..357590)
FT                   /locus_tag="BCAN_A0355"
FT   CDS_pept        complement(356163..357590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0355"
FT                   /product="Chitin deacetylase"
FT                   /note="GO_function: GO:0016810 - hydrolase activity, acting
FT                   on carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0005975 - carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61443"
FT                   /db_xref="GOA:A9M8C7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C7"
FT                   /protein_id="ABX61443.1"
FT                   /translation="MKYPRNLVGYGRNTPDPRWPGGANIAVQFVVNYEEGGECCILDGD
FT                   PASECLLSEIVGAQPWRGQRNLNMESIYEYGARSGFWRLWRAFTRRNMPVTVYGVTLAM
FT                   ARNPEAVAAMKEAGWEIASHGLRWWEYKDVPEEIEREHIREAVRLHTEVTGSRPLGIYQ
FT                   GKPSDNTLKLVMEEGGFLYSADSYADELPYWVKGPKGPHLIVPYTLDANDMRFATPQGF
FT                   NSGDQFFTYLKDSFDVLYREGEEGAPKMMSIGLHCRLAGRPGRMAALERFLDYVQSHDK
FT                   VWVAKRVDIARHWHKHHQPVVADVVPSKADRQAFVARYGSIFEHSPWIAERAYDARLTV
FT                   EEDSASGLAAAMTKVFRTAAPDERLAVLKAHPDLAGKLAQARRLTAESTAEQASAGLDA
FT                   LTDTEKQAFTELNDAYTAKFGFPFIIAVKGRNKQEILDAFRRRVSNDRDTEFETACAQV
FT                   ERIALLRLKDILPETLY"
FT   gene            357858..358133
FT                   /locus_tag="BCAN_A0356"
FT   CDS_pept        357858..358133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0356"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61444"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C8"
FT                   /protein_id="ABX61444.1"
FT                   /translation="MGQEQNGYGRLRMRIPDQASGKPAANPCMELHPIGKRQAENLEEA
FT                   PIREAGHRSVAFRNSVHLRFGICGGKAHYRLPRLVSPFSCSTCWGS"
FT   gene            358139..359617
FT                   /gene="xdhA"
FT                   /locus_tag="BCAN_A0357"
FT   CDS_pept        358139..359617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="BCAN_A0357"
FT                   /product="xanthine dehydrogenase, small subunit"
FT                   /note="GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006143 - purine metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61445"
FT                   /db_xref="GOA:A9M8C9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8C9"
FT                   /protein_id="ABX61445.1"
FT                   /translation="MGQSARHEIRFLLNGETIVLDRVSPTETLLDYLRLSARLRGTKEG
FT                   CGEGDCGACTVLVGRVVDGGLVYESVNACIRFVGSLDGCHVVTIEYLRGADGDLHPVQK
FT                   AMVEFHGSQCGFCTPGFVMSLYALWMRDPRPADAAIEKALQGNLCRCTGYEAIMRAARA
FT                   ISDYGNVAQDPLAAERAHVLQRLTALRDGARVEVGAGKDRLIVPADLDDFATILAAEPK
FT                   ATIVAGSTDVGLWVTKMMRDISPVVFIGHLEELHSIREENGVVTIGAGVTYTQAFGFLA
FT                   GRIPALGQLINRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALGATLTLRKGAERRTI
FT                   ALEDFFIAYGKQDRGAGEFVEAVHVPLPGEGSRFAAYKVSKRREEDITASLGAFHLMLD
FT                   AAGNVAHIRIAYGGMAATPKRAHAVETALMGKPWTEATVEAALEAYAQDYTPLTDMRAT
FT                   AEYRLLVARNMLRRFYLETTVSGETLGALRGEAA"
FT   gene            359630..361984
FT                   /gene="xdhB"
FT                   /locus_tag="BCAN_A0358"
FT   CDS_pept        359630..361984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="BCAN_A0358"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   subunit"
FT                   /note="GO_function: GO:0004854 - xanthine dehydrogenase
FT                   activity; GO_process: GO:0009115 - xanthine catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61446"
FT                   /db_xref="GOA:A9M8D0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D0"
FT                   /protein_id="ABX61446.1"
FT                   /translation="MNRHSATDIKAARIRGGVATEQKHDSAHKHVTGTAVYIDDIPEPE
FT                   GTLHIGVGYASVAHGRIKSMDLEAVRAAPGVVDILTCKDVPGENDVSPSGMHDDPIFAV
FT                   DKVEFHGQPIFAVIAKTRDQARRAARLAKIEYEEAPGIYSIDMLDGLKDRLVTPPLTLE
FT                   RGNARAAIDAAPHRIRNRMYLGGQDHFYLEGQVSLAVPGEDEDVTVYCSTQGPSETQHL
FT                   VAHALGVSSHSVTVEVRRMGGGFGGKETQANQWAAIAAIAAKKHKRAVKIRLDRDEDMT
FT                   STGKRHGFVIDYEVGFDDDGTILGVDYLYALNAGFSADLSGPVGDRALFHCDNAYFYPA
FT                   VHAQSAPLYTNTVSNTAFRGFGGPQGMAGAERVIDEVAFALGKDPLEIRKRNFYDEMGK
FT                   DGTRNVTPYHQKVEDCIIQRIVAQLEESADYAKRREAIREFNAKSRYVKRGIALTPVKF
FT                   GISFTKTESNQAGALVHVYADGSVHMNHGGTEMGQGLHMKVAQVVAEEFQIDIDRVKIT
FT                   ATTTAKVPNTAPTAASSGADLNGMAAQDAARQIKKRLIRFAAQQYQVPEDQIMFLPNRV
FT                   RVGNQEISFNDLVNQAYIGRVQLSAAGHYKTPKIHWDRAKGRGHAFYYYAYGAACSEVS
FT                   VDTLTGEYVVERTDILHDTGRSLNRAIDIGQIEGGFVQGMGWLTTEELVWDEKGRLRTH
FT                   APSTYKIPLASDRPKIFNVALTDWSEAYEPTIHRSKAVGEPPLPLGLSVLHALADAVAS
FT                   VADYKVCPRLDAPATPERVLMTVERLRKQNG"
FT   gene            361989..362861
FT                   /gene="xdhC"
FT                   /locus_tag="BCAN_A0359"
FT   CDS_pept        361989..362861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="BCAN_A0359"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="GO_function: GO:0043546 - molybdopterin cofactor
FT                   binding; GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61447"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D1"
FT                   /protein_id="ABX61447.1"
FT                   /translation="MPGARDDIRAFLHQRPARNGLDCVLVEVTDVKGSAPRDAGAWMLV
FT                   ARDTIFRTIGGGQLEYMAIEHARKILSGGRDTPLDVPLGPEIGQCCGGRVSLSFRLMTH
FT                   GLADELVGKVDTEIAMRPHVYIFGAGHVGGALAHALSLTPVRIIMVDTREAELMKFQEK
FT                   WEPVFRPGFHGNYICDVPGVETCLSAIPEQAVRSAPPHSAFIILTHDHALDFLIAAEAL
FT                   QRRDAAYVGMVGSKTKKATFKNWLKREAGREDLFENLVYPIGGAVVKDKRPEVIAALAA
FT                   AEILTAVLV"
FT   gene            complement(362942..363856)
FT                   /locus_tag="BCAN_A0360"
FT   CDS_pept        complement(362942..363856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0360"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61448"
FT                   /db_xref="GOA:A9M8D2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D2"
FT                   /protein_id="ABX61448.1"
FT                   /translation="MSYLDNLRVFVRVVELGNLSAAGRDQRASPAVVSNRIKELEKHLG
FT                   VRLFNRTTRKLTPTEHGRVFYDGALKILEAVDEAEAAVAELAKNPKGSIRITAPLGFGR
FT                   RLIASGIPEFHDRYPDIEVRLRLSDHEVDIMSEGVDVAFKLGVLENSNLRMRGIMNCER
FT                   VVCAAPQYLERHGTPQSPEALLSDRHHCLLLRFPGSKEYYWLLQTPEGLRKFEVTGPYD
FT                   SDDGDVLTQWALGGRGIINKPLFEVKEYIRDGRLTPILQHTPPAPIQLAAIYPHKRLQD
FT                   PKVRLIIDFMTERCQRLIREALA"
FT   gene            364037..365284
FT                   /locus_tag="BCAN_A0361"
FT   CDS_pept        364037..365284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0361"
FT                   /product="protein of unknown function DUF989"
FT                   /note="GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61449"
FT                   /db_xref="GOA:A9M8D3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D3"
FT                   /protein_id="ABX61449.1"
FT                   /translation="MYDFAVAWDWLGFAVRWLHVTTAIAWIGSSFYFIALDLGLRQRPG
FT                   LPEGAYGEEWQVHGGGFYQIQKYLVAPAQMPEHLTWFKWESYATWLSGFTLLCIVYYAG
FT                   ADLYLVDPNVLDVSVPVAIAISLAFGWIAYNTICNMMLGRSDTLLMVILYCILVVMAWG
FT                   YTHLFTGRAAFLHLGAFTATIMSANVFMIIIPNQKIVVADLIAGRKPDPKYGKIAKQRS
FT                   THNNYLTLPVLFLMLSNHYPLAFGTEFNWIIASLVFLMGVTIRHWFNTRHARKGNPTWT
FT                   WLVTVILFIIIIIWLSTVPKILTGEPENPKVSALQQSFLNDPHFDKVRDTVLGRCSMCH
FT                   ATEPGWEGIIAPPKGVVLDTDRNIAAHAREIYLQAGRSHAMPPANVTGVTDEERQLLAS
FT                   WYQSVTTGPKEGTKTE"
FT   gene            365281..366585
FT                   /gene="guaD"
FT                   /locus_tag="BCAN_A0362"
FT   CDS_pept        365281..366585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="BCAN_A0362"
FT                   /product="guanine deaminase"
FT                   /note="GO_function: GO:0008892 - guanine deaminase
FT                   activity; GO_process: GO:0006147 - guanine catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61450"
FT                   /db_xref="GOA:A9M8D4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D4"
FT                   /protein_id="ABX61450.1"
FT                   /translation="MTKLLIRGRVLTFRDEPQSLDDSHAYRYIEDGAVLVENGRILRLG
FT                   DYAEVSGEAGADVKLADHRPHLVVPGFIDTHIHYPQTQVVASYAANLLEWLNTYTFVAE
FT                   QKFADEQHAEFIAEHFLDELIRHGTTTAIAYCSVHPQSVDAYFRASQHRNMRMLGGKVM
FT                   MDRNAPPALCDTAQSGYDDTKALIARWQGQGRLDYVITPRFAITSTPEQLEASQTLVRE
FT                   HPECFVQTHLSENHDEIAFTRSLYPDAPDYLGIYEHYSLLGNKTLLGHSIHLEEREVRL
FT                   MAETGSIAVFCPTSNLFLGSGLFDRDRLKAAGVRMAVATDIGGGTSFSMLRTMDEGYKV
FT                   LQLRGQRLNPFQSFYMMTLGNARALSMEDRIGTLEEGTEADIVVLDSSATSPMRLRMAA
FT                   GATLEQELFLLQTLGDDRAIVETYVAGKPMKADLL"
FT   gene            366665..367951
FT                   /gene="ttuD"
FT                   /locus_tag="BCAN_A0363"
FT   CDS_pept        366665..367951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuD"
FT                   /locus_tag="BCAN_A0363"
FT                   /product="hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61451"
FT                   /db_xref="GOA:A9M8D5"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D5"
FT                   /protein_id="ABX61451.1"
FT                   /translation="MSAIADPKKFLTNLFDAAVAAADPELVIRANLPEKPKGRTIVIGA
FT                   GKGSAQMAAAFERAWAEKHDAPLEGVVVTRYGYGAPCERIRIIEAAHPVPDGAGLAASR
FT                   RLFNAVSGLSEDDLVVALISGGGSALLPSPPEGMTLEDEIAVNKALLASGAPISAMNAV
FT                   RKHLSTIKGGRLAAAAHPAKVFSLVVSDIPGDNPAFVASGPTVPDETSRDEALKIIERY
FT                   RLDLPQAALAHIKSENAHAPQPDDGVFARNEVRVIASAAVSLEAAAREASRHGVEAVIL
FT                   SDSVEGEAREVAHVHAAIAREVAERDRPFKKPVVILSGGETTVTIGSPGGKGGRNSEFL
FT                   LSFALDIDGYANIHALAADTDGIDGSEDNAGAFADGGTVSRLQKLGEDGMARLNANDAW
FT                   TAFDALGDLFVPGPTGTNVNDLRAILITV"
FT   gene            complement(367932..368090)
FT                   /gene="ccoS"
FT                   /locus_tag="BCAN_A0364"
FT   CDS_pept        complement(367932..368090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoS"
FT                   /locus_tag="BCAN_A0364"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="GO_process: GO:0008535 - cytochrome c oxidase
FT                   complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61452"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D6"
FT                   /protein_id="ABX61452.1"
FT                   /translation="MSGLIFLIPIALFLGLLGLAAFLWSLKSGQYDDLDGAANRILLDD
FT                   ESKPLSK"
FT   gene            complement(368087..370345)
FT                   /locus_tag="BCAN_A0365"
FT   CDS_pept        complement(368087..370345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0365"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="GO_function: GO:0046873 - metal ion transporter
FT                   activity; GO_process: GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61453"
FT                   /db_xref="GOA:A9M8D7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D7"
FT                   /protein_id="ABX61453.1"
FT                   /translation="MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHC
FT                   GLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKDGETPPNVVDTLRRLGYEAHIFDMA
FT                   QDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLVYSG
FT                   RIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIG
FT                   RTLDYMMRARARSAVRGLAQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPV
FT                   DAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLSTPLVIRATAEARDSFLSEMV
FT                   RLMDIAEDGRAHYRRLADRASELYVPMVHATAFLAFAGWMFYTGGDWYRSIYIAISTLI
FT                   ITCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGTLTLGQPWL
FT                   INAQEIEPHYLEIAAELSLYSRHPLSRVLALFSGATPMTPFTHIEEVPGAGIEAELDGT
FT                   IYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPREDAANAIAALKRNGLK
FT                   LGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPA
FT                   LVAAHVSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNI
FT                   IAVPIAVFGYVTPLVAALSMSLSSIVVVTNALRLRAGKQKQQARQSGAPATTMKEAHK"
FT   gene            complement(370342..370839)
FT                   /locus_tag="BCAN_A0366"
FT   CDS_pept        complement(370342..370839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0366"
FT                   /product="FixH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61454"
FT                   /db_xref="GOA:A9M8D8"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D8"
FT                   /protein_id="ABX61454.1"
FT                   /translation="MSTNSKTSGTFTGWHMLGIMFMFFGVIIAVNLLMAYNAIHSWSGL
FT                   VVQNTYVASQEFNDKAKTGKEQAALNWQSKPAYENGVFTWQLADHNGKAVAMTGGTVDF
FT                   KRPVGDAHDTKVTLTVREPGILTAPLELGEGAWIMEVNADAGLEDPYRHIIRVLVKDGK
FT                   IL"
FT   gene            complement(370839..372389)
FT                   /gene="ccoG"
FT                   /locus_tag="BCAN_A0367"
FT   CDS_pept        complement(370839..372389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoG"
FT                   /locus_tag="BCAN_A0367"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0008535 - cytochrome c oxidase complex
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61455"
FT                   /db_xref="GOA:A9M8D9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8D9"
FT                   /protein_id="ABX61455.1"
FT                   /translation="MSDDVERIDVQAVNSPKTRQSLYASRVKIFPKRVQGTFRRFKWIV
FT                   MFITLGIYYLTPWLRWDRGAYAPDQAVLIDLANRRFYFFFIEIWPQEFYYVAGLLIMAG
FT                   LGLFLVTSVAGRAWCGYTCPQTVWVDLFLVVERAVEGDRNARMKLDKAPWTFDKVWKRL
FT                   AKHSIWIVIGVLTGGAWIFYFADAPTLLKDFVTGHAAPVAYFTVAILTATTYIFGGLMR
FT                   EQVCTYMCPWPRIQAAMLDENSLTVTYNDWRGEPRSRHSKKAIAAGETVGDCVDCNACV
FT                   AACPMGIDIRDGQQLECITCALCIDACDSVMDKIGKPRGLISYATLADYDANMALATNN
FT                   GIAPTDPARVYEAPNKFSDKVQNLSWKKVLRPRSMFYFAIWALIGVVLIVSLSTRQRIG
FT                   INVLHDRTPQYVLLSDGSIRNGYTVKLLNMIPTPRTFQLSIQGLPEATLTVQDETPDAN
FT                   GNYAIAVEPDKLKNLRVFVTMPHDAVTEPRKDYEIEVRAEDGSEGARYKATFMAPERK"
FT   gene            complement(372549..373412)
FT                   /locus_tag="BCAN_A0368"
FT   CDS_pept        complement(372549..373412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0368"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61456"
FT                   /db_xref="GOA:A9M8E0"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E0"
FT                   /protein_id="ABX61456.1"
FT                   /translation="MTDKQIDEVSGVSTTGHEWDGIKELDNPMPRWWLWTFYATIFWAI
FT                   AYVIAYPAWPLISGSTAGLTGWSSRGQFWQENAKIAASRQGIIDQIKAKDVHEILADEE
FT                   LRQYAIAGGAAAFRVNCVQCHGSGAQGAPGYPNLNDDDWLWGGSIDDIVTTIRHGVRSP
FT                   DDPETRLSEMTAFADVLEPQQIRDVAAYVVNLSGTPHDPSMVPEGQKVFAENCAVCHGA
FT                   DAKGLREFGAPNLTDAIWLYGSGEDAIIRQVSHPKHGVMPAWEARLGDATVKQLAIFVH
FT                   SLGGGE"
FT   gene            complement(373405..373563)
FT                   /locus_tag="BCAN_A0369"
FT   CDS_pept        complement(373405..373563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0369"
FT                   /product="Cbb3-type cytochrome oxidase component"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61457"
FT                   /db_xref="GOA:A9M8E1"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E1"
FT                   /protein_id="ABX61457.1"
FT                   /translation="MDYNSLRTFADSWGLFGMALFFVFVVLYAFRPGSKKKADEAKEIP
FT                   FKDDKND"
FT   gene            complement(373578..374309)
FT                   /gene="ccoO"
FT                   /locus_tag="BCAN_A0370"
FT   CDS_pept        complement(373578..374309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoO"
FT                   /locus_tag="BCAN_A0370"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="GO_function: GO:0004129 - cytochrome-c oxidase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61458"
FT                   /db_xref="GOA:A9M8E2"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E2"
FT                   /protein_id="ABX61458.1"
FT                   /translation="MSILKNHSKLEKNATLLLIASLAVVTVGGLVEIAPLFYLENTIEK
FT                   VEGMRPYSPLELAGRDIYVREGCYLCHSQMIRPFRDEVERYGHYSLAAESMYDHSFQWG
FT                   SKRTGPDLARVGGRYSNEWHVQHLVRPRDVVPESVMPSYAFLKERPLKADDIAAHLKAN
FT                   VAVGVPYTQEMIDKALDDLKAQATPDADTSGMEERYPKARVGDFDGNPQMISEMDALIA
FT                   YLQMLGTLVDFSTYDQSPKAR"
FT   gene            complement(374324..375949)
FT                   /gene="ccoN"
FT                   /locus_tag="BCAN_A0371"
FT   CDS_pept        complement(374324..375949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoN"
FT                   /locus_tag="BCAN_A0371"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /note="GO_function: GO:0004129 - cytochrome-c oxidase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61459"
FT                   /db_xref="GOA:A9M8E3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E3"
FT                   /protein_id="ABX61459.1"
FT                   /translation="MNYAAGTVLSGLGALFAVLLAGFSHDELFRTHMWILFATLAIFTI
FT                   LLMRNADYGLTPKKVDQSTYMDGPIRYGVIATVFWGVVGFLVGVLIAAQLAFPDLNLQP
FT                   YFNFGRLRPVHTSAVIFAFGGNALICSSFYVVQRTCRARLFGGDLAWFVFWGYQLFIVM
FT                   AATGYLLGITQSREYAEPEWYVDIWLTIVWVAYLVVFMGTLLRRKEPHIYVANWFYLSF
FT                   IITIAMLHIINNLAIPVSFLGVKSYSAFAGVQDAVTQWWYGHNAVAFFLTVPFLAMMYY
FT                   FVPKQANRPVYSYRLSIVHFWSIIFLYIWAGPHHLHYTAVPDWAQTLGMVFSIMLWMPS
FT                   WGGMINGLMTLSGAWDKVRTDPIIRLMVAAIAFYGMATFEGPMLSIKAVNSLSHYTDWT
FT                   IGHVHAGALGWNGMISFAAVYYLAPKLWNRQRLYSIRMVNWHFWLATLGIVLYASSMWV
FT                   AGIQQGLMWREYDNQGFLVYSFAETVLAMFPYYVIRTIGGVFYLTGGLLMAWNVYQTIR
FT                   GRLRNEAPMGGTRPVAGATMQPAE"
FT   gene            complement(376167..376625)
FT                   /gene="fur"
FT                   /locus_tag="BCAN_A0372"
FT   CDS_pept        complement(376167..376625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="BCAN_A0372"
FT                   /product="Ferric uptake regulation protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61460"
FT                   /db_xref="GOA:A9M8E4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E4"
FT                   /protein_id="ABX61460.1"
FT                   /translation="MLFDPHKAPTSQPKPAKVKSILQQAGLRPTRQRMALGRLLFLDQN
FT                   RHVTPDLLYEEALQAGVTLSVATVYNTLNQFAEAGLVRRISIHGERTYFDTDTGDHTHF
FT                   YIAEEGRIIDIPSENVSIGPLPAPPDGYRISKVDITIQIERDPGSKRI"
FT   gene            376624..376950
FT                   /locus_tag="BCAN_A0373"
FT   CDS_pept        376624..376950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0373"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61461"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E5"
FT                   /protein_id="ABX61461.1"
FT                   /translation="MSASFALREAAFADAVFDSPVLAQWQSCLPPGRANEKPVAAKIIG
FT                   LEAVSRCQENHLGASDIANGLQLQSKAGGAYPSMKIEPIVQWTGFAGNVLNPRGFRYSA
FT                   LRLP"
FT   gene            377067..377681
FT                   /locus_tag="BCAN_A0374"
FT   CDS_pept        377067..377681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0374"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61462"
FT                   /db_xref="GOA:A9M8E6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E6"
FT                   /protein_id="ABX61462.1"
FT                   /translation="MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVL
FT                   GNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDGNVRLVMKDWIIFGETSAYAARLVL
FT                   AAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGILQRN
FT                   MKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT"
FT   gene            complement(377730..379175)
FT                   /locus_tag="BCAN_A0375"
FT   CDS_pept        complement(377730..379175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0375"
FT                   /product="Succinate semialdehyde dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61463"
FT                   /db_xref="GOA:A9M8E7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E7"
FT                   /protein_id="ABX61463.1"
FT                   /translation="MPAIGFIIDGKESGGASGKTFERKDPITGKVATVAAAASLADVDT
FT                   VAEAAAKAFESWSETGPNARRALLNKAADLMDSRTAEFTRLMLEETGATAPWAGFNVHL
FT                   GANILREAAALTTQITGEIIPSDKPGIMLMAVRQPVGVVLGMAPWNAPVILGVRAVAAA
FT                   LACGNTVILRSSETCPGVHHLIIKILNDAGFPAGVANVISNAPDDATEIVAALIAHPAI
FT                   RRINFTGSTQVGRIIARQAAGHLKPVLLELGGKAPFIVLEDADLDQAVDAAAFGAFMNQ
FT                   GQICMSTERFIVHEKVADAFAEKLAAKARSLPAGDPRGNVVLGSLVDLKSAQRMDALIA
FT                   DAVAKGGRVLAGGKRDGAVVEATIIDGVTPQMDIYTQESFGPVKPIIRVKSAEEAIRVA
FT                   NDTEYGLSSAIFSQNVKRALALSRKLETGICHINGPTVADEAQVPFGGVKSSDYGRFGG
FT                   KAAINEFTELRWITIEGPQHYPF"
FT   gene            379374..380459
FT                   /locus_tag="BCAN_A0376"
FT   CDS_pept        379374..380459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0376"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /note="GO_function: GO:0003908 -
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61464"
FT                   /db_xref="GOA:A9M8E8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E8"
FT                   /protein_id="ABX61464.1"
FT                   /translation="MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSC
FT                   PSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLSDTLATQNNARHAEMVASACRFIET
FT                   AETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRVTDA
FT                   IYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCA
FT                   IFMGDDPQGLIHDLEKRFPKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAF
FT                   QQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQACAANKIAVAVPCHRVVRNDGG
FT                   ISGYRWGVERKRDLLERERKA"
FT   gene            380641..380991
FT                   /locus_tag="BCAN_A0377"
FT   CDS_pept        380641..380991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61465"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8E9"
FT                   /protein_id="ABX61465.1"
FT                   /translation="MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDR
FT                   FLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLERDGKLMVG
FT                   FKPAQYEAYFKL"
FT   gene            381328..382371
FT                   /locus_tag="BCAN_A0378"
FT   CDS_pept        381328..382371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0378"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61466"
FT                   /db_xref="GOA:A9M8F0"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F0"
FT                   /protein_id="ABX61466.1"
FT                   /translation="MQQGVTNILQHWLASWRDSLMACVAGSLAWLICEELLGQPKPIFA
FT                   MVTGVACLAPNLPNHGKQAIRVVLGVTAGVIVAELSLFLPQTVSVLHTGMVAFIAMVLA
FT                   TTFGTAPAIPIQAGVSAILVLAMGPQEAGLSRLTDVLVGAGVGLLFSQILLTPDPVRVI
FT                   DRAVRGLLEPIASGLKKSAAVLKDDNPEEANTTITQFIEAHRALVALSDGLALVRSDAR
FT                   WSLRGRLVASEITDMASRYERRGIRLYAAALLFGEALGNALRKKETEPPAWLMESLQIV
FT                   IANCSMEPGREPHRIPPIPKDLPFGWRECVLRLEGVQDTLLHFLNSDQPDSVLVPKCEA
FT                   KPQVDAV"
FT   gene            382522..383601
FT                   /pseudo
FT                   /locus_tag="BCAN_A0379"
FT                   /note="protein of unknown function DUF1228"
FT   gene            383823..385070
FT                   /locus_tag="BCAN_A0380"
FT   CDS_pept        383823..385070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0380"
FT                   /product="SbmABacA family protein"
FT                   /note="GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61467"
FT                   /db_xref="GOA:A9M8F1"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F1"
FT                   /protein_id="ABX61467.1"
FT                   /translation="MFASFFPRPKLFFISALLWTLLAVLGWYMGGENLGSVFGLAPAAS
FT                   DAAPLIGAHVFWSRPFLWFYIYFAVITFAFYGFWVRFSPHPWQRWSILGSALILFATYF
FT                   NVQVSVAINTWYGPFYDMVQKGLTTPGAVSAAEFYWGLADFAGIAFLAITIGVLNLFFV
FT                   SHYIFRWRTAMNDYYMSHWPKLRHIEGAAQRVQEDTMRFSTTLEQLGVSLVKSVMTLIA
FT                   FLPVLFTFSQKVSTLPIIGYVPHALVWAAVIWALFGTGFLALVGIKLPGLEFNNQRVEA
FT                   AYRKELVYGEDHADRAEPITMRELFKNVRHNYFRLYFHYVYFNVARIFYLQVDNIFPLI
FT                   ILIPSIVAGKLTLGLMSQITNVFDQVRGSFQYLVNSWTTIIELLSIYKRLRAFEAAIHG
FT                   EPLQAVDRINLEPGAG"
FT   gene            complement(385109..386107)
FT                   /locus_tag="BCAN_A0381"
FT   CDS_pept        complement(385109..386107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0381"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61468"
FT                   /db_xref="GOA:A9M8F2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F2"
FT                   /protein_id="ABX61468.1"
FT                   /translation="MRFPLSRLVAFCAFAVTSLAGQALAGEPPKTQYVLISFDGAHDNT
FT                   LWTRSRELARKNNAHFTYFLSCVFLMTKQDRSGYKPPHKKAGASNVGFALSRDEVATRL
FT                   DNIWQAHLEGNEITSHGCGHFDGTKWSTADWKKEIGEFRRIVADAYRNNGIGGEPEGWR
FT                   ALALTGINGFRAPYLAAGKPVQDVLKATGFRYQASSVTRGPELPQMTDRLASFGLPLVP
FT                   EGPSQRPVVAMDYNLYVRHSKAVEAPQKAAEFEARAYKAFRAAFDKQYAGKRIPLQLGF
FT                   HFVLMNDGAYWRALERLVSEVCTKPDVKCTTYGAYLDQLQNTGSNTAHNRF"
FT   gene            386353..387024
FT                   /locus_tag="BCAN_A0382"
FT   CDS_pept        386353..387024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0382"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61469"
FT                   /db_xref="GOA:A9M8F3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F3"
FT                   /protein_id="ABX61469.1"
FT                   /translation="MADDSFIREVNEELRSERAKQVWRNFGPALIGAAVAVVLGTAGWV
FT                   GYQHWTDSKASASGDKFLAALDLAAAGKTDEALAAFTDLEKTGYGSYPVLARLRVASVL
FT                   ADKGDAAAAVKAFDEISADNSVPEPLRNIARLRAGYLLVDNGSYDDVAKRVEPLSADGN
FT                   PMRTSAREALGLAAWKAERFDDAAKLFKLVAEDSLAPANARQRANIMLDLMHSAGVAAQ
FT                   G"
FT   gene            387046..388497
FT                   /locus_tag="BCAN_A0383"
FT   CDS_pept        387046..388497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0383"
FT                   /product="small GTP-binding protein domain"
FT                   /note="GO_function: GO:0005525 - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61470"
FT                   /db_xref="GOA:A9M8F4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8F4"
FT                   /protein_id="ABX61470.1"
FT                   /translation="MGFTLAIVGRPNVGKSTLFNRLVGRKLALVDDLPGVTRDRRIHDA
FT                   KLYDLKFQVIDTAGLEEAANDSLEARMRAQTEAAISEADAVLFVIDAKAGITPADSTFA
FT                   EAVRRSGKPVVLVANKAEARGSEAGMYDAFQLGLGEPCPISAEHGQGMPDLRDAIVELL
FT                   GEERVFAEERQEEAADEVFTPAAVGALVGDDIEDPDAEEIPAYDATKPLRIAIVGRPNA
FT                   GKSTLINTMLGEDRLLTGPEAGITRDSISADWEWHGRKIKLFDTAGMRRKARVQEKLEK
FT                   LSVADGLRAIRFAEVVIIVLDATIPFEKQDLQIADLIIREGRAPVIAFNKWDLIEDRQM
FT                   VLADLYEKTARLLPQVRGLRAVPISGERGQGIDKLMENVVKTHEIWNRRISTGRLNRWL
FT                   EGVIAHQPPPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRYLINGLRETFD
FT                   MPGVPIRLSLRTSDNPFAGRAKKKK"
FT   gene            388656..389972
FT                   /gene="dnaK"
FT                   /locus_tag="BCAN_A0384"
FT   CDS_pept        388656..389972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BCAN_A0384"
FT                   /product="Chaperone protein dnaK"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61471"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F5"
FT                   /protein_id="ABX61471.1"
FT                   /translation="MTPSDQGVEQSGVTLGIDFGTTNTVLSVAAPDGTTAVLSVPKDGV
FT                   EITGYRSILCFWQDRETGERTAESGPWTVDAFVNAPHSTRMLQSFKTFAASKSFKDTPV
FT                   FGRRFKFEDILQTFLETVAAKLGDRLPPKGNRVVIGCPVIFAGNAPDEALAMLRYEKAF
FT                   RAFGFTDIHYVYEPVAAAYFYAQQLTADSNVLVADFGGGTSDFSIVRFEVGKEGLRFTP
FT                   LSQTGLGIAGDTFDYRIIDNAVSPLLGKGTEYESFGKRLTVPNYYYANFARWNTLFLMN
FT                   SPTTIRELDELARQAVDPKPLESFIHLIENDYGYEIYRAVSELKVRLSSQHIAELHFKA
FT                   DDFEIRSDITRNDFENWIDGDVRQIERSVQQAVEKAGLASSAIDRVFLTGGTSFVPVIR
FT                   TVFESRFPDAMVTSSNQFDSIANGLALIGQSGDIDRWSV"
FT   gene            390409..391698
FT                   /locus_tag="BCAN_A0385"
FT   CDS_pept        390409..391698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0385"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0016787 - hydrolase activity; GO_process: GO:0009847 -
FT                   spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61472"
FT                   /db_xref="GOA:A9M8F6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F6"
FT                   /protein_id="ABX61472.1"
FT                   /translation="MRLVSLRALFGRSCAAAEPVWHYPVTGYCPEDGRYYGVRAKPRQI
FT                   PHKQHWLVPFVLAASAYLFNSNAIAFQDMASLVPAADLGTHRWTAFIARAPVGSVHQAE
FT                   MPFVDATTVTGSIATNGIEVPGIGHVALSGGGKTAKLGVDDPNPDENRINRADKTNRLV
FT                   SVKPKAPAKAFTAGSMFEKISLISRPPEKIDTRMAFTRKLEGKEIGITMAFHRVKPPKP
FT                   KAELPTQLAKLINNEQPDVLALGYAPATPDYGKTSPFESILRPDQSEGRFVPPIGDQDH
FT                   DWAATPLPPSAFSPREQKCLAEAVYYEARGESVKGQVAVAQVVLNRVRNPAYPGSICGV
FT                   VYQNRDWLNACQFSFACDGQKHRVTEPAQWRMAQQVAKTVSAGQIWLPEVGSATHYHAT
FT                   YVRPFWAPTMKKLTKIGLHIFYRTYGGGWS"
FT   gene            391969..392367
FT                   /locus_tag="BCAN_A0386"
FT   CDS_pept        391969..392367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0386"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61473"
FT                   /db_xref="GOA:A9M8F7"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F7"
FT                   /protein_id="ABX61473.1"
FT                   /translation="MARGAEPEKPSGTIKDAKREPGSGELDQRLKRLEAELAKKGVLKQ
FT                   PASEEERSETSSSVAQAMKLSSEFIAGILVGALIGWFLDRYAGTSPWGLIVLLLLGFGA
FT                   GTLNVLRSAGYVAEQGNNKSSAEKDDRK"
FT   gene            392475..393224
FT                   /gene="atpB"
FT                   /locus_tag="BCAN_A0387"
FT   CDS_pept        392475..393224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BCAN_A0387"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="GO_component: GO:0045264 - plasma membrane
FT                   proton-transporting ATP synthase complex, coupling factor
FT                   F(o); GO_function: GO:0046933 - hydrogen ion transporting
FT                   ATP synthase activity, rotational mechanism; GO_process:
FT                   GO:0015986 - ATP synthesis coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61474"
FT                   /db_xref="GOA:A9M8F8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8F8"
FT                   /protein_id="ABX61474.1"
FT                   /translation="MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLY
FT                   LTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLF
FT                   PYFYTVTSQIIVTFALSLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALE
FT                   FLVAFLQAYVFTVLTCMYINDAVHPGH"
FT   gene            393292..393519
FT                   /gene="atpE"
FT                   /locus_tag="BCAN_A0388"
FT   CDS_pept        393292..393519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BCAN_A0388"
FT                   /product="ATP synthase C chain"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0046961 - hydrogen ion transporting ATPase activity,
FT                   rotational mechanism; GO_process: GO:0015986 - ATP
FT                   synthesis coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61475"
FT                   /db_xref="GOA:A9M8F9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8F9"
FT                   /protein_id="ABX61475.1"
FT                   /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAADS
FT                   QFGRLVFGFAVTEALGIFSLLIALLLLFAV"
FT   gene            393691..394317
FT                   /locus_tag="BCAN_A0389"
FT   CDS_pept        393691..394317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0389"
FT                   /product="ATP synthase subunit B"
FT                   /note="GO_component: GO:0016469 - proton-transporting
FT                   two-sector ATPase complex; GO_function: GO:0016820 -
FT                   hydrolase activity, acting on acid anhydrides, catalyzing
FT                   transmembrane movement of substances; GO_process:
FT                   GO:0015986 - ATP synthesis coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61476"
FT                   /db_xref="GOA:A9M8G0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8G0"
FT                   /protein_id="ABX61476.1"
FT                   /translation="MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGV
FT                   FPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQD
FT                   ADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAI
FT                   KAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKAIRASNA"
FT   gene            394328..394807
FT                   /gene="atpF"
FT                   /locus_tag="BCAN_A0390"
FT   CDS_pept        394328..394807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="BCAN_A0390"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="GO_component: GO:0045264 - plasma membrane
FT                   proton-transporting ATP synthase complex, coupling factor
FT                   F(o); GO_function: GO:0046933 - hydrogen ion transporting
FT                   ATP synthase activity, rotational mechanism; GO_process:
FT                   GO:0015986 - ATP synthesis coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61477"
FT                   /db_xref="GOA:A9M8G1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8G1"
FT                   /protein_id="ABX61477.1"
FT                   /translation="MDATFWAFIALVIFVVIVVYMKVPGMIGRTLDERADRIKKELEEA
FT                   RTLREEAQQLLAEYHRKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAE
FT                   QKIATAETDAINAVRASAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKSHLN"
FT   gene            complement(394930..395592)
FT                   /gene="rnhB"
FT                   /locus_tag="BCAN_A0391"
FT   CDS_pept        complement(394930..395592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BCAN_A0391"
FT                   /product="Ribonuclease HII"
FT                   /note="GO_function: GO:0004523 - ribonuclease H activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61478"
FT                   /db_xref="GOA:A9M8G2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8G2"
FT                   /protein_id="ABX61478.1"
FT                   /translation="MKRSASDSPLLFDLPLAPDFSQEQQLMKRGLKHIAGIDEAGRGPL
FT                   AGPVVAAAVVLDQNDLPEGLDDSKRLTAARREALYEIILTKAITVSVASLSARSIDASD
FT                   IRKAALEAMRRAVIGLTLKPCHALVDGRDVPPGLPCPGSALVKGDQRSVSIAAASIVAK
FT                   VTRDRMMIRAGAAHPPYGLEIHAGYATQKHRAAIESEGPVPGLHRYTFAPIKGRFDC"
FT   gene            complement(395769..396941)
FT                   /locus_tag="BCAN_A0392"
FT   CDS_pept        complement(395769..396941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0392"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61479"
FT                   /db_xref="GOA:A9M8G3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G3"
FT                   /protein_id="ABX61479.1"
FT                   /translation="MAVIHQAEIIGQADRLAFGAGRAEHANAVIGEAGLRIDHARRRGR
FT                   GAGINPSGRFEPTVRQEFDDGWSTLEELPAFKTDVQIEKPRTIITRNDSPDISFDRSIN
FT                   PYRGCEHGCIYCFARPTHSYMGLSAGLDFETRLFTKPDAPRLLERELARPGYQPKTIAI
FT                   GTNTDPYQPVEKKWRIMREILEVLEAANHPVGIVTKSALVVRDIDILSRMAEKGLAKVA
FT                   LSVTTLDAHLARTMEPRASTPSLRLQAIRRLTDAGIPASVMMGPVIPGINDHEIERILD
FT                   AAYAQGAREAGYVLLRLPLEVAPLFKDWLLRNYPDRYRHVMSLVRSMRDGKDYDAEWGK
FT                   RMRGTGPYAWQIGRRFEIAARKLGFNTQRLRLRTDLFEPIQKGGKQLSLF"
FT   gene            397077..397582
FT                   /pseudo
FT                   /locus_tag="BCAN_A0393"
FT                   /note="Hypothetical protein"
FT   gene            complement(397662..397934)
FT                   /locus_tag="BCAN_A0394"
FT   CDS_pept        complement(397662..397934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0394"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61480"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G4"
FT                   /protein_id="ABX61480.1"
FT                   /translation="MPSKGATRRIRKMKKFALAALAVALSAGAAYAENPYVGQPANMAA
FT                   QDKAFMQGGSTPVRGNTDYTAPASIKAPVYQDGSAHRFGDASPSN"
FT   gene            complement(398078..398353)
FT                   /locus_tag="BCAN_A0395"
FT   CDS_pept        complement(398078..398353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0395"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61481"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G5"
FT                   /protein_id="ABX61481.1"
FT                   /translation="MTFGLPRREPSYGDRKMKKFVLAAAALALSAGAALAENPHVGEPA
FT                   NLYANDRTPVATQKLDYTAPASIKAPVYQDGSAHRFGDASPSSYQN"
FT   gene            complement(398425..398637)
FT                   /locus_tag="BCAN_A0396"
FT   CDS_pept        complement(398425..398637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0396"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61482"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G6"
FT                   /protein_id="ABX61482.1"
FT                   /translation="MVLQNSPIVHFYCTINPYTLFAPFEQRRLHNKHVKADIPNKPLII
FT                   LIYFIRFVKISENWVHECVIRKTFS"
FT   gene            complement(398621..398767)
FT                   /locus_tag="BCAN_A0397"
FT   CDS_pept        complement(398621..398767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0397"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61483"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G7"
FT                   /protein_id="ABX61483.1"
FT                   /translation="MKIRAGLQFLRTAFLPEPDLSPIVFILSTDRYAAPVFARIFARNG
FT                   IAK"
FT   gene            complement(398712..399611)
FT                   /gene="ispE"
FT                   /locus_tag="BCAN_A0398"
FT   CDS_pept        complement(398712..399611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BCAN_A0398"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="GO_function: GO:0050515 - 4-(cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase activity;
FT                   GO_process: GO:0016114 - terpenoid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61484"
FT                   /db_xref="GOA:A9M8G8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G8"
FT                   /protein_id="ABX61484.1"
FT                   /translation="MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFADH
FT                   GDRIHIEKAGSDSFTVSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKNLP
FT                   IASGIGGGSSDAAATLLALNTLWQLDLDFEMLAAIGLSLGADLSMCLHGAAHGTPLIAR
FT                   GIGEELNDVSGIAALPMLLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALCAYLR
FT                   ETRNDLLPAAISLAPQIEPKLALLRAKGALYAQMSGSGATCFAIFSDESALTRAAKEIA
FT                   DENPGWFAVPSHSFPSRA"
FT   gene            complement(399641..399862)
FT                   /locus_tag="BCAN_A0399"
FT   CDS_pept        complement(399641..399862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0399"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61485"
FT                   /db_xref="GOA:A9M8G9"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8G9"
FT                   /protein_id="ABX61485.1"
FT                   /translation="MRDGAQAQGHEVMPQLIFLLLIIAAAWYGYRSFKREAARVSQRVR
FT                   QAEKEAQNRAHGTLVQDPKTGEYYVRKD"
FT   gene            complement(400293..401399)
FT                   /locus_tag="BCAN_A0400"
FT   CDS_pept        complement(400293..401399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0400"
FT                   /product="peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61486"
FT                   /db_xref="GOA:A9M8H0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H0"
FT                   /protein_id="ABX61486.1"
FT                   /translation="MSFPAPPFRPFAAISCCGRRPDQSAANPLWKADESPEAKNFGRFL
FT                   CVFHFASYIASTYCTERLQAASSLLRRSSLEFALPGLLKRLIPRRFRAVETEIPVVRLH
FT                   GAIMTGGTSLRPTLSLASTAGILEKAFADKHAPAVAISINSPGGAPVQSRLIYRRIRDL
FT                   AVEHQKKVFVFVEDVAASGGYMIALAGDEIIADPSSIVGSIGVVSASFGFPELLKKIGV
FT                   ERRVYTAGSNKVTLDPFQPEKAEDIERLKALQLEIHATFIDMVKERRAGKLGDNPDLFS
FT                   GLFWTGTTAASLGLIDGLGDMRSFLRKTYGDKVKLKLIQPQRGLLGRKLPGIGMDSGSV
FT                   EPAQIAAHLGDGLLCVAEEKAIWARYGL"
FT   gene            complement(401320..402501)
FT                   /gene="nhaA"
FT                   /locus_tag="BCAN_A0401"
FT   CDS_pept        complement(401320..402501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="BCAN_A0401"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="GO_function: GO:0015385 - sodium:hydrogen antiporter
FT                   activity; GO_process: GO:0006814 - sodium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61487"
FT                   /db_xref="GOA:A9M8H1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8H1"
FT                   /protein_id="ABX61487.1"
FT                   /translation="MNHSPQSARPVSIMRRFLDSEAAGGITLMAAAALALIVANSPFAQ
FT                   TYFDALHLYIGPLSLAHWINDALMAIFFLLVGLEIKREMLDGQLASWPNRMLPGIAAAG
FT                   GVILPAIIFAVLNHDNPAKLRGWAVPSATDIAFALGVLSLLGSRAPSSLKVFLATLAIL
FT                   DDLAAVVIIAIFYTAEISMPYLGAAFITAAVLFVMNRMGVVKLLPYLISAVILWFFVFN
FT                   SGVHATVAGVVAALMIPLKPAPGRPDDMTSPLHKLEHALAKPVAFIVVPIFGFANAGIS
FT                   FKGLEASVLGDTLTLGILLGLFLGKQFGVFGAAWLAIKTGLAEKPMGASWVQLYGVAIL
FT                   CGIGFTMSIFIGLLSFPSDLMQTETKIGVLSGSALSAICGYLLLRAAARPKRG"
FT   gene            complement(402521..402742)
FT                   /locus_tag="BCAN_A0402"
FT   CDS_pept        complement(402521..402742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0402"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61488"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H2"
FT                   /protein_id="ABX61488.1"
FT                   /translation="MQMMFSRAFRCYCRLCICLLACGKLAGFARFSLGTVRFLLKRHMR
FT                   PNISGTEIFVLPFRPVFIPTVPKVILRR"
FT   gene            complement(402791..403573)
FT                   /locus_tag="BCAN_A0403"
FT   CDS_pept        complement(402791..403573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0403"
FT                   /product="methyltransferase small"
FT                   /note="GO_function: GO:0008168 - methyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61489"
FT                   /db_xref="GOA:A9M8H3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H3"
FT                   /protein_id="ABX61489.1"
FT                   /translation="MTAPAEDKVEETLDVFHRGAFHLVQPALKGHRSGVDAMILASAVP
FT                   GGFAGRAADLGSGAGAAGLAVAARCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRI
FT                   DILEADVALKGKARVFAGLADNSFDFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQ
FT                   WVRTAAAIVKPGGGIAIIARPGSIRPILDALGGRFGGLKIVAIQPRADAPAIRIVITGT
FT                   RGSRAGLSLMPALILHGDEGHGFTARADAINNGLSSLF"
FT   gene            complement(403570..403797)
FT                   /locus_tag="BCAN_A0404"
FT   CDS_pept        complement(403570..403797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0404"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61490"
FT                   /db_xref="GOA:A9M8H4"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H4"
FT                   /protein_id="ABX61490.1"
FT                   /translation="MIELIRTNDSVLLSFAEALMKEAGIAYFIADTNMSIIEGSLGVLP
FT                   RRLMVDEDQMEEARQILIDAKIEHELRDNK"
FT   gene            404060..405082
FT                   /locus_tag="BCAN_A0405"
FT   CDS_pept        404060..405082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0405"
FT                   /product="Hypothetical protein"
FT                   /note="GO_process: GO:0008299 - isoprenoid biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61491"
FT                   /db_xref="GOA:A9M8H5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H5"
FT                   /protein_id="ABX61491.1"
FT                   /translation="MALGVVLNLDGKMKQEGSVQPLVDLTRADMARVNELILSRAGSDV
FT                   EMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDGHVRLATSVEFMHTATLLHDDVVD
FT                   ESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVDVGSFDALDVLATSASIIAEGEV
FT                   MQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPIIAGAQRSDRAALRDYGLNLGLA
FT                   FQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYRRGTDEERAFWKGAIEGGASY
FT                   DASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKASPQKDALIEVVDFCISRVN
FT                   "
FT   gene            405386..407251
FT                   /gene="bimA"
FT                   /locus_tag="BCAN_A0406"
FT   CDS_pept        405386..407251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bimA"
FT                   /locus_tag="BCAN_A0406"
FT                   /product="Protein bimA"
FT                   /note="GO_function: GO:0005488 - binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61492"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H6"
FT                   /protein_id="ABX61492.1"
FT                   /translation="MRLGSKHRPLYGLLLSLLAGIAISTSGALAKTTPDPVRAQVRAGS
FT                   FAGAYLAGRTAESDDNLSAAVDFYRQAMAFDPNNSQIKQDLMLVLLTEGRFKDALPLAH
FT                   ELQNVTAIERFSRLALAIDAINRQQYRKVGPLLMFSLQSDMDRLLINLMNAWVKVGQGN
FT                   PKEALADVQKMDGPEWYDLFRTYNAALIADLAGRKQEARDYYQQAIDDRRGGSAAPDTY
FT                   ERVVMAFAAFKLRQGDRAGAIKTLKDAEELLNGRMTITEMREKIEAGHKYGRLVKTAQD
FT                   GAAETLYTLGTAINRSGAEAFAKLYLQMSLPLRPDNDATLYQLGDISAKLHEPQKAVEY
FT                   YGRVPEQSPYRRDAEMQRALNLAENDQSAEAIKQLKVLLGRDKSDMRTYLALGGVYAQD
FT                   KNFADAAKIYDAAVEQIKTPARKDWPLFYQRGIAYERLQEWDKAEPNFRKALELYPDQP
FT                   QVLNYLGYSWVDRNENFDEALNMIRKAVELRPQDGYIVDSLGWAYYQLGRYNDAVVELE
FT                   KAVKLRPEDPTINDHMGDAYWRVGRLLEATFQWNHAIAGKPEPEELAKIKEKLKKGLPD
FT                   IPGQSAADATKPAGKKPDEAKPEAPAPSATPAAPSDKAPEKPTTD"
FT   gene            407403..408329
FT                   /gene="glyQ"
FT                   /locus_tag="BCAN_A0407"
FT   CDS_pept        407403..408329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="BCAN_A0407"
FT                   /product="Glycyl-tRNA synthetase alpha chain"
FT                   /note="GO_function: GO:0004820 - glycine-tRNA ligase
FT                   activity; GO_process: GO:0006426 - glycyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61493"
FT                   /db_xref="GOA:A9M8H7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8H7"
FT                   /protein_id="ABX61493.1"
FT                   /translation="MHPTRSFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLR
FT                   SLGPKPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKAIG
FT                   LDPTLHDVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGLEGDEKVTYGDVFLQAEQEYSRYNFEMANTETLHQHF
FT                   IDAERECEAILKAGSTGENSLHKCVFPAYDQCIKASHVFNLMDARGVISVTERQSYILR
FT                   VRNLARQCGEAFLLTDAGGFNFKREGE"
FT   gene            408326..408448
FT                   /locus_tag="BCAN_A0408"
FT   CDS_pept        408326..408448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0408"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61494"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H8"
FT                   /protein_id="ABX61494.1"
FT                   /translation="MKNMPDLLLELFSEEIPALPSARSEARTDKLNNVHAEGVR"
FT   gene            408448..410781
FT                   /gene="glyS"
FT                   /locus_tag="BCAN_A0409"
FT   CDS_pept        408448..410781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BCAN_A0409"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /note="GO_component: GO:0009345 - glycine-tRNA ligase
FT                   complex; GO_function: GO:0004820 - glycine-tRNA ligase
FT                   activity; GO_process: GO:0006426 - glycyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61495"
FT                   /db_xref="GOA:A9M8H9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8H9"
FT                   /protein_id="ABX61495.1"
FT                   /translation="MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAATA
FT                   YWTPRRLALDIRGLTVRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSDPK
FT                   KGDFYVAHLTKPGRAAEDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQSIL
FT                   CTFGPETEETKVIDFDVDGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFVVLDA
FT                   ERRKEIISQDAHNLAFASGLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIR
FT                   LTIRANQKCFVTRKQGDASRLASPAPQHEEIQALSNEFILVSNVAARDGGTEIAYGNGK
FT                   VVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLDLKKPLDQRMARLDALNVTFHAKL
FT                   GTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKADLQTEVVGEFPELQGAMGRKYA
FT                   LLQGEDKAVAAALEEHYKPQGPSDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKD
FT                   PYALRRAALGVIRPLLSQEWKFPLLPLFRSAFAALQEGQMQRKLREFEAKLAAENSGDV
FT                   DGEQDVDNALANYEKEIRAEAEASCGPVLADLLSFFHDRFKVHLKEEGARYDAIDAVLT
FT                   PEADNLLLVARRLEALIVFINEVDGKNLLAGAKRAANILAAEEKKGTKVADRVDPALLR
FT                   EAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVDIFFDKVLVNDEDGNVRA
FT                   NRLALLDQIRAATGKVADFSKIAG"
FT   gene            410920..411891
FT                   /locus_tag="BCAN_A0410"
FT   CDS_pept        410920..411891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0410"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61496"
FT                   /db_xref="GOA:A9M8I0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I0"
FT                   /protein_id="ABX61496.1"
FT                   /translation="MTETLKFDDGAVLRAVEVLRRGGLVAIPTETVYGLAADAANGEGV
FT                   AGIFAAKGRPQFNPLIAHVDGIAMAGRYVAFDPVSRRLAEAFWPGPLTIVLPLKERQDT
FT                   ERPIHPLVTAGLSTLAVRMPHGRVRDVITALDSPVAAPSANTSGRISPTSAAAVAGDLG
FT                   GRIDLILDAGPCGVGVESTIVKVDGDQVHLLRPGGLAAEEIEAFLGQKLRRAEHAAAIQ
FT                   APGMMESHYAPDASMRLAVSDVKPGEALLAFGPHRVAESNRAAAVLNLSATGDLREAAA
FT                   NLFDFMRRLDATGAATIAVEPIPLDGLGEAINDRLKRAAAPR"
FT   gene            411917..413329
FT                   /locus_tag="BCAN_A0411"
FT   CDS_pept        411917..413329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61497"
FT                   /db_xref="GOA:A9M8I1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I1"
FT                   /protein_id="ABX61497.1"
FT                   /translation="MPDTALIERFAAIVGEKNALTAPEDIAAYLIEQRDLYHGRTPLVL
FT                   RPGSTEEVAAIMKLATETRTPVVPQGGNTGLVGGQQPDESGAAIILSLGRMNRIRNLDT
FT                   VGNLVTLEAGVILKNLQDAAEKAGRLFPLSLGAEGSCQIGGNLGSNAGGTAVLAYGNMR
FT                   ELCLGLEVVLPTGEILNDLRYVKKDNTGYDLKDIFVGSEGTLGVITAAVLKIFPQPKGK
FT                   GVAYAGLRSPEDVLRLFQLATEHAGPSLTGFELMPRVGVEFTVRHVDGVRDPLESPHDW
FT                   YVLIDISSSRSEEDARTTLETILTEAFENDLIQDAAIAESVAQAQSFWKMREEMSWAQK
FT                   PEGGSIKHDISVPVASIPAFIHEANAATLDMIPGARVVCFGHIGDGNLHYNVSQPVGAD
FT                   KEAFLARWHDLNHRIHTIVASYGGSISAEHGIGQLKREELVFFKQDIALDLMRRIKAAF
FT                   DPAGIMNPGKVL"
FT   gene            complement(413367..413684)
FT                   /locus_tag="BCAN_A0412"
FT   CDS_pept        complement(413367..413684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0412"
FT                   /product="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61498"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I2"
FT                   /protein_id="ABX61498.1"
FT                   /translation="MKVIVSPAARDYIKSEIAYLKLRSPSAAVQLSEDLKRLKRDLGRF
FT                   SQMGHFTEELPVPGIRRFVMGAYLIDYEIRADAILIFAIRHGRERPPILPPDEDFDFEQ
FT                   S"
FT   gene            complement(413681..413941)
FT                   /locus_tag="BCAN_A0413"
FT   CDS_pept        complement(413681..413941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0413"
FT                   /product="CopG-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61499"
FT                   /db_xref="GOA:A9M8I3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I3"
FT                   /protein_id="ABX61499.1"
FT                   /translation="MKNQHLSDPITMRIPRDLLAEIEEIASLTERSRSWVIVRAMKAYL
FT                   AAEGREIRDIAKARCAIENGEGIDLDTVIEEAEAIIKGAAT"
FT   gene            complement(414050..414262)
FT                   /locus_tag="BCAN_A0414"
FT   CDS_pept        complement(414050..414262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0414"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61500"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I4"
FT                   /protein_id="ABX61500.1"
FT                   /translation="MLIIFDASVSLSLLFREPVIPASLIELLLFVELENRRRSLPAALT
FT                   SWVNFFLPFPLVSRLQPGVRIRKFF"
FT   gene            414252..414818
FT                   /locus_tag="BCAN_A0415"
FT   CDS_pept        414252..414818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0415"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61501"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I5"
FT                   /protein_id="ABX61501.1"
FT                   /translation="MMSKGLKPDWAGRELRLDPFHFPQVVTYASHDGSSDVTFTINERG
FT                   AVIRQVLPSSGLPMSIALPACAFVGVAARAVEDEFGEITVTLELMHEDPLLSVPLLVAH
FT                   DLGDIAADWRAWSAAFNLPMMLVEEDGVARPLYESTGPVRTGQPQARRQGQEPRRRRPR
FT                   FLARRKTGTLGVRLVISGKEIIARH"
FT   gene            complement(414961..415713)
FT                   /locus_tag="BCAN_A0416"
FT   CDS_pept        complement(414961..415713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0416"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61502"
FT                   /db_xref="GOA:A9M8I6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I6"
FT                   /protein_id="ABX61502.1"
FT                   /translation="MSEHILIERKGAVQVIRLNRPEKKNAITRAMYAAMAKALKDGDAD
FT                   DAVRAHVFLGVPGAFSSGNDMQDFMAAATGDTSFGSEILDFLIPLAETKKPIVSGVDGL
FT                   AIGVGTTIHFHCDLTFATPRALFRTPFVDLGLVPEAGSSLLAPLLMGHQKAFALLALGH
FT                   GFTAEAAQKSGIVYQIVDEEALEAEVMKAAEEIAAKPPQAMQIARALMRLPAENIADRI
FT                   TREAKHFAERLTSDEAREAVMAFLSRKK"
FT   gene            complement(415716..417494)
FT                   /locus_tag="BCAN_A0417"
FT   CDS_pept        complement(415716..417494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0417"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61503"
FT                   /db_xref="GOA:A9M8I7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I7"
FT                   /protein_id="ABX61503.1"
FT                   /translation="MYRAPVSEISHTLMKVAGLEKALEENRFPEFSADLAAAILEEAGK
FT                   FAADRIEPLRITGDKNGATVKDGVVTTAPGWKELYRNWIAGGWNSLTGTPEYGGQGLPT
FT                   MMSVAVSEMWNSGTLAFAIAPTLTMGAVEALEKHASRELKDIYLEKLISGEWMGTMNLT
FT                   EPQAGSDLGALRTRAERRDDGTYRIFGQKIFITYGEHDLTDNIVHLVLARLPDAPAGTK
FT                   GISLFLVPKFLVNEDGSLGRRNDLFCSGLEHKMGIHASPTCTMIYGDGFVKGEEQGAVG
FT                   YLIGEENRGLACMFTMMNNARLLVGIQGVGVAEAAYQQALAYAKERKQGRALGADPKQG
FT                   MSPIIEHPDVQRMLLTMKALTQVARSITYACAHAIDMSHVTDGADAQFWSDRAGLLTPL
FT                   AKSFATDAGVDVSSLGIQIHGGMGFIEETGAAQLLRDARITPIYEGTNGIQAIDLVMRK
FT                   LPLQKGDHIKGFLAELQGDADKATASNRAELGETGARLSKAISEAREATDWLQKATAEG
FT                   RAEEALSGATPYQRLLSLTAGGAYLARAALAGDDAARAALCRFFAENMLAEVSSLKDTV
FT                   ITGAASLTAAKSALEA"
FT   gene            417812..418957
FT                   /locus_tag="BCAN_A0418"
FT   CDS_pept        417812..418957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0418"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /note="GO_function: GO:0009975 - cyclase activity;
FT                   GO_process: GO:0009966 - regulation of signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61504"
FT                   /db_xref="GOA:A9M8I8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I8"
FT                   /protein_id="ABX61504.1"
FT                   /translation="MTLVPFFLTVNLTVASLFVLTFAFVSMQERGHRAPRWFTLAFLCS
FT                   MAMPLFGFGLPTTENPRIIILGSFAAIMAALTLLVIGLCETYRQRIEWRLLGFLFIAAL
FT                   ACNALVFELPRTSLLHRFLYQLPLCLIELVTIRVIYRSGMPRLVDKLLMALAVLSVVHF
FT                   FSKAFLIVWPGMDARPEDQSDTGQAIFSLSMGVFVQVSTGLLLLLRTMLRILGDASEQS
FT                   EIDALSQIYNRRGFDCHVMRRLMRKGPDTPYAIIMSDLDYFKRVNDTYGHDCGDRVIEA
FT                   FGGLLRTHLPKPAVAARMGGEEFVVFMPGADAVAAHDLAQTLRTTMTALSFSGDAAEWM
FT                   PTASFGVAEHRVGEGLYDTIRYAVPMARFTKPRRLDATASM"
FT   gene            complement(418975..420258)
FT                   /gene="purD"
FT                   /locus_tag="BCAN_A0419"
FT   CDS_pept        complement(418975..420258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BCAN_A0419"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="GO_function: GO:0004637 -
FT                   phosphoribosylamine-glycine ligase activity; GO_process:
FT                   GO:0006189 - 'de novo' IMP biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61505"
FT                   /db_xref="GOA:A9M8I9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8I9"
FT                   /protein_id="ABX61505.1"
FT                   /translation="MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELAD
FT                   IGVDDHAALIAFAKEKHIDLVVVGPEAPLVTGLADEMRAEGIRVFGPSRAAAQLEGSKG
FT                   FTKDLCARFNIPTGAYGRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEAL
FT                   DAVDSCFEGAFGAAGAEVVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGP
FT                   NTGGMGAYAPAPVMTPEMVARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLI
FT                   EYNTRFGDPECQVLMMRLNSDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPAN
FT                   VKKGSVIRDLEKLESIDGVKLFHAGTALKDGAIVAGGGRVLNITATAATVAQAQARAYE
FT                   ALKLIDWPEGFYRSDIGWRAVEREKANR"
FT   gene            420403..421404
FT                   /gene="ubiA"
FT                   /locus_tag="BCAN_A0420"
FT   CDS_pept        420403..421404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="BCAN_A0420"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="GO_function: GO:0008412 - 4-hydroxybenzoate
FT                   octaprenyltransferase activity; GO_process: GO:0006744 -
FT                   ubiquinone biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61506"
FT                   /db_xref="GOA:A9M8J0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J0"
FT                   /protein_id="ABX61506.1"
FT                   /translation="MQQPQANSDIQSRAARGRVKDAPSGHWVYRVLPQWLWPYAQLARW
FT                   DRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMRGAGCTYN
FT                   DLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVILQALVGLAVVLQFNWFSVALGIFSL
FT                   LIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWTIGYDT
FT                   IYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPALAGLL
FT                   AAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLVFGTLWVAVKPLV"
FT   gene            complement(421444..422055)
FT                   /gene="pdxH"
FT                   /locus_tag="BCAN_A0421"
FT   CDS_pept        complement(421444..422055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="BCAN_A0421"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /note="GO_function: GO:0004733 - pyridoxamine-phosphate
FT                   oxidase activity; GO_process: GO:0008615 - pyridoxine
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61507"
FT                   /db_xref="GOA:A9M8J1"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8J1"
FT                   /protein_id="ABX61507.1"
FT                   /translation="MTNSSDDFTQSAEPFKLFAEWLADAAKSEPNDPNAVALATVDPDG
FT                   LPNVRMVLLKDFDETGFVFYTNYESKKGQEILSAEKAAMCFHWKSLRRQVRVRGPVEKV
FT                   SDAEADAYYASRPRGSRIGAWASKQSRPLESRFALEKAVAEYTAKYAIGDIPRPPYWSG
FT                   FRIRPVSIEFWHDRPFRLHDRVLFTRPTPEGDWNKDRLYP"
FT   gene            422329..422799
FT                   /locus_tag="BCAN_A0422"
FT   CDS_pept        422329..422799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0422"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61508"
FT                   /db_xref="GOA:A9M8J2"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J2"
FT                   /protein_id="ABX61508.1"
FT                   /translation="MAARPARHDRNDRTRIRRTIFTRNAAFAILMLSLGGCAMGGFSIE
FT                   KAVPDASAITGSVQQAEPAETDTGKLSDQSAIKNVVSALNFTQWGKKPVPWANPDTGSQ
FT                   GTITTIAESSTNNKLCRQFETSREAFDGVSIYRGETCMERGGQWTVTAFAPI"
FT   gene            422944..423885
FT                   /gene="dnaJ"
FT                   /locus_tag="BCAN_A0423"
FT   CDS_pept        422944..423885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="BCAN_A0423"
FT                   /product="Chaperone protein dnaJ"
FT                   /note="GO_function: GO:0051082 - unfolded protein binding;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61509"
FT                   /db_xref="GOA:A9M8J3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J3"
FT                   /protein_id="ABX61509.1"
FT                   /translation="MRDPYSVLGVAKTAKPEEIKSAFRKLAKKHHPDQNQDDPKAQERF
FT                   AEVNQAYEIIGDKDKRAQFDRGEIDAEGKPVFQGFAGGQGFGGAHGDPFAGFRQGGGNS
FT                   HFEFRGGPGGFQGGGFGGAEDILNDLFGGAFGGGRSGARQRGPSKGADLSASIDISLSQ
FT                   AVGAEKVEAIFPNGKHLKIKLPKFVEDGQTIRLKGQGEPLMGGTPGDALVTIRFKPHSR
FT                   FRLEGRDVHVDLPVSIDDAVLGGKQEVETLDGRISVKIPAWSSSDRVLRLKEKGLPLKA
FT                   GGRGDLYVHVRIMLPEGGDKELEDFLQKRRVV"
FT   gene            424029..424847
FT                   /gene="fabI"
FT                   /locus_tag="BCAN_A0424"
FT   CDS_pept        424029..424847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="BCAN_A0424"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61510"
FT                   /db_xref="GOA:A9M8J4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J4"
FT                   /protein_id="ABX61510.1"
FT                   /translation="MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQG
FT                   DALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDEL
FT                   TGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMG
FT                   VAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRT
FT                   VTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGMKAVDAPDISVVKD"
FT   gene            424962..425542
FT                   /pseudo
FT                   /gene="gpmA"
FT                   /locus_tag="BCAN_A0425"
FT                   /note="2,3-bisphosphoglycerate-dependent phosphoglycerate
FT                   mutase"
FT   gene            425903..426013
FT                   /locus_tag="BCAN_A0427"
FT   CDS_pept        425903..426013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0427"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61511"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J5"
FT                   /protein_id="ABX61511.1"
FT                   /translation="MERAGLHSLVEGQKVGYEVVADRRSGKSAAANLESL"
FT   gene            complement(426111..426260)
FT                   /locus_tag="BCAN_A0428"
FT   CDS_pept        complement(426111..426260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0428"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61512"
FT                   /db_xref="GOA:A9M8J6"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J6"
FT                   /protein_id="ABX61512.1"
FT                   /translation="MGTLDFRFRRTMSVIAPGTNIITGLCRLFKIVMFHLILLCYGPST
FT                   KQQK"
FT   gene            426483..426695
FT                   /locus_tag="BCAN_A0429"
FT   CDS_pept        426483..426695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0429"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61513"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J7"
FT                   /protein_id="ABX61513.1"
FT                   /translation="MYQDKESGFNKVTLFKPNLSRMEAKSAVTDKTAKAILDTERAAVE
FT                   AKTERLRAARLASEENKPQVASKRK"
FT   gene            426772..427452
FT                   /locus_tag="BCAN_A0430"
FT   CDS_pept        426772..427452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0430"
FT                   /product="protein of unknown function DUF374"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61514"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8J8"
FT                   /protein_id="ABX61514.1"
FT                   /translation="MSLKKIVKSPVAIKFITSVGTAYLRFVWWSSRNTAGRNETNPLAQ
FT                   AGPCIVAMWHGQMFLAAFARPPEKKFVAAVSKSRDGELVAQMLGKLGIRAIRGSGAGQR
FT                   KGNRQGGAAALRQMLYALRNGESIVMAAETNKKVFRCGEGVIALARLSGCPIYPASART
FT                   SFTRTLNSWDRAELPMPFGRRSVVIGEPIFVPRDASDEELEQYRLQVEQVINQAYAAAK
FT                   LACS"
FT   gene            complement(427597..427848)
FT                   /locus_tag="BCAN_A0431"
FT   CDS_pept        complement(427597..427848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0431"
FT                   /product="protein of unknown function DUF1344"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61515"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V1"
FT                   /protein_id="ABX61515.1"
FT                   /translation="MHYLIGLILIIAALFSTVAMAEDAEGKITDINKDSETITLDDGET
FT                   YKLPGEFDIGAINPGMKVLIIYDIVDHTRFITDIQEAP"
FT   gene            428123..429217
FT                   /gene="aroC"
FT                   /locus_tag="BCAN_A0432"
FT   CDS_pept        428123..429217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BCAN_A0432"
FT                   /product="chorismate synthase"
FT                   /note="GO_function: GO:0004107 - chorismate synthase
FT                   activity; GO_process: GO:0009423 - chorismate biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61516"
FT                   /db_xref="GOA:A9M8V2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8V2"
FT                   /protein_id="ABX61516.1"
FT                   /translation="MSHNSFGHLFRVTTWGESHGLALGCVVDGCPPGITFTEAEIQSFL
FT                   DKRKPGQSKYTTQRREPDQVRVLSGVLLGEDGVTMTTTGTPISMMIENTDQRSKDYGEI
FT                   ARQYRPGHADYAYDVKYGIRDYRGGGRSSARETAARVAAGAIARKVVPGLEVRGALVSI
FT                   GAHDIDRSRWNWAEVDNNPFFTPDAGSVEVFADYLDGIRKNGSSVGAIIEIVAEGVPAG
FT                   IGAPIYGKLDQDIASYLMSINAVKGVEIGNGFEAARLTGEENADEMRMGNDGKPIFLSN
FT                   HAGGVLGGIATGAPVVARFAVKPTSSILTPRRSIDKDGNEVDVMTRGRHDPCVGIRAVP
FT                   IGEAMVACAIADHYLRHRGQTGRV"
FT   gene            429353..430468
FT                   /gene="ribB"
FT                   /locus_tag="BCAN_A0433"
FT   CDS_pept        429353..430468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="BCAN_A0433"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="GO_function: GO:0008686 -
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61517"
FT                   /db_xref="GOA:A9M8V3"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V3"
FT                   /protein_id="ABX61517.1"
FT                   /translation="MSYNQKQVVDAIRAFERGEIVVVMDDDGRENEGDLIVAAVHCTPE
FT                   KMAFIVRHTSGIVCTPMTREEAKRLNLTPMVAENESAHTTAFTVTVDYRHGTTTGISAE
FT                   DRTLTVRNLANPNAGASDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLANLPPIGV
FT                   ICELVNDDGTVKRGPDVAAFAEEHKLHRVTVADLIAYRQRKETLVRRIGDAPVETCAGK
FT                   AHAYSYELPWELMRHVAVVFGDIRDGEEVPVRLHREDVLNDVFGKGGSNLDAIMQRMGQ
FT                   EGRGILVYLREGSVGVRSDHRDARAREALQGEHEAHAEAVAREEEWRQIGLGAQILKDL
FT                   GVSSIVLLASRERHYVGLEGFGICITRTEII"
FT   gene            430684..431634
FT                   /locus_tag="BCAN_A0434"
FT   CDS_pept        430684..431634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0434"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61518"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V4"
FT                   /protein_id="ABX61518.1"
FT                   /translation="MTTRLYWHPIYLEHLTPPGHPERPDRIRALMSELEGPDFYRLDRV
FT                   EAPHAGEAAILLAHPEEHLEAVRSKIPEPVEDGEASQPIVKLDGDTYVSPKSMDAALTA
FT                   IGAAMAAVDDVMSGAADNVFVASRPPGHHAERSRAMGFCVFNNIAIAARHAQRHHGLER
FT                   IAIVDWDVHHGNGTQDIFKDDPGVMFCSTHQFPLYPGSGDKHETGVGNIVNAPLSPNTG
FT                   SREFREAFNSRILPALDNFRPDLILISAGFDAHFRDPLAEINLDESDFDWATGKLMERA
FT                   ERFCDHRLVSVLEGGYDLEGLSQSASVHITRLLKG"
FT   gene            431639..431893
FT                   /gene="xseB"
FT                   /locus_tag="BCAN_A0435"
FT   CDS_pept        431639..431893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BCAN_A0435"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="GO_component: GO:0009318 - exodeoxyribonuclease VII
FT                   complex; GO_function: GO:0008855 - exodeoxyribonuclease VII
FT                   activity; GO_process: GO:0006308 - DNA catabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61519"
FT                   /db_xref="GOA:A9M8V5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V5"
FT                   /protein_id="ABX61519.1"
FT                   /translation="MVTEPSNADIAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYER
FT                   GEALKKHCDTLLKSAEDKVEKIRIGRDGQPVGTEPLDPE"
FT   gene            complement(431900..432418)
FT                   /locus_tag="BCAN_A0436"
FT   CDS_pept        complement(431900..432418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0436"
FT                   /product="SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61520"
FT                   /db_xref="GOA:A9M8V6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V6"
FT                   /protein_id="ABX61520.1"
FT                   /translation="MHFVESYLATYGTLALFFIIYSESFGAPLPGESALIASSLLALHG
FT                   TLHIQTVLITVFIASVLGDSTGYLIGRFGGRKLILRYGYLVKLTPERLNQFEKIFAEKG
FT                   IYVVATARFVVLLRQLNGLVAGSMKMNPLHFLAANMVGAAGWTLIWGLGPYLLSGVLAP
FT                   YVAHLKALF"
FT   gene            complement(432660..432920)
FT                   /gene="ymgE"
FT                   /locus_tag="BCAN_A0437"
FT   CDS_pept        complement(432660..432920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymgE"
FT                   /locus_tag="BCAN_A0437"
FT                   /product="transglycosylase-associated protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61521"
FT                   /db_xref="GOA:A9M8V7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V7"
FT                   /protein_id="ABX61521.1"
FT                   /translation="MSVISWIILGLIAGFIGSKIVNKSGQGMFLDIALGVVGAIIGGVI
FT                   FTFFSAQGVTGLNIYSLIVSVIGAVIVLWIYHAVTGKRSIG"
FT   gene            433083..433634
FT                   /locus_tag="BCAN_A0438"
FT   CDS_pept        433083..433634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0438"
FT                   /product="protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61522"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V8"
FT                   /protein_id="ABX61522.1"
FT                   /translation="MGSYDDNSGNSPIPGGSLAKPVMIALGALLIGKLLKGNSDDAPAT
FT                   QAQPVPEQPQAGGGLLGGILGGLGGLLGSAAAGNASAAPAPGPLGGGLGGLLDQLKQSG
FT                   LGDKVDSWVGQGENHPIEPGQLGNAIGQTTLEQIAAHAGIDQQELLNQLSQVLPGLVDK
FT                   LTANGQVPDANTLSKLLQGR"
FT   gene            433838..434710
FT                   /locus_tag="BCAN_A0439"
FT   CDS_pept        433838..434710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0439"
FT                   /product="Pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61523"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8V9"
FT                   /protein_id="ABX61523.1"
FT                   /translation="MDSIETLVIPRTSDIGGLEVRRALPTARRRLVGPFIFFDRMGPAI
FT                   LRDGEALDVRPHPHIGLSTVTYLFDGHIRHRDSLGTEMVIRPGDVNLMTAGRGIVHSER
FT                   SPEEERAGPMPISGVQTWLALPDAMEEIDPAFHHINAPDLPLMDDAAFSGRLIIGSLHG
FT                   LSSPVIQHAETLYADIRIHQGGRFQIPPTTEERAIYTLEGNVGIGGEVFPPDRLLAFRP
FT                   GDDIVVQAGPEGAHIMLFGGAPLGSRRYIWWNFVASSKERIEQAKEEWRTGRFDIVPGD
FT                   EQDFIPLPE"
FT   gene            434853..436784
FT                   /gene="dxs"
FT                   /locus_tag="BCAN_A0440"
FT   CDS_pept        434853..436784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BCAN_A0440"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0008661 - 1-deoxy-D-xylulose-5-phosphate synthase
FT                   activity; GO_process: GO:0009240 - isopentenyl diphosphate
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61524"
FT                   /db_xref="GOA:A9M8W0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8W0"
FT                   /protein_id="ABX61524.1"
FT                   /translation="MSRPSTPLLDKAPTPDRLRALPEQDLPQLAEELRTELIDAVSTTG
FT                   GHLGAGLGVVELTVALHHVFNTPYDRIIWDVGHQAYPHKILTGRRDRIRTLRQAGGLSG
FT                   FTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKRNVIAVIGDGSMSAGMAYEAMN
FT                   NAGALDARLIVILNDNDMSIAPPTGAMSAYLARLVSGRTYRSVREAAKQVAQKLPKFLQ
FT                   DKARKSEEYARAFFTGGTLFEELGFYYVGPIDGHNLDHLLPVLKNVRDTQKGPVLIHVV
FT                   TQKGKGYAPAEAAADKYHGVNKFDVITGKQAKPPANVPSYTKIFGTSLIEEARHDDKIV
FT                   AVTAAMPTGTGLDLFGEAFPKRVFDVGIAEQHAVTFAAGLASEGYKPFCAIYSTFLQRG
FT                   YDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDTGFLAALPGFVVMAASDEAELR
FT                   HMVRTAAEYDEGPISFRYPRGDGVGVDLPERGSVLEIGKGRIVREGTKVALLSFGTRLQ
FT                   ECLAAAEELGAAGLSTTVADARFAKPLDHDLIRRLAREHEVLVMVEEGAVGGFGSHVLQ
FT                   FLATDGLLDRGLKVRALTLPDIYQDHGKPDAMYAEAGLDRTGIVRTVFAALHRDELGHE
FT                   ALPTPFRA"
FT   gene            436790..437551
FT                   /locus_tag="BCAN_A0441"
FT   CDS_pept        436790..437551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0441"
FT                   /product="hemolysin A"
FT                   /note="GO_function: GO:0050827 - toxin receptor binding;
FT                   GO_process: GO:0019836 - hemolysis by symbiont of host red
FT                   blood cells"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61525"
FT                   /db_xref="GOA:A9M8W1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W1"
FT                   /protein_id="ABX61525.1"
FT                   /translation="MNGQSTDNRPRLDQLLVERGFFATRSRARDAIQRGTVKVDGRPIT
FT                   KPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVL
FT                   LERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFI
FT                   SLRLALPPALALAEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLET
FT                   QPGWRALGLCPSPIEGGDGNREYLLAGKKDR"
FT   gene            437548..438795
FT                   /gene="rumA"
FT                   /locus_tag="BCAN_A0442"
FT   CDS_pept        437548..438795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="BCAN_A0442"
FT                   /product="23S ribosomal RNA (uracil-5-)-methyltransferase
FT                   rumA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61526"
FT                   /db_xref="GOA:A9M8W2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W2"
FT                   /protein_id="ABX61526.1"
FT                   /translation="MTSSKTGQITIRSIGAGGDGVANLPDGQIYVPFTLPGEVVNVARD
FT                   KNRATLMALLEASPERQNPACRHFEDCGGCALQHWQDEPYRLWKRELVVGALKGRGIDV
FT                   EVAPLVACNPHTRRRAVFAARKTEKGVLLGFNRHQSHEIIDIVECPVTVPEIIARLDDL
FT                   REVGALLAPGSGPFKLAATLTESGLDLAASGCGKLNDEQRRALTALVIKKDFARLSHEG
FT                   EIIVEPKKPLIHFGKVPVPVPPGCFLQATAEAEETMAALVLAHLGKARRVADLFCGVGT
FT                   FALRIAEKSAVHAVENDAAALAALDRGVRHVQGLKPVSIERRDLFRRPLMPKELLPYNA
FT                   VVFDPPRAGAEEQALELAKSKVEKVVAISCNPVTLARDLAILQKGGYRIERVTPIDQFL
FT                   WSAHVEAVAVLTKGRQ"
FT   gene            complement(438939..439541)
FT                   /locus_tag="BCAN_A0443"
FT   CDS_pept        complement(438939..439541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61527"
FT                   /db_xref="GOA:A9M8W3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W3"
FT                   /protein_id="ABX61527.1"
FT                   /translation="MSEIRSICVYCGSSTGQNPLYREAGLALGRSIAEHDIRLVYGGGT
FT                   RGIMGAVAQGVMEAGGEVTGIIPTFLLDKEASLERAKELSELIIVDDMHERKHLMFQRS
FT                   DAFVTLPGGIGTVEEIVEMMTWAQLGKHRKPMVFANINNFWQPMLALLDHMRAEGFIHT
FT                   AHQVQPLIVDKAEDIVPAIIAANGRRKAGDLEIIGKM"
FT   gene            439671..440036
FT                   /locus_tag="BCAN_A0444"
FT   CDS_pept        439671..440036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0444"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61528"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W4"
FT                   /protein_id="ABX61528.1"
FT                   /translation="MKMWTLAKMSVAAAALSFAASAASASEITIKLPDSVKVSTNSILY
FT                   KCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTASLY
FT                   NLIDNPEEDKPISCVEQ"
FT   gene            440223..441437
FT                   /locus_tag="BCAN_A0445"
FT   CDS_pept        440223..441437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0445"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="GO_process: GO:0016998 - cell wall catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61529"
FT                   /db_xref="GOA:A9M8W5"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W5"
FT                   /protein_id="ABX61529.1"
FT                   /translation="MQKYWSWLLGVGLVVIAGGLAFYWNSLTRTADAPKVDNASIASPV
FT                   TPGPAKEKPAQAQQTPATAMPATAKAVDVPVFDVLRVEADGSVVIAGQAAPNSAVDVVA
FT                   GAEVVGQARAGANGDFAVVLDRALSPGDHQLVLRATSSDKHVATSAQTAIVSVPATADG
FT                   PVLALVEEPEQASRLITKPKTAPEGSAAGAPSGGEMQAGAAGETEQAKPDADRPIAIEA
FT                   VEIEGSSVFVAGKAKDGARVIVHANDVLLGTSAISPEGRFLVQGERPLAIGDYIIRADL
FT                   LDGTNRILATARVPFRREAGENILAVAPAANQQAGSANTQADGAQDTAALQKVDGSVII
FT                   RRGDNLWTISKRTYGQGTRYTTIYLANRDQIRNPDLIWPGQVFVMPKEPLRDNEVKRKL
FT                   LEKNP"
FT   gene            441640..443526
FT                   /locus_tag="BCAN_A0446"
FT   CDS_pept        441640..443526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0446"
FT                   /product="Heavy metal tolerance protein precursor"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61530"
FT                   /db_xref="GOA:A9M8W6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W6"
FT                   /protein_id="ABX61530.1"
FT                   /translation="MNAPKTVSAESGETLKTLRNLWPYMWPSDRPDLRMRVVWATFYLV
FT                   LSKIVLILVPYFFKWVTNALNGQLHAPDYIPVVLVGAVMLVLAYNAAKIVQAGLNQLRD
FT                   ALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTGGLSRVIERGTKGIETIVRFTILN
FT                   TLPTILEFALTAVIFAFAYGLSYLVVVAATVWLYTWFTIRASDWRINIRREMNDSDTDA
FT                   NTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAVIFGAG
FT                   MAIVMVMSAMEVQKGTQSLGDFVFINALLMQLSIPLNFIGFIYREIRQGLTDIEQMFDL
FT                   LDVKQEVKDKPGAPALKVDSGAISFKDVHFAYDPQRPILRGISFDVPAGKTVAIVGPSG
FT                   AGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMVPQDTVLFNDTIAYNIR
FT                   YGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGERGLKLSGGEKQRVAIARTILKA
FT                   PPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIGADEIIVLKDGLIA
FT                   ERGTHRHLLDQKGLYASMWDRQREASEAEERLRQVRESDDMGVVLRGTPAAE"
FT   gene            443631..444329
FT                   /locus_tag="BCAN_A0447"
FT   CDS_pept        443631..444329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0447"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61531"
FT                   /db_xref="GOA:A9M8W7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8W7"
FT                   /protein_id="ABX61531.1"
FT                   /translation="MSLTDTIRNTFVPIHREGYPFIAGFFVVSLILGWLWDPLFWIGMV
FT                   LTVWCIYFYRDPERVTPMDDDLVISPADGKVSFVGLAVPPAELDLGYEPMTRVSVFMNV
FT                   FSVHINRSPVRGKIDKVVHRPGKFLNAELDKASTENERNSVLIESPHGKVGVVQIAGLV
FT                   ARRIVCWSNQDDELSVGERFGLIRFGSRVDVYLPSDATVRVAVGQTAIAGETVLADYGT
FT                   ERGEPVVRIA"
FT   gene            444334..445170
FT                   /gene="pssA"
FT                   /locus_tag="BCAN_A0448"
FT   CDS_pept        444334..445170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BCAN_A0448"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="GO_function: GO:0003882 - CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase activity; GO_process: GO:0008654
FT                   - phospholipid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61532"
FT                   /db_xref="GOA:A9M8W8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W8"
FT                   /protein_id="ABX61532.1"
FT                   /translation="METPFPPFEPNGRVDASRGPKLSQIPLRIVVPNVITVLAICAGLT
FT                   GIRLAFENRFELAVAMVLLAAFLDGIDGRIARMIKGSSKFGAQMDSLADIVNFGVAPAL
FT                   VLYAFMLDQARSFGWIAALLYAIACCLRLARFNVMLEDPNRPAWQNNYFIGVPAPAGAM
FT                   LVLLPVYLGFLGLMPTRALAFGVAAYTVAIAFLLVSRLPVYNGKSAGSLVRRDIVMPLI
FT                   LCVVIYVALLMSFTWQTLSLTALAYLAFLPFSLAAWNKREAADRKKAAEEASSGDN"
FT   gene            complement(445255..445995)
FT                   /locus_tag="BCAN_A0449"
FT   CDS_pept        complement(445255..445995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0449"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61533"
FT                   /db_xref="GOA:A9M8W9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8W9"
FT                   /protein_id="ABX61533.1"
FT                   /translation="MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLE
FT                   ELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHV
FT                   EAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAA
FT                   VEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLAD
FT                   PKLEVTGKLFDVRQDRFLDYHMPS"
FT   gene            complement(446064..447521)
FT                   /gene="purF"
FT                   /locus_tag="BCAN_A0450"
FT   CDS_pept        complement(446064..447521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BCAN_A0450"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="GO_function: GO:0004044 -
FT                   amidophosphoribosyltransferase activity; GO_process:
FT                   GO:0009152 - purine ribonucleotide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61534"
FT                   /db_xref="GOA:A9M8X0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X0"
FT                   /protein_id="ABX61534.1"
FT                   /translation="MLDDDTLHEECGVFGILGHEDAAALTALGLHALQHRGQEAAGIVS
FT                   YHNRRFHSERHMGLVGDHFTDAATLNRLPGNRAIGHVRYSTTGETILRNVQPLFAELEV
FT                   GGIAIAHNGNFTNGITLRKQLIASGAIFQATSDTEVVLHMIARSRHSSSTDRFVEAIRQ
FT                   VEGGYAMLALTRTKLIAARDPIGIRPLVMGELDGKPIFCSETCALDIIGAKYIRDVENG
FT                   EVVVCEIQKDGSITTRSIKPENPQPERLCLFEYVYFARPDSVVGGRSVYVARKNMGMNL
FT                   AAEAGVDADVVVPVPDGGTPAALGFAQASGIPFEYGIIRNHYVGRTFIEPTQQIRALGV
FT                   KLKHSANRAMIEGKRVVLVDDSIVRGTTSVKIVQMIRDAGATEVHMRVASPMIFHPDFY
FT                   GIDTPHADKLLANQHESLESMCRYIGADSLAFLSIDGLYKAVGGKPRDPKAPTFTDHYF
FT                   TGEYPTRLLDQEGESNVHTLSLLASNG"
FT   gene            447543..447740
FT                   /locus_tag="BCAN_A0451"
FT   CDS_pept        447543..447740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0451"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61535"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X1"
FT                   /protein_id="ABX61535.1"
FT                   /translation="MAGHCRKAFRLQRQLKHIAEKRRPVFRSTTCIKTSSASLSQDGFL
FT                   LKAKSSPLRRYNLIDGSIAC"
FT   gene            complement(447836..448414)
FT                   /locus_tag="BCAN_A0452"
FT   CDS_pept        complement(447836..448414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0452"
FT                   /product="Colicin V production protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_process:
FT                   GO:0009403 - toxin biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61536"
FT                   /db_xref="GOA:A9M8X2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X2"
FT                   /protein_id="ABX61536.1"
FT                   /translation="MPITMLDGILLGITLVSAVLAMVRGFSREVLSLVSWAAAAAAAVL
FT                   LYKPVLPYVKPYISNDTIAMIAAMAAVFLVVLIVVSLITMKIADFIIDSRIGALDRTLG
FT                   FLFGAARGVLLVVVAMLFFNWLVPTNQPDWVTNAKSKPMLDSFGQQLIELLPADPDKSL
FT                   IEKLKPKVDAPAAGEPEEAPVPDDTPAQE"
FT   gene            complement(448540..449943)
FT                   /gene="radA"
FT                   /locus_tag="BCAN_A0453"
FT   CDS_pept        complement(448540..449943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BCAN_A0453"
FT                   /product="DNA repair protein RadA"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61537"
FT                   /db_xref="GOA:A9M8X3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X3"
FT                   /protein_id="ABX61537.1"
FT                   /translation="MAKTRVQFICQNCGAVHSRWAGKCDSCGEWNTLIEEGTNSGIGSG
FT                   PGAMLSKRKGRTVALTSLSGEIEDAPRIISGISELDRVTGGGFVRGSALLIGGDPGIGK
FT                   STLLTQAAAALSNRGHRIVYVSGEEAVAQIRLRAQRLGVAASAVELAAETNVEDIIATI
FT                   SSDNSGSKRPDLVIIDSIQTLWTDMADSAPGTVTQVRSSAQAMIRYAKQTGAAVVLVGH
FT                   VTKDGQIAGPRVVEHMVDGVLYFEGEGGHHYRILRTVKNRFGPTDEIGVFEMSDGGLRE
FT                   VSNPSELFLGERNEKSPGAAVFAGMEGTRPVLVEIQALVAPSSLGTPRRAVVGWDGGRL
FT                   AMILAVLESHCGVRFGQHDVYLNVAGGYRISEPAADIAVAAALVSSMAGIALPPDCVYF
FT                   GEISLSGAVRAVSHAVQRLKEAEKLGFRQAEVPNGSGELWKDRNFRLMETAALADLVAR
FT                   IAASGAGKK"
FT   gene            complement(449971..451476)
FT                   /gene="dnaB"
FT                   /locus_tag="BCAN_A0454"
FT   CDS_pept        complement(449971..451476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BCAN_A0454"
FT                   /product="replicative DNA helicase"
FT                   /note="GO_function: GO:0004003 - ATP-dependent DNA helicase
FT                   activity; GO_process: GO:0006260 - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61538"
FT                   /db_xref="GOA:A9M8X4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X4"
FT                   /protein_id="ABX61538.1"
FT                   /translation="MAEAAVRKLDDARDQKDVRYREAPHNIEAEQALLGAILINNDAFY
FT                   RVSDFLKPTHFLEPLHRRIYEIATDLIRVGKMANPVTMKTFLPTEGKVGDLSIFQYVTR
FT                   LATEAVTIINAEDYGRAIYDLATRRALIGIGEDMVNIAYDAPVDMAPQEQIEDAERRLF
FT                   ELAETGRYDGGFLPFKDAVTTAVDMANAAFMRDGHLSGISTGIHALDSKMGGLQPSDLI
FT                   ILAGRPGMGKTSLATNIAFNIANAYEPDQQADGTIKAANGGVVGFFSLEMSAEQLATRI
FT                   ISEQTEVSSSKIRRGEITETDFEKLVACSQVMQKIPLYIDQTGGISIAQLAARARRLKR
FT                   QRGLDVLVIDYVQLMTGSSKASAQNRVQEITEITTGLKALAKELNVPIIALSQLSRQVE
FT                   SRDDKRPQLSDLRESGSIEQDADVVLFVFREEYYVKNLEPRDEFDPKYEEWKQHFEKVR
FT                   GTADVIIAKQRHGPTGTVKLAFQSEFTRFADLADGSYLPEQYE"
FT   gene            complement(451675..452953)
FT                   /pseudo
FT                   /locus_tag="BCAN_A0455"
FT                   /note="Cyclopropane-fatty-acyl-phospholipid synthase"
FT   gene            complement(453327..453896)
FT                   /gene="rplI"
FT                   /locus_tag="BCAN_A0457"
FT   CDS_pept        complement(453327..453896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BCAN_A0457"
FT                   /product="ribosomal protein L9"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - translation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61539"
FT                   /db_xref="GOA:A9M8X5"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8X5"
FT                   /protein_id="ABX61539.1"
FT                   /translation="MEVILLERIGRLGQMGDTVKVKDGYARNFLLPQGKALRANEANKK
FT                   KFEGQRAQLEAQNLERKNEAQAVADKLNGESFIVVRSAGETGQLYGSVSTRDIAEIITA
FT                   DGFTLHRNQVELNHPIKTIGLHEVSVSLHPEVQVKVMVNIARSTEEAERQAKGEDLTSI
FT                   EAIYGIEEQPLSEEVFDDEDEAEDQA"
FT   gene            complement(453926..454897)
FT                   /locus_tag="BCAN_A0458"
FT   CDS_pept        complement(453926..454897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0458"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61540"
FT                   /db_xref="GOA:A9M8X6"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X6"
FT                   /protein_id="ABX61540.1"
FT                   /translation="MKFNGTIIGIGIMAGLASALMSAGVIVQPGLMAGLAMVFYFITPL
FT                   PIFAAALGWGSSAGIVAALAATGAVGIFAAPMAALLMALTSFIPAATGAYLSGLTRPAE
FT                   ELGGPKGVLVWYPLSDITFRLAMMVALSFVIIGAIVGFGPEMARELANTLIDGVAEADQ
FT                   QFTASDETRDSVTMLLMVALPAIQPATCLAILIGNLYLALRLTALSGRLRRPRDDWPAT
FT                   MRMPRPALLVFAIALAAAFLPGDIGLIATVVAGTLSTGFMMAGLAIMHHRTRGKLWRLV
FT                   ALWLVYVAILLFAFLLFVFMVLGLFDTSRGAPISKIPGADNQ"
FT   gene            complement(455048..455296)
FT                   /gene="rpsR"
FT                   /locus_tag="BCAN_A0459"
FT   CDS_pept        complement(455048..455296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BCAN_A0459"
FT                   /product="ribosomal protein S18"
FT                   /note="GO_component: GO:0000314 - organellar small
FT                   ribosomal subunit; GO_function: GO:0003735 - structural
FT                   constituent of ribosome; GO_process: GO:0006412 -
FT                   translation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61541"
FT                   /db_xref="GOA:A9M8X7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8X7"
FT                   /protein_id="ABX61541.1"
FT                   /translation="MVDINQIPTRRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISER
FT                   GKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYVVK"
FT   gene            complement(455299..455745)
FT                   /gene="rpsF"
FT                   /locus_tag="BCAN_A0460"
FT   CDS_pept        complement(455299..455745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BCAN_A0460"
FT                   /product="ribosomal protein S6"
FT                   /note="GO_component: GO:0030873 - cytosolic small ribosomal
FT                   subunit (sensu Archaea); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - translation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61542"
FT                   /db_xref="GOA:A9M8X8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8X8"
FT                   /protein_id="ABX61542.1"
FT                   /translation="MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGL
FT                   RPLTYRIKKNRKAYYTLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML
FT                   TRRDDRRERDGDDRPRRREGGFDRGDRGDRGPRRPRDTEAGEGA"
FT   gene            complement(455770..456129)
FT                   /locus_tag="BCAN_A0461"
FT   CDS_pept        complement(455770..456129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0461"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61543"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8X9"
FT                   /protein_id="ABX61543.1"
FT                   /translation="MEPIVLSFSLDRAPCNELIILRGVPHRVPQSQVFPGFSAHISLQS
FT                   RGKTRNDRPFIARRQLGAERRAVTRHCSSMRYHVEVTSASASRVSALDRLIERPFFSGF
FT                   PAKEKSQRLSRWRQA"
FT   gene            456151..457095
FT                   /gene="fabD"
FT                   /locus_tag="BCAN_A0462"
FT   CDS_pept        456151..457095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="BCAN_A0462"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="GO_function: GO:0004314 - [acyl-carrier-protein]
FT                   S-malonyltransferase activity; GO_process: GO:0006633 -
FT                   fatty acid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61544"
FT                   /db_xref="GOA:A9M8Y0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y0"
FT                   /protein_id="ABX61544.1"
FT                   /translation="MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSA
FT                   TMFEGPEDVLTLTANAQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAA
FT                   GTFSLADTARLLRIRGNAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIAND
FT                   NGGGQLVISGARAAVELAAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREALAAVE
FT                   KHDPVVPLIANVRAAPVTDANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGK
FT                   VLTGLARRISKDVSGAAVGSAEEIEAALAALNA"
FT   gene            457165..457902
FT                   /gene="fabG"
FT                   /locus_tag="BCAN_A0463"
FT   CDS_pept        457165..457902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BCAN_A0463"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="GO_function: GO:0004316 -
FT                   3-oxoacyl-[acyl-carrier-protein] reductase activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61545"
FT                   /db_xref="GOA:A9M8Y1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y1"
FT                   /protein_id="ABX61545.1"
FT                   /translation="MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKE
FT                   LAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDW
FT                   DAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFS
FT                   KSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVY
FT                   LASDEAAYVTGQTLHVNGGMAMI"
FT   gene            458176..458412
FT                   /gene="acpP"
FT                   /locus_tag="BCAN_A0464"
FT   CDS_pept        458176..458412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="BCAN_A0464"
FT                   /product="acyl carrier protein"
FT                   /note="GO_function: GO:0000036 - acyl carrier activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61546"
FT                   /db_xref="GOA:A9M8Y2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8Y2"
FT                   /protein_id="ABX61546.1"
FT                   /translation="MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVM
FT                   AFEEEFGVEIPDDAAETILTVGDAVKFIDKASA"
FT   gene            458416..458679
FT                   /locus_tag="BCAN_A0465"
FT   CDS_pept        458416..458679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0465"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61547"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y3"
FT                   /protein_id="ABX61547.1"
FT                   /translation="MPQGLGFIQIPALFASCCRQGREAPCLAGGSLIENSATAVLRPIC
FT                   SSAANRAHRIQGAYGIWRIDVCTGLIDCGIVPESRAGTLDGQ"
FT   gene            458736..459998
FT                   /locus_tag="BCAN_A0466"
FT   CDS_pept        458736..459998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0466"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61548"
FT                   /db_xref="GOA:A9M8Y4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y4"
FT                   /protein_id="ABX61548.1"
FT                   /translation="MRRVVITGLGLVSPLASGVEETWKRLLAGESGARRVTEFEVDDLA
FT                   CQIACRIPVGDGTNGTFNPDLHMDPKEQRKVDPFIVYAVGAADQALDDAGWHPENDEDQ
FT                   VRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLRGPN
FT                   HSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTKRNDD
FT                   PTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPT
FT                   ESGEGAQRCMVAALKRAGIVPDEIDYINAHGTSTMADTIELGAVERVVGEAAAKISMSS
FT                   TKSSIGHLLGAAGAAEAIFSTLAIRDNIAPATLNLDNPAAQTRIDLVPHKPRERKIDVA
FT                   LSNSFGFGGTNASLVLRRYTA"
FT   gene            460223..461461
FT                   /locus_tag="BCAN_A0467"
FT   CDS_pept        460223..461461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61549"
FT                   /db_xref="GOA:A9M8Y5"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y5"
FT                   /protein_id="ABX61549.1"
FT                   /translation="MNSEEKPGTNPAEQQSVSEPQNEAVPTAPEKAAEPKPFVPKSASE
FT                   ALRPEPGTPPPRNRSRHARSQIVVFMNFMLSLVVLVLLGASALFYFGKLQFDAQGPLTA
FT                   ETTFLVKRGAGIAEVSNGLESRDIVSDARIFRYGMRTLGHENDLKAGEYAIPVGASMRD
FT                   VMNILISGKSIMYPFTVPEGLTVKQVFDRIAADPILIGDMPKEMPPEGSLFTDTLNFTR
FT                   GTTRSEIIDRMIASQKKLVDDLWAKRRPDLPVRDKNEFVTLASIVEKETGIASERPHVA
FT                   SVFVNRLNKGMRLQSDPTIIYGLFGGAGKPSDRPIFKSDIEKPTPYNTYIINGLPPTPI
FT                   ANPGKAALAAVANPLQTDDLYFVADGTGGHVFSATLKGHNDNVRKWRAAEQQKNIGQQK
FT                   DTSGGSGKPDTGQ"
FT   gene            461646..462545
FT                   /locus_tag="BCAN_A0468"
FT   CDS_pept        461646..462545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61550"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y6"
FT                   /protein_id="ABX61550.1"
FT                   /translation="MALQSMTGFARHAAQHGMADGEARIAWEVRSVNGKGLDLRLRLPQ
FT                   GLESVEHPVRSLLARHFSRGNFQASLTVERSETQAGFAINQPMLAEVLKLGAELQEKYG
FT                   LAPASVDGILALRGIIDQSQRAEDEEERAALEATIVAAFEGALKAIAEARRQEGKALFT
FT                   ILSTHLDTIERLTADARNDPSRATEAIKARLAGQVALLLDATRELDETRLYQEAAFLAT
FT                   KADIQEELDRLETHVASARKLLGEGGPVGRKLDFLSQEFNREANTLCSKSNAASITAIG
FT                   LGLKAVVDQFREQVQNLE"
FT   gene            462554..463216
FT                   /gene="gmk"
FT                   /locus_tag="BCAN_A0469"
FT   CDS_pept        462554..463216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="BCAN_A0469"
FT                   /product="Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61551"
FT                   /db_xref="GOA:A9M8Y7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y7"
FT                   /protein_id="ABX61551.1"
FT                   /translation="MAISSVENGVARRGLMVVISSPSGAGKSTIARLLLEDPKMKLSLS
FT                   ISVTTRQRRPSEIDGVHYHFITIREFERLRDNDELIEWAEVHGNFYGTLRETAEIALAD
FT                   GQDMLFDIDWQGADQLQAKMPADVVSIFILPPTMRELQQRLNRRAEDTAEVIETRLQNA
FT                   RFEIQKWVKYDYIVINEDLDRSYAAIKSIINAERLRRDRRPGLFDFVTGLLEEDPGM"
FT   gene            complement(463243..464655)
FT                   /gene="tldD"
FT                   /locus_tag="BCAN_A0470"
FT   CDS_pept        complement(463243..464655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="BCAN_A0470"
FT                   /product="TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61552"
FT                   /db_xref="GOA:A9M8Y8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y8"
FT                   /protein_id="ABX61552.1"
FT                   /translation="MKSLIDSFDTGRDHIERLVAESLKGSDDGELFLEYREAEALVFDN
FT                   GRLKTGSFNQDQGFGLRSVAGEAIGYAHAGDLSLAALKRASDAVSATLKGYGGTYSPAP
FT                   AGTNRHLYTDENPIGAPGFDAKVQLLQQIDAYLRAKDTKVRQVSVSLACSWQQVEILRA
FT                   DGHFVRDIRPMARLSVSVVAGSGDRQESGSYTLGGRKGFGEFITTESWQHAADEALRQA
FT                   LVNLEAIPAPAGTFDIVLANGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGQQVAATG
FT                   VTVVDDGTIAERRGSLTIDDEGTPTNRTVLIEDGKLVNYMQNRQNARLMGMEATGNGRR
FT                   ESYAHAPMPRMTNTYMLSGDKTPEEIIASIRKGIYAVSFGGGQVDITSGKFVFGCTEAY
FT                   MIEDGKVGAPIKGAMLIGNGPDAMKRISMIGNDMKLDTGSGNCGKGGQWVPVGVGQPHL
FT                   RMDQITVGGTAV"
FT   gene            complement(464797..465423)
FT                   /locus_tag="BCAN_A0471"
FT   CDS_pept        complement(464797..465423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0471"
FT                   /product="Invasion associated locus B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61553"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Y9"
FT                   /protein_id="ABX61553.1"
FT                   /translation="MVFRMFAHRTMIQRLAALAAGAGLSLAAATLPSAAQNNTPGTPGQ
FT                   LPAPQQTPAEPQPTTSATPQQSGALKSQHGAWSILCDTPAGAKTEQCALIQNVVAAKRP
FT                   ELGLSVVVLKTADNKARILRVLAPLGVLLPNGLGLNVDGKDIGRAYFVRCFEDGCYAEV
FT                   ILEDDLLKTLRNGKAATFIVFQTPEEGVGIPVDLKGFGEGFDALP"
FT   gene            complement(465621..465713)
FT                   /locus_tag="BCAN_A0472"
FT   CDS_pept        complement(465621..465713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0472"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61554"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z0"
FT                   /protein_id="ABX61554.1"
FT                   /translation="MFLCGIFARGIAPTGPSPAIAGFATRRGSL"
FT   gene            465857..466711
FT                   /gene="coxB"
FT                   /locus_tag="BCAN_A0473"
FT   CDS_pept        465857..466711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="BCAN_A0473"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="GO_function: GO:0004129 - cytochrome-c oxidase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61555"
FT                   /db_xref="GOA:A9M8Z1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z1"
FT                   /protein_id="ABX61555.1"
FT                   /translation="MGGALAVLWTTGAALADQPRPWEWRFQDAATGIAEQIHWFERYTL
FT                   WFIIPITLLVLGLLVWVVLRFRASVNPEPSKTSHNTAIEVIWTVGPVIILLFLAVPSFQ
FT                   LLTAQYSPEDPTLTVKATGYQWYWGYEYQVDNPVSFDSVIRKDDDRAAAGKEDRARYPR
FT                   LLTVDNEVVVPVGETVRLLVTASDVIHSWTIPAFGVKMDAVPGRINETWFKADKEGLYY
FT                   GQCSELCGKDHGFMPIAVRVVSKDQYQNWLSAAATDLPGANKALLQAEGEGSANDKVAA
FT                   AGL"
FT   gene            466849..468507
FT                   /gene="ctaD"
FT                   /locus_tag="BCAN_A0474"
FT   CDS_pept        466849..468507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="BCAN_A0474"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="GO_function: GO:0004129 - cytochrome-c oxidase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61556"
FT                   /db_xref="GOA:A9M8Z2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z2"
FT                   /protein_id="ABX61556.1"
FT                   /translation="MAGTAAHEHGAHDDHKPHGWVRWVYSTNHKDIGTLYLIFAIIAGI
FT                   IGGALSIAMRAELQEPGIQIFHGLAQMVYGVEGDAALDAGKHMFNVFTSAHALVMIFFM
FT                   VMPALIGGFANWMVPLMIGAPDMAFPRMNNISFWLLPPALTLLLISLFMPGPAGGWGPG
FT                   GGWTLYPPFSTSGQPGPAVDFAILAIHISGASSILGAINFITTILNMRAPGMTLHKMPL
FT                   FAWAVLGTAFLLLLSLPVLAGGITMLLTDRNFGTTFFAPDGGGDPILYQHLFWFFGHPE
FT                   VYILILPGFGIVSHVVSTFSRKPIFGYLGMAYAMVAIGVVGFVVWAHHMYTVGLSLDTQ
FT                   RYFVFATMVIAVPTGIKIFSWIATMWGGSISFRAPMLWAIGFIFLFTIGGVTGVQLANA
FT                   GLDRALHDTYYVVAHFHYVLSLGAVFAIFAGWYYWFPKMSGYMYNEFTAKLHFWVTFVG
FT                   VNLVFFPQHFLGLAGMPRRYIDYPDAYAGWNMISSYGSYISGFAVLIFLYNVFEAFAKK
FT                   REAGANPWGDGATTLEWQLSSPPPFHQWEQLPRIK"
FT   gene            468735..469682
FT                   /gene="cyoE"
FT                   /locus_tag="BCAN_A0475"
FT   CDS_pept        468735..469682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="BCAN_A0475"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="GO_function: GO:0008495 - protoheme IX
FT                   farnesyltransferase activity; GO_process: GO:0006783 - heme
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61557"
FT                   /db_xref="GOA:A9M8Z3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8Z3"
FT                   /protein_id="ABX61557.1"
FT                   /translation="MSLVEKNTASEDAFALSEATARDYLVLLKPRVMSLVVFTGLVGLV
FT                   LAPGHMNPVLAVISILCIAVGAGASGALNMWYDADIDAVMKRTRKRPIPAGIIAPNQVL
FT                   AFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIYTMWLKRSTPQNIVIGGAAGAFP
FT                   PMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFTTNDYEAARIPMMPNVKGELST
FT                   RRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAFVYYAWRLWAADSQPQMLAAA
FT                   RKLFRFSLLYLAGIFAVLLFEALTFKLLAAFGVF"
FT   gene            469682..469867
FT                   /locus_tag="BCAN_A0476"
FT   CDS_pept        469682..469867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0476"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61558"
FT                   /db_xref="GOA:A9M8Z4"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z4"
FT                   /protein_id="ABX61558.1"
FT                   /translation="MDKTAHKPVHEKLELVVPTEQQKKAQRNRSWGLAIALALFVLLVY
FT                   IGTLAKMGAGVFMRPI"
FT   gene            469887..470492
FT                   /gene="ctaG"
FT                   /locus_tag="BCAN_A0477"
FT   CDS_pept        469887..470492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="BCAN_A0477"
FT                   /product="Cytochrome c oxidase assembly protein ctaG"
FT                   /note="GO_function: GO:0005507 - copper ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61559"
FT                   /db_xref="GOA:A9M8Z5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8Z5"
FT                   /protein_id="ABX61559.1"
FT                   /translation="MTDQGENEKKQRRSNATIAVACLSFFVCMIGAAYASVPLYRIFCQ
FT                   VTGYGGTTQRVEQYSDTILDKTIKVRFDANIANGLPWDFKPMQREVTVRIGETTMIKYE
FT                   AHNLFGEETYGRASFNVAPGRAGAYFNKVECFCFTDNTLKPGEDLELPVVFFVDPEFVN
FT                   DPDLKDVKTITLSYTFFPIDKPRPVVNAKAVGSTRNGG"
FT   gene            470701..471579
FT                   /locus_tag="BCAN_A0478"
FT   CDS_pept        470701..471579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0478"
FT                   /product="Cytochrome c oxidase subunit 3"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004129 - cytochrome-c oxidase activity; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61560"
FT                   /db_xref="GOA:A9M8Z6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z6"
FT                   /protein_id="ABX61560.1"
FT                   /translation="MADVHQKNHDYHIIAPSPWPFLSSVGAFVLAIGGIAWMRYINAGE
FT                   LPFFGLNVVTPWIFFIGLAIVLYCMFGWWSDTIKEGHEGHHTRVVSLHLRYGMIMFIAS
FT                   EVMFFVAWFWAFFDASLFPNEVHQVARAEFTGGVWPPKGIEVLDPLHLPLYNTVILLLS
FT                   GTTLTWAHHALLHNDRKGMITGLAITVALGVLFSCVQAYEYIHAPFAFKDSIYGATFFM
FT                   ATGFHGFHVLIGTIFLLVCLFRAIGGDFTPKQHFGFEAAAWYWHFVDVVWLFLFFAIYV
FT                   WGGWGAPMHGG"
FT   gene            471693..472076
FT                   /locus_tag="BCAN_A0479"
FT   CDS_pept        471693..472076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0479"
FT                   /product="protein of unknown function DUF983"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61561"
FT                   /db_xref="GOA:A9M8Z7"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z7"
FT                   /protein_id="ABX61561.1"
FT                   /translation="MPEHGHYPQVDPIRSGIAGHCPRCGEGKLFNGFLTVAPRCTACGL
FT                   DYGFADSGDGPAAFVILIIGFIVVGLALWMEVNIGPPLWVHFILWVPLAIILSLVAMRW
FT                   IKGILINMQYRHKAEQGRLDSNK"
FT   gene            472073..472822
FT                   /pseudo
FT                   /locus_tag="BCAN_A0480"
FT                   /note="Surfeit locus 1 family protein"
FT   gene            472853..473971
FT                   /gene="ispH"
FT                   /locus_tag="BCAN_A0482"
FT   CDS_pept        472853..473971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="BCAN_A0482"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /note="GO_function: GO:0042380 - hydroxymethylbutenyl
FT                   pyrophosphate reductase activity; GO_process: GO:0009240 -
FT                   isopentenyl diphosphate biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61562"
FT                   /db_xref="GOA:A9M8Z8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:A9M8Z8"
FT                   /protein_id="ABX61562.1"
FT                   /translation="MEKSRKSHDRSVLRFLRHLLENEYAIMTQQRPPLEIRLCGPRGFC
FT                   AGVDRAIQIVVLALKKYGAPVYVRHEIVHNRYVVEGLQARGAIFVEELDEIPAAHRNQP
FT                   VVFSAHGVPKSVPADAEAKNLFYLDATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEV
FT                   IGTMGQLPDGAVTLIETVEDAHTCHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNL
FT                   AAPAAESICYATTNRQDAVRAAAPGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQ
FT                   RAEDIEWEQIGDISVVGLSAGASAPEIIVDEIIDAFKAHFDVKIELAETTVETENFLVN
FT                   REIRDVELTVKDMAFVNGEHRVVSISKLMQGK"
FT   gene            473977..474957
FT                   /gene="thrB"
FT                   /locus_tag="BCAN_A0483"
FT   CDS_pept        473977..474957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="BCAN_A0483"
FT                   /product="homoserine kinase"
FT                   /note="GO_function: GO:0004413 - homoserine kinase
FT                   activity; GO_process: GO:0009088 - threonine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61563"
FT                   /db_xref="GOA:A9M8Z9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M8Z9"
FT                   /protein_id="ABX61563.1"
FT                   /translation="MAVYTDINEIELGAFLRHYDIGTLTSYKGIAEGVENSNYLLHTSS
FT                   GSFILTLYEKRTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIVTF
FT                   LEGMWMRRPTVAHCEAVGEGLAHMHLAGADFPMRRRNGLTLPDWRPLWNLSRKCADTVE
FT                   RGLVAETEADLDFLEKNWPADLPQGVIHADLFPDNAFFLGDRLSGFIDFYFACTDILAY
FT                   DVAVCLNAWCFEKDFSYNRTKGAALLRGYTSVRPLSEAEADALPVLARGAAVRFMLTRL
FT                   YDWLTVPAGSFVVKKDPMEYVRRMRFHRQIESAAEYGLEMQGVAA"
FT   gene            474954..475418
FT                   /locus_tag="BCAN_A0484"
FT   CDS_pept        474954..475418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0484"
FT                   /product="ribonuclease H"
FT                   /note="GO_function: GO:0004523 - ribonuclease H activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61564"
FT                   /db_xref="GOA:A9M900"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9M900"
FT                   /protein_id="ABX61564.1"
FT                   /translation="MKRIEAYTDGACSGNPGPGGWGALLRWNGNEKELKGGEAETTNNR
FT                   MELMAAISALSALKEPCEVDLYTDSVYVRDGISGWIEGWKRNGWKTAAKKPVKNAELWQ
FT                   ALDEARKAHKVTWHWIKGHAGHPENERADELARAGMEPFKYAGHRTLKVK"
FT   gene            complement(475448..475933)
FT                   /locus_tag="BCAN_A0485"
FT   CDS_pept        complement(475448..475933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0485"
FT                   /product="Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61565"
FT                   /db_xref="GOA:A9M901"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A9M901"
FT                   /protein_id="ABX61565.1"
FT                   /translation="MTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAF
FT                   TPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSA
FT                   TFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQL"
FT   gene            complement(476113..476913)
FT                   /locus_tag="BCAN_A0486"
FT   CDS_pept        complement(476113..476913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0486"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61566"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A9M902"
FT                   /protein_id="ABX61566.1"
FT                   /translation="MKICTSILAPFILAVLAIPAQASTSAWTETPGGRVRIVIEGGDPA
FT                   ITGKQEVRGALQIELRPGWKTYWRNPGDAGVPPQISIEGDAKAQIAFPAPVRFAGDEEG
FT                   GIGYKKPVSLPVTFHIEPGGKRLKGHAFLGMCENICVPVLAEFDFPLDADRQKSSSENL
FT                   AARTVVETAFAQLPAPASPDFGVSAVKHDKDEAIFDVALPDPNAPAELFVASDTVNLSA
FT                   PVSVEDGKASQRFIAKMQGKTKDAVIDYTIVQNGKAVSGRLELD"
FT   gene            477048..477650
FT                   /locus_tag="BCAN_A0487"
FT   CDS_pept        477048..477650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61567"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M903"
FT                   /protein_id="ABX61567.1"
FT                   /translation="MTTHRKPSQEQGFLNGQFLLAMPGMSDERFARSVVYICAHSDEGA
FT                   MGFIINQLQPVQFPDLLRQIGVIGEEDLIILPDRAQHMVVRNGGPVDRTRGFVLHSDDY
FT                   MVDSTMPVSDDVCLTATVDILRAIYGGGGPERALMALGYSGWAPGQLEMEVAENGWLTC
FT                   DAPLDMLFDSDIEGKYSRLMLHMGIDMSRLVSDAGHA"
FT   gene            complement(477748..480642)
FT                   /locus_tag="BCAN_A0488"
FT   CDS_pept        complement(477748..480642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0488"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /note="GO_function: GO:0009975 - cyclase activity;
FT                   GO_process: GO:0009966 - regulation of signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61568"
FT                   /db_xref="GOA:A9M904"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9M904"
FT                   /protein_id="ABX61568.1"
FT                   /translation="MRGFSKNCFEAGARFFALFVFLTLSAVHASAIEPIKISKEDTALD
FT                   LSRAVELLRNKGESVQVSTMPGPDGIVRRIEVQSDQNANASGDWAAFSIANPTDEQIDR
FT                   LIVAPHFRLVGSGVIWPDLGSPRIASITPSEGFALDRQPSADADVFRITLNPGSVITFV
FT                   AELSSHNLPQLYLWEPEAYKDMVNSYTLYRGILLGISGLLALFLTILFVVKGTSLFPAT
FT                   AALAWAVLAYICVDFGFWNKLMQITPGNEQIWRAGTEVALAASLVIFLFTYLNLNRWHD
FT                   HFSYGAVTWILGLLALAGVAVFDPPVASGIARISLALTVFSGVAIIGYLAVKGYDRAVM
FT                   LIPAWLLTLIWLIGAWMAVSGHLDNDIVQSALGGGLVLIVLLIGFTVMQHAFAGGGLQQ
FT                   GLLSDMERQALAVIGAGDIVWDWDVPRDRVVTTPDIANYLGNTASSLQGPVRNWLPAMH
FT                   ADDRDRFRSTLDAILENRRGRIGQIFRLRANDGHYHWYALRARPVIGSDGEVVRCVGTL
FT                   VNVTEQKKAEERLLHDAVHDNLTGLPNRELFLDRLSSMMNMARGESNLHPTVFVIDIDR
FT                   FKQVNDSLGMSAGDTILLTISRRLARLMKPQDTLSRLSSDQFGLLLASEVDPGRIATFA
FT                   EALRQAVRSPIAYAKREIVLTASIGLITWTKTATTAEDFVKDAELAMFQAKRFGGDRIE
FT                   PFRPAFRAIGSDKLQLESDLRRALERDEISLVYQPIVKLEEGTVAGFEALMRWEHPRRG
FT                   AISPSEFIPIAENSGLIVQLGLFAMQRAAEDLFAWQEQFPKLDLFVSVNLSSTQLIRQD
FT                   LINDVRSVLSRIHLNPGSLKLELTESVLMENPEQSAYVLARLKAMGIGLSLDDFGTGYS
FT                   SLAYLTRFPFDIIKIDRSFVKGDQPQKTTLLRSIVSMAHDLGLAVVTEGVESETDALQL
FT                   RQMGCEYVQSFMFGQPTSHDEATRMIREQLDAAA"
FT   gene            complement(480639..481259)
FT                   /locus_tag="BCAN_A0489"
FT   CDS_pept        complement(480639..481259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0489"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61569"
FT                   /db_xref="GOA:A9M905"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9M905"
FT                   /protein_id="ABX61569.1"
FT                   /translation="MIGLPFRRSNPTVLRGQRIYLRDPMMSDYASWASLREQSRAFLTP
FT                   WEPTWPDDDLTRSAFRYRIRHYQDETSAGTGYPFFIFRNSDNRIVGGITIGNIHRGVGQ
FT                   NGVIGYWSGAPFAGKGYMTEALSLVIPFAFDQLRLHRLEAACIPHNVRSIRLLEKAGFQ
FT                   REGLLRSYLKINGFWQDHLLLALIESDKRMTDRGVIIGKVERS"
FT   gene            complement(481430..482722)
FT                   /locus_tag="BCAN_A0490"
FT   CDS_pept        complement(481430..482722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61570"
FT                   /db_xref="GOA:A9M906"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A9M906"
FT                   /protein_id="ABX61570.1"
FT                   /translation="MGVEVTRLPNGLTIATDTMPHVESVALGIWVKVGARNEAPDRHGI
FT                   AHLLEHMAFKGTENRTAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILS
FT                   DILTASKFDEGELEREKQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPET
FT                   VMSFTSDDLRQYMQEQYSVDRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAH
FT                   YVGGDFRENRELMDAQVLIGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGL
FT                   CYSVYAFHWGFSDTGLFGIHAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYR
FT                   ASLLMSQESAASRAGQIARQFLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPT
FT                   IAGVGPVGCLMSFDRLTDALSTNAHTRKIAV"
FT   gene            complement(482776..484167)
FT                   /gene="thrC"
FT                   /locus_tag="BCAN_A0491"
FT   CDS_pept        complement(482776..484167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="BCAN_A0491"
FT                   /product="threonine synthase"
FT                   /note="GO_function: GO:0004795 - threonine synthase
FT                   activity; GO_process: GO:0009088 - threonine biosynthetic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61571"
FT                   /db_xref="GOA:A9M907"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A9M907"
FT                   /protein_id="ABX61571.1"
FT                   /translation="MKYVSTRGEAPVLEFSDALLAGLARDGGLYLPQEYPQFTAEQIRA
FT                   LRGKSYVEVALAVLTPFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELF
FT                   HGPTLAFKDVAMQLLARMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFIL
FT                   FPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDALSLSGVNSI
FT                   NWARIMPQVVYYFTAALSLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATN
FT                   DNDILSRTLESGAYEMRGVAQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQ
FT                   SGGFTISEKPLSAIRSEFSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKAS
FT                   GTAPMVVLATAHPAKFPDAVKAACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVR
FT                   HHSRA"
FT   gene            complement(484247..484498)
FT                   /locus_tag="BCAN_A0492"
FT   CDS_pept        complement(484247..484498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0492"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61572"
FT                   /db_xref="UniProtKB/TrEMBL:A9M908"
FT                   /protein_id="ABX61572.1"
FT                   /translation="MFQMQNCFALLAGNANLSWSHCPTQNRFALLARNANLSWSHYPTQ
FT                   NRFALLLEMLYTTAKCVARWRFPVFCRREQPIHWGCFK"
FT   gene            484649..485227
FT                   /locus_tag="BCAN_A0493"
FT   CDS_pept        484649..485227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0493"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61573"
FT                   /db_xref="UniProtKB/TrEMBL:A9M909"
FT                   /protein_id="ABX61573.1"
FT                   /translation="MQKASQNRSSLFPVFATVLLASLAGCTTSGTENGANSSLPTKVTS
FT                   GEKRISETELRAYCPSVSLRDGTAFFNTYEKGGDKDPERVIYQAALTDTTRSCQYGNGT
FT                   LTMDIAGAGKVVPGPKYKTGTIVMPIRVAIRQGDQVVYSKLHKQRVSITNPDTATQFVF
FT                   NDKGVTIPMPDKQNVQIFIGFDEGPYNTK"
FT   gene            485541..487175
FT                   /locus_tag="BCAN_A0494"
FT   CDS_pept        485541..487175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0494"
FT                   /product="Hypothetical protein, conserved"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61574"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A9M910"
FT                   /protein_id="ABX61574.1"
FT                   /translation="MRFRRNSLISPVFLVLLLMLILGAVAGQLVGKGLRILEEERHMDI
FT                   YMTALRDYSSRLLASARNTLEAANNSPFEICSPQDLAYQRKLVFAAYHIKDIGRLRDDQ
FT                   LICSTLLSDIKTQPRRSVANVNLKDGTYIYADDALITPGSHGPIIGRGNANVVLSSVAF
FT                   DLLHTPRYAFSIFATDEEKKHFALLYNYSGNAEPGPEPSSGDWAQKFVEAPDGKVLREN
FT                   SCDPDTGVCISLSATIDRTSTAARLKNLLAICLGALAGGSVGLGWLYYRNRDHSLLYRL
FT                   NKALAAGEPHLLYQPVVDMADGKVLGFEALIRWEIRKGDFVPPDVFVARAEEAGTATKI
FT                   TIYVLERLIEDMGDTLRQRRDLRININITASDLQSPAFMSRMERRLAAADIEPQQVGLE
FT                   LTERTAVDFSKATDGIRRLREQGHRIYIDDFGTGYSSLAYLGELHVDAIKIDKAFTRTV
FT                   GNDYATVSIIPQIISMAKEHGLDIVVEGVETEAQALYFRKLGTPLAAQGWFFGKPLCVS
FT                   DAQALVATVKKKQSRVKLARKTTQKAK"
FT   gene            487225..487320
FT                   /locus_tag="BCAN_A0495"
FT   CDS_pept        487225..487320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0495"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61575"
FT                   /db_xref="UniProtKB/TrEMBL:A9M911"
FT                   /protein_id="ABX61575.1"
FT                   /translation="MQIDKIQIKFDCPYEMNGKRFGLFCAYETEI"
FT   gene            487304..487489
FT                   /locus_tag="BCAN_A0496"
FT   CDS_pept        487304..487489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0496"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61576"
FT                   /db_xref="UniProtKB/TrEMBL:A9M912"
FT                   /protein_id="ABX61576.1"
FT                   /translation="MKQKFERILEPTDTWAIFDTTADVPAMMGTRLLIGLTEKEAEELL
FT                   AILNAPPKGRNKCSAA"
FT   gene            complement(487531..488217)
FT                   /locus_tag="BCAN_A0497"
FT   CDS_pept        complement(487531..488217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0497"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61577"
FT                   /db_xref="GOA:A9M913"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9M913"
FT                   /protein_id="ABX61577.1"
FT                   /translation="MAAPSLIIFDCDGVLVDSEIIAAEVESALLTESGYPIAADEMAER
FT                   FAGLTWQDILLTVEREAGIPLSASLLDKSERILDEKLKNEVNAVEDIVEVVSALKLPKC
FT                   ICSNSTSLRLENMLKRVGLYELFAPNIFSAKEVGSGKTKPAPDVFLHAARHFGVDPANV
FT                   LVIEDSVHGVHGARAAGMRVIGFTGGAHTYPGHADKLTDAGAETVIHRHKDLQSVIDAL
FT                   SIWTDA"
FT   gene            complement(488365..490155)
FT                   /locus_tag="BCAN_A0498"
FT   CDS_pept        complement(488365..490155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0498"
FT                   /product="chloride channel protein clcB-like protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005247 - voltage-gated chloride channel activity;
FT                   GO_process: GO:0006821 - chloride transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61578"
FT                   /db_xref="GOA:A9M914"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A9M914"
FT                   /protein_id="ABX61578.1"
FT                   /translation="MNFAELRHNRYLRVLFVPFRTRALVRGSEIGIVIAGALIGILSGL
FT                   AVAAIGGISQWMHQAIFGLQQGERLSAAIQLYPSAFIAPMAGGILMGVLIWVLARWRKR
FT                   PIVDPIEANALHGGRLSLTDSFILVGQNLISNGFGASVGLEAAYTQLASGFASRIGRAL
FT                   KLRRADMRTLVGCGAAAAIASAFNAPLTGSFYAFELIIGVYSIATLAPVVVAAIIGTLV
FT                   TQAIGGAPFIIDIGLIDDITPRDYVPALMLGFISAGIAILIMRGVTLVEKVARRSVVPN
FT                   VLAPAIGGAIVGMIAFFSPQVLASGHGALHLDLNANITIPVLVLLILTKSLASAVSIGS
FT                   GFRGGLFFASLFLGALTGKLFAAIAGTIMPASLALAPEVYAVIGMSSLAVAVVGGPMTM
FT                   TFLALEMTGDFPISMLVLGAVVSSSLMVRKTFGYSFATWRFHLRGEAIRSAHDIGWIRD
FT                   LTVARMMRHDVRTVAIDTDIETFRHDFPLGSTQRVIAVDSEGRYVGMIPVPEAYGDSFD
FT                   TADKTHSIAELLKYQDEFLLPQMNAKEAVARFDRAESEALAVIDNAQDRKVLGLLSEAH
FT                   TLRRYSEELDRRRREVAGEV"
FT   gene            complement(490158..490298)
FT                   /locus_tag="BCAN_A0499"
FT   CDS_pept        complement(490158..490298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0499"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61579"
FT                   /db_xref="UniProtKB/TrEMBL:A9M915"
FT                   /protein_id="ABX61579.1"
FT                   /translation="MCKAGTAYVAINKAWLFLLVYDPAANDDDAMCVAAARRLKCLSGV
FT                   V"
FT   gene            490492..491625
FT                   /locus_tag="BCAN_A0500"
FT   CDS_pept        490492..491625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0500"
FT                   /product="Modification methylase HinfI"
FT                   /note="GO_function: GO:0008170 - N-methyltransferase
FT                   activity; GO_process: GO:0006306 - DNA methylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61580"
FT                   /db_xref="GOA:A9M916"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M916"
FT                   /protein_id="ABX61580.1"
FT                   /translation="MSLVRLAHELPIEAPRTAWLDSIIKGDCVSALERLPDHSVDVIFA
FT                   DPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESFQAYDAFTRAWLLACRRVLKPNGTIWV
FT                   IGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMPNFRGRRFQNAHETLIWASRDQKGKG
FT                   YTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDENGDKVHPTQKPEALLARIMMASSK
FT                   PGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYIDAATARINAVEPLGKAELTVMTG
FT                   KRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRADGTLTANGEAGSIHRIGARVQG
FT                   FDACNGWTFWHFEENGVLKPIDALRKIIREQMAAAGA"
FT   gene            complement(491708..492325)
FT                   /locus_tag="BCAN_A0501"
FT   CDS_pept        complement(491708..492325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0501"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61581"
FT                   /db_xref="GOA:A9M917"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9M917"
FT                   /protein_id="ABX61581.1"
FT                   /translation="MNSSPVKHVVFDIGKVLIHYDPELAFLDIIPDAGERRWFLENICT
FT                   SAWNIEQDRGRSWQEAEALLLESHPQHHDHIRAFRRNWSRMVPHAYDDSVEILRGLIAA
FT                   GHDVTMLTNFASDTFREAQARFPFLTESRGVTVSGDIRLIKPDRAIYDHHVASFGLDPA
FT                   ATLFIDDTMHNVEGAKQAGWQAVHFTSAAKLADDLRARQLSF"
FT   gene            complement(492322..493398)
FT                   /gene="mutY"
FT                   /locus_tag="BCAN_A0502"
FT   CDS_pept        complement(492322..493398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BCAN_A0502"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="GO_function: GO:0004844 - uracil DNA N-glycosylase
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61582"
FT                   /db_xref="GOA:A9M918"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A9M918"
FT                   /protein_id="ABX61582.1"
FT                   /translation="MDPTTFLLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIML
FT                   QQTTVEAVKSYFLRFIERWPTVRAMAKASEDDILHAWAGLGYYSRARNLKKCADIVVAE
FT                   HGGEFPKSAAGLKELPGIGDYTSAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVA
FT                   KAQICALMGQMTPPDRPGDFAQAMMDLGATICTPRRPACALCPLNKGCIALCERDPEDF
FT                   PVKAPKAEKPVRTGAAFIAIAGDGSVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVN
FT                   AAPFSAAWTPSGTITHVFTHFELRLSVYRASNVRKQAANEGWWSTPEELCGEALPTVMK
FT                   KAIAAAIPDAFKRGRKSR"
FT   gene            493672..494199
FT                   /locus_tag="BCAN_A0503"
FT   CDS_pept        493672..494199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0503"
FT                   /product="protein of unknown function DUF1159"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61583"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A9M919"
FT                   /protein_id="ABX61583.1"
FT                   /translation="MSEPNPKRGFRPLADMASGLVDPVLRKRAGINLALLQAWEDIVGP
FT                   AIGASSRPLRILWPRRIREDDPFTPATLVIACEGFAALQIQHETGEIISRVNGFLGFAA
FT                   IGRIRIKQKPPVIAVKRRVKRLASLGPAEERSVDKATAGIEDDALRQALARLGRNILAE
FT                   KRMLGKKGGSKN"
FT   gene            494217..494390
FT                   /locus_tag="BCAN_A0504"
FT   CDS_pept        494217..494390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0504"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61584"
FT                   /db_xref="UniProtKB/TrEMBL:A9M920"
FT                   /protein_id="ABX61584.1"
FT                   /translation="MAPGGVSFVAINLMQAIHSLHMRGVPQEFAVVYMESGCRFTAYHL
FT                   NVAGLVPSDLLL"
FT   gene            494437..495090
FT                   /locus_tag="BCAN_A0505"
FT   CDS_pept        494437..495090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0505"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61585"
FT                   /db_xref="GOA:A9M921"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9M921"
FT                   /protein_id="ABX61585.1"
FT                   /translation="MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAK
FT                   PGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLITFPKIKEKYIDTGKARLIFRDFPF
FT                   DPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQESFEA
FT                   CLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL"
FT   gene            495169..498627
FT                   /gene="smc"
FT                   /locus_tag="BCAN_A0506"
FT   CDS_pept        495169..498627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="BCAN_A0506"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0007059 - chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61586"
FT                   /db_xref="GOA:A9M922"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A9M922"
FT                   /protein_id="ABX61586.1"
FT                   /translation="MRFSRLRLVGFKSFVEPMEFVIEGGLTGVVGPNGCGKSNLVEALR
FT                   WVMGENSYKNMRASGMDDVIFSGSATRPARNTAEVTLFLDNSDRTAPPAYNDADELQVS
FT                   RRIEREAGSLYRINGKEARAKDVQLLFADQSTGARSPSMVGQGRIGELIQAKPQARRAL
FT                   LEEAAGISGLHTRRHEAELRLRAAETNLERLDDVVGELGSQIESLKRQARQANRFKSLS
FT                   ADIRRAEAALLHLRWNVAKGQEAEAQSALSQATATVGDMAEAQMKAARDQAVGAHKLPE
FT                   LREAEAGAAAALQRLSIARTQLDEEGERIRARRAELMKRLEQLTADIAREEQMLRENAD
FT                   ILARLDEEEQELAASSEASGERNEELRALFEEAEIRLQDSESALARLTAERAEAAAERA
FT                   QVERALKEAQDRRDRLAVQMENIERDIAAVVGQIGGLFDPAEKRIVVDACTQALEAAEE
FT                   AVVAAEELVAHAREAEAASRQPLSEARTELNRIETEAQTLARILNAGETGQFPPVVEEL
FT                   RVEKGYEVALGAALGEDLDAASDENAPVYWAYNPAAETDPALPEGAMPLDRLVDGPQQL
FT                   RRRLAQVGVVSEADGRRLQVGLRPGQRLVSKTGALWRWDGYTASADAPTPAAQRLAQKN
FT                   RLAELEQDAIGARRRVVDAGQAVERAEAAVRKAVEDERVARDQWRANQRKLDEAREALA
FT                   AAERAAGELATRRSALDESRARLEENLEEAQIRVAEAGDRLGEMPDMDAIAQRLSALTS
FT                   EVQSDRAALAEARAAYEGLRREADARLRRLEMIALERRNWISRAENADRQIAALNDRRA
FT                   ETAEEAEVLAEAPDEIENRRRALLNELSLAEERRRAAADILAEAETRQAELDKAATLAI
FT                   QHLAASREQRARAEERLTAAQERRKDAEARIFEALNCPPHEAIRHAGLKPEDAMPDPDQ
FT                   LERQLERLKIERERLGAVNLRAEEESRELSDRLDALISEREDVIEAIKKLRQAIQSLNR
FT                   EGRERLLAAFDVVNAQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQTM
FT                   TLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTETR
FT                   FVVITHNPITMARMNRLFGVTMGEQGVSQLVSVDLQTAEQLREAS"
FT   gene            498650..499543
FT                   /locus_tag="BCAN_A0507"
FT   CDS_pept        498650..499543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0507"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0015562 - efflux permease activity; GO_process:
FT                   GO:0006812 - cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61587"
FT                   /db_xref="GOA:A9M923"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A9M923"
FT                   /protein_id="ABX61587.1"
FT                   /translation="MGADHEHADVKNTPISRLWIAFGLTGIFMIAEVIGSFATGSLALL
FT                   SDAMHMATDAFALLLALIAIYLGRRPADVLRTYGYARFEILAAAFNALLLLGVAFYILY
FT                   EAWERLSEPADVQSLGMLAVAIVGLVMNFISMRILTVHKDDSLNVKGAYLEVWTDMLGS
FT                   VGVIAAAIIIYLTGWEWVDSAIAVGIGFMVFPRTWVLLKECINILLEGVPAGGDVKKLE
FT                   AAILAVPGVASVHDLHVWSLTKTEHSLTAHLVLAQEADGETVCRAVEHVLQNDYDLHHT
FT                   TLQTEKVTCAAKELIH"
FT   gene            complement(499653..500018)
FT                   /locus_tag="BCAN_A0508"
FT   CDS_pept        complement(499653..500018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0508"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61588"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A9M924"
FT                   /protein_id="ABX61588.1"
FT                   /translation="MGNLSELAMRITGKLDYLEMPALNGSLDATKNFYARAFGWAFTDY
FT                   GPTYSAFAEGLDGGFDAQSSTAKPLPVLFAANLEEALDAVTDAGGAVVKPIFTFPGGRR
FT                   FHFTDPAGNELAVWSDK"
FT   gene            500258..502921
FT                   /gene="ppdK"
FT                   /locus_tag="BCAN_A0509"
FT   CDS_pept        500258..502921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="BCAN_A0509"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /note="GO_function: GO:0050242 - pyruvate, phosphate
FT                   dikinase activity; GO_process: GO:0015976 - carbon
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61589"
FT                   /db_xref="GOA:A9M925"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9M925"
FT                   /protein_id="ABX61589.1"
FT                   /translation="MAKWVYTFGDGKAEGAASDRNLLGGKGANLAEMSSLGLPVPPGFT
FT                   ITTEVCTYYYNNDRVYPSELDAQVQAALAHIATLTGRNFGDAEKPLLVSVRSGARASMP
FT                   GMMDTVLNLGLNDETVQAIARESGDERFAYDSYRRFIQMYSDVVLGVDHGFFEEILEDT
FT                   KADLGVEVDTALSADDWKNVIGLYKAKVEEELGQPFPQDPREQLWGAIGAVFSSWMNAR
FT                   AITYRRLHNIPAAWGTAVNVQAMVFGNMGETSATGVAFTRNPSTGENKLYGEFLVNAQG
FT                   EDVVAGIRTPQNITEEARIAAGSDKPSLEKVMPEAFAEFLKVANRLEQHYRDMQDLEFT
FT                   IERGKLWMLQTRSGKRTARAALKMAVEMAAEGLISEEEAVLRIDPAALDQLLHPTIDPR
FT                   AERQVVGMGLPASPGAATGEIVFSSEEAEQAKAEGRNVILVRIETSPEDIHGMHASEGI
FT                   LTTRGGMTSHAAVVARGMGKPCVSGAGSLRVDYRNGTMLAAGQTFRKGDVITIDGASGQ
FT                   VLKGSVAMLQPELSGDFGKLMEWADRARRMKVRANAETPADARTARSFGAEGIGLCRTE
FT                   HMFFDGSRIVAMREMILSDTEEGRRLALAKLLPMQRSDFAELFEIMKGLPVTIRLLDPP
FT                   LHEFLLHTDEEVDEVARSMGVDAAKLRDRADALHEFNPMLGHRGCRLAVSYPEIAEMQA
FT                   RAIFEAAVEAGKKTGEPVVPEVMVPLVGLKAELDFVKARIDAVAKEVMSEAGIKIDYMV
FT                   GTMIELPRAALRAAEIAESAEFFSFGTNDLTQTTFGISRDDAAGFLTTYQNRGVIEQDP
FT                   FVSLDVDGVGELVQIAAERGRKTREKIKLGICGEHGGDPASIAFCEKTGLDYVSCSPFR
FT                   VPIARLAAAQAAVRKV"
FT   gene            complement(503200..503602)
FT                   /pseudo
FT                   /locus_tag="BCAN_A0510"
FT                   /note="Hypothetical protein"
FT   gene            503886..504674
FT                   /locus_tag="BCAN_A0512"
FT   CDS_pept        503886..504674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0512"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61590"
FT                   /db_xref="GOA:A9M926"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:A9M926"
FT                   /protein_id="ABX61590.1"
FT                   /translation="MRKLRYQRRQSRSAIWALRFGVFGALLLAIAFLLHRFWRLETPDF
FT                   VLVAILSGALALLALICAAKGFRNLWVNGDKGGARSFWGSVFALVVMVPLALVGALWYG
FT                   SPPFYDVSTDFETPPQFTDNMPARLQWMNPLTERVDGDPLAQLSAYPDVVGRRYEAAPD
FT                   RVMQGVETTLKAFGWTVIARDVATPEQNAIRFAATAHSFILGLKSDIVIRLLDEGETTY
FT                   VDMRSLSRYGKRDMGLNAGFITDFLGALEGEVNKAPADVE"
FT   gene            complement(504675..505580)
FT                   /locus_tag="BCAN_A0513"
FT   CDS_pept        complement(504675..505580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0513"
FT                   /product="beta-lactamase domain protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61591"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A9M927"
FT                   /protein_id="ABX61591.1"
FT                   /translation="MALVFDNNFTPEYGKPVTLGKGIVRLTANNPSAFTFHGTNSYIVG
FT                   TDTLAIIDPGPENEAHYRALLETVAGRPVSHIFVSHTHRDHSPLAQRLKEELGALTVAE
FT                   GPHRPARPYHAGEVNLLEASADMDFRPDILLADGATVDGDGWALEGIHTPGHTANHMAF
FT                   ALKGTDILFSADHVMAWATPVVAPPDGSMSDYMASLEKLLARDDAAYLPGHGGAVTKPA
FT                   AFVRGLRAHRKMRERAILERIVQGDRTIRDMVKVIYRDTDPRLHGAAALSVLAHLEDLV
FT                   GRGEIITEGDPSLNGIYQPA"
FT   gene            505781..506380
FT                   /gene="bioY"
FT                   /locus_tag="BCAN_A0514"
FT   CDS_pept        505781..506380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY"
FT                   /locus_tag="BCAN_A0514"
FT                   /product="Protein bioY"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61592"
FT                   /db_xref="GOA:A9M928"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A9M928"
FT                   /protein_id="ABX61592.1"
FT                   /translation="MPQRAKSRVAAAALIADYLPLGQLSRAFWFVSLALVGTAILTLSA
FT                   KIKVDLVYVNVTMQTFAVFAIAALYGSRLAVATVALYLLEGALGMPVFTGTPEKGIGLA
FT                   YMVGPTGGYLLSYLAAAWIVGRAADKGLARNPFALGGVMLLAEAVILVMGAGWMAYLFG
FT                   FEKGIAFGFGIFIVGDLVKLALAAIGVPAVTALVKR"
FT   gene            506534..507043
FT                   /gene="allA"
FT                   /locus_tag="BCAN_A0515"
FT   CDS_pept        506534..507043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="BCAN_A0515"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /note="GO_function: GO:0004848 - ureidoglycolate hydrolase
FT                   activity; GO_process: GO:0000256 - allantoin catabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61593"
FT                   /db_xref="GOA:A9M929"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M929"
FT                   /protein_id="ABX61593.1"
FT                   /translation="MQIETLTVEPLTKEAFAPFGDVIEVEGAQLRLINNGTTERYHDLA
FT                   RVEAAGTQTRVLINIFRGQSFAAPIDIMMMERHPFGSQAFIPLNGRPFLVVVAEDAGAG
FT                   PARPRAFLARGDQGVNYLRNIWHHPLLALEQKSDFLVVDRAGREDNLEEYFFSDYAYRI
FT                   ETTQTA"
FT   gene            507055..507411
FT                   /gene="pucM"
FT                   /locus_tag="BCAN_A0516"
FT   CDS_pept        507055..507411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pucM"
FT                   /locus_tag="BCAN_A0516"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="GO_process: GO:0019628 - urate catabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61594"
FT                   /db_xref="GOA:A9M930"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A9M930"
FT                   /protein_id="ABX61594.1"
FT                   /translation="MGKLSTHVLDTAHGTPAAAMRVELYRIAASGTPELLKRVVTNLDG
FT                   RTDAPLLSGDKMRTGIYELQFHVAEYFEGRGAELAHEPFLDLIPIRFGIADEDGNYHVP
FT                   LLVSPWSYSTYRGS"
FT   gene            507482..508318
FT                   /locus_tag="BCAN_A0517"
FT   CDS_pept        507482..508318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0517"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61595"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A9M931"
FT                   /protein_id="ABX61595.1"
FT                   /translation="MDETPNLKLPYILPSQAQKHVTHNEALRMLDAIVHLGVKSWSLGD
FT                   APSSPAEGDRYIVAAQASGAWAGKDGMVASFIDGGWLFVIPATGWLAYVADEALLLVFD
FT                   GSLWKNSSSVPDELSLSMLGVQATPDAVNRFALSSDASLFNNAGAGHQVKVNKQAASDT
FT                   ASLLFQTNWTGYAEMGLNGSNDFSVKVGDDGGNWHEALRVDRATGNVAIGSNWPKTRLD
FT                   VDGPIRPASYSVATLPSAASHGAGAIIFVTDSGTGAEMAYSDGNAWRSMRSGSLIS"
FT   gene            508807..510492
FT                   /gene="capD"
FT                   /locus_tag="BCAN_A0518"
FT   CDS_pept        508807..510492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capD"
FT                   /locus_tag="BCAN_A0518"
FT                   /product="Capsular polysaccharide biosynthesis protein
FT                   capD"
FT                   /note="GO_process: GO:0009058 - biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61596"
FT                   /db_xref="GOA:A9M932"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M932"
FT                   /protein_id="ABX61596.1"
FT                   /translation="MPGLVSLHLEGGITARMSLKYPWKRLALLPRISKQIILVLSDCLL
FT                   LLASAYLAFVVRFGFVFVPNLAQLFLILIAPLLAIPVFIRFGLYRAIIRYLAERAIWSI
FT                   FQATAVAALFWVALVFLMELYGSTGLPRSVPLLYWLLSTVFISASRFGAKWLLRTAEHD
FT                   KRYTSSALIIGIGEPARQLATALRSHSDTLVVGFIDPAGQLAGMDIIGLRVYRTEEIPS
FT                   LIENYGIKQVVVSEPALEQKERQEFARLLGRLPVNTRILPPIADLTAGKYLVSALRNVE
FT                   IDDLLGRSPVPPDTTLLREVVEGRRIMITGAGGSIGSQLCLTIAQWNPAAIVLFESSEF
FT                   ALYQIDRQLRQFASCTVVPVLGSVRDRACVEKTIRDHSIDTVYHCAAYKHVPLVERNPL
FT                   VGIFNNVFGTLEVAEAALNTDVERMVLISSDKAVRPTNVMGATKRWAELVVYYYGRLAE
FT                   QAGKKKAFYSVRFGNVLGSNGSVVPLFREQIANGGPVTLTHEDMTRYFMSIKEAAELIV
FT                   QSGAIAQSGDTVLLEMGEPVKIRDLAENMIQRQQGHHAGDQDCI"
FT   gene            510565..510849
FT                   /locus_tag="BCAN_A0519"
FT   CDS_pept        510565..510849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0519"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61597"
FT                   /db_xref="UniProtKB/TrEMBL:A9M933"
FT                   /protein_id="ABX61597.1"
FT                   /translation="MSLEDVLTLGCTHDNCGARIQNIIKRQNKRDHDVCFTRKQQQGCS
FT                   YDQPQWGASGIAEKNAGRRAVEQGKTEKPAGSHRPDAATCQPRQPQGAE"
FT   gene            complement(511235..511516)
FT                   /locus_tag="BCAN_A0520"
FT   CDS_pept        complement(511235..511516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0520"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61598"
FT                   /db_xref="UniProtKB/TrEMBL:A9M934"
FT                   /protein_id="ABX61598.1"
FT                   /translation="MLAEEWTRTRFQTGQPNLSIHDRTYRNIEQPAGLRLAAKLIFPPE
FT                   NLFIGISHAIFTGFIFRQCPSLRDWAFSAVASAASELSCRAHEFAFQP"
FT   gene            511737..511808
FT                   /locus_tag="BCAN_A0521"
FT   tRNA            511737..511808
FT                   /locus_tag="BCAN_A0521"
FT                   /product="tRNA-Gln"
FT   gene            512018..512836
FT                   /locus_tag="BCAN_A0522"
FT   CDS_pept        512018..512836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0522"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61599"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9M935"
FT                   /protein_id="ABX61599.1"
FT                   /translation="MAGEFWLDDQQWAVIAPLLPTNQPGAHRTDDRRVISGIIHVLRSG
FT                   CRWQDCPACYGPPTTVYNRFHCWSAKGIWRRLFEALVQPTDRDIHMIDSTTAKAHRPAA
FT                   GGKGGDAEAIGRSRGGRSTKIHAVVDSCGRPVALRITPGQRGDAPIVILLLDVSFQEVV
FT                   HSERIEETGVTIPQFSRIAPNEHPQECPTDAIASRRNGGRSSRRQADEGAGCTPLWGLA
FT                   ENCFSLDRTVQDIWPGGDDGSLVAPHPQPPSNGPGHCRTDTPSSQTTPDR"
FT   gene            512568..513155
FT                   /locus_tag="BCAN_A0523"
FT   CDS_pept        512568..513155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0523"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61600"
FT                   /db_xref="GOA:A9M936"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9M936"
FT                   /protein_id="ABX61600.1"
FT                   /translation="MNIHKNARLTPLRREEMAVAVLGGRLTKAQAARLYGVSLKIVSRW
FT                   TERFRISGRAAMTDRSSRPTRSPRQMGQDIVERILHLRRQRLTGKHIAMETGVSPATVS
FT                   RILRRAKLSRMKDIDPVEPVIRYEYAEPGGLIHLDIKRLGRFERVGHRITGNRTRQSNA
FT                   RGVGWEYVHVCIDDVSRIAFTDIFPDEKAIMP"
FT   gene            513212..513511
FT                   /locus_tag="BCAN_A0524"
FT   CDS_pept        513212..513511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0524"
FT                   /product="insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61601"
FT                   /db_xref="GOA:A9M937"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9M937"
FT                   /protein_id="ABX61601.1"
FT                   /translation="MMTDNGACYIAKACKALDLKHIRTKPYTPKTNGKAERFIQTALRE
FT                   WAYARAYPSSQIRKAHLPNWTHMYNWHRPHSGLKSKTPISRLGLNRDNLLTLHS"
FT   gene            513568..513798
FT                   /locus_tag="BCAN_A0525"
FT   CDS_pept        513568..513798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0525"
FT                   /product="Transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61602"
FT                   /db_xref="GOA:A9M938"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A9M938"
FT                   /protein_id="ABX61602.1"
FT                   /translation="MRDFLTARGTQRVIPNNPTRKRIRPFDPIAYRRRNIIERTFCRLK
FT                   DWRRIATRYDKLMINFAATCYIAAIVTWWIN"
FT   gene            complement(513923..514186)
FT                   /locus_tag="BCAN_A0526"
FT   CDS_pept        complement(513923..514186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61603"
FT                   /db_xref="UniProtKB/TrEMBL:A9M939"
FT                   /protein_id="ABX61603.1"
FT                   /translation="MLRVSPLLSQKVFQSGVVEHRICQEPFQLCVFVFQRLQPLGLGHV
FT                   HAVELGFPFIDAGIADAVLATKLRDRRARLVLLQNADDLFRL"
FT   gene            514049..514174
FT                   /locus_tag="BCAN_A0527"
FT   CDS_pept        514049..514174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0527"
FT                   /product="hypothetical protein"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61604"
FT                   /db_xref="UniProtKB/TrEMBL:A9M940"
FT                   /protein_id="ABX61604.1"
FT                   /translation="MDVSEAKRLKTLEDENTKLKRLLADAMLDNAALKDLLGKKW"
FT   gene            514168..514890
FT                   /locus_tag="BCAN_A0528"
FT   CDS_pept        514168..514890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61605"
FT                   /db_xref="GOA:A9M941"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9M941"
FT                   /protein_id="ABX61605.1"
FT                   /translation="MVTPAASRKAVAHLMDHHQMSERRTCKAMGFCCMAIRYETRRSDD
FT                   HDLRERMKALAHERRCFGYRRLQVLLRCEGHLVNHKWLFRLYREEKLTVRKRGGRKRAI
FT                   GTRAPMLIPPAANVRWLLDFVSDQLTDGRRFRVLAVVDDCTRECLPLVADTSLSGLRVA
FT                   RELDRIIERRGKPKMIVSDNGSEFTSNAILHWVDRTKMEWHYIAPGKPIQNAFIESFNG
FT                   QLRDELLNETFFSSLTHA"
FT   gene            complement(515230..516009)
FT                   /gene="arnA"
FT                   /locus_tag="BCAN_A0529"
FT   CDS_pept        complement(515230..516009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arnA"
FT                   /locus_tag="BCAN_A0529"
FT                   /product="Bifunctional polymyxin resistance arnA protein"
FT                   /note="GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61606"
FT                   /db_xref="GOA:A9M942"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A9M942"
FT                   /protein_id="ABX61606.1"
FT                   /translation="MAIAPNTRVLVAGYGLPAEFCVTTLIGMGVEIDKIAVATHREDNR
FT                   NCGLHSMLRLRNIQFTTAAANSEEFYEFGANFDPDMIISMHYRSLIPGRFLKLAKKGSV
FT                   NLHPSLLPAYRGTNSVAWVIINGESETGFSYHRMDENFDTGAILLQERISVEETDTAFS
FT                   LFHRQIARAMLRLEEVILKLDQGDPGFAQLGEASYYARELPFGGVIDPRWSEVQIDRFI
FT                   RAMFFPPFPPAVLKIDGKVYYVPSIDIYRSLMRGIPS"
FT   gene            complement(516036..516890)
FT                   /locus_tag="BCAN_A0530"
FT   CDS_pept        complement(516036..516890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0530"
FT                   /product="WbcT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61607"
FT                   /db_xref="UniProtKB/TrEMBL:A9M943"
FT                   /protein_id="ABX61607.1"
FT                   /translation="MIRDSGAPRRVLWLLNHTTLRECEVPLLQSMGFEIFTPKRFPRNS
FT                   DNRSASVSFETDESLTIPASVIDELNSYDFYQAPVNPRIDFLINYYFENAIVAYMFPMF
FT                   TQIISRFKGRILLRAFGLTSETWTYFDFANFVAGSFFKRTWMKASNQFWFAASYSSLIE
FT                   IEPNFIRERTVLLPVGLPERILAKQDTWRGGDKRIMFVCPDIETYPEAKAAYSESKHVF
FT                   GNLSHVICGNQTIPVVDDDNVVDRLSAEDGGRLPIAMSCTNCSANCTNVTQVGMQSRVS
FT                   IYA"
FT   gene            complement(516887..517645)
FT                   /gene="rfbB"
FT                   /locus_tag="BCAN_A0531"
FT   CDS_pept        complement(516887..517645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="BCAN_A0531"
FT                   /product="O-antigen export system ATP-binding protein rfbB"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61608"
FT                   /db_xref="GOA:A9M944"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M944"
FT                   /protein_id="ABX61608.1"
FT                   /translation="MIQPSITLSNVHLHYAASAFKERSVKTLVNALLSMRRSAGANIED
FT                   IHALKGISVDIARGERVALIGHNGAGKSTFLKTIAGLYPISSGTLKVTGTVRSLFDIGL
FT                   GFEPDATGRENILYRGLLLGLTPRFMREIEDEIIEFADLGDFIDYPIKTYSAGMQVRLA
FT                   FAISTAVDGDILLLDEVIGAGDAAFMTKAKARIMNMVEKAEIMVLASHDLANVRQLCTR
FT                   ALVFKAGTIAFDGRVEDAISFYNSGMGAIA"
FT   gene            complement(517642..518424)
FT                   /gene="rfbD"
FT                   /locus_tag="BCAN_A0532"
FT   CDS_pept        complement(517642..518424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="BCAN_A0532"
FT                   /product="O-antigen export system permease protein rfbD"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61609"
FT                   /db_xref="GOA:A9M945"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A9M945"
FT                   /protein_id="ABX61609.1"
FT                   /translation="MISYMANVWKVRHFWWHLSMSDLRGRFRRSSLGILWAVIQPLALT
FT                   LLLSFVFSKLLNQSISAYAPYILSGIIIWEYISFTVVGGSTALVQADAYIKQTRNPLAI
FT                   YTLRNTVSGLVVLSVASISLFGWVLIMFPENFSLSWLAIPTLLPILALIVWPLATIVGY
FT                   IGARFRDLPNALALVLQAAWFVSPVYFKESMFRQGGLNAFVDYNPIYHVMQILRAPVLY
FT                   GEWPTATNYIWCLGVSLLLTCVAVAVGMRAEKRAIFYL"
FT   gene            complement(518439..519542)
FT                   /gene="rbmB"
FT                   /locus_tag="BCAN_A0533"
FT   CDS_pept        complement(518439..519542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbmB"
FT                   /locus_tag="BCAN_A0533"
FT                   /product="L-glutamine:2-deoxy-scyllo-inosose
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61610"
FT                   /db_xref="GOA:A9M946"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9M946"
FT                   /protein_id="ABX61610.1"
FT                   /translation="MDIPVYSPYLCGNFKKYVNECLDTGWISSRGEFISRFEDAFAQYV
FT                   DVPSATSVANGTVALHLALDALGIGAGDEVIVPTFTYIASVNTILQTGATPVYVDSLEN
FT                   TLQIDPEGVRLAITERTKAVMVVHLYGHPCDMDSIREICDEKSLLLVEDCAEGFGTKWK
FT                   NSHVGTFGDVATFSFFGNKTITTGEGGMVLARNPQVMEKCRHLKSQGTSPTREYWHDAL
FT                   AYNYRMTNIQAAIGLSQIEMADEILSLKARTAASYASKLAGLPLRMHTPVGDVKHSYWM
FT                   CSIVLDNSEHREPLRQHLRENGVDTRPFFPPAHRMPHSASTGSYPVADSLSARGLNLPS
FT                   LPHITDVEISFVCDLVRSYFSNHSNHI"
FT   gene            complement(519550..520638)
FT                   /gene="gmd"
FT                   /locus_tag="BCAN_A0534"
FT   CDS_pept        complement(519550..520638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="BCAN_A0534"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="GO_function: GO:0008446 - GDP-mannose
FT                   4,6-dehydratase activity; GO_process: GO:0000271 -
FT                   polysaccharide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61611"
FT                   /db_xref="GOA:A9M947"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M947"
FT                   /protein_id="ABX61611.1"
FT                   /translation="MKKVALITGITGQDGAYLAELLLQKGYAVHGIKRRTSQFNTARID
FT                   HLYHDPHEQGVDLTLHHGDLTDTSSLVRIMQLVRPDEVYNLGAQSHVAVSFEEPEYTAN
FT                   SDALGALRLLEAIRILGMEKQTRYYQASTSELYGLVQEIPQKETTPFYPRSPYAAAKLY
FT                   AYWITVNYREAYGIYACNGILFNHESPLRGETFVTRKITRALARIKIGNQNRLYLGNLD
FT                   SLRDWGHARDYVEMQWLMLQQDQPEDFVIATGKQYSVREFVTLAAKDIGIEMRWEGSGE
FT                   AEKGYDAKTGACIVEVDPRYFRPAEVETLLGDATKAHQKLGWKPKISFETLVSEMIAED
FT                   LAAAARENLLREHGHQFFAPKE"
FT   gene            521157..521585
FT                   /locus_tag="BCAN_A0535"
FT   CDS_pept        521157..521585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61612"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9M948"
FT                   /protein_id="ABX61612.1"
FT                   /translation="MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRT
FT                   GSPWAEVPERYGPPTACYNRFVRWRKAGVWDRLLEAVSKAYDGDIVMIDSTCVRVHQHA
FT                   ATGKKGMETMVAWDVPAAGLRAKSTRSLMPKVARSIYV"
FT   gene            521504..521878
FT                   /locus_tag="BCAN_A0536"
FT   CDS_pept        521504..521878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0536"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61613"
FT                   /db_xref="GOA:A9M949"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A9M949"
FT                   /protein_id="ABX61613.1"
FT                   /translation="MGRSRGGLTSKIHALVDAEGRPVNLRLTGGQIADCAEADALTNEF
FT                   GEGDILLADKGYDTNAIRARCLVPACDGVELSPTQRRELRDKFFTAAPRPRTPFEQSYS
FT                   DRKLRPRSLRGGTASMRKRS"
FT   gene            521908..522702
FT                   /locus_tag="BCAN_A0537"
FT   CDS_pept        521908..522702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0537"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61614"
FT                   /db_xref="GOA:A9M950"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A9M950"
FT                   /protein_id="ABX61614.1"
FT                   /translation="MPMGPKERRSTVLAPVEEAAIVALRVQARLPLDDVYIALKDVIPH
FT                   LTCSSLHRCLQRHGISRLPKGDREKPKKFKDYEIGYFHIDIAELRYEGGKGFLFVAVDR
FT                   TSKLVFARIYRKATKLAAAGFLKSLIRTVPYRIHTILTDNGVQFVQREQGTGLTFSHIF
FT                   GRVALEHGIEHRLTKPYHPWTNGQAERMVRTIKEATVKSFHYSSINEMRRHVRDWLTAY
FT                   NFAKQLKALKFKTPYEAIHELWKSKPEAFIVKPHHHMMGPNT"
FT   gene            522772..523140
FT                   /locus_tag="BCAN_A0538"
FT   CDS_pept        522772..523140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0538"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61615"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9M779"
FT                   /protein_id="ABX61615.1"
FT                   /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAAN
FT                   AAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHALADTPDFEYVLIDSTISKVHADA
FT                   AGAKGGLKLPASVARAVD"
FT   gene            523137..523415
FT                   /locus_tag="BCAN_A0539"
FT   CDS_pept        523137..523415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0539"
FT                   /product="transposase for insertion sequence element
FT                   IS6501"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61616"
FT                   /db_xref="GOA:A9M9F2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F2"
FT                   /protein_id="ABX61616.1"
FT                   /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHVI
FT                   ADAAYDADHLRAFIASDLKATAQIQGQSNTFQCPNNRLEAVQGTPSD"
FT   gene            523532..523771
FT                   /locus_tag="BCAN_A0540"
FT   CDS_pept        523532..523771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0540"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61617"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F3"
FT                   /protein_id="ABX61617.1"
FT                   /translation="MQTRPKVAERKAWANIPPKSNRKDSFVFSRWVCRQRSLVERFFNR
FT                   IKQFRDIATRYDKRPENYLAAVKLVATRIWCQSL"
FT   gene            523902..525020
FT                   /locus_tag="BCAN_A0541"
FT   CDS_pept        523902..525020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0541"
FT                   /product="mannosyltransferase"
FT                   /note="GO_process: GO:0009058 - biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61618"
FT                   /db_xref="GOA:A9M9F4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F4"
FT                   /protein_id="ABX61618.1"
FT                   /translation="MRIGVDARNLVNNITGISRYVMENCRELYERGHELVLYTPEKPRV
FT                   QLSSSEGFDFRVSNFQGPAGRLFWSQTVLPLQLRKDRIDVFWGPAHRLPALKGAIPSVV
FT                   SIHDLVWYYASSTMRLQGWLADRFLMKGALRNADQIVAVSYATSSAISSVFPQYTSKIQ
FT                   MVYPGVSHFNRIGTSNILKEHRINKSYGLFIGTLEPRKNLIRLLEAYANLPECVRNNFL
FT                   LVVAGGKGWNLGDIGKTINRLGIAEYTRLTGYVTDSDLNDLYRNARTLLMPSLYEGFGL
FT                   PIIEAQAYGVPVITSNCSSMPEVAGDAAILVDPLNVAEISNALYRIATDNKLWQRKSLL
FT                   ALQNIERFNWHNSIEKLESVFIKARESKLMTY"
FT   gene            525541..525882
FT                   /locus_tag="BCAN_A0542"
FT   CDS_pept        525541..525882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0542"
FT                   /product="transposase"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61619"
FT                   /db_xref="GOA:A9M9F5"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F5"
FT                   /protein_id="ABX61619.1"
FT                   /translation="MLHAFPKAKDLLADKGYDADWFRDALAERKITACIPSRANRKDVI
FT                   PYDPVLYKRRHKIENMFGRLKDWRRIHTRYDRCAHTFFSSICIAAAVTVLQINSDFNVL
FT                   KNVSTIALS"
FT   gene            complement(525777..525902)
FT                   /locus_tag="BCAN_A0543"
FT   CDS_pept        complement(525777..525902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0543"
FT                   /product="IS3 family element, transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61620"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F6"
FT                   /protein_id="ABX61620.1"
FT                   /translation="MSGTGNCYDNAMVETFFKTLKSELIWRTVTAAAMHMLEKKV"
FT   gene            525901..525942
FT                   /locus_tag="BCAN_A0544"
FT   CDS_pept        525901..525942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0544"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61621"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F7"
FT                   /protein_id="ABX61621.1"
FT                   /translation="MEIVMLLAFSFAW"
FT   gene            complement(525972..526559)
FT                   /locus_tag="BCAN_A0545"
FT   CDS_pept        complement(525972..526559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0545"
FT                   /product="hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61622"
FT                   /db_xref="GOA:A9M9F8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9F8"
FT                   /protein_id="ABX61622.1"
FT                   /translation="MRQLFSSGLRQMREQSSELFSCRTVDEVSIHRSGEEGIPHISSLP
FT                   CHGRKPKWLFRLEYRPVRRRQRDDLVMLAHMRTAWSLGRHRIARLIRENAMQARQKRRF
FT                   RKTSDSHHAFPVAPNILAQDFAATGPNQKWDADISYIWTKEGWLHLAGVIGRFARRVVG
FT                   WSVSDRLHRQLALQALEKAITMRRPPKGLIHH"
FT   gene            526691..527119
FT                   /locus_tag="BCAN_A0546"
FT   CDS_pept        526691..527119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61623"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A9M948"
FT                   /protein_id="ABX61623.1"
FT                   /translation="MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRT
FT                   GSPWAEVPERYGPPTACYNRFVRWRKAGVWDRLLEAVSKAYDGDIVMIDSTCVRVHQHA
FT                   ATGKKGMETMVAWDVPAAGLRAKSTRSLMPKVARSIYV"
FT   gene            527038..527454
FT                   /locus_tag="BCAN_A0547"
FT   CDS_pept        527038..527454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0547"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - transposition, DNA-mediated"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61624"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G0"
FT                   /protein_id="ABX61624.1"
FT                   /translation="MGRSRGGLTSKIHALVDAEGRPVNLRLTGGQIADCAEADALTNEF
FT                   GEGDILLADKGYDTNAIRAKAAARKAWANIPPKSNRKGSFVFSRWVYRQRNLVERFFNR
FT                   IKQFRGIATRYDKRPENYLAAVKLVATRIWCQSL"
FT   gene            527814..528113
FT                   /locus_tag="BCAN_A0548"
FT   CDS_pept        527814..528113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0548"
FT                   /product="Transposase for insertion sequence element IS629"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61625"
FT                   /db_xref="GOA:A9M9G1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G1"
FT                   /protein_id="ABX61625.1"
FT                   /translation="MSVRYSERLAEVGIEPSVESVGDSYDNALAETISGLYKAEVIHRR
FT                   GPWRNFEALECVTLEWVDWFNHRCLMEAIGKILPAEAERTILCHTGRASHGRIT"
FT   gene            528345..529682
FT                   /gene="manB"
FT                   /locus_tag="BCAN_A0549"
FT   CDS_pept        528345..529682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="BCAN_A0549"
FT                   /product="Phosphomannomutase"
FT                   /note="GO_function: GO:0016868 - intramolecular transferase
FT                   activity, phosphotransferases; GO_process: GO:0005975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61626"
FT                   /db_xref="GOA:A9M9G2"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G2"
FT                   /protein_id="ABX61626.1"
FT                   /translation="MVYVSAFLQHLSHNFSYETVYVGADLRESSPKITISCYRAIELTG
FT                   RRAIWAGNVPTPALAAYAMARNAPAIMITGSHIPEAYNGIKFYRPDGEFLKDDEAPVRG
FT                   LAEELLSKVVDGQRSVNLPAPLADVAEEYVSRSIGAFGRDTLAGMKIGIDLHSAVGRDI
FT                   LVRIFKGLGAEVYPFRRTENFVAVDTEALDPADISRARTFIAEHGLDAVVSTDGDGDRP
FT                   LVIDDQGRQVNGDTLGILTARYLRAKTVVTPLSTTSALEESGWFENIHRTRIGSPYVVV
FT                   EMARAVAHPVVGFEANGGFLLGDDVALKTGLLRRLPTRDAVLPAVAVLAQAKDQGMRLS
FT                   EMVATLPSRFMKADRVKEVPGDRAAPFLHAIETSQSFRSNFSPLIAEPEAISTVDGVRM
FT                   AFANGDTVHFRQSGNAPEMRIYIETDSAEKTDRMLSEFIAKLSETI"
FT   gene            529707..531131
FT                   /locus_tag="BCAN_A0550"
FT   CDS_pept        529707..531131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0550"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="GO_function: GO:0004476 - mannose-6-phosphate
FT                   isomerase activity; GO_process: GO:0009103 -
FT                   lipopolysaccharide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61627"
FT                   /db_xref="GOA:A9M9G3"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G3"
FT                   /protein_id="ABX61627.1"
FT                   /translation="MREMLMRPVVLAGGKGTRLWPMSRSQRPKQFLALTGELSLFQMTL
FT                   KRLSDPNRYSSPIIITNADYRFLVAEQALECGVELSDVILEPMARNTAPAIAAAALIAS
FT                   KDEQTLIHVVASDHNIEINDAYFQAVDTACNAARMGRLATFGITPTEPATGFGYIEAGE
FT                   LEESGACAIKRFVEKPKEEVAREMLAAGGFYWNSGMFLFRSDVFLDECRRYAPAVYEAA
FT                   EASVATAQRDLDFVRLNSAEFEKAPDISVDYAIFEKTKLASVVPSPIHWSDLGSWDAVW
FT                   KESKQDPSGNVARGPVSLHNTNNSLVLSEGVHVAVNGVDDLTIVASEDALYVGKLSEAQ
FT                   GVGTIVKALMKQPATAKLAEEHRTIYRPWGGYTHLLSGDRFQVKRLFIKPGKQLSLQKH
FT                   HHRSEHWVVVRGVAEIVIDDKSLFLSENESTYISQGAIHRVSNPGKILLELIEVQTGAY
FT                   LGEDDIVRFEDDFGRV"
FT   gene            531164..532336
FT                   /locus_tag="BCAN_A0551"
FT   CDS_pept        531164..532336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0551"
FT                   /product="Hypothetical protein"
FT                   /note="GO_function: GO:0004476 - mannose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006013 - mannose
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61628"
FT                   /db_xref="GOA:A9M9G4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G4"
FT                   /protein_id="ABX61628.1"
FT                   /translation="MNDVIRKLQVEVERLSSWLHNDALPLWLSAGVDAPNSGFFERIGQ
FT                   DGVATDADNRRSRVHPRQIYCFAKAGAMGWQGEWKQTVEAGIEYYDRVYRREDGFYGSL
FT                   AGQSGKMIDHTFDLYNQAFSVFAAAQIAVSIPDRFDEMRQRALGLMNTLVADYHHPLGG
FT                   FEEANPPKLPLCSNPHMHLFEAMLAWETVDPETRFWSTYADEIANLALTKFIDGKTGAL
FT                   REFFDHDWKPYPGDKGRVVEPGHQFEWSWLMGQWADRRQNGDGMMAAKRLFQIAVDRGV
FT                   CEQRKVAIMSLYDDFSVHDSLARLWPQTEWIKSALLFASLSKDEERVYYLQSALRAIDA
FT                   LRPFLETPIKGLWYDKWPEGGTLIDEPAPASTFYHILCACYEAEKTISEL"
FT   gene            532419..533528
FT                   /locus_tag="BCAN_A0552"
FT   CDS_pept        532419..533528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0552"
FT                   /product="probable glycosyltransferase protein"
FT                   /note="GO_process: GO:0009058 - biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61629"
FT                   /db_xref="GOA:A9M9G5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G5"
FT                   /protein_id="ABX61629.1"
FT                   /translation="MRVLHFFKTYWPDTFGGIERTIHAIAKGVAEHGIASDVLSLSAKP
FT                   EENTRNFDGHMAYKAKLDLEFASTGLSRDVFSRFRELSSQADVIHYHFPWPMSDIVQIG
FT                   VRPDKPTIVTYHSDIVKQKLLLQFYRPLMNRFLGSVDRIVATSPNYLATSDVLQRFSDK
FT                   TTVIPLGLDESDYSAADATTKARWRERFPRPFFLFVGVLRYYKGLRTLLAAARTSDIDI
FT                   VIVGDGPMKPQLIAYANEHNLSHVHFAGALPDTDKTALLELSAGLIFPSHLRSEAFGLS
FT                   LVEASMFGKPMISCEIGTGTSYVNLNGQTGIVVPPQNPEALSAAMRSIAHDTEQAKVFG
FT                   MNARARYIEHFTADKMALEYAKNYTSLMQ"
FT   gene            complement(534009..534188)
FT                   /locus_tag="BCAN_A0553"
FT   CDS_pept        complement(534009..534188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0553"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61630"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G6"
FT                   /protein_id="ABX61630.1"
FT                   /translation="MSCAPASFDNPAARELLPKLYVRKLIFRVEVRKAKILGRTQRVAR
FT                   LKIAPFHKIYGGIF"
FT   gene            534220..535755
FT                   /gene="rbsA"
FT                   /locus_tag="BCAN_A0554"
FT   CDS_pept        534220..535755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="BCAN_A0554"
FT                   /product="Ribose import ATP-binding protein rbsA"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61631"
FT                   /db_xref="GOA:A9M9G7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G7"
FT                   /protein_id="ABX61631.1"
FT                   /translation="MTAPRQAGEPALLEAVSLSKSFGPVQVLENINLRVNGGEIHAIIG
FT                   ENGAGKSTLMKILAGNERQTGGEIRIDGKPVSFSSPAAAEARGIVLVHQEILLAPDLTV
FT                   AQNIYLGRELGGKRGRGLLVDDRSMREGARRAIRDLGAEIDPDAVVATLSIAQRQLVQI
FT                   ARVLLVPHRLVIFDEPTASLTPFETEALLKVIRDIRAKGVAVLYISHRLPEVKEIADRV
FT                   TVLRDGKLVSSHLASSLQPADMARLMVGRDVAKLYPDRASRYDSAAILEVENFSVPGFV
FT                   RNASFCLNRGEILGFAGLVGAGRTELMEGIVGLRPAKGELRHDGRLVHFNNAHDSQQAG
FT                   IVYLSEDRKGKGLLLSKDLGTNLTLASLDRFVRGLQIDRNRERAALDEAIRAFDIRTGR
FT                   KDILAGQLSGGNQQKLLLAKMMMLTPSIIIIDEPTRGIHVGTKEQIYQFIANLADEGKS
FT                   IIVVSSEMPELIGICDRIVVMREGQIAGEVSGAGMTEHEIVALATGVGANEAA"
FT   gene            535776..536777
FT                   /locus_tag="BCAN_A0555"
FT   CDS_pept        535776..536777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0555"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61632"
FT                   /db_xref="GOA:A9M9G8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G8"
FT                   /protein_id="ABX61632.1"
FT                   /translation="MTEVATDKGRVAKTSRDWDLRAVAPFVALLLLLILGTIANPNFIS
FT                   IDNLLNVATRSAFIAIIALGATYVISSGGLDLSVGAMVAFVASIMILFMNSGMIADPVL
FT                   MLIAAVMLALVVGAACGLLNGIITTVGGIEPFIATLGTMGIYRGLTTWLSQGGAITLRN
FT                   PEIQSLYRPAYFGSVLGVPVPVIVIFVTAALAAFVLYRTRYGRHIIAVGSNEDVARYSG
FT                   ISVKKVRTIAFVIQGLCVAVAVLLYVPRLGSTSATTGLMWELQAITAVVVGGTALRGGV
FT                   GRIWGTICGAFILEIIGNIMLLSSFVSEYLLGAIQGAIIIIAMLVQRSLSRR"
FT   gene            complement(536604..537587)
FT                   /locus_tag="BCAN_A0556"
FT   CDS_pept        complement(536604..537587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0556"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61633"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9G9"
FT                   /protein_id="ABX61633.1"
FT                   /translation="MNVGAIGLLDSFENANQHVVILRPDHINLRIFGQEVLHHAEGIVA
FT                   VPVTILAVKHLDIGALDTLIETVLALLIDRDWQAANDDDLCIRGRGLDIFTGHLPQCGV
FT                   VTSHVKIADGIVVVARRAVYQSDEGPLVLDLLDGVDQRIGISRRDNEAIQPLHCQILQS
FT                   IGLRCGIGRRLDDDVEARMLLHQKLRHTLGVIDDACRPAMVGSRDRHADRHFLILCACC
FT                   TGKSQRARRQCSESKLHQIPSHGLPPSKRGALIPLWLESPQQFRQSIDLSSGQRTLHQH
FT                   SDNYDCALNCTEQIFADKARQQHDIADNFQNEGAADRTPDAPHAAT"
FT   gene            536856..537818
FT                   /locus_tag="BCAN_A0557"
FT   CDS_pept        536856..537818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0557"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61634"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H0"
FT                   /protein_id="ABX61634.1"
FT                   /translation="MRRNLMKLAFAALTAGALAFAGAASAQDKKVTIGVSIPAADHGWT
FT                   AGVVYHAERVAKLLMEEHPGLNVIVKTSPDAASQANALQDLAVQGLDGLVVPPTDPDPL
FT                   VNAIKEIKDKGTFVALVDRAPSNNDNTIRDLYVAGNNPALGQVAGEYIKATTPDAQVVV
FT                   IRGLPIPIDQQRQDGFDKGIEGSNVKVLDRQYGNWNRDDAFRVMQDFLTKYPKIDVVWA
FT                   QDDDMLVGVLEAIKQSNRSDIQYVVGGAGSKDMIKRVMDGDKLVPVDVLYPPAMVSTAM
FT                   ELAAGHFYDQISVSGDYILDATLVTKDNAKDFYFPDSPF"
FT   gene            537876..538928
FT                   /locus_tag="BCAN_A0558"
FT   CDS_pept        537876..538928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0558"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61635"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H1"
FT                   /protein_id="ABX61635.1"
FT                   /translation="MKTIKGPGIFLGQFASDEAPFNTWDGITRWAAEKGYAGVQVPTWA
FT                   SQLIDLKKASESRDYCDEFAGVARENGVEVTELSTHLQGQLVAVHPAYDEAFDGFAVPE
FT                   VRGNPQARQQWAVEQVKMAIRASRNLGIGAHATFSGALAWPFVYPWPQRPAGLVETAFD
FT                   ELARRWMPILDHADEHGVDICYEIHPGEDLHDGVTFEMFLERVKNHKRANMLYDPSHYV
FT                   LQCLDYLDNIDIYKDRIKMFHVKDAEFNPTGRQGVYGGYQGWVNRAGRFRSLGDGQVDF
FT                   GAVFSKMAANDFDGWAVVEWECALKHPEDGAREGAEFVRAHIIRVTDKAFDDFASGGTD
FT                   EAANRRMLGL"
FT   gene            538936..540108
FT                   /locus_tag="BCAN_A0559"
FT   CDS_pept        538936..540108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0559"
FT                   /product="oxidoreductase domain protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61636"
FT                   /db_xref="GOA:A9M9H2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H2"
FT                   /protein_id="ABX61636.1"
FT                   /translation="MTIEAKIKETSASRIRLGMVGGGAGAFIGGVHRMAARLDNRFDLV
FT                   AGALSSSPERAQASGRELGLAEDRIYSSYKDMAIREARLKNGIEAVSIVTPNHVHYDAA
FT                   KEFLRRGIHVICDKPLTSTLADAKKLKKVADESGALFILTHNYTGYPMVRQAREMIANG
FT                   DLGDLRVVQVEYAQDWLTEAVEATGAKGAVWRTDPVQSGLGGATGDIGTHAFNLASFVT
FT                   GLTLDSLAADLDSFVEGRRLDDNAHVMLRFEGGAKGMLWCSQVAPGNENALRLRVYGTK
FT                   GGIEWAQEDPNWLWFTPFGEQKRLITRGGAGVGPAATRVTRVPAGHPEGYLEAFATIYS
FT                   EAANAIEAHRNGKKPDRAVVYPTVEDGLKGVAFIDACVRSSRKNGGWVKL"
FT   gene            complement(540150..541457)
FT                   /gene="xylA"
FT                   /locus_tag="BCAN_A0560"
FT   CDS_pept        complement(540150..541457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="BCAN_A0560"
FT                   /product="xylose isomerase"
FT                   /note="GO_function: GO:0009045 - xylose isomerase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61637"
FT                   /db_xref="GOA:A9M9H3"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M9H3"
FT                   /protein_id="ABX61637.1"
FT                   /translation="MSTGFFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRF
FT                   AVAYWHSFAWEGGDPFGGRPFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDADV
FT                   RPEGRNFAENTRYLNEIVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPDVFA
FT                   FAAATVKTCIDATKRLGGENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEYKHKI
FT                   GFKGTILIEPKPQEPTKHQYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHE
FT                   LALARTLGIFGSIDMNRNDYQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGGTNFDAK
FT                   LRRQSLDPQDLLIGHIGGMDCCARGLKAAARMLEDGALSKPLDERYAGWNGEFGKRLLS
FT                   GLSLDQIAGEVEAKDINPQPKSGRQEYLENIVNRYV"
FT   gene            complement(541504..542955)
FT                   /gene="xylB"
FT                   /locus_tag="BCAN_A0561"
FT   CDS_pept        complement(541504..542955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BCAN_A0561"
FT                   /product="xylulokinase"
FT                   /note="GO_function: GO:0004856 - xylulokinase activity;
FT                   GO_process: GO:0005997 - xylulose metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61638"
FT                   /db_xref="GOA:A9M9H4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H4"
FT                   /protein_id="ABX61638.1"
FT                   /translation="MYLGLDLGTSGVKALLIDEAQNPVGAAHGELDVSRPHPGWSEQDP
FT                   AQWIKACRTAIEALRAAHPKEFSAITGIGLSGQMHGATLLDAEDRVLRPCILWNDTRSY
FT                   REAAELDADPAFHAITGNIVFPGFTAPKLVWVARNEADIFARIRKVLLPKDYLRLWLTG
FT                   EYISDMSDSAGTSWLDTGARRWSAELLAKTGLGEGQMPQLVEGSEAAGCLRAELAAEWS
FT                   LTASVIVAGGAGDNAASACGMGTVKPGHAFVSLGTSGVLFAANGAYQPKPESAVHAFCH
FT                   ALPRTWHQMGVILSAASALEWYSKIVGATPQSLDRELGETLKAPGSVTFLPYLSGERTP
FT                   YNDAKIRGSFCGLEHEADRSALTQAVLEGVAFAIRDNLLALQSAGTEITSLTAVGGGSR
FT                   STYWLKAIATALNVPIALPEEGDFGAAFGAARLGLIAATGADPFTICTPPQTARTIEPE
FT                   QALLSAYDEAYQRYHALYPALHALD"
FT   gene            complement(542988..544019)
FT                   /gene="degA"
FT                   /locus_tag="BCAN_A0562"
FT   CDS_pept        complement(542988..544019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degA"
FT                   /locus_tag="BCAN_A0562"
FT                   /product="HTH-type transcriptional regulator degA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61639"
FT                   /db_xref="GOA:A9M9H5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H5"
FT                   /protein_id="ABX61639.1"
FT                   /translation="MKPTVHDIARTAGVSLATVDRVLNDRPGVRAKTRDRVMAAMNMLG
FT                   YVRDVGAANLARGRLYQFDFILPDNENTFMLSLRSELYAASERALAERVRINLRLVPAF
FT                   DEAALVAALDESAARKPDGVAFVALDTDPVREGCARLAEKGIHAVTLVSDLGQSAREHY
FT                   VGVDNGAAGRTAARLLGLFANGTEGSIAVVAGSLKVRDHRERFDGFRAAMQADFPDREI
FT                   LPVLEGFDKDPQVEKLVGELLAKRSDIAGIYSLGAGNSGLVAALSAHKANHPLVIAHER
FT                   DEITSKALEDGIIHAILAQDAGHEIRSAIRVLKASADRLAIVPGQEYIRIEIFLKDNLP
FT                   RFN"
FT   gene            complement(544281..545351)
FT                   /locus_tag="BCAN_A0563"
FT   CDS_pept        complement(544281..545351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0563"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61640"
FT                   /db_xref="GOA:A9M9H6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9H6"
FT                   /protein_id="ABX61640.1"
FT                   /translation="MNRELFLSTDMVDATQRDDFWREAVKLIYDVMSSDDQSGKGFKGT
FT                   LRSQQFGTCLIGSATSNGQNYQRTPSIIAQSDMDHYVLQAMIAGRMTGDFNGTNVSAKP
FT                   GDIVILDLLQTVSSSVEAGERITIVIQRGELEKLVGWRNLHGMVLPGEAPTTRLLFEYL
FT                   RGLDAVAAELPPNEALAAQEAMLTLLSASITSKEEEAIENTPANLPMRHRIITYIDENL
FT                   TNPLLGPHSIMQHFHLSRSHLYRAFEPDGGVAKVIRDKRLDLAYRILIDRKGKPTSLKE
FT                   IAYCCGFNDRTQFTKAFKARFELSPKEARETGAPLPQAPSGALILHSHLSEQAAKIASE
FT                   HATTSTKAPPSAPVKP"
FT   gene            complement(545890..547353)
FT                   /gene="betB"
FT                   /locus_tag="BCAN_A0564"
FT   CDS_pept        complement(545890..547353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BCAN_A0564"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="GO_function: GO:0008802 - betaine-aldehyde
FT                   dehydrogenase activity; GO_process: GO:0006578 - betaine
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61641"
FT                   /db_xref="GOA:A9M9H7"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M9H7"
FT                   /protein_id="ABX61641.1"
FT                   /translation="MKAQPKASHFIGGAFVEDKAGKPLPVIYPATDEEIASLYSATPGI
FT                   IEAAYAAALKAQGEWAALKPVERGRILRRTAEILREKNRKLSKLETLDTGKALQETLVA
FT                   DAASAADALEFFGGIISGFNGEFVELGGSFAYTRREALGICVGIGAWNYPIQIAAWKSA
FT                   PALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHRLTAK
FT                   VSLTGSVPTGRRIMAQAGEQLKHVTMELGGKSPLIVFDDADLESAIGGAMLGNFYSTGQ
FT                   VCSNGTRVFVHKNIRERFIERLVERTRKIRIGDPFDEATQMGPLISAAQRDKVLSYIKK
FT                   GKAEGATLACGGGVPKLQGFDKGFFIEPTVFADVTDTMTIAREEIFGPVMSVLEFSDED
FT                   EVIARANDSEFGLAAGVFTADLSRGHHVIGQIKAGTCWINAYNLTPVEVPFGGYKQSGI
FT                   GRENGIAALAHYSQIKTVYVEMGKVDSPY"
FT   gene            complement(547539..549188)
FT                   /gene="betA"
FT                   /locus_tag="BCAN_A0565"
FT   CDS_pept        complement(547539..549188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BCAN_A0565"
FT                   /product="Choline dehydrogenase"
FT                   /note="GO_function: GO:0050660 - FAD binding; GO_process:
FT                   GO:0006066 - alcohol metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61642"
FT                   /db_xref="GOA:A9M9H8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M9H8"
FT                   /protein_id="ABX61642.1"
FT                   /translation="MEADFVIIGSGSAGSAMAYRLSEDGRYSVIVIEYGVPDVGPLIQM
FT                   PAALSFPMNMETYDWGFSSEPEPHIGGRSLVTPRGKVLGGSSSINGMVYVRGHACDFDH
FT                   WSQSGARGWAYADVLPYFKRMENSQGGQEGWRGTNGPLYVQRGKRDNPLFHAFVEAGHQ
FT                   AGFEVADDYNGEKQEGFGPMEQTIHNGRRWSAANAYLKPALKRPNVKLVKGFARKIVLE
FT                   GKRAVGVEIEAGRTFSTIRARREVIIAASSINSPKLLMLSGIGPAAHLKEHGIDLVADR
FT                   PGVGQNLQDHLEVYIQQECTQPITLYSELNLFSKARIGVEWLLFKTGDGATNHFESAAF
FT                   VRSKAGVEYPDIQYHFLPVAIRYDGKAAAQSHGFQAHVGPMRSKSRGSVTLRSANPREK
FT                   PVIKFNYMSHEDDWADFRHCVRLTREIFGQAAFDPYRGAEIQPGAHVQTDDEIDNFIRE
FT                   HVESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFPRITNGNLNGPSIMV
FT                   GEKASDHILGRTPLARSNQEPWINPRWQVSDR"
FT   gene            complement(549191..549787)
FT                   /gene="betI"
FT                   /locus_tag="BCAN_A0566"
FT   CDS_pept        complement(549191..549787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="BCAN_A0566"
FT                   /product="HTH-type transcriptional regulator betI"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61643"
FT                   /db_xref="GOA:A9M9H9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M9H9"
FT                   /protein_id="ABX61643.1"
FT                   /translation="MPKIEMEPLRRRELIDAAIRTIGQRGSLDVTVAQIAHEAGVSPAL
FT                   AHHYFGGKDKLILATMRHLLRELGRDLNAAIKQANTPHERIAAIIAVNFSAAQFAQETI
FT                   AAWLTFYVHAQQSDDIKRLLRIYARRLHSNLVFALEQLTSRARANRIAEGAGAMIDGLY
FT                   IRHALGADAPDAASAIALVEDYIAIQLSGQPSAEN"
FT   gene            549978..551000
FT                   /locus_tag="BCAN_A0567"
FT   CDS_pept        549978..551000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0567"
FT                   /product="L-asparaginase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61644"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I0"
FT                   /protein_id="ABX61644.1"
FT                   /translation="MESNPVLVEVYRGPVVESRHRGAIAVVDGDGRNVFSLGDIERPTF
FT                   PRSAIKSIQALPLVESGAADAFGFENADLAMACASHSGEEEHVARAASMLQKAGLDSTA
FT                   LECGSHWPFQQPVLVKLAQSGRQPTPLHNNCSGKHAGFLAACVHCGMETKGYVALGSSI
FT                   QDMVRDTMEAVTGAPHSIDHCGTDGCSIPTYAIPLSNLAHGFAKMATGAGLGDKRAKAA
FT                   QRLIHACMAEPFYVAGTKRACTELMRMAPGRIFVKTGAEGVFCGSVPELGFGFAMKCDD
FT                   GATRASEAMVAAVLSRLFRKDEALSAKLADFASPEMKNWNGIPLGSVTPAAVLGTAQIG
FT                   "
FT   gene            551045..551515
FT                   /gene="greA"
FT                   /locus_tag="BCAN_A0568"
FT   CDS_pept        551045..551515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BCAN_A0568"
FT                   /product="Transcription elongation factor greA"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61645"
FT                   /db_xref="GOA:A9M9I1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I1"
FT                   /protein_id="ABX61645.1"
FT                   /translation="MSRAFTKEQDDAPTDLGERPISPHRNLVTPAGLKQIDDELARLQH
FT                   DLAEANIAGERSAVARISRDLRYWMARRETAELSVPAPDSHVVRFGMTVELENLDDGST
FT                   RRWTIVGEDEADPSRGKISHVAPVSILLFGKPVGDVVKINGTEWEIVSLKVN"
FT   gene            complement(551512..551901)
FT                   /locus_tag="BCAN_A0569"
FT   CDS_pept        complement(551512..551901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0569"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61646"
FT                   /db_xref="GOA:A9M9I2"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I2"
FT                   /protein_id="ABX61646.1"
FT                   /translation="MIDFHSRVFIEALHQEQLRLHGGATGIRDSSLLDSALARAQHKEA
FT                   YGNPDIFDLAAAYLFGILKNHPFIDGNKRTGLAAADLFLYFNGYSLEAEQEDVIQLVLM
FT                   VTTSEIDETGAAAFFRDHAVVINDD"
FT   gene            complement(551898..552128)
FT                   /locus_tag="BCAN_A0570"
FT   CDS_pept        complement(551898..552128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0570"
FT                   /product="addiction module antidote"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61647"
FT                   /db_xref="GOA:A9M9I3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR013432"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I3"
FT                   /protein_id="ABX61647.1"
FT                   /translation="MNITLRKIGNSYGVIIPKEVLERLNLQTGDTLTLTTDENGLRLAR
FT                   STEDAEVLEKKMQIARERMKKYETAYRVLAQ"
FT   gene            complement(552189..553181)
FT                   /locus_tag="BCAN_A0571"
FT   CDS_pept        complement(552189..553181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0571"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0046873 - metal ion transporter activity; GO_process:
FT                   GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61648"
FT                   /db_xref="GOA:A9M9I4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I4"
FT                   /protein_id="ABX61648.1"
FT                   /translation="MITLYCLSGDHLEQIDVEPGTPLPDNVIWIDIFTPGVSEDHIVEA
FT                   WTGISIPTREDMTEIEESSRFYMESGAQYLTVPILHAVDLDHRELAPVTFITHGARLIT
FT                   VRYANPKSFSIYISRVTKPGNGLIPAKCTGISIMLGIIEATTNRLADILEGVAGKIDAA
FT                   SHSIYRRQPKAHPMTTEDFRHVLTQIGGQGTFLSRTRESLAGLSRMLVYLSANNSPVSA
FT                   KKDTRSWIKSLERDAQSLTAYVDFLANKVTFLLDTIVGLISVEQNAIIKIFSVAAVGFM
FT                   PPTLVASIYGMNFSFMPELHSPWGYPMALIFMVASALLPLLYFRSKGWL"
FT   gene            553337..554014
FT                   /locus_tag="BCAN_A0572"
FT   CDS_pept        553337..554014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0572"
FT                   /product="GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61649"
FT                   /db_xref="GOA:A9M9I5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I5"
FT                   /protein_id="ABX61649.1"
FT                   /translation="MKTISRTNLTESAMQAIRAEITSGRWVVGEKLPNEADLSARLGVS
FT                   RGTVREAVRALVAQGMLETRQGSGTYVRSAADTARSLDRIRHTSLRDRFETRALLETEA
FT                   ARLAAQRATPKIIARLNKLLDERTGRADMDRATFVARDFAFHEAIVAASGNSALAEIYA
FT                   FFSASIRESIEATLDGGLPEPSDEAHRRIVEAIATGDPDKAGATVRSFMAPLIAELERL
FT                   LAS"
FT   gene            554011..555321
FT                   /locus_tag="BCAN_A0573"
FT   CDS_pept        554011..555321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0573"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61650"
FT                   /db_xref="GOA:A9M9I6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I6"
FT                   /protein_id="ABX61650.1"
FT                   /translation="MSHASALPLDGPAGDDILVRSQPPLIDAEADSVPAPDAQRPPSKA
FT                   LRILLGASLVLIAANLRPVFSSVSVLLPEIIQATGMSSVSAGVLTTLPVVCLGAFAPFA
FT                   PRLAQRFGAERTLLFVLIVLTVGTAIRGLGTQSFLYMGAALAGAAIAVGNVLLPGVVKR
FT                   DFPKTAAIMTGLYTMALCAGAASAAGFTIPIKNMLGGSWNLALAFWAVPAALVFVLWLP
FT                   QALRAKHHVAHSGFKVAGLWRDRLAWQVTLFMGLQSSTAYIVFGWLAPILRERGMSAGT
FT                   AGGLVSFSIMAQVITCLLISSIAVRQKNQSFINVFLCGCAVLALIGFLYLPGWAFLPLA
FT                   IIQGIGQGGLIAAAMMVIVLRSPDSHTAAHLSGMAQCVGYILAAIGPLLVGMIHSATGS
FT                   FAACGVLFVLLGLGASINGWGAGRAGHVGVQVSKDSA"
FT   gene            complement(555378..555740)
FT                   /locus_tag="BCAN_A0574"
FT   CDS_pept        complement(555378..555740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0574"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61651"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I7"
FT                   /protein_id="ABX61651.1"
FT                   /translation="MEELIARITSNVGIDAATAEKAVGMILAFLQKEGPADKVQQLLAA
FT                   IPGAEEAVSQVKGGGFLSNLVGGVMGLGTQLMGAGLGMGEISGVAKETIRFAKEKAGDE
FT                   PVDAVVGAIPGLGQFV"
FT   gene            556076..557587
FT                   /locus_tag="BCAN_A0575"
FT   CDS_pept        556076..557587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0575"
FT                   /product="protein of unknown function DUF853 NPT hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61652"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I8"
FT                   /protein_id="ABX61652.1"
FT                   /translation="MTAEDAIFLGASRKPDDTYQQPEYLALQYGNRHGLVTGATGTGKT
FT                   VSLQVLAESFSAAGVPVFCADIKGDLSGIAAAGVLNDGLKKRAAEVKLDPYEMRAAPVI
FT                   FWDIFGEKGHPVRATISEMGPLLLSRLMNLTDAQEGVLNIAFRLADEEGLLLLDLKDLQ
FT                   AILTEMAGRSDELSAKYGNVNKASVGAIQRSLLVLDQQGGSKFFGEPALRIADLMRTTT
FT                   DGRGVVSVLAADKLMMNPRLYSTFLLWLMSELFEELPEVGDPDKPKMVFFFDEAHLLFD
FT                   EAPKALIDRVEQVVRLIRSKGVGIYFVTQNPLDVPETVLAQLGNRVQHALRAYTPRETN
FT                   AVKTAADTFRPNPDFNTFQAITSLGTGEALVSTLQAKGVPSMVQRTLMRPPSSRIGPLT
FT                   PEERAQIIAASPVAGQYDQPLDRDSAFEMLARKAADAAAAQQKTGQEEEGGGGLLGDII
FT                   GTALGTGRRSGRQTVAEAAMKSVARSVGSSLGRALVRGILGGFRR"
FT   gene            557629..557727
FT                   /locus_tag="BCAN_A0576"
FT   CDS_pept        557629..557727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0576"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61653"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9I9"
FT                   /protein_id="ABX61653.1"
FT                   /translation="MVADGFSARDILERIPKSVKRFSEKMRVKTKD"
FT   gene            complement(557785..558501)
FT                   /locus_tag="BCAN_A0577"
FT   CDS_pept        complement(557785..558501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0577"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61654"
FT                   /db_xref="GOA:A9M9J0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J0"
FT                   /protein_id="ABX61654.1"
FT                   /translation="MQTTLTRRSFLTAMTATAATGLAGCAQLGQTVPIIDVDAFGNPAN
FT                   RVPQANVDSSYGGWVQMYAAVEDNGYQLPAIPIQKMDTRYLRQVVPDPTGEMPGTIVID
FT                   TANRFCYLVLDNGQALRYGVGIGREGFAWSGRAVIQYKRQWPRWTPPDEMVARQPELVQ
FT                   YSAKNGGMAPGLKNPLGARALYIFKDGKDTLYRLHGNPEWWSIGKAVSSGCVRFLNQDI
FT                   IDLYDRVPAKTPILVM"
FT   gene            complement(558804..559457)
FT                   /gene="dehII"
FT                   /locus_tag="BCAN_A0578"
FT   CDS_pept        complement(558804..559457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII"
FT                   /locus_tag="BCAN_A0578"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="GO_function: GO:0018784 - (S)-2-haloacid
FT                   dehalogenase activity; GO_process: GO:0006805 - xenobiotic
FT                   metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61655"
FT                   /db_xref="GOA:A9M9J1"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J1"
FT                   /protein_id="ABX61655.1"
FT                   /translation="MSYSSYAFDAYGTLFDVHSAVRRHADKAGPDGRALSELWRAKQLE
FT                   YSWVLSLMGAYSDFWKLTEESLDYALAHYPSVDPALRNDLLDAYWKLDCYPEVPAALKA
FT                   LKDRGARLAILSNGSPAMLEAAVRSAALDVLLDDVISVDMVKKYKTSLAVYELIAVQWR
FT                   LYPSAISFQSSNRWDVAGAVRFGMRGVWINRSNEPDEYKQFPPALILPSLHLLD"
FT   gene            559680..560279
FT                   /gene="sodB"
FT                   /locus_tag="BCAN_A0579"
FT   CDS_pept        559680..560279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="BCAN_A0579"
FT                   /product="Superoxide dismutase (Fe)"
FT                   /note="GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0006801 - superoxide metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61656"
FT                   /db_xref="GOA:A9M9J2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J2"
FT                   /protein_id="ABX61656.1"
FT                   /translation="MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEG
FT                   SGLAGKSLEEIVKESFGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSD
FT                   LGGYDKFRADFIAAGAGQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWE
FT                   HSYYIDYRNARPKYLEAFVDSLVNWDYVLEMYEKAA"
FT   gene            560325..560900
FT                   /locus_tag="BCAN_A0580"
FT   CDS_pept        560325..560900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0580"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61657"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J3"
FT                   /protein_id="ABX61657.1"
FT                   /translation="MRPGIGYDAPASFIIRVLHAWRMDGQLAHRLRRCVFFFAIIGLSL
FT                   DTARQRCRACIGVFALHRIEPALAFGHRGKAAIAVNCDERVAIADKGRIVHAAELADDD
FT                   AAAARRRVAASPRIFAHILADLRLGAGHCGNNGRKSQGKAGQKSQGIDLHGRALQIVEY
FT                   FQDNAAKQILRVAPAIPLKRNRPRRIKA"
FT   gene            complement(560451..560837)
FT                   /locus_tag="BCAN_A0581"
FT   CDS_pept        complement(560451..560837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61658"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J4"
FT                   /protein_id="ABX61658.1"
FT                   /translation="MFCRIILKILYNLECTAMKINSLAFLTSLALALPAVIPTVTSAEA
FT                   QVRKDVSEYAGRRCNTPPRGSGIIVGQFSGVDDSPFISDGDALVAIDRYRCFTTMSECK
FT                   GWLYTMQSKYTNAGAATLARCIKR"
FT   gene            complement(560904..563012)
FT                   /gene="ptrB"
FT                   /locus_tag="BCAN_A0582"
FT   CDS_pept        complement(560904..563012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="BCAN_A0582"
FT                   /product="Protease 2"
FT                   /note="GO_function: GO:0004287 - prolyl oligopeptidase
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61659"
FT                   /db_xref="GOA:A9M9J5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J5"
FT                   /protein_id="ABX61659.1"
FT                   /translation="MPQDFLRPLPPHAPKHPASDARHGITRTDDYAWLRAENWQEVFRD
FT                   PSVLTPEIRAHLDAENAYQAALMKDTENLQKVLFAEMRGRIKEDDSSVPAKDGPYAYGV
FT                   SYRTGGEQPYFIRTPRDGGPETILLDGDREGEGKAYFRLASADHAPNHNLLIWGYDDKG
FT                   SEFYKLKVRDLTTMADLEDIVTDTNGGGAWDAKSEGFFYTRLDENHRPSKVFYHKIGTQ
FT                   QADDKLIYEETDPGFFLGVGGSALDDYIFIDIHDHETSECWLLPADDPSAEPKLVMARK
FT                   AGTEYDIAPGGDVFYILTNADGAKDFKICQAPASAPQPENWQEIVAEKPGRLILSHSAY
FT                   KHHLVWIERDNSLPRIVIHDRKTGEEHAIAFDEEAYSLGLHGSAEYDTDVIRFSYSSMT
FT                   TPEQLFDYNMRTRERTLLKTQEVPSGHNPQDYVTRRILAPAFDGELVPVSLLYHKDTKL
FT                   DGSAPCLLYGYGSYGITIPASFSTSRLSLVDRGFVYAIAHIRGGKDKGFAWYENGKRDK
FT                   KTNTFKDFIAAAQHLVKEGFTSHDRIVAHGGSAGGMLMGAIANMAPQAFGGIIAEVPFV
FT                   DVLNTMLDDTLPLTPPEWPEWGNPIASEADYRTIASYSPYDNVTAQAYPAILAVAGLTD
FT                   PRVTYWEPAKWVAKLRELKTDSHPVLFRINMDAGHAGASGRFSRLEEVAYSFAFALKVV
FT                   GKVPSFKN"
FT   gene            563436..563630
FT                   /locus_tag="BCAN_A0583"
FT   CDS_pept        563436..563630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0583"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61660"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J6"
FT                   /protein_id="ABX61660.1"
FT                   /translation="MTILLQMASSIDISIRDRVGPDYEIRSGGKGWVAIVSRCADNKKL
FT                   KKENLWKIWKQMTKAPSCF"
FT   gene            563585..564013
FT                   /gene="rosAR"
FT                   /locus_tag="BCAN_A0584"
FT   CDS_pept        563585..564013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rosAR"
FT                   /locus_tag="BCAN_A0584"
FT                   /product="Transcriptional regulatory protein rosAr"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0045449 - regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61661"
FT                   /db_xref="GOA:A9M9J7"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J7"
FT                   /protein_id="ABX61661.1"
FT                   /translation="MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHA
FT                   AFKRHVEREEAPVVVEKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQ
FT                   YREKWDLDPNYPMVAPNYAAARSRLAKKMGLGRKPKDA"
FT   gene            complement(564221..564532)
FT                   /locus_tag="BCAN_A0585"
FT   CDS_pept        complement(564221..564532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0585"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61662"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J8"
FT                   /protein_id="ABX61662.1"
FT                   /translation="MMQATLKIDRNAFLANRAQERMNAMQRAALQIIAGIDMDLLMKAS
FT                   KEEKQQASRRLCRLIERERLKGTNGHWSYDLNRHIALKQALDVLEGRTVRRRQMRHYC"
FT   gene            564713..565168
FT                   /locus_tag="BCAN_A0586"
FT   CDS_pept        564713..565168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0586"
FT                   /product="Chromosomal replication initiator DnaA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61663"
FT                   /db_xref="GOA:A9M9J9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9J9"
FT                   /protein_id="ABX61663.1"
FT                   /translation="MELLDVIHTRAQAFEALKRIAARHGRPLNPDALVRLTHRADKKRR
FT                   ERCIELCEALIDLLAASFGASGAEIRSPLRGRQEVSRIRQIGMYVAHTSLGMAMNEVAL
FT                   GFARDRTTVMHACHTVEDLRDDVEFDALVSLFEKIVNSTFTAWRMAA"
FT   gene            565165..565959
FT                   /locus_tag="BCAN_A0587"
FT   CDS_pept        565165..565959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0587"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61664"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K0"
FT                   /protein_id="ABX61664.1"
FT                   /translation="MTRQISAAETRIIRFLKQGGCELQDSVRETHALLVGEQGTIAASR
FT                   LEIERMRKAGTIQCDGQRIALSAMGRKRPKEQKKPTLTAASVRETYEIEPGEKVEINPA
FT                   ESPLAMLYRRRNADGRAFISEDEFRAGERLRADFTRGSLMPSVTSRWDVQAGSGGHYGA
FT                   GGMAELTDIALASRIRVERALEAVGPELSGILIDVCCFLKGLETVERERQWPVRSAKVL
FT                   LKAGLAMLHRHYNPPREGERRRGAVLHWGAEDYRPEIRPRSV"
FT   gene            566050..567387
FT                   /gene="iaaH"
FT                   /locus_tag="BCAN_A0588"
FT   CDS_pept        566050..567387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iaaH"
FT                   /locus_tag="BCAN_A0588"
FT                   /product="Indoleacetamide hydrolase"
FT                   /note="GO_function: GO:0004040 - amidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61665"
FT                   /db_xref="GOA:A9M9K1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K1"
FT                   /protein_id="ABX61665.1"
FT                   /translation="MVGVRDRLEATLARLAARAGEEHVFSKIYAERARAEADAADTRLR
FT                   AGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCDALIVQRLRNAGAVIIGK
FT                   THMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGGSVR
FT                   IPAALNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRTVADAILADAVMAGEKPILPE
FT                   VLPVNGLRIALPKDYLLADMEPDVAAHFEASLAALEKAGAIIADLAVDDLIGRLKEATR
FT                   IGSIAGIEASHIHASTWLADLDANVDIRVKRPLSVRIKVPLEAYHALMETRKALAREMD
FT                   ERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVENLLLRDTQVANQFDLCSITLPMPG
FT                   MKLPTGLMLTARNDSDKRLLAAALSIEKLLEHDPEKCERFSEKDHA"
FT   gene            complement(567428..567853)
FT                   /locus_tag="BCAN_A0589"
FT   CDS_pept        complement(567428..567853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61666"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K2"
FT                   /protein_id="ABX61666.1"
FT                   /translation="MTTTIDSIMSDFEFLDDWEDRYRYVIDLGKELPPYPDDARDAAHK
FT                   VQGCVSQVWLKTLPQDGNDPVIEFLGDSDAHIVRGLVAIVLALYSGRRASEILATEPEE
FT                   VLKKLGLDEHLTPQRSNGLRAMVARIHREAELAKEST"
FT   gene            complement(567933..568382)
FT                   /locus_tag="BCAN_A0590"
FT   CDS_pept        complement(567933..568382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0590"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61667"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K3"
FT                   /protein_id="ABX61667.1"
FT                   /translation="MIRFLLKSAFWLSLAFIAVPHFFPADQENKPHEKPAHEQAKQEPS
FT                   SIEQILANGKTAVEIGKLCMDNPSFCKSGTSLVSSAGSGFLEGSRVMLEYLSARFGAKK
FT                   ETPVQERPAAAETISVKSQIPVPTPREEALRALDHRVTGSITPNR"
FT   gene            568673..570502
FT                   /locus_tag="BCAN_A0591"
FT   CDS_pept        568673..570502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0591"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61668"
FT                   /db_xref="GOA:A9M9K4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K4"
FT                   /protein_id="ABX61668.1"
FT                   /translation="MNVIHLKAAQIVRNSLHGLACFHDRFCRRWVATPDAASIRVIGAV
FT                   FTLPFLLCAAVAASGVAAGLTDFAILAGSFTGVAMIFCALSLMGLRAGILGALNFAAYG
FT                   AGLATIGAFSNGNAALWLMAAGLPLEIWFASRKPGSTIAGSLAAMAILAFLAVKTGGTI
FT                   SGGSLISGAILLLYAASLVLRGVAVARKPVQISVAAPQVAVAAGDMQFGLDIEGIVSSV
FT                   DGETAKLLGVQPKMLEGTALIDRVHVADRVQYLSLLADLRAGMATRKVDVRLRSIENGN
FT                   PVFRAYRFEGAGSDRAITLIGRSLEGEQKLLDEIAMLKAELESERIGKGRLLATVSHEL
FT                   RTPLNSIIGFSDMLTHEIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTY
FT                   SIAPQSFVFRDAVEMCTAVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATN
FT                   AVKFTQSGGCVTIDAARVMADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQA
FT                   QEGSGLGLSVVKGLVELHQGSMQLKSRPGEGTVVMIRLPLAGPQYRAGEEQQELGTVID
FT                   MYRHQGERRNDWQKDEIRDQSPEQPHAQTRKTA"
FT   gene            570429..571445
FT                   /locus_tag="BCAN_A0592"
FT   CDS_pept        570429..571445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0592"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="GO_process: GO:0000270 - peptidoglycan metabolic
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61669"
FT                   /db_xref="GOA:A9M9K5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K5"
FT                   /protein_id="ABX61669.1"
FT                   /translation="MTGRKTKSGTKAQSSHMRKPAKRRSLAARLLHFFFTSASVLAIAA
FT                   GDFVVRNPVLTGGATAFLVVMGFVSANALWYQPEAHDAVFFRTRPDFVFKPTPRAALPG
FT                   TAAINSEGKPAAQSVRQPANNGPTPSVATADLSPDRLQLSGSVDDMLPALAPNADLEIA
FT                   RLQQRLSMLGIYKGPVDGFTGPQTREAVEHWRALQQKLGVKQASLPAQLENNAPAQDDV
FT                   AGIIEVAVPSPRPQPAVLKDAAPIKPKADLASYEKPAHRKQPAAAAAQPSKISSQDIVR
FT                   VQAGLKAFGNDTVPVNGQPGKATQEAVREFQKLFGLHVTGEIDSALISKMREIGLIS"
FT   gene            571459..571806
FT                   /locus_tag="BCAN_A0593"
FT   CDS_pept        571459..571806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0593"
FT                   /product="protein of unknown function DUF1491"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61670"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K6"
FT                   /protein_id="ABX61670.1"
FT                   /translation="MRLTSDFWVSALIRKVRGGGGFAYLARRGSPEAGAIFIKVSSRLG
FT                   ACDLYSPAPQTSYEEDSDGERMFLRILHNADDMAANTRMEREIRFDSDLWLVELEDIAD
FT                   ATEFFRISVDG"
FT   gene            complement(571817..572893)
FT                   /locus_tag="BCAN_A0594"
FT   CDS_pept        complement(571817..572893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0594"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61671"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K7"
FT                   /protein_id="ABX61671.1"
FT                   /translation="MAVSVCLPEYLCVTNDQFRVLEEISGNRSPSSSKTGSSKADDLLA
FT                   AALSAFATIMRPGRQDMQQLEDLAMPLLQCASTRGKRHAANALAHLEEAPRRLVLALAN
FT                   EPIEISAPLLLRSPLLRPSDLVDIIARNGIAHARAIARRQSDDVLLRGVLRSFADAAID
FT                   RTLALQENLANIDAEPLEKPEIPDLSVASGPLMRENHSERLVRALQQPFFTAGALPGCE
FT                   HLIDTALLIDSQLFRTALADALDISFDRADAIIGKWPDSYLPIALKALGLSAPECYLVM
FT                   TAVLGSIETTRDGLRDFVHIYRSIDRAKAMSLVRRWKSDDMSAMLRNKLREMAVSAENE
FT                   PLDDAANTDAPKPTRSVK"
FT   gene            complement(573091..573633)
FT                   /locus_tag="BCAN_A0595"
FT   CDS_pept        complement(573091..573633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0595"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61672"
FT                   /db_xref="GOA:A9M9K8"
FT                   /db_xref="InterPro:IPR014456"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K8"
FT                   /protein_id="ABX61672.1"
FT                   /translation="MAKLVRLVLLGLIGAAIVHIAIVFLVPVYSDKNAWSRIEASGDPY
FT                   RFYRLDQKTGPISDSDPLVKEATCRFDLSNGPVHITTQRNVPYWSLSIYAPNGDNLYSL
FT                   NDNVSNDRKLDLVIADPIGMASLRSDASRSDTRSIFIEQNIGEGAAVLRVFVPDTTWNA
FT                   QVQRFFDEAQCEPFEGF"
FT   gene            complement(573626..574237)
FT                   /locus_tag="BCAN_A0596"
FT   CDS_pept        complement(573626..574237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0596"
FT                   /product="protein of unknown function DUF1214"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61673"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR012038"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9K9"
FT                   /protein_id="ABX61673.1"
FT                   /translation="MFKTIFKVVAVLALALGGGIWSVDYALDSFEGFGELRVGAWRAYP
FT                   AAGTPDADPYSKARAARKAYLPLGTTEGLPFYAQRDSAGRELRRGCTYRLSGFTPPARF
FT                   WTLYPATPDLKPIAPREGLQSALHSRAVLYEKDGSLSITISPDASPGNWLPVEGRGNFV
FT                   LVMTLYDTPAGSSSGLSDLVMPSLVRLANQGPKGQEACRG"
FT   gene            complement(574244..576400)
FT                   /locus_tag="BCAN_A0597"
FT   CDS_pept        complement(574244..576400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0597"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61674"
FT                   /db_xref="GOA:A9M9L0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L0"
FT                   /protein_id="ABX61674.1"
FT                   /translation="MRNTAEKDRRNDKRKPFRVSRLIGLDAWIDSALYNLHFRLGEWWE
FT                   NITIFSRRFRVRGFRRFTVEVLDEGFTLGVAGSVLMLMLALPAFEETKKDWRAQDDYAV
FT                   TFLDRYGNEIGRRGILHRQAVPIDELPDHVIKAVLGTEDRRFFDHYGIDLMGLSRALSQ
FT                   NMRANGVVQGGSTITQQLAKNLFLSNERTIERKVKEAFLALWLESNLSKKEILQLYLDR
FT                   AYMGGGTFGIAAASEFYFGKNVKDISLAEAAMLAGLFKAPAKFAPHVNLPAARARANVV
FT                   LSNMVESGFLSEGQVAVARRHPASVIDRAKDESPDYFLDWAFDEVKKVADRFNQHTLIV
FT                   RTTLDRNIQKAAEESLEFHLRQYGKEYNVSEAATVVLANDGSVRALVGGRDYGESQFNR
FT                   ATRALRQAGSSFKPYVYAAAMEKGLTPSTIVSDAPISWGNWSPRNYGRSFAGRVDLTTA
FT                   LVRSLNSVPVRLARDYLTTAPVVALTKAMGVESPISSHKTMVLGTSEMTVMDQATGFNV
FT                   FANAGMAGNRHAFTQILASDGKVLWDFGRDAPKPHRALSEKAALEMNSMLVQVPERGTG
FT                   RRAALTMTRVAGKTGTTQNYRDAWFVGFTGNFTAAVWFGNDNFTPMKELTGGVLPAMAW
FT                   QRMMAYAHQNIELKPLPGVNPPFPAQPKNPPAQVADTRPHETMAAPPRVLSPLATKILK
FT                   ELHDRFLAAPPLPTIAERTKVSVL"
FT   gene            576758..577270
FT                   /locus_tag="BCAN_A0598"
FT   CDS_pept        576758..577270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0598"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61675"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L1"
FT                   /protein_id="ABX61675.1"
FT                   /translation="MKTGKGLAQRHERIRLAYQLQVRHGITAEDLAKILGLSEERYDLW
FT                   LRRLKCTGSEAKAPQRPIEGAFERLQAELQRLLDGEQLPDKSKAEALMALAKAVKTVDE
FT                   LTAESTTTETGREIATPDIKEVRQALARIDRRIEELAEKRAREILGGGPGVSADIGSAR
FT                   RMADPGA"
FT   gene            577233..578468
FT                   /locus_tag="BCAN_A0599"
FT   CDS_pept        577233..578468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0599"
FT                   /product="protein of unknown function DUF264"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61676"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L2"
FT                   /protein_id="ABX61676.1"
FT                   /translation="MAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKTRAGAEWVSG
FT                   MALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSRLVRPRYEASRRRLIWDN
FT                   GAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLGDNPRQVVTTTP
FT                   RAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGTRLGRQELDGELVEER
FT                   PGALWSRDRIEQCFEENPPPLARIVVAVDPPASSGKASDACGIVVAGIDAEGVGHVLAD
FT                   ESMTMAKPHQWARRAIALYHTHEADAIVAEVNQGGEMVAAVLAAEDPSVPVLKRRASRG
FT                   KWLRAEPVAALYEQGRVRHAGRFPALEDEMCDFAPEGLSSGRSPDRLDALVWALGELML
FT                   GADHKPRIRRFG"
FT   gene            578500..579693
FT                   /locus_tag="BCAN_A0600"
FT   CDS_pept        578500..579693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0600"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="GO_component: GO:0019012 - virion; GO_function:
FT                   GO:0005198 - structural molecule activity; GO_process:
FT                   GO:0019068 - virus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61677"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L3"
FT                   /protein_id="ABX61677.1"
FT                   /translation="MAWNWPWRKSAANLPARANAVSQTKMANGFVALHMERNASWIARD
FT                   YSTLAREGFMRNPVAYRCVRLIAEAASTIPWLLYEGATEHEAHPLLDLLTHPQGAVEGG
FT                   SFFERLYGHLLIAGNAYVERVDLPSGRMELHLLRPERVTVETDADGWPQALVYRSGLAS
FT                   RTIPVAGLDAPGLHLKLFHPLDDHYGFPPLEAALMALDIHNAAGAWNKALLDNSARPSG
FT                   ALVYASKEGGNLTEEQFERLKAELEEGYTGASGAGRPLLLEGGLDWKAMGYSPQDMDFI
FT                   EAKNGAARDIALAFGVPPMLLGIPGDNTYANYAEANRAFYRLTVLPLIGRTAKAFGNWL
FT                   GPLFGGGLRLEHDIDRIEGLSAERESLWRRVSEASFLTDDEKRDAVGYQPRVGRRVS"
FT   gene            579690..580067
FT                   /locus_tag="BCAN_A0601"
FT   CDS_pept        579690..580067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0601"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61678"
FT                   /db_xref="GOA:A9M9L4"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L4"
FT                   /protein_id="ABX61678.1"
FT                   /translation="MNNWNDAVLASDTAWLWFAKIAGAVAGSAVSLAYMLPHGKREAAI
FT                   RFAVGIICGMVFGGAAGVKIAETLALGDALGRAELMLMGSAAASLAAWSALGVFRRFAE
FT                   RLKQAPLPGVLPAERNMHGEI"
FT   gene            580054..580722
FT                   /locus_tag="BCAN_A0602"
FT   CDS_pept        580054..580722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0602"
FT                   /product="phage prohead protease, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61679"
FT                   /db_xref="GOA:A9M9L5"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L5"
FT                   /protein_id="ABX61679.1"
FT                   /translation="MARFDLKLDMKRAALAVEEVEIDGSFSGYASVFGLPDLGNDVIEQ
FT                   GAFARALKERGASGVRMLWQHDAAEPIGVWTQIREDARGLYVEGRLAKGVARAREALEL
FT                   MRSGGLDGLSIGFRTVRARKDARTGLRHITQADLWEISVVTFPMLPQARVTGIKAGLPT
FT                   IREFERWLTRDAGLSRAAARTVIAKGYAALGASLNGREAIGQDEADLAGRMRRAARTMI
FT                   "
FT   gene            580744..582018
FT                   /locus_tag="BCAN_A0603"
FT   CDS_pept        580744..582018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0603"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="GO_component: GO:0019012 - virion; GO_function:
FT                   GO:0005198 - structural molecule activity; GO_process:
FT                   GO:0019068 - virus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61680"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L6"
FT                   /protein_id="ABX61680.1"
FT                   /translation="MEHSSIRALETKSVETKALAPNAGSDGDVAEAFDEFMTAFSAFRE
FT                   ANDERLKKVEKHADTDVLLREKVDRINRALDEQKAALDQFVLKRARPPLGQNAPMGDVE
FT                   HKQAFDGYVRRGDEQALRGIEQKAHSYASGPDGGYLVPAELETEIGRRLAVLSPIRGIS
FT                   GVRQVSGAVLKKPFSISGPATGWVGETDARPQTASAKLAELQFPTMEIYAMPAATSSLL
FT                   DDSAVNVEQWIAEEVEAAFAEQEGAAFVSGDGVNKPRGFLSYETVADDAWAWGKIGHVA
FT                   TGVAGALPPEDPSDKLIELIYTLKAGYRQNANFVMNRKTQSVLRKLKDKDGNYLWQPPA
FT                   AIGEKASFMGFGLVEAEHMPDIAADAAAIAFGDFGRGYLVVDRIGVRVLRDPYSAKPYV
FT                   LFYTTKRVGGGVQDFEAIKLLKFAV"
FT   gene            582183..582749
FT                   /locus_tag="BCAN_A0604"
FT   CDS_pept        582183..582749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0604"
FT                   /product="phage conserved hypothetical protein, phiE125 gp8
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61681"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L7"
FT                   /protein_id="ABX61681.1"
FT                   /translation="MTMFLVTPPALEPVTIADARAFLRISTESEDDILGRLITTARELV
FT                   EAETGLALIDQTWRLRVDRWPRSGRLALFKYPIKAVTGVVAYRPDGAAISFLPDEFALH
FT                   HDRRPQRLYMAQYPDASTFCGIEVDFIAGFGESGVEVPDTLKQAILTLTAHLYESRAGV
FT                   NADAVQRSFPPIVNQMVDSWRRISL"
FT   gene            582746..583084
FT                   /locus_tag="BCAN_A0605"
FT   CDS_pept        582746..583084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0605"
FT                   /product="phage head-tail adaptor"
FT                   /note="GO_component: GO:0019012 - virion; GO_function:
FT                   GO:0005198 - structural molecule activity; GO_process:
FT                   GO:0019068 - virus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61682"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L8"
FT                   /protein_id="ABX61682.1"
FT                   /translation="MNNVLFIDPGQLTSELALEAMQPLPDGMGGYAETWSEIAMVWGRI
FT                   EPVSTTQKDFGARPQPEVTHRILMRFREDISTDKRLRKAGRIFALRSVHDPDESGRYLI
FT                   CLAREEGR"
FT   gene            583081..583248
FT                   /locus_tag="BCAN_A0606"
FT   CDS_pept        583081..583248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0606"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61683"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9L9"
FT                   /protein_id="ABX61683.1"
FT                   /translation="MNIAMTLTFESLVRALRWKALAAGEAIAIEQNPNVKDASGGKHED
FT                   WRGSTPESPV"
FT   gene            583208..583615
FT                   /locus_tag="BCAN_A0607"
FT   CDS_pept        583208..583615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0607"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61684"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M0"
FT                   /protein_id="ABX61684.1"
FT                   /translation="MKTGAAALQKALFEALKNDGELIETLGGERVYDHVPARTPFPYVT
FT                   LGETMCRDWSTASEEGGEHFLNIQIWARESGRKRVLDIAAKIAMRLDEKPVEIEGHRLV
FT                   NLMLTEVLARNTDGLGSYLGTMRYRAVTEPA"
FT   gene            583656..584069
FT                   /locus_tag="BCAN_A0608"
FT   CDS_pept        583656..584069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0608"
FT                   /product="phage major tail protein, TP901-1 family"
FT                   /note="GO_component: GO:0019012 - virion; GO_function:
FT                   GO:0005198 - structural molecule activity; GO_process:
FT                   GO:0019068 - virus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61685"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="InterPro:IPR022344"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M1"
FT                   /protein_id="ABX61685.1"
FT                   /translation="MAAQRGKDILLKTVRDDGTFETCAGLRTKRIAFNAETVDVTDADA
FT                   AGRWRQLLAGSGVQRASISGSGIFKAAASDALIRRIFFDGEIRDWQIVLPDFGTISGPF
FT                   QITALEYGGNHDAEVTFEIALESASLITFGEAI"
FT   gene            584066..584407
FT                   /locus_tag="BCAN_A0609"
FT   CDS_pept        584066..584407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0609"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61686"
FT                   /db_xref="InterPro:IPR021791"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M2"
FT                   /protein_id="ABX61686.1"
FT                   /translation="MMMANRHRGEVAARLDGRDWTLCLTLGALAELESVFETDNLSALV
FT                   ARFSSGRLSARDMQRIICAGLRGGGHTVSEEDVADMRAEGGVAGFARIVSSLLTVTFGT
FT                   SEKDSAPNP"
FT   gene            584451..584621
FT                   /locus_tag="BCAN_A0610"
FT   CDS_pept        584451..584621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0610"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61687"
FT                   /db_xref="InterPro:IPR019056"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M3"
FT                   /protein_id="ABX61687.1"
FT                   /translation="MGRGDVCGFRFAAAHPQAFWSMTPRELSAAIGPLAPVLDAPSRQT
FT                   LDALMLAFPDR"
FT   gene            584626..585171
FT                   /locus_tag="BCAN_A0611"
FT   CDS_pept        584626..585171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0611"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61688"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M4"
FT                   /protein_id="ABX61688.1"
FT                   /translation="MTDETVTVSVNADTSAFDRALSDLEKRSSSFGNSLNSALKGAITS
FT                   GKGLEDVLRGLASSLAGTALSADLQPLQGLTSSMMGGLLSGIRGIMPFAKGGVVSSPTY
FT                   FGMGNGSLGLAGEAGAEAILPLARGSDGRLGIATGGGSKPVQVVFNMTSPDASSFRKSE
FT                   AQLATMLAGAVRRGARRL"
FT   gene            585174..585806
FT                   /locus_tag="BCAN_A0612"
FT   CDS_pept        585174..585806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61689"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M5"
FT                   /protein_id="ABX61689.1"
FT                   /translation="MVEAFHDVRFPLGVSFGATGGPEWRNEIVTLTSGLEKRNARWAHS
FT                   RRHFDAGTGLRSLDDLRMVLAFFEARRGSLHAFRFRDPFDFSSATGKASLSAFDQPLGT
FT                   GDGVAVHFQLRKNYESYDRPITLPVPGSVVIGVDGVKVPEGEAFTVDPLTGIVTFTPDY
FT                   LPARDVPVTSGFLFDVPARFDTDRLTASIASFQAGEIPSIPIVEVKR"
FT   gene            585803..586678
FT                   /locus_tag="BCAN_A0613"
FT   CDS_pept        585803..586678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0613"
FT                   /product="phage conserved hypothetical protein BR0599"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61690"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M6"
FT                   /protein_id="ABX61690.1"
FT                   /translation="MIPVPPALESHLQGEVTTHCFAWLIRRLDGAVLGFTDHDAPLTVD
FT                   QVICDPLTGLNSSEASTALGLGIAGGEVEGVLSSTQISDEDIEQGRFDGATIEAFLVNW
FT                   DEPDQHMLLRRWAAGKISRSGSRFVMELKGVAAAFDAVRGRRILRHCDAMLGDKRCGID
FT                   TGDPRFFAQGTVLVAEGTRLDVAGLDGFAAGWFSEGRLAWTSGANRGRVVRVVGHAGAS
FT                   LQLGEPMILPVAAGDAFRLVCGCDKSFATCKAKFANGVNFRGFPHLPGNDAAYAYVNST
FT                   NDYDGSVLVP"
FT   gene            586675..587109
FT                   /locus_tag="BCAN_A0614"
FT   CDS_pept        586675..587109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0614"
FT                   /product="phage cell wall peptidase, NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61691"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011929"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M7"
FT                   /protein_id="ABX61691.1"
FT                   /translation="MMIAERVLAEAHRWIGTPYRHGASTLGVSCDCLGLVRGIWRALYG
FT                   VEPENPGVYAPDWAEVSQGDPMLEAAVRYMVRREEHAPQPGDLLVFRWKPGFAAKHMGI
FT                   MAREGRFIHAYQGHGVLASALVPQWRRRMAGIFLFPEPKV"
FT   gene            587113..590968
FT                   /pseudo
FT                   /locus_tag="BCAN_A0615"
FT                   /note="Hypothetical protein"
FT   gene            591033..591239
FT                   /locus_tag="BCAN_A0617"
FT   CDS_pept        591033..591239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0617"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61692"
FT                   /db_xref="GOA:A9M9M8"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M8"
FT                   /protein_id="ABX61692.1"
FT                   /translation="MTANKSWYLSRTVWAGLVALFLSVAGLFGVATDMIDQGNMTDVLL
FT                   QLATAIAGVVTVIGRIGATSRIL"
FT   gene            591401..591697
FT                   /locus_tag="BCAN_A0618"
FT   CDS_pept        591401..591697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0618"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61693"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9M9"
FT                   /protein_id="ABX61693.1"
FT                   /translation="MKQNPALKVFALLAVSVGLLPVNAGALPMAAPQKPNLLIATAGDC
FT                   TAVGEQVAAQQGGQLAKATPTMQNGRAMCVIVVLIPGRNGERPRRVEVAVPAQ"
FT   gene            591776..592465
FT                   /locus_tag="BCAN_A0619"
FT   CDS_pept        591776..592465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0619"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61694"
FT                   /db_xref="GOA:A9M9N0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N0"
FT                   /protein_id="ABX61694.1"
FT                   /translation="MRILIVEDDKDLNRQLSEAMIAAGYVVDSAYDGEEGHYLGDTELY
FT                   DAVVLDIGLPQMDGISVVERWRRSGRTMPVLMLTARDRWSDKVAGIDAGADDYVAKPFH
FT                   IEEVLARLRALIRRAAGHASSEFVCGPLHLDTKTSKASIDGVALKLTSHEYRLLSYMMH
FT                   HMDEVVSRTELVEHLYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGMGYRMRSGGEG
FT                   EAKGSGS"
FT   gene            592615..593850
FT                   /gene="phoQ"
FT                   /locus_tag="BCAN_A0620"
FT   CDS_pept        592615..593850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoQ"
FT                   /locus_tag="BCAN_A0620"
FT                   /product="Sensor protein phoQ"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61695"
FT                   /db_xref="GOA:A9M9N1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N1"
FT                   /protein_id="ABX61695.1"
FT                   /translation="MTAHLFSLVGAVIVSGEGTLQGRPELGDLRYSSPLSGWYWSVDPV
FT                   TPNLTGKLESPSLVGRIVPEMPVSQAPFDSSFMRSYTLPGLDNEELSIVETEVVLDNSN
FT                   RVARFRVMGNLSEVLNEIANFRARLLVYLGVFGIGSILINAAVILFGLRPLDKVRQALA
FT                   DIREGRSSRLDATLPLEIAPLAREMNALIENNRRIMERSRTQVGNLAHSLKTPLSVLVN
FT                   EARAMGGAPGRIVQEQSEAMQVQIQHYLQRARIAAQRDSVVFRTPVTPVLERLHRVTAK
FT                   LHPTFNISFRNDLPGAVFAGEREDLEEIIGNLLENAGKWGRKCITIRLAAIAGEQRQFE
FT                   IVIEDDGPGLEADKIEAALKRGSRVDETKPGTGLGLAIVQDTVREYGGSLHLGKDALGG
FT                   LAVRVVLPLTQD"
FT   gene            593911..594396
FT                   /gene="omp"
FT                   /locus_tag="BCAN_A0621"
FT   CDS_pept        593911..594396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp"
FT                   /locus_tag="BCAN_A0621"
FT                   /product="17 kDa surface antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61696"
FT                   /db_xref="InterPro:IPR016364"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N2"
FT                   /protein_id="ABX61696.1"
FT                   /translation="MRADCYEGRFVMMIVSRFSRPVPVISMMFVVSLALSACGTTGGGK
FT                   GSGFPSLGGSSQKPETNLLASLGNGLLGNSASQLSAADRRKALEAEYRALEYSPAGKSV
FT                   LWSGAGSNAGDVTAAQPYQVGSQNCRQYSHSFTIGGDQQTVRGTACRNPDGSWTPLT"
FT   gene            594497..595636
FT                   /locus_tag="BCAN_A0622"
FT   CDS_pept        594497..595636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0622"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /note="GO_function: GO:0005488 - binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61697"
FT                   /db_xref="GOA:A9M9N3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N3"
FT                   /protein_id="ABX61697.1"
FT                   /translation="MEFWLVAALLTFAATLAVLLPLTRRRQAALPAEKNDLEVYRDQLR
FT                   EVEADVARGMIDLQSAEQARIEISRRILNAEKAAMAATADGGQGRSGRVLAFVAVLAVP
FT                   LVAWGIYPLFGAPDMPSMPLAPRLAGRTGSSSVTDLIARAEAHLAQNPGDVRGWDVLAP
FT                   IYLRLGRASDAVSAYRTSIRIAGENLARILGLGEALTAASGGTVTAEAEKLFKKAAELS
FT                   PDDIRPQYYLAQGEMQDGHPDRAADRLQAFLDKAPADAPWRGQLEKTIAILRDPASAKQ
FT                   AEAKGPSAEDVEAASTLSAGDRQAMVEGMVQRLDETLRQNGGDIDGWKRLVRSYMILNR
FT                   RNDAQDALARGMKALQGENRTELQSFATTLGLDVGTAQE"
FT   gene            595633..596130
FT                   /gene="ccmE"
FT                   /locus_tag="BCAN_A0623"
FT   CDS_pept        595633..596130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="BCAN_A0623"
FT                   /product="Cytochrome c-type biogenesis protein ccmE"
FT                   /note="GO_process: GO:0017004 - cytochrome complex
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61698"
FT                   /db_xref="GOA:A9M9N4"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9M9N4"
FT                   /protein_id="ABX61698.1"
FT                   /translation="MSATAEQNARNPKGKGGFARTVSQRKRKRLFLIGGALAVLAVAVG
FT                   LMLTAFNQDIRFFRTPADLTEQDMTSGARFRLGGLVEEGSVSRTGSELRFTVTDTIKTV
FT                   KVVFEGIPPDLFREGQGVVAEGRFGSDGLFRADNVLAKHDENYVPKDLANSLKKKGVWE
FT                   GK"
FT   gene            596150..598141
FT                   /gene="ccmF"
FT                   /locus_tag="BCAN_A0624"
FT   CDS_pept        596150..598141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="BCAN_A0624"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0017004 - cytochrome complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61699"
FT                   /db_xref="GOA:A9M9N5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N5"
FT                   /protein_id="ABX61699.1"
FT                   /translation="MSVEIGHFALVLALALSIVQSIVPVVGAHRRDAQLMAVAVPTALA
FT                   VFALIVLASAALIHAYVVSDFSVLNVVENSHSQKPLLYKITGVWGNHEGSMLLWVFILT
FT                   LFSALVAAFSGNLPETLRADVLAVQGWIGTAFLAFIIFTSNPFTRIFPAPMEGGDINPV
FT                   LQDIGLAIHPPLLYLGYVGFSVCFSFAVAALLEGRLDAAWARWVRPWALMAWMFLTGGI
FT                   AMGSYWAYYELGWGGWWFWDPVENASLMPWLVGTALLHSAIVMEKRSALKIWTVLLAIL
FT                   TFSLSLLGTFLVRSGVLTSVHSFATDPGRGLFILGILALFIGGSLSLFALRVQSLSAGG
FT                   IFHPISREGALVFNNLFLTTAAATVLIGTLYPLLLEVTTGEKISVGAPFFNMTFGPLMV
FT                   PLLFAVPFGPLLAWKRGDLYGVGQRLMTAFALSLAVVGIMLWRTSAHSVLAALGIGLAA
FT                   WLIFGSLTDLVLKAGIGKVSASKAFARFKGLPRSVFGTSLAHIGLGLTLLGIVSVTTFG
FT                   TENVLVMQPGGTAKVQNYTLRFEGLRPITGSNFTENRGAFTLLDSSGRDLAVIEPSKRF
FT                   FPACQMPTTESGIKTLWFSQVYVALGDEPGNGAVVVRIWWKPLVTLIWYGALVMMLGGL
FT                   FSLADRRLRVGAPSKVRRSASKEAEAVA"
FT   gene            598138..598614
FT                   /locus_tag="BCAN_A0625"
FT   CDS_pept        598138..598614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0625"
FT                   /product="Cytochrome c-type biogenesis protein ccl2
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61700"
FT                   /db_xref="GOA:A9M9N6"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N6"
FT                   /protein_id="ABX61700.1"
FT                   /translation="MKKNNLFRALLISATFALQATAALAVNPDEVLSDPKLEKRAREIS
FT                   AELRCMVCQNESIDDSNAELARDLRILVRERLTKGDTDGQVIDFVVDRYGEFVLLKPRF
FT                   NAQTALLWGFPVIILLIGGGALLVAFRRRRAAGTAPQPLSESEKAELSRLLDGK"
FT   gene            598499..598672
FT                   /locus_tag="BCAN_A0626"
FT   CDS_pept        598499..598672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0626"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61701"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N7"
FT                   /protein_id="ABX61701.1"
FT                   /translation="MAAARFLLLSGVGALLARPHSPFPKAKKRNFPACSTENRPTKPLE
FT                   TLRNFHLAEIER"
FT   gene            598756..600297
FT                   /gene="degP"
FT                   /locus_tag="BCAN_A0627"
FT   CDS_pept        598756..600297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="BCAN_A0627"
FT                   /product="protease Do"
FT                   /note="GO_component: GO:0030288 - outer membrane-bounded
FT                   periplasmic space; GO_function: GO:0005515 - protein
FT                   binding; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61702"
FT                   /db_xref="GOA:A9M9N8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N8"
FT                   /protein_id="ABX61702.1"
FT                   /translation="MSRARISNYRKGVAAVALSAALAGAFVVTGPLGALNEARAEAVHV
FT                   TPPPQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPPGFDQLPDGHPLKRFFRD
FT                   FGMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAYTVV
FT                   LDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNPFGLG
FT                   GTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIFSPSGG
FT                   SVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASP
FT                   QDDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINV
FT                   TIAAMPNDKGKSGSQSNDNDGGQGETLDSYGLTVVPSEDGKGVVVTDVDPDSDAADRGI
FT                   RSGDVIVSVNNQTVKTAGDINKAITAAEKSGRKAVLLQLQSNDQSRFVALPINQE"
FT   gene            600391..601098
FT                   /gene="copR"
FT                   /locus_tag="BCAN_A0628"
FT   CDS_pept        600391..601098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copR"
FT                   /locus_tag="BCAN_A0628"
FT                   /product="Transcriptional activator protein copR"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61703"
FT                   /db_xref="GOA:A9M9N9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9N9"
FT                   /protein_id="ABX61703.1"
FT                   /translation="MKILVIEDDREAARYLEKAFAEAGHSADIAGDGETGYALAENGNY
FT                   DVLVVDRMLPKRDGLSVVAGLRAKGMETPVLILSALGEVDDRVTGLRAGGDDYLTKPYA
FT                   FSELLARVEVLQRRSSPREADTIYRVGDLELDRLAHTARRQSVDITLQPREFRLLEYLM
FT                   RHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRSKIEKGFDEPLLHTVRGAGYMLK
FT                   AGRGKQSAAARAE"
FT   gene            601098..602501
FT                   /locus_tag="BCAN_A0629"
FT   CDS_pept        601098..602501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0629"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61704"
FT                   /db_xref="GOA:A9M9P0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P0"
FT                   /protein_id="ABX61704.1"
FT                   /translation="MSRFSALMRTTAARLSALYLLLFAVGAVALVFYMTNLSASILAGQ
FT                   TQQALGEEVASIGKSYARGGIPQLVRTIDYRSRQPGAYLYLVADPTGRILAGNVESVEP
FT                   GVLNTDGIIERAFTYRRYGEQAPQMEHRAIAVVIALPNGMRLLVGRDLGEPERFRDLIR
FT                   NSLVLALGIMGVGALLIWLFVGRRALKRIDDVSRASQRIMDGDLTGRLPVNGSGDEFDR
FT                   LSGNLNVMLARILELNEGLKQVSDNIAHDLKTPLTRLRNRAEEALGGEKVEPEYRAALE
FT                   DIIGESDQLIRTFNAILMISRLEAGYSSENLDDMPVAPIMRDVAEMYEPVAEDAGVTLT
FT                   LGALDDVALHINRELVGQTVSNLVDNAIKYAGGEGRTATVTLLMEKDAQWVRIVVADNG
FT                   PGIPADKRDHATERFVRLEESRTQPGSGLGLSLAKAVMKLHGGALRLEDNGPGLRAVLE
FT                   FPLPHREVG"
FT   gene            602624..605575
FT                   /gene="glnE"
FT                   /locus_tag="BCAN_A0630"
FT   CDS_pept        602624..605575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="BCAN_A0630"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61705"
FT                   /db_xref="GOA:A9M9P1"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P1"
FT                   /protein_id="ABX61705.1"
FT                   /translation="MTVENAKALFFERNLCALTPLDPERASAFLADLEARAREEELAGV
FT                   VALLGRKKAADFLSAILDLSPFIREALTRQPRILDRIVSATPESALEAILDEISASGTV
FT                   AGVSESELMTSLRQLKREAHVLIALCDLARIFNTETTTDRLTDLAEACTGAAVRFLLLD
FT                   ADAAGRINLPDRSNPEKDCGWIVLGMGKFGARELNYSSDIDLIVFIDETKPAIGDPYEC
FT                   VDTFSRLTRRLVRILQDRTGDGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGRGQNWE
FT                   RAAMIKARPVAGDRLSGKQILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKGHGDIAV
FT                   RGHNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGNQTVPMLARLAERGWITQQARDAL
FT                   AQEYWFLRDVEHRIQMIADEQTHILPEDDEGFARVSHMMGYADPAEFSEIFLAALKVVE
FT                   KQYAALFAQAPELGAASGNLVFTGDVDDPGTLETLSAMGYERSSDICRVIRTWHFGRYR
FT                   ATQSAEARERLTELTPALLKAFAETRRADESLRRFDGFLQGLPAGIQLFSLLQSNPRLL
FT                   NLLVMIMSAAPRLADIITRNPHVFDGLLDPAIFSEVPTRAYLEERLRAFLGSATDFEEV
FT                   LDRLRIFAAEHRFLIGIRLLTGAINGVRAGQAFSDLAELMVGRALEAVEAELQRRHGKV
FT                   KGAKVALLAMGKLGSRELTAGSDVDLILLYDHDKDAEESDGEKPLAPSQYYIRLTQRLI
FT                   AALSAPTAEGVLYEVDMRLRPSGNKGPVATHIEAFGKYQRNDAWTWEHMALTRARPIHG
FT                   DEAFIARIKVDIEDVLAMPRDVRKLAGDVREMRELIAQEKPPRDDWDLKLKPGGIIDLE
FT                   FIAQFATLAGYVKKTPRPFATEEVLANLDPFFADPAMVDGLVEAHRFYTNLSQAIRLCL
FT                   NDSAGLDQFPPGMRELLCRVAGLPDIERIEYELLEHYRLVRAAFDKLVGHGAD"
FT   gene            complement(605620..607731)
FT                   /gene="lgtB"
FT                   /locus_tag="BCAN_A0631"
FT   CDS_pept        complement(605620..607731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtB"
FT                   /locus_tag="BCAN_A0631"
FT                   /product="Lacto-N-neotetraose biosynthesis glycosyl
FT                   transferase lgtB"
FT                   /note="GO_process: GO:0009103 - lipopolysaccharide
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61706"
FT                   /db_xref="GOA:A9M9P2"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P2"
FT                   /protein_id="ABX61706.1"
FT                   /translation="MILPVFVINMASQPAAYKTVAASIEAYGQGFQLHRIDAVNGHTAT
FT                   QRIGIDDARFDAINGREMLPGEYGCYRSHLKALESFLSDGSPYGLILEDDVVFTETTSA
FT                   RIHDIIKSLPDFDVVKLVNHRSPLFMSLLETDAGDTIGRAIHGPQGSAAAYLVSREGAR
FT                   KLLSALSTMELPWDVAMERFWHHKARLFSSDENILAFSSHSEISNISDQNSGYDEAKHP
FT                   WYMRLRTSLFRTFDYYVRVHHTLLQPQNPDGSSMKSQSGAYKLPGISLTGELIAAISLL
FT                   VFMSTVWVETDAYRYIALGFVVAALIRYARTDFWKYEKPMVGWAGLLCVAWTFYVLARF
FT                   AYIYLFYPEMGTGSAEGIYLFPLFYPTLGFALLLFIRRPFLIAVAFMAISLVILIFGFH
FT                   YDLLWNERAVTLLQHNPIHAAVSSGFIALCAMAFGIHTLNRNTLDTRARVVLCLLALAT
FT                   FIAALIAIYSLYSKGVWLAMAIAFPTFVVLVALTDKSQTSRMAALVCILIGLLSVFAGE
FT                   HILQRVGGNTANTSWELLSDLKTGDNIMQDFDKAIKNPETGLSERERLMIWANTLHIWH
FT                   KNPIFGAGVSWLHYWEKRPYQQTDFTLLHNGYLEIAIRYGFLGLLFYGVLTVWAVRCTW
FT                   QATRAGLIDSAAFQCYVATLVFFAVTILSNSNVRLAIGESYMALAFGFAFYCQYLLQQH
FT                   NRQYPRTYF"
FT   gene            complement(608002..610353)
FT                   /locus_tag="BCAN_A0632"
FT   CDS_pept        complement(608002..610353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0632"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="GO_function: GO:0005524 - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61707"
FT                   /db_xref="GOA:A9M9P3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P3"
FT                   /protein_id="ABX61707.1"
FT                   /translation="MASTDAYGAPAGTHCESGRKKRKGRLSGHVSLLAGPAYSKFIVIE
FT                   PILRRLVPTLIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQMIERVANGI
FT                   ETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAASGPAGIAGSQIDTILGD
FT                   AQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWKRAVSLNVT
FT                   LFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWDMARGRIY
FT                   WSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVFRMRHAD
FT                   GSWVWMRVRAEIASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENISEAFVLWD
FT                   ANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNRAGGQTFER
FT                   QLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIARKGER
FT                   DRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGP
FT                   LGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVRIIS
FT                   LQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGAAL
FT                   FMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIRS
FT                   TERVGTVVSVCIPDRNPAPNAGHDARTHAA"
FT   gene            complement(610744..613395)
FT                   /gene="pepN"
FT                   /locus_tag="BCAN_A0633"
FT   CDS_pept        complement(610744..613395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BCAN_A0633"
FT                   /product="aminopeptidase N"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61708"
FT                   /db_xref="GOA:A9M9P4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P4"
FT                   /protein_id="ABX61708.1"
FT                   /translation="MRTETGHTFRLEDYRQTPYAIPETKLDFTLEPEKTIVRATLTIER
FT                   RSDTPAGTPLVLHGDELKLVSLAIDGKALSDNSFSATPDQLTISDLPKDVRFTLQIVTE
FT                   VNPTANRQLSGLYRSSGVYCTQCEAEGFRRITYFYDRPDVLSVYTVRVDADRKAAPILL
FT                   SNGNPVENGMVDGQPERHFAVWHDPHPKPSYLFALVAGSLGVVKDHFTTRSGRPVDLAI
FT                   HVEHGKEGRALYAMDALKRSMKWDEEKFGREYDLNVFNIVAVSDFNMGAMENKGLNIFN
FT                   DKYVLADPETATDADYAGIEAVIAHEYFHNWTGNRITCRDWFQLCLKEGLTVYRDHEFS
FT                   ADQRSRPVKRIAEVKILKAQQFPEDAGPLAHPVRPREYREINNFYTATVYEKGSEVVRM
FT                   IRTIIGPELFRKGMDLYFERHDGDAATIENFIQVFADVSGQDFSQFALWYDQAGTPKVE
FT                   AGFHHDSAAKTFTIKLEQSLAPTPGQSIRKPMHIPIAFGLIGPDGKDMQPSSVEGGEVR
FT                   DGVIHLRRPSETIVFHGIEARPVPSLLRGFSAPVNLAAPLTAEDRVFLALNDSDPVARW
FT                   QAMNSIFSATLLDGAKRVRGGHQPETDPKIVALAGKVAFDEILDPAFRALCLTLPSESD
FT                   IAREMGNNVDPDAILASRNHLIAAIASAYADGFAGLYDTLKQEGAFSPDAAPAEKRALR
FT                   SALLDYLSVQEKSPERAERQFVEADNMTDRATALAVLVHRFGDSGEARQALATFEQTFG
FT                   QDALVMDKWFIVQATRPGETALEAVRELTRHPLFSLDNPNRVRALIGAFTASNPTGFNR
FT                   QDGAAYGFLADTLLTIDPKNPQLSARLLTAMRSWRSLEEVRREHARAALARIAGAGKLS
FT                   TDLRDIIDRTLA"
FT   gene            613564..614580
FT                   /locus_tag="BCAN_A0634"
FT   CDS_pept        613564..614580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0634"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61709"
FT                   /db_xref="GOA:A9M9P5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P5"
FT                   /protein_id="ABX61709.1"
FT                   /translation="MAEIFSAGDSHRLLLRNSVVNAHTRAAADAARLEMNPMLGIGLKI
FT                   ASVAVFVAMSTLLKAAEGVPVGQLIFFRSFFAIFAILLYLGWRGQLGGVFSTRHGFSHF
FT                   WRGLVGVCSMSMSFFALTKLPLPEAIAINYASPLITVILGAAILHEVVRFYRWSAVLIG
FT                   LFGVMIIIWPRLTLFSAGSVGRDEAVGALAALGAAVMSAVAMMLVRRLVQTERTPTIVI
FT                   YFSISASVIALVSLPFGWVVPNWSQLAMLVGAGFAGGIGQILLTECYRHAPMSTIAPFE
FT                   YTSMLLGLVIGFMLFGDIPTFEMLIGSGIVMAAGGFIIYREHQLSLAPHKVNAPQAQ"
FT   gene            complement(614585..615841)
FT                   /locus_tag="BCAN_A0635"
FT   CDS_pept        complement(614585..615841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0635"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61710"
FT                   /db_xref="GOA:A9M9P6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P6"
FT                   /protein_id="ABX61710.1"
FT                   /translation="MAGQLLPIAALLASTFLMLLAGGLAGILLPLRGGMEGWSTTTIGW
FT                   MGTSYSLAFTIGCIFIPHLVRRVGHVRVFSALLTLLSMALLFHALVVNPAAWMIFRGIA
FT                   GFSLAGSYMIIESWLNERVTNESRGMIFSIYMIITMVGLLLGQYILPFGNAATQTLFII
FT                   CAIIYASALLPTALSSAQSPNPLTQVSLDLKGLYRRSPAAVVGSFIAGIVAGTWNFLAA
FT                   IYGEMNGLSTFGIATMLASAMIGGAIFQYPLGRASDFVDRRYMMILAGAIGFTLSFIMV
FT                   LFHPTSPYTLYAMMFLFGSMVFPIYSLNVAHANDYADASEFVKISGGLLIVYGVGSVLG
FT                   PAISGPLMDVIGANGFFVTMAIAYCIYGLHAWWRIYRLERPAISDQKTEFKFHTPDGQS
FT                   TPETMQLDPRAEGTSGQAQ"
FT   gene            complement(616003..616875)
FT                   /locus_tag="BCAN_A0636"
FT   CDS_pept        complement(616003..616875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0636"
FT                   /product="uracil-DNA glycosylase, family 4"
FT                   /note="GO_function: GO:0004844 - uracil DNA N-glycosylase
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61711"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P7"
FT                   /protein_id="ABX61711.1"
FT                   /translation="MTDGRETLDMEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQS
FT                   RMQAAAQQPESNPAQAREERARTVAVPSPSSKPVQAAMDLPDNAQIALAREAASQAETL
FT                   EELREKLAAFDGCNLKFTAKNLCFADGDPSSDIMFIGEAPGRDEDMEGLPFVGKSGQLL
FT                   NRMIEAIGLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAAPKVLVALGG
FT                   PAGKALTGAAEGILRLRGNWKIHRTPTGMEIPVMPTLHPAYLLRTPAQKRFAWRDFLAV
FT                   KLKLAELRG"
FT   gene            617264..618955
FT                   /locus_tag="BCAN_A0637"
FT   CDS_pept        617264..618955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0637"
FT                   /product="Electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase"
FT                   /note="GO_function: GO:0004174 -
FT                   electron-transferring-flavoprotein dehydrogenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61712"
FT                   /db_xref="GOA:A9M9P8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P8"
FT                   /protein_id="ABX61712.1"
FT                   /translation="MSEANELPERESMEFDVVIVGAGPAGLAAAIRFKQINPELSVVVL
FT                   EKGGEVGAHILSGAVVDPVGIDQLLPGWREEEGHPFKTPVTADHFLVLGPAGSVRLPNF
FT                   AMPSLMNNHGNYIVSLGNVCRWLGTKAEELGVEIYPGFAATEVLYNDEGAVIGVATGDM
FT                   GVERDGTRGPNYTRGMALLGKYVLIGEGARGSLAKQLIAKFKLDEGREPAKFGIGLKEL
FT                   WQVNPSKHKPGLVQHSFGWPLDMKTGGGSFLYHLEDNMVAVGFVLHLNYKNPYLSPFEE
FT                   FQRFKTHPAIRDTFEGGKRLAYGARAITEGGWQSVPKLSFPGGALIGCSAGFVNVPRIK
FT                   GSHNAILSGILAADKIAEAIAAGRANDEPIEIENSWRASAIGKDLKRVRNVKPLWSKFG
FT                   TAIGIALGGLDMWTNQLFGFSFFGTMKHGKTDAQALEPAANYKKIDYPKPDGVLTFDRL
FT                   SSVFLSNTNHDENEPVHLQVRDMELQKTSEHDVFAGPSTRYCPAGVYEWVNADGNAAAD
FT                   PGVKDVRFVINAQNCVHCKTCDIKDPNQNINWVPPQGGEGPVYVNM"
FT   gene            complement(619071..620147)
FT                   /locus_tag="BCAN_A0638"
FT   CDS_pept        complement(619071..620147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0638"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61713"
FT                   /db_xref="GOA:A9M9P9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9P9"
FT                   /protein_id="ABX61713.1"
FT                   /translation="MLEPCRKQGGSDNQKPIPLFPYPIHFLAVIRHYCRLMSKSRLNLP
FT                   FLILVAATLVSIPLVLSFLNSLHPAFDTFSHLRIHLAVLMGLLALPLLFTKLRREGAMI
FT                   LLLAVFAIAVTPHVFPASEDAHAGEAAQPHYRLLQMNLRFDNGSPEQALSLIAHIRPDV
FT                   VTLEEVSAMWREKFGHIASAYPYSIFCPHPGAVFGVAILSRRPFIADSTPACDPKGMMA
FT                   VASVDFGGRPVDVAALHLHWPWPFQQSEQIEALSVQFRGLSENAILSGDLNATPWSATT
FT                   KRIAELAAMTPAPPTGPTWLYRRLPASLRFAGLPIDQTFAKGRVAISKITRQQPIGSDH
FT                   LPVLVEFSIIPQPETVAS"
FT   gene            complement(620200..621702)
FT                   /gene="amn"
FT                   /locus_tag="BCAN_A0639"
FT   CDS_pept        complement(620200..621702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="BCAN_A0639"
FT                   /product="AMP nucleosidase"
FT                   /note="GO_function: GO:0008714 - AMP nucleosidase activity;
FT                   GO_process: GO:0046033 - AMP metabolic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61714"
FT                   /db_xref="GOA:A9M9Q0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9Q0"
FT                   /protein_id="ABX61714.1"
FT                   /translation="MTQRIEHPFLTDIKTPPLMEPEVFSDAQAAVAALCKLYERNTAFL
FT                   RSAFEKVARGEIAPQRYRAFYPEICLSTSSFAHVDSRLAYGHVSTPGDYSATVTRPDLF
FT                   GHYLREQIRLLMRNHGVTVTVRESSTPIPIHFAFKEGAYVEASVASAFTHPLRDLFDVP
FT                   DLAATDDKIVNADFEPAPGEPMPLAPFTAQRIDYSLHRLSHYTATSPSHFQNFVLFTNY
FT                   QFYMDEFCAYARQLMAEGGGGYDQFVEPGNIVTRAGETAPSTGNPLQRLPQMPAYHLQK
FT                   AGYGGITMVNIGVGPSNAKTITDHIAVLRPHAWLMLGHCAGLRNSQQLGDYVLAHAYMR
FT                   EDHVLDDDLPVWVPLPALAEIQVALEEAVEEITGLQGYDLKQIMRTGTVATIDNRNWEL
FT                   RDQRGPVQRLSQARAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMATE
FT                   FYKRQVAQHLRIGIRAMEKIASMPDERLHSRKLRSFYETAFQ"
FT   gene            621755..621913
FT                   /locus_tag="BCAN_A0640"
FT   CDS_pept        621755..621913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0640"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61715"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9Q1"
FT                   /protein_id="ABX61715.1"
FT                   /translation="MQAYIKNQASPVHLCMVADLRIGESRGRARKNGGEEEYAQANGGN
FT                   GRCSGSH"
FT   gene            621910..622191
FT                   /locus_tag="BCAN_A0641"
FT   CDS_pept        621910..622191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0641"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61716"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9Q2"
FT                   /protein_id="ABX61716.1"
FT                   /translation="MTCLSIGKIVHMGQGDSVDNRLVAINIVCPVCQNAGEGGKTRDHK
FT                   ADYCKPLKQHDCPQSSKPVCFRIGAYGRVPELSLRVLFMPRSKILMPG"
FT   gene            622269..622979
FT                   /locus_tag="BCAN_A0642"
FT   CDS_pept        622269..622979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0642"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61717"
FT                   /db_xref="GOA:A9M9Q3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A9M9Q3"
FT                   /protein_id="ABX61717.1"
FT                   /translation="MAEQTKPIELYYWPTPNGFKISIMLEELGVHYAVKYINIGKGDQF
FT                   EPGFLKIAPNNRMPAIVDPEGPGGEPISVFESGAILQYLGRKFGKFYPTDKRKRVTVEE
FT                   WLMWQMGGLGPMSGQAGHFRIYAPEKIQYGIDRYTNEVNRLYGVLNRRLEGRDYIADEY
FT                   SIADMACIGWVNAYKNYEQNLDDFANLKRWHETMNARPAVQRGLLVGKEERERADAAAN
FT                   KEEEQKILFGQKAR"
FT   gene            complement(623038..623385)
FT                   /locus_tag="BCAN_A0643"
FT   CDS_pept        complement(623038..623385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0643"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61718"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA06"
FT                   /protein_id="ABX61718.1"
FT                   /translation="MIRTLILGVTLAAGFAAPAFADEAIVGTWKRPNGTLISYAACGAN
FT                   KFCGTVMTGEYKGKSIGTMSGKDGNYKGEVNKLDEGKTYSGKASVKGNTLSLSGCVMGG
FT                   LICKSESLARQ"
FT   gene            complement(623382..623672)
FT                   /locus_tag="BCAN_A0644"
FT   CDS_pept        complement(623382..623672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0644"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61719"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA07"
FT                   /protein_id="ABX61719.1"
FT                   /translation="MGFSENFGFGRKAGGNRMITIGRIGMVRIGAKRALQTAMMKLKIA
FT                   PSASPETRLRLRLRKLMRGAERMLLQRLKRMNSGFIAAPTIRDSRHFGRNE"
FT   gene            623891..624148
FT                   /locus_tag="BCAN_A0645"
FT   CDS_pept        623891..624148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0645"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61720"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA08"
FT                   /protein_id="ABX61720.1"
FT                   /translation="MAQFQSFNHNENPAAQDRILLEMGMKYAIGRDCEIDVIEAHKWLN
FT                   IAAIRGNQKAERMRNQVAATMSKSELAAALRCAREWMTAH"
FT   gene            complement(624208..624981)
FT                   /locus_tag="BCAN_A0646"
FT   CDS_pept        complement(624208..624981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0646"
FT                   /product="protein of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61721"
FT                   /db_xref="GOA:A9MA09"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA09"
FT                   /protein_id="ABX61721.1"
FT                   /translation="MMQSNSGEDGILGTALFRCFTHYPKQSRFALLLEMLWSLKLADIA
FT                   DSAPSLADASSPISVDRHRLYEDAIAMLIGTSFIALGITLYSHAMLMTGSTAGIALLIH
FT                   YATGTGFGLLYFLINLPFYYFAVRRMGWAFTIRTFAAVALLSGFTRLMPLSVDFTSINP
FT                   LFAALMGGTLMGMGVLALFRHRSGVGGVNILALYLQDAYGIRAGWFQLGLDVLIMLASL
FT                   FFIPWENMVLSLVGAVAMNVIIAINHKPGRYIGIS"
FT   gene            625635..626285
FT                   /locus_tag="BCAN_A0647"
FT   CDS_pept        625635..626285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0647"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61722"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA10"
FT                   /protein_id="ABX61722.1"
FT                   /translation="MSIRTITAMAGTAFIMGAAAIAFSSPASALTMKECSTKYQAAKDA
FT                   GTLGNMKWNDFRKAQCGDDAASAPAAAPAAAPATKKAAKAAAPASNDGAKSLTMKQCSA
FT                   KYQAAKDAGTDNGMKWNDFRKAECGPGADPVALSTDGDSEPAAPSVAAPKGVKFPTAVS
FT                   AKYSKESAGKARMHTCLDQYHALKDANALGGLKWVQKGGGYYSLCNARLKGNS"
FT   gene            complement(626330..626704)
FT                   /locus_tag="BCAN_A0648"
FT   CDS_pept        complement(626330..626704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0648"
FT                   /product="protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61723"
FT                   /db_xref="GOA:A9MA11"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA11"
FT                   /protein_id="ABX61723.1"
FT                   /translation="MPSINGQPRSVLFGTLAGLCGALGIASYAGAAHMGESHLGTIAPL
FT                   LLAHAPALLFLSLISPVSRVVRIGGAILVVGLALFCGDLFMRDMTGDRLFPFAAPTGGS
FT                   LMILGWLCLGCSGWFSANAK"
FT   gene            complement(626722..627855)
FT                   /gene="hisC"
FT                   /locus_tag="BCAN_A0649"
FT   CDS_pept        complement(626722..627855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="BCAN_A0649"
FT                   /product="Histidinol-phosphate aminotransferase"
FT                   /note="GO_function: GO:0016769 - transferase activity,
FT                   transferring nitrogenous groups; GO_process: GO:0009058 -
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61724"
FT                   /db_xref="GOA:A9MA12"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA12"
FT                   /protein_id="ABX61724.1"
FT                   /translation="MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFKARIGANESSFG
FT                   PAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVRQY
FT                   VQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLYIAN
FT                   PDNPMGTWHEGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRMRTFS
FT                   KAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVVGKICA
FT                   GRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPGTPVLDR
FT                   CIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT"
FT   gene            complement(628218..629144)
FT                   /gene="xerC"
FT                   /locus_tag="BCAN_A0650"
FT   CDS_pept        complement(628218..629144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BCAN_A0650"
FT                   /product="Tyrosine recombinase xerC"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61725"
FT                   /db_xref="GOA:A9MA13"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA13"
FT                   /protein_id="ABX61725.1"
FT                   /translation="MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAELT
FT                   AKYINILWDDGSHKYNVRSFLGEIDEILKGARFSGFDQEMLDSIIGTLRERGNSNATIN
FT                   RKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEDSYR
FT                   LSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPRERLK
FT                   GPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQMWLGH
FT                   QTLQMTMRYAHLATHDLDSCVKVLEIH"
FT   gene            complement(629418..630521)
FT                   /gene="ropA"
FT                   /locus_tag="BCAN_A0651"
FT   CDS_pept        complement(629418..630521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropA"
FT                   /locus_tag="BCAN_A0651"
FT                   /product="Outer membrane protein IIIA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61726"
FT                   /db_xref="GOA:A9MA14"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA14"
FT                   /protein_id="ABX61726.1"
FT                   /translation="MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGA
FT                   GYFYIPGTETCLRVHGYVRYDVKGGDDVYTGSDRKGWDKGARFALMFNTNSETELGTLG
FT                   TYTQLRFNYTSNNSRHDGQYGDFSDDRDVADGGVSTGTDLQFAYITLGGFKVGIDESEF
FT                   HTFTGYLGDVINDDVVAAGSYRTGKIAYTFTGGNGFSAVIALEQGGEDVDNDYTIDGYM
FT                   PHVVGGLKYAGGWGSIAGAVAYDPVIEEWATKVRGDVNITDRFSVWLQGAYSSAATPNQ
FT                   NYGQWGGDWAVWGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTITPEVSY
FT                   TKFGGEWKDTVAEDNAWGGIVRFQRSF"
FT   gene            complement(630705..630792)
FT                   /locus_tag="BCAN_A0652"
FT   tRNA            complement(630705..630792)
FT                   /locus_tag="BCAN_A0652"
FT                   /product="tRNA-Ser"
FT   gene            631322..632449
FT                   /gene="ropA"
FT                   /locus_tag="BCAN_A0653"
FT   CDS_pept        631322..632449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropA"
FT                   /locus_tag="BCAN_A0653"
FT                   /product="Outer membrane protein IIIA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61727"
FT                   /db_xref="GOA:A9MA15"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA15"
FT                   /protein_id="ABX61727.1"
FT                   /translation="MPRPIFNFDWRSEMNIKSLLLGSAAALVAASGAQAADAIVAPEPE
FT                   AVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGDDVYTGSDRKGWDKSARFALR
FT                   VSTGSETELGTLKTFTELRFNYAANNSGVDGKYGNETSSGTVMEFAYIQLGGLRVGIDE
FT                   SEFHTFTGYLGDVINDDVISAGSYRTGKISYTFTGGNGFSAVIALEQGGDNDGGYTGTT
FT                   NYHIDGYMPDVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDQFSVWLQGAY
FT                   SSAATPDQNYGQWGGDWAVWGGLKYQATQKAAFNLQAAHDDWGKTAVTANVAYELVPGF
FT                   TVTPEVSYTKFGGEWKNTVAEDNAWGGIVRFQRSF"
FT   gene            632593..633234
FT                   /locus_tag="BCAN_A0654"
FT   CDS_pept        632593..633234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0654"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61728"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA16"
FT                   /protein_id="ABX61728.1"
FT                   /translation="MKKWFWPCLTWTACLTALALWFGADRVETDIAEQTAKALEPYVWA
FT                   GFYVDGRDVVLKGMAPDPDMQRAAHAALEHVWAIRDITDLTTVLQLASPYRFKIGRNAQ
FT                   GLVLSGFIPNNESRDQVMTAAGEVAPDIFIDDEMAVARGNQPEFMERVLFAIDLAKKLP
FT                   EAEIEIVDEKLSIRGTVSDEAIYDEIEALKAAQLPYGLKLAVLDVKKSVQ"
FT   gene            633290..633472
FT                   /locus_tag="BCAN_A0655"
FT   CDS_pept        633290..633472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0655"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61729"
FT                   /db_xref="GOA:A9MA17"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA17"
FT                   /protein_id="ABX61729.1"
FT                   /translation="MTVFPIRPFLCYDYSAKGLKCLAKYYAESLMLYLVETFWPVLVLA
FT                   ILIGAATGWLTAGER"
FT   gene            633534..634208
FT                   /locus_tag="BCAN_A0656"
FT   CDS_pept        633534..634208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61730"
FT                   /db_xref="GOA:A9MA18"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA18"
FT                   /protein_id="ABX61730.1"
FT                   /translation="MEYEDEMPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERT
FT                   IVAAALSTPPLAEKPEPVPPAEPVRADSDPLKRKAGLEKARIEPVEGSADSDVAAAPVL
FT                   QKVPAETPDDAGRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTRE
FT                   EAIWIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANNVRSGTRRAKKQ
FT                   AG"
FT   gene            complement(634271..636328)
FT                   /locus_tag="BCAN_A0657"
FT   CDS_pept        complement(634271..636328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0657"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61731"
FT                   /db_xref="GOA:A9MA19"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA19"
FT                   /protein_id="ABX61731.1"
FT                   /translation="MVSLAQSSLPPEIPTPLARPFAPTTTHQSPISLVTPRPRPIAPDP
FT                   MATSAVSRTDNPAVIGGTLKNGLDALSAKNVASAIASRNNLPRGSLDRQILTWAIATSG
FT                   MDGVPSTEIAAAASELSGWPGMATLRRNSERALFKENPSSATIIATFGSTRPQTTEGMI
FT                   ALARAYVATGNSTKAHQLLSPWWTRKRLSSDDEQKILKEFSAILTREDHQRRLLHSLYN
FT                   GRLQSARLLAGPAQAQSLYNAYAAVAQKSPNAASAIAAVDRSWQANPVYQFLKIRYLRR
FT                   AERYNEAAELLLKAPRKASVLVDPDAWWVERRILSRELLDLGKPQLAYRLAAAHAAETP
FT                   TMAAEAEFHAGWYALRALNQPKLAAPHFAKITQISARPISASRAYYWLGRAAEAGSGGD
FT                   ARAYYRRSAHFGTTFYGQLAAAKLNEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQV
FT                   GYGNKAAALYTQLSQELDSVGELALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHP
FT                   LGAIPASANIKGSGKALAYAIARQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMS
FT                   FSAQKLTADAAYNATLGAHFLGEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGK
FT                   SVEQVVDWIERIPYSETRNYVQRVMENYEVYKTRLTGRADIKTDLVYGRR"
FT   gene            636252..636416
FT                   /locus_tag="BCAN_A0658"
FT   CDS_pept        636252..636416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0658"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61732"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA20"
FT                   /protein_id="ABX61732.1"
FT                   /translation="MVVGAKGRASGVGISGGSDDWASETIGWTAAAMKQPARSTVRLEE
FT                   IAATFLNMA"
FT   gene            636804..637685
FT                   /gene="dapA"
FT                   /locus_tag="BCAN_A0659"
FT   CDS_pept        636804..637685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BCAN_A0659"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="GO_function: GO:0008840 - dihydrodipicolinate
FT                   synthase activity; GO_process: GO:0009089 - lysine
FT                   biosynthetic process via diaminopimelate"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61733"
FT                   /db_xref="GOA:A9MA21"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA21"
FT                   /protein_id="ABX61733.1"
FT                   /translation="MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGTT
FT                   GETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLVVT
FT                   PYYNKPNQRGLYEHFSRVVRSISIPLVIYNIPGRSIIDMTPETMGALVRDCKNIVGVKD
FT                   ATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEFQEAC
FT                   QAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEAATAEK
FT                   IDHAMKHAGLIN"
FT   gene            637776..638252
FT                   /gene="smpB"
FT                   /locus_tag="BCAN_A0660"
FT   CDS_pept        637776..638252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BCAN_A0660"
FT                   /product="SsrA-binding protein"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_process:
FT                   GO:0006450 - regulation of translational fidelity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61734"
FT                   /db_xref="GOA:A9MA22"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA22"
FT                   /protein_id="ABX61734.1"
FT                   /translation="MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLRA
FT                   NQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSVSR
FT                   EGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG"
FT   gene            complement(638389..639060)
FT                   /locus_tag="BCAN_A0661"
FT   CDS_pept        complement(638389..639060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0661"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61735"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA23"
FT                   /protein_id="ABX61735.1"
FT                   /translation="MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDV
FT                   RLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACI
FT                   VNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSR
FT                   HPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLS
FT                   V"
FT   gene            complement(639091..639666)
FT                   /locus_tag="BCAN_A0662"
FT   CDS_pept        complement(639091..639666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0662"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61736"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA24"
FT                   /protein_id="ABX61736.1"
FT                   /translation="MFDSREKIALFINGANLYAASKTLGFDIDYRKLLKAFQKRGYLLR
FT                   AYYYTALVEDQEYSSIRPLIDWLDYNGYKVVTKAAKEFTDSTGRRKVKGNMDIELTVDA
FT                   MQLTDTVDHFVIFSGDGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADHFID
FT                   LVSLKAEIGRDPSERAPRRQEEDFDESY"
FT   gene            complement(639866..640021)
FT                   /locus_tag="BCAN_A0663"
FT   CDS_pept        complement(639866..640021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0663"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61737"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA25"
FT                   /protein_id="ABX61737.1"
FT                   /translation="MHITLVEGNYKQKRKAPHYNRLYISMLHVFMKSDAEFEIRFILIQ
FT                   YSASYQ"
FT   gene            640063..640464
FT                   /gene="rpoZ"
FT                   /locus_tag="BCAN_A0664"
FT   CDS_pept        640063..640464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BCAN_A0664"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="GO_function: GO:0003899 - DNA-directed RNA
FT                   polymerase activity; GO_process: GO:0006350 -
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61738"
FT                   /db_xref="GOA:A9MA26"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA26"
FT                   /protein_id="ABX61738.1"
FT                   /translation="MARVTVEDCVDKVENRFELVLLAGHRARQISQGVPITVDRDNDKN
FT                   PVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAGEE
FT                   DVVTFDRMSEEELLAGIEGLVAPEKNDGF"
FT   gene            640705..642957
FT                   /locus_tag="BCAN_A0665"
FT   CDS_pept        640705..642957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0665"
FT                   /product="RelA/SpoT family protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0015968 - stringent response"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61739"
FT                   /db_xref="GOA:A9MA27"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA27"
FT                   /protein_id="ABX61739.1"
FT                   /translation="MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPY
FT                   FSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLK
FT                   KLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMCEDKRLRIAEETM
FT                   DIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSE
FT                   IFEKNGIKASVKSRQKKPWSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIH
FT                   TTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSI
FT                   YKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKG
FT                   RLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPP
FT                   AAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRL
FT                   ARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTKNNPAKAGEKGWFNIQNAAGMI
FT                   FKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPG
FT                   AGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAINSPGSLAKIAQI
FT                   AAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESASVSSAKRVNG"
FT   gene            642965..643543
FT                   /gene="pyrE"
FT                   /locus_tag="BCAN_A0666"
FT   CDS_pept        642965..643543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BCAN_A0666"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="GO_function: GO:0004588 - orotate
FT                   phosphoribosyltransferase activity; GO_process: GO:0009220
FT                   - pyrimidine ribonucleotide biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61740"
FT                   /db_xref="GOA:A9MA28"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA28"
FT                   /protein_id="ABX61740.1"
FT                   /translation="MNTDDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKT
FT                   EKLCKALAEKIRAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLRRF
FT                   DVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLISLA
FT                   AYEVPAYPADKLPPELAAIPAVKPGSRNI"
FT   gene            643703..644458
FT                   /gene="fnrA"
FT                   /locus_tag="BCAN_A0667"
FT   CDS_pept        643703..644458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnrA"
FT                   /locus_tag="BCAN_A0667"
FT                   /product="Transcriptional activator protein fnrA"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61741"
FT                   /db_xref="GOA:A9MA29"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA29"
FT                   /protein_id="ABX61741.1"
FT                   /translation="MVVVPFALDQNQKLAARTPCKVCEDCCVRSMAVCSALDDGDLAAL
FT                   EAIMTSKKLDTNEMLVEEGEPELRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLA
FT                   DDEVYSQSAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLVLGR
FT                   LAPVEKLASFLLVLSARAEKRGEKPNPVHLLMNRTDIADYLGLTIETVSRSFTKLKTQG
FT                   LIQLRGANTVEILSRRSLAVVAGLDPDNL"
FT   gene            644839..646172
FT                   /pseudo
FT                   /gene="hemN"
FT                   /locus_tag="BCAN_A0668"
FT                   /note="oxygen-independent coproporphyrinogen III oxidase"
FT   gene            complement(646356..647567)
FT                   /locus_tag="BCAN_A0669"
FT   CDS_pept        complement(646356..647567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0669"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61742"
FT                   /db_xref="GOA:A9MA30"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA30"
FT                   /protein_id="ABX61742.1"
FT                   /translation="MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYPM
FT                   LKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFLAT
FT                   AHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGPLLA
FT                   AFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANASKPKPDKTLPLPRNRVIA
FT                   PVAVLALLVFTKYIYMAILTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTIIGGPI
FT                   GDKISARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVFAQELLP
FT                   GRVGMVSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSYLPFLGLLTIFLPKLER
FT                   RRKA"
FT   gene            647819..648601
FT                   /locus_tag="BCAN_A0670"
FT   CDS_pept        647819..648601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0670"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61743"
FT                   /db_xref="GOA:A9MA31"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA31"
FT                   /protein_id="ABX61743.1"
FT                   /translation="MPENEDLQRFHERRIAMLESMTGPAIALPTRYPDGYFVPRHSHSR
FT                   AQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAISGV
FT                   PNYLHVVGLTDLMRCLIIDATSHDSIPAPEYPLGLPFPSDPRLQKLCRDFVKKPSSRAT
FT                   IDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACLFAAVPRLSEGEPVTSVALDLGYD
FT                   SVSAFTTMFRRMLGVPPKFYQPRLDVAPSERSDKAAFG"
FT   gene            648651..649226
FT                   /locus_tag="BCAN_A0671"
FT   CDS_pept        648651..649226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61744"
FT                   /db_xref="GOA:A9MA32"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA32"
FT                   /protein_id="ABX61744.1"
FT                   /translation="MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPHA
FT                   VAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGSTFE
FT                   LGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFVTRY
FT                   AVSVFRRRRLERLAEKHRLHRQRELQKA"
FT   gene            649223..649627
FT                   /gene="acpS"
FT                   /locus_tag="BCAN_A0672"
FT   CDS_pept        649223..649627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BCAN_A0672"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /note="GO_function: GO:0008897 -
FT                   phosphopantetheinyltransferase activity; GO_process:
FT                   GO:0008610 - lipid biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61745"
FT                   /db_xref="GOA:A9MA33"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA33"
FT                   /protein_id="ABX61745.1"
FT                   /translation="MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQR
FT                   AASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPA
FT                   GTNAAIHLTITDDFPLAQAFVIIEALPVLE"
FT   gene            649738..650520
FT                   /gene="lepB"
FT                   /locus_tag="BCAN_A0673"
FT   CDS_pept        649738..650520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="BCAN_A0673"
FT                   /product="signal peptidase I"
FT                   /note="GO_function: GO:0009004 - signal peptidase I
FT                   activity; GO_process: GO:0006465 - signal peptide
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61746"
FT                   /db_xref="GOA:A9MA34"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA34"
FT                   /protein_id="ABX61746.1"
FT                   /translation="MSVSSKNETKKSGGLGETISVIVQALLLALIIRTLLFQPFSIPSG
FT                   SMRPTLLEGDYLFVSKYAYGYSRYSLPFGLDLFSGRIWSAEPKRGDVVVFKLPSDTSVD
FT                   YIKRVIGLPGDRVQMRGGVLYINDKPVKRERVGTINNPDVTEENRPVEVYRETLPNGVT
FT                   YDTLELAPNSIGDDTRVFEVPAGHYFMMGDNRDNSLDSRFGVGYVPFENLVGRANIIFF
FT                   SIADKASPLEIWKWPTDVRFNRLFTWVSGEPHTAVTGN"
FT   gene            650489..651226
FT                   /gene="rnc"
FT                   /locus_tag="BCAN_A0674"
FT   CDS_pept        650489..651226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BCAN_A0674"
FT                   /product="ribonuclease III"
FT                   /note="GO_function: GO:0004525 - ribonuclease III activity;
FT                   GO_process: GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61747"
FT                   /db_xref="GOA:A9MA35"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA35"
FT                   /protein_id="ABX61747.1"
FT                   /translation="MNRTRPLPEIKMVSANKTASILEERTGHRFLNLKRLERALTHSSV
FT                   QAPARANYERLEFLGDRVLGLTVAEMLFEAFPEASEGELSVRLNALVNAETCAAIADEI
FT                   GLADLIHTGSDIKSLNDKRLLNVRADVVEALIATIYLDGGLEAARSFIQRYWKKRSLET
FT                   GAARRDAKTELQEWAHQQGNVHPVYAILSRSGPDHDPLFLVEVTVKGFAPEKGEGRSKR
FT                   IAEQSAAEAMLYREGVWKRDGSA"
FT   gene            651269..651367
FT                   /locus_tag="BCAN_A0675"
FT   CDS_pept        651269..651367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0675"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61748"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA36"
FT                   /protein_id="ABX61748.1"
FT                   /translation="MIATVIGLKAALLQRDAVSQGEGNLPQEGLEG"
FT   gene            651371..652306
FT                   /gene="era"
FT                   /locus_tag="BCAN_A0676"
FT   CDS_pept        651371..652306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="BCAN_A0676"
FT                   /product="GTP-binding protein Era"
FT                   /note="GO_function: GO:0005525 - GTP binding; GO_process:
FT                   GO:0016049 - cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61749"
FT                   /db_xref="GOA:A9MA37"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA37"
FT                   /protein_id="ABX61749.1"
FT                   /translation="MNNGTSPAGGETEATQTRSGFVALIGAPNAGKSTLVNQLVGTKVS
FT                   IVTHKVQTTRALVRGIFIEGPAQIVLVDTPGIFRPKRRLDRAMVTTAWGGAKDADIILV
FT                   IIDAQGGFNENAEALLESMKDVRQKKVLVLNKVDRVDPPVLLSLAQKANELVPFDRTFM
FT                   ISALNGSGCKDLAKYLAESVPNGPWYYPEDQISDIPMRQLAAEITREKLYLRLHEELPY
FT                   ASTVETERWEERKDGSVRIEQVIYVERESQKKIVLGHKGETVKAIGQAARKEISEILEQ
FT                   TVHLFLFVKVRENWGNDPERYREMGLDFPT"
FT   gene            652333..653076
FT                   /gene="recO"
FT                   /locus_tag="BCAN_A0677"
FT   CDS_pept        652333..653076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="BCAN_A0677"
FT                   /product="DNA repair protein RecO"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61750"
FT                   /db_xref="GOA:A9MA38"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA38"
FT                   /protein_id="ABX61750.1"
FT                   /translation="MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQ
FT                   PLLQPGNHVDVSWWARLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPER
FT                   DPHRGLYETLRLIIEHFDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYV
FT                   SPKSGRAVCREAGAPWAEKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPR
FT                   AQTPPDSRSGFLNAVGRAINLSQAS"
FT   gene            complement(653054..653563)
FT                   /locus_tag="BCAN_A0678"
FT   CDS_pept        complement(653054..653563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0678"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61751"
FT                   /db_xref="GOA:A9MA39"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA39"
FT                   /protein_id="ABX61751.1"
FT                   /translation="MSRIVVTPLSQLATQITLHRPSHVLTLTSGEPAALPAGHGASRLT
FT                   LIFNDIVEPREGLVAPGESHVRALIDFVQGWPRKAPLLIHCYAGISRSTAAAYIAALAL
FT                   DRDMDEHRLAERLRRFSPSATPNIRLISIADTMLGRRGRMVEAIKAIGRGAEAYEGEVF
FT                   SLPVKD"
FT   gene            complement(653560..654180)
FT                   /locus_tag="BCAN_A0679"
FT   CDS_pept        complement(653560..654180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61752"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA40"
FT                   /protein_id="ABX61752.1"
FT                   /translation="MANADRTSGKPRAWQRMLSGRRLDLLDPSPLDVEIEDIAHGLARV
FT                   ARWNGQTVGEHAFSVAQHSLLVDQIFNRLVPGASIEWQMLALLHDAPEYVIGDMISPFK
FT                   AVMGGNYKLIETRLESAIHLRFSLPVSPPAKLKTLIKRADQVAAFFEATRLAGFTEAEG
FT                   VKYFGRPRGLNPVGLDIVPRPTQDVQADFLKRFSALDKARQTA"
FT   gene            complement(654180..655043)
FT                   /locus_tag="BCAN_A0680"
FT   CDS_pept        complement(654180..655043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0680"
FT                   /product="Glycine cleavage T-protein barrel"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61753"
FT                   /db_xref="GOA:A9MA41"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA41"
FT                   /protein_id="ABX61753.1"
FT                   /translation="MMTASKTVNLSYRALVHITGEEAEKFLQAVITTNLDQLGPHELKP
FT                   GALLTPQGKILFDFLVSRIEGGLRFDLPADVAGDFVKRITLYRLRAKAEIVQVPESLVS
FT                   VCWQGDSPASDNDSIKRDSRFPAQLNVLRLYHQASANAGLDAWVQLRAEYGIAEGEADF
FT                   AYGDVFPHDVNFDQTGGVSFPKGCFIGQEVVSRMQHRGTARRRVLIARSDVPLPPMGTP
FT                   ITVEGREIGAMGSSASQIGLALVRIDRVKDAMDTGNSILAGDAAITLSLPPHVRFGFPE
FT                   AETGHG"
FT   gene            655129..656463
FT                   /gene="pyrC"
FT                   /locus_tag="BCAN_A0681"
FT   CDS_pept        655129..656463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="BCAN_A0681"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="GO_function: GO:0004151 - dihydroorotase activity;
FT                   GO_process: GO:0009220 - pyrimidine ribonucleotide
FT                   biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61754"
FT                   /db_xref="GOA:A9MA42"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA42"
FT                   /protein_id="ABX61754.1"
FT                   /translation="MAATFDTILKGATIVNHDGIGQRDIGIRNGRIAAIGSLAGNSAGE
FT                   VIDCTGLHILPGVVDSQVHFREPGLEHKEDLETGSLAAVLGGVTAVFEMPNTKPLTTSA
FT                   EMLEDKIRRGRHRMHCDFAFWVGGTRDNAKDVAELERLPGAAGIKVFMGSSTGDLLVED
FT                   DDGVRSILRNTRRRAAFHSEDEFRLKEREGLRVEGDPSSHPVWRDEIAALQCTQRLVRI
FT                   ARETGARIHVLHISTAEEIDFLKDYKDVATCEATPHHLTLSADDYKALGNLIQMNPPVR
FT                   DKRHREGVWKGIDQGIVDVLGSDHAPHTLEEKQKSYPASPSGMTGVQTLVPIMLDHVNA
FT                   GKLSLERFVDLSSHGPNRIFGMARKGRIAVGYDADLTIVDMKRRETITHEQAGSKAGWT
FT                   PYHGKTVTGWPVGTFVRGIKVMWEAEIVNPHKGEPVEFLEALPRR"
FT   gene            complement(656512..657276)
FT                   /locus_tag="BCAN_A0682"
FT   CDS_pept        complement(656512..657276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0682"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61755"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA43"
FT                   /protein_id="ABX61755.1"
FT                   /translation="MALPLFSAKMLLPVGNPPSLKTLATGLILACGIALPASAKDTLQV
FT                   ALADRSEFLPLSRSSIEANRGNTPALVPLPDALPRAIPKSASDGAPAPLHISKAIPEIH
FT                   RDFDKLPEPVRAMRERMLEAARSGDIERLRPLLGVQDKATQLALEDNEEDVIDFLKSLS
FT                   GDEDGREVLAIITDLLDTGYVHLNVGQQNEVYVWPYFYAMPLDKLTPPQIVELFQIVTA
FT                   GDFEDMKKAGGYIFYSIGIGPDGSWRFFTAGQ"
FT   gene            complement(657325..657591)
FT                   /locus_tag="BCAN_A0683"
FT   CDS_pept        complement(657325..657591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0683"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61756"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA44"
FT                   /protein_id="ABX61756.1"
FT                   /translation="MKSMEYAPADLDEMIAREKKLVAIEYQNEAWADGMSEGIEPEILA
FT                   EAAFTTALTELIREVGDDCALDLIEKMREQVIAGTFLSRRILQ"
FT   gene            complement(657748..658131)
FT                   /locus_tag="BCAN_A0684"
FT   CDS_pept        complement(657748..658131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61757"
FT                   /db_xref="InterPro:IPR012645"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA45"
FT                   /protein_id="ABX61757.1"
FT                   /translation="MKDYRRLFRLAAGAAALWLAVCPPVLAQDAPYEGKMLRLAEVLGS
FT                   LHYLRNLCGEKGSEWRDRMDAIIAAEKPPEAERLKLVSSFNHGYRVFSDNYARCTPSAL
FT                   AAIDRYMKEGGDLSNEIISRYGN"
FT   gene            complement(658211..658654)
FT                   /locus_tag="BCAN_A0685"
FT   CDS_pept        complement(658211..658654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0685"
FT                   /product="NUDIX hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61758"
FT                   /db_xref="GOA:A9MA46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA46"
FT                   /protein_id="ABX61758.1"
FT                   /translation="MRTVAVTPIPLQIHGVSTICRREGRFLLVERAKEPWKGWLAFPGG
FT                   GVEAGETPEEAAIRELKEETALDAHSLCHVITIDLAREGNAYEKSYYLSVYRTLEISGT
FT                   EQPGDDAAAIRWLTVEEMETANVTDSTLDVARMVAQDEDGSGY"
FT   gene            658740..659519
FT                   /locus_tag="BCAN_A0686"
FT   CDS_pept        658740..659519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0686"
FT                   /product="protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61759"
FT                   /db_xref="GOA:A9MA47"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA47"
FT                   /protein_id="ABX61759.1"
FT                   /translation="MCGRFSLTASRQELETLFGALIAEDFPPRYNIAPTQPILAILAGE
FT                   TPPPGSNRPDRIAMLVRWGFVPAWVKDPNDWPLMFNIRSETAAEKNSFKAALSHRRALV
FT                   PASGFYEWRREGRNKSQAYWVRPRNGGVVAFGALMETWSSADGSQIDTAGILTTSANGL
FT                   LQPIHERMPVVVQPEDYRRWLDCKQFLAREVADIMRPVQDDFFEAIPVSGKVNKVANTS
FT                   PDLQERVTEDLTQGQPQPKRKKGPEPEEDSGGQLSMF"
FT   gene            659574..660188
FT                   /locus_tag="BCAN_A0687"
FT   CDS_pept        659574..660188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0687"
FT                   /product="amino acid transporter yggA"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005293 - lysine permease activity; GO_process:
FT                   GO:0006865 - amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61760"
FT                   /db_xref="GOA:A9MA48"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA48"
FT                   /protein_id="ABX61760.1"
FT                   /translation="MFPAALSGFLLGASLIIAIGAQNAFILRQGLLRQHVFILCLICAL
FT                   SDALLISAGVAGLGTLIAQSPKLIAFVTLAGAAFLFWYASVAFRRAFHPEAMQVKSNGA
FT                   VSLKAAAATCLAPTFLNPHVYLDTVLLIGSLSARLEGPARAAYGAGAATASCIWFFALG
FT                   YGTRLLQPIFAKPAAWRVLDCIIGVVMALIGLSLSARFFHG"
FT   gene            complement(660165..660332)
FT                   /locus_tag="BCAN_A0688"
FT   CDS_pept        complement(660165..660332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0688"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61761"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA49"
FT                   /protein_id="ABX61761.1"
FT                   /translation="MSKNDLQSRPERLVDQYRDIGPAVLVAACKATHRTGNQQRSNLDR
FT                   PSILAVKKPG"
FT   gene            660699..662219
FT                   /gene="cysS"
FT                   /locus_tag="BCAN_A0689"
FT   CDS_pept        660699..662219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BCAN_A0689"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004817 - cysteine-tRNA ligase activity; GO_process:
FT                   GO:0006423 - cysteinyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61762"
FT                   /db_xref="GOA:A9MA50"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA50"
FT                   /protein_id="ABX61762.1"
FT                   /translation="MPDTAPQLRLYNTLTRTKEAFAPIDAKNVRMYVCGPTVYDFAHIG
FT                   NARPVIVFDVLFRLLRHVYGAQHVTYARNITDVDDKINARAARDYPDLPFNEAIRKVTE
FT                   STNAQFQADVTALGNLQPTVQPRATEHMDEMRAMIDRLVQRGVAYVAQDHVLFSPSAMN
FT                   ARKGPRYGALARRSLDEMLAGARVDVASYKRDEMDFVLWKPSKKGEPGWPSPAGIETLG
FT                   RPGWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQSCCAL
FT                   GTERMANIWMHNGFLQVEGQKMSKSLGNFITIRDVLNDGLPQLGEWGDNTVRDRWAGLA
FT                   ARLSMLQTHYREPINWTAQRLAESADELHRWYGLLRDEGFGAPEKLSHASAVAAALCDD
FT                   LNSWAAITALRQAFKVRDVAALGEGMALMGLLDPYFVTASDVPIFARADVDASAIAARI
FT                   AERLNFINAKNWAEADRIRDELLQEGVQLKDSKDPATGERITTWDVVG"
FT   gene            662238..662372
FT                   /locus_tag="BCAN_A0690"
FT   CDS_pept        662238..662372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0690"
FT                   /product="Hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61763"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA51"
FT                   /protein_id="ABX61763.1"
FT                   /translation="MARERIYIYDTTSVDGQQTLPARPQPRSERGRAKAKAGVCLGGQ"
FT   gene            662372..663985
FT                   /locus_tag="BCAN_A0691"
FT   CDS_pept        662372..663985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0691"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61764"
FT                   /db_xref="GOA:A9MA52"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA52"
FT                   /protein_id="ABX61764.1"
FT                   /translation="MARERIYIYDTTLRDGQQTPGVDFSVEDKKSIVTLLEELGVDYVE
FT                   GGYPGANPTDTAFFKRRQTARAKFVAFGMTKRAGVSVSNDPGLSSLLQASADAVCFVAK
FT                   SWDYHVRLALGCTNEENLESITASATAARMAGREALVDCEHFFDGYKANPEYALACAKA
FT                   AYSAGARWVVLCDTNGGTQPLEVAAIVEAVKAVVPGESLGIHAHNDTEQAVAVSLAAID
FT                   AGVRHVQGTLNGIGERCGNANLVSLIPTLVLKPYWAERFELGIKPASLKSITRISRAFD
FT                   DILNRPATEQAPYTGTSAFATKAGIHASALMKEPQTYEHIPPESVGNSRRVMVSDQGGK
FT                   SNFIAELERRGIRVAKDDVRLDTLIALVKEREAEGYAYEGADASFELLARGMLNPQPEF
FT                   FKVESFRCLVERRFDANGMLKTVSEAVVKVEVDGEMHMSVAEGHGPVNALDIALRKDLG
FT                   RFQAEIEDLELVDFKVRILNGGTAAITRVLIESGDATGARWRTVGVSDNIIDASFQALM
FT                   DSVNYKLMKNRAMAGLAAAE"
FT   gene            664232..665152
FT                   /gene="rarD"
FT                   /locus_tag="BCAN_A0692"
FT   CDS_pept        664232..665152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="BCAN_A0692"
FT                   /product="RarD protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61765"
FT                   /db_xref="GOA:A9MA53"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA53"
FT                   /protein_id="ABX61765.1"
FT                   /translation="MADQAISDTRLSDGSRGFLMALGAYGLWGALPFYLKALSHVPAME
FT                   VVSHRVIWSVPVALVLLILLGQFRGILSAVRQPRMLAMAALTAALVTMNWSVYVWAVAH
FT                   DQVMGAALGYYINPLFNVVLGRLFLGERLTKTQYVAVGLAFVAVVLLTINAGGLPWVSL
FT                   ALPISFGLYGFFRKSLPMPPLQGFTLEVLILCIPALAYVAWLAATGQDHFVAGPVSNIT
FT                   LLLLAGPFTAIPLILYAGGAKLLRYATLGLMQYMTPTMLFFFAIFIFHEPFSTAQLAAF
FT                   LLIWAGLALYTWSSLSQHRRNRAQA"
FT   gene            665285..667018
FT                   /locus_tag="BCAN_A0693"
FT   CDS_pept        665285..667018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BCAN_A0693"
FT                   /product="peptidase M23B"
FT                   /note="GO_function: GO:0004222 - metalloendopeptidase
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61766"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA54"
FT                   /protein_id="ABX61766.1"
FT                   /translation="MVFGSARVGGEAVFTHNVVTPDGAALAEPLSLNIPKSSSYVHFSL
FT                   RTHARLCLALVSALAIAGGGLILTTGRLVPHGHAAQPVMVNPANLSHHTAAPKQPRLAP
FT                   QMNIATNRRISKRIDIAEGAGDGDARLYTYQHVVLDLKGGTGSLDANVSPEPSKPAQTA
FT                   LPLAPDQNGIPINVSLARPATAPGHQVHEIVIAPQSREEMGALLQAAGVSSDDSKRLEE
FT                   ALARTVLVPGDNLELLIDKPAGRNKNADKTAHISLARFRHGDAAHAVYGRADDGVFHAN
FT                   GNERLFARLSRDAMLTAYHPQPLQPSDGSISYRLKQAGAPEAVVREVKKLASDNGISLA
FT                   KNNNALNLIDLLFRKSEENAPELVYVEFNINGRSKRLYRHEGSGGVDYFNEDGSPMTKY
FT                   LMHKPLPNGRLNDGFGWRIHPVLHVRKHHNGVDYDAPLGSPIVAAGDGVVDLISWQKGY
FT                   GKYVRIRHQGGYSTTYAHLSAEAKGLKVGKHVKQGEVIAYVGSTGYSTGPHLYYELKVG
FT                   DKYVDPLTARLNAGEKLTGSSLSSFREEISHVGKIVNEMKLPILDNGSAGSADKPAHNG
FT                   Q"
FT   gene            complement(667086..667916)
FT                   /gene="ksgA"
FT                   /locus_tag="BCAN_A0694"
FT   CDS_pept        complement(667086..667916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BCAN_A0694"
FT                   /product="dimethyladenosine transferase"
FT                   /note="GO_function: GO:0000179 - rRNA
FT                   (adenine-N6,N6-)-dimethyltransferase activity; GO_process:
FT                   GO:0000154 - rRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61767"
FT                   /db_xref="GOA:A9MA55"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MA55"
FT                   /protein_id="ABX61767.1"
FT                   /translation="MSIDSLPPLREVIERHDLMPKKSLGQNFLFDLNLTSKIARQAGDL
FT                   RDQPVIEVGPGPGGLTRALLAQGAYVTAIERDDRCLEALAEIAAHYPGRLRIIAGDALE
FT                   QDFTALFPEGPKPRIVANLPYNVGTQLLLNWLLVEPWPPFYSSMTLMFQREVAERIVAK
FT                   PDSDHYGRLGVLAGWRTQAKIAFDVPPQAFTPPPKVMSSVVHIVPRETPLPCRAEALGQ
FT                   ITQAAFGQRRKMLRQSLKSIGGAALLEKTGIDGTRRAETLSVEEFVALANACLP"
FT   gene            complement(667913..668944)
FT                   /gene="pdxA"
FT                   /locus_tag="BCAN_A0695"
FT   CDS_pept        complement(667913..668944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BCAN_A0695"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /note="GO_function: GO:0050570 -
FT                   4-hydroxythreonine-4-phosphate dehydrogenase activity;
FT                   GO_process: GO:0008615 - pyridoxine biosynthetic process"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61768"
FT                   /db_xref="GOA:A9MA56"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA56"
FT                   /protein_id="ABX61768.1"
FT                   /translation="MRAKPLPPLAVSIGDPSGIGADVALAAWLKRCELSLPPFFLIADP
FT                   KQLAARARHLGLAVDFAILSDPREAEAAFGERLPLLALKHSHTESPGKPLTENAAGVIE
FT                   AIERAVELTLKGEAAAVVTCPIAKKPLYEAGFQHPGHTEFLAELAGHHLGKPVTPVMML
FT                   AGPQLRAVPVTIHIPLSEVPARLTTTEIVAVSRITANELRERFGIASPRLAISGLNPHA
FT                   GEGGALGKEDDAIILPAIEQLIREGIDARGPLPADTMFHAPARATYDAAICMYHDQALI
FT                   PAKALAFDETVNVTLGLPFIRTSPDHGTAFDIAGKGIARPDSLVAAMRLAQQLAENAAS
FT                   RNA"
FT   gene            complement(669009..669965)
FT                   /gene="surA"
FT                   /locus_tag="BCAN_A0696"
FT   CDS_pept        complement(669009..669965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="BCAN_A0696"
FT                   /product="Chaperone surA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BCAN_A0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABX61769"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A9MA57"
FT                   /protein_id="ABX61769.1"
FT                   /translation="MMFARPLIASMLGAAVCLTALGTVTAPAFAAGESEVKVIVSGNAI
FT                   TNSDIKHRMAFLKLQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFA
FT                   SRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLK
FT                   NGGKKPVATEYHLQQVIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAKGILD
FT                   VTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQL
FT                   VFSMEGADSPAGQEKKAEELSKKYVQELREKATIVNR"
FT   gene            complement(670276..672654)
FT                   /gene="imp"
FT                   /locus_tag="BCAN_A0697"
FT   CDS_pept        complement(670276..672654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="BCAN_A0697"
FT                   /product="Organic solvent tolera