(data stored in ACNUC7421 zone)

EMBL: CP000875

ID   CP000875; SV 1; circular; genomic DNA; STD; PRO; 6346587 BP.
XX
AC   CP000875; AATI01000000-AATI01000172;
XX
PR   Project:PRJNA16523;
XX
DT   15-NOV-2007 (Rel. 93, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 5)
XX
DE   Herpetosiphon aurantiacus DSM 785, complete genome.
XX
KW   .
XX
OS   Herpetosiphon aurantiacus DSM 785
OC   Bacteria; Chloroflexi; Chloroflexia; Herpetosiphonales; Herpetosiphonaceae;
OC   Herpetosiphon.
XX
RN   [1]
RP   1-6346587
RX   DOI; 10.4056/sigs.2194987.
RX   PUBMED; 22675585.
RA   Kiss H., Nett M., Domin N., Martin K., Maresca J.A., Copeland A.,
RA   Lapidus A., Lucas S., Berry K.W., Glavina Del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Richardson P., Bruce D., Goodwin L., Han C., Detter J.C.,
RA   Schmutz J., Brettin T., Land M., Hauser L., Kyrpides N.C., Ivanova N.,
RA   Goker M., Woyke T., Klenk H.P., Bryant D.A.;
RT   "Complete genome sequence of the filamentous gliding predatory bacterium
RT   Herpetosiphon aurantiacus type strain (114-95(T))";
RL   Stand Genomic Sci 5(3):356-370(2011).
XX
RN   [2]
RP   1-6346587
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Bryant D.,
RA   Richardson P.;
RT   ;
RL   Submitted (30-OCT-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 124d1d285246e58fb66896e83dcfab62.
DR   BioSample; SAMN00623048.
DR   EnsemblGenomes-Gn; EBG00001092476.
DR   EnsemblGenomes-Gn; EBG00001092477.
DR   EnsemblGenomes-Gn; EBG00001092478.
DR   EnsemblGenomes-Gn; EBG00001092479.
DR   EnsemblGenomes-Gn; EBG00001092480.
DR   EnsemblGenomes-Gn; EBG00001092481.
DR   EnsemblGenomes-Gn; EBG00001092482.
DR   EnsemblGenomes-Gn; EBG00001092483.
DR   EnsemblGenomes-Gn; EBG00001092484.
DR   EnsemblGenomes-Gn; EBG00001092485.
DR   EnsemblGenomes-Gn; EBG00001092486.
DR   EnsemblGenomes-Gn; EBG00001092487.
DR   EnsemblGenomes-Gn; EBG00001092488.
DR   EnsemblGenomes-Gn; EBG00001092489.
DR   EnsemblGenomes-Gn; EBG00001092490.
DR   EnsemblGenomes-Gn; EBG00001092491.
DR   EnsemblGenomes-Gn; EBG00001092492.
DR   EnsemblGenomes-Gn; EBG00001092493.
DR   EnsemblGenomes-Gn; EBG00001092494.
DR   EnsemblGenomes-Gn; EBG00001092495.
DR   EnsemblGenomes-Gn; EBG00001092496.
DR   EnsemblGenomes-Gn; EBG00001092497.
DR   EnsemblGenomes-Gn; EBG00001092498.
DR   EnsemblGenomes-Gn; EBG00001092499.
DR   EnsemblGenomes-Gn; EBG00001092500.
DR   EnsemblGenomes-Gn; EBG00001092501.
DR   EnsemblGenomes-Gn; EBG00001092502.
DR   EnsemblGenomes-Gn; EBG00001092503.
DR   EnsemblGenomes-Gn; EBG00001092504.
DR   EnsemblGenomes-Gn; EBG00001092505.
DR   EnsemblGenomes-Gn; EBG00001092506.
DR   EnsemblGenomes-Gn; EBG00001092507.
DR   EnsemblGenomes-Gn; EBG00001092508.
DR   EnsemblGenomes-Gn; EBG00001092509.
DR   EnsemblGenomes-Gn; EBG00001092510.
DR   EnsemblGenomes-Gn; EBG00001092511.
DR   EnsemblGenomes-Gn; EBG00001092512.
DR   EnsemblGenomes-Gn; EBG00001092513.
DR   EnsemblGenomes-Gn; EBG00001092514.
DR   EnsemblGenomes-Gn; EBG00001092515.
DR   EnsemblGenomes-Gn; EBG00001092516.
DR   EnsemblGenomes-Gn; EBG00001092517.
DR   EnsemblGenomes-Gn; EBG00001092518.
DR   EnsemblGenomes-Gn; EBG00001092519.
DR   EnsemblGenomes-Gn; EBG00001092520.
DR   EnsemblGenomes-Gn; EBG00001092522.
DR   EnsemblGenomes-Gn; EBG00001092523.
DR   EnsemblGenomes-Gn; EBG00001092524.
DR   EnsemblGenomes-Gn; EBG00001092525.
DR   EnsemblGenomes-Gn; EBG00001092526.
DR   EnsemblGenomes-Gn; EBG00001092527.
DR   EnsemblGenomes-Gn; EBG00001092528.
DR   EnsemblGenomes-Gn; EBG00001092529.
DR   EnsemblGenomes-Gn; EBG00001092530.
DR   EnsemblGenomes-Gn; EBG00001092531.
DR   EnsemblGenomes-Gn; EBG00001092532.
DR   EnsemblGenomes-Gn; EBG00001092533.
DR   EnsemblGenomes-Gn; EBG00001092534.
DR   EnsemblGenomes-Gn; EBG00001092535.
DR   EnsemblGenomes-Gn; EBG00001092536.
DR   EnsemblGenomes-Gn; EBG00001092537.
DR   EnsemblGenomes-Gn; EBG00001092538.
DR   EnsemblGenomes-Gn; EBG00001092539.
DR   EnsemblGenomes-Gn; EBG00001092540.
DR   EnsemblGenomes-Gn; EBG00001092541.
DR   EnsemblGenomes-Gn; EBG00001092542.
DR   EnsemblGenomes-Gn; EBG00001092543.
DR   EnsemblGenomes-Gn; EBG00001092544.
DR   EnsemblGenomes-Gn; EBG00001092545.
DR   EnsemblGenomes-Gn; EBG00001092546.
DR   EnsemblGenomes-Gn; EBG00001092547.
DR   EnsemblGenomes-Gn; EBG00001092548.
DR   EnsemblGenomes-Gn; EBG00001092549.
DR   EnsemblGenomes-Gn; EBG00001092550.
DR   EnsemblGenomes-Gn; EBG00001092551.
DR   EnsemblGenomes-Gn; EBG00001092552.
DR   EnsemblGenomes-Gn; EBG00001092553.
DR   EnsemblGenomes-Gn; EBG00001092554.
DR   EnsemblGenomes-Gn; EBG00001092555.
DR   EnsemblGenomes-Gn; EBG00001092556.
DR   EnsemblGenomes-Gn; EBG00001092557.
DR   EnsemblGenomes-Gn; EBG00001092558.
DR   EnsemblGenomes-Gn; EBG00001092559.
DR   EnsemblGenomes-Gn; EBG00001092560.
DR   EnsemblGenomes-Gn; EBG00001092561.
DR   EnsemblGenomes-Gn; EBG00001092562.
DR   EnsemblGenomes-Gn; EBG00001092563.
DR   EnsemblGenomes-Gn; EBG00001092564.
DR   EnsemblGenomes-Gn; EBG00001092565.
DR   EnsemblGenomes-Gn; EBG00001092566.
DR   EnsemblGenomes-Gn; EBG00001092567.
DR   EnsemblGenomes-Gn; EBG00001092568.
DR   EnsemblGenomes-Gn; EBG00001092569.
DR   EnsemblGenomes-Gn; EBG00001092570.
DR   EnsemblGenomes-Gn; EBG00001092571.
DR   EnsemblGenomes-Gn; EBG00001092572.
DR   EnsemblGenomes-Gn; EBG00001092573.
DR   EnsemblGenomes-Gn; EBG00001092574.
DR   EnsemblGenomes-Gn; EBG00001092575.
DR   EnsemblGenomes-Gn; EBG00001092576.
DR   EnsemblGenomes-Gn; EBG00001092577.
DR   EnsemblGenomes-Gn; EBG00001092578.
DR   EnsemblGenomes-Gn; EBG00001092579.
DR   EnsemblGenomes-Gn; EBG00001092580.
DR   EnsemblGenomes-Gn; EBG00001092581.
DR   EnsemblGenomes-Gn; EBG00001092582.
DR   EnsemblGenomes-Gn; EBG00001092583.
DR   EnsemblGenomes-Gn; EBG00001092585.
DR   EnsemblGenomes-Gn; EBG00001092586.
DR   EnsemblGenomes-Gn; EBG00001092587.
DR   EnsemblGenomes-Gn; EBG00001092588.
DR   EnsemblGenomes-Gn; EBG00001092589.
DR   EnsemblGenomes-Gn; EBG00001092590.
DR   EnsemblGenomes-Gn; EBG00001092592.
DR   EnsemblGenomes-Gn; EBG00001092593.
DR   EnsemblGenomes-Gn; EBG00001092594.
DR   EnsemblGenomes-Gn; EBG00001092595.
DR   EnsemblGenomes-Gn; EBG00001092596.
DR   EnsemblGenomes-Gn; EBG00001092597.
DR   EnsemblGenomes-Gn; EBG00001092598.
DR   EnsemblGenomes-Gn; EBG00001092599.
DR   EnsemblGenomes-Gn; EBG00001092600.
DR   EnsemblGenomes-Gn; EBG00001092601.
DR   EnsemblGenomes-Gn; EBG00001092602.
DR   EnsemblGenomes-Gn; EBG00001092603.
DR   EnsemblGenomes-Gn; EBG00001092604.
DR   EnsemblGenomes-Gn; EBG00001092605.
DR   EnsemblGenomes-Gn; EBG00001092606.
DR   EnsemblGenomes-Gn; EBG00001092607.
DR   EnsemblGenomes-Gn; EBG00001092608.
DR   EnsemblGenomes-Gn; EBG00001092609.
DR   EnsemblGenomes-Gn; EBG00001092610.
DR   EnsemblGenomes-Gn; EBG00001092611.
DR   EnsemblGenomes-Gn; EBG00001092612.
DR   EnsemblGenomes-Gn; EBG00001092613.
DR   EnsemblGenomes-Gn; EBG00001092614.
DR   EnsemblGenomes-Gn; EBG00001092615.
DR   EnsemblGenomes-Gn; EBG00001092616.
DR   EnsemblGenomes-Gn; EBG00001092617.
DR   EnsemblGenomes-Gn; EBG00001092618.
DR   EnsemblGenomes-Gn; EBG00001092619.
DR   EnsemblGenomes-Gn; EBG00001092620.
DR   EnsemblGenomes-Gn; EBG00001092621.
DR   EnsemblGenomes-Gn; EBG00001092622.
DR   EnsemblGenomes-Gn; EBG00001092623.
DR   EnsemblGenomes-Gn; EBG00001092624.
DR   EnsemblGenomes-Gn; EBG00001092625.
DR   EnsemblGenomes-Gn; EBG00001092626.
DR   EnsemblGenomes-Gn; EBG00001092627.
DR   EnsemblGenomes-Gn; EBG00001092628.
DR   EnsemblGenomes-Gn; EBG00001092629.
DR   EnsemblGenomes-Gn; EBG00001092630.
DR   EnsemblGenomes-Gn; EBG00001092631.
DR   EnsemblGenomes-Gn; EBG00001092632.
DR   EnsemblGenomes-Gn; EBG00001092633.
DR   EnsemblGenomes-Gn; EBG00001092634.
DR   EnsemblGenomes-Gn; EBG00001092635.
DR   EnsemblGenomes-Gn; EBG00001092636.
DR   EnsemblGenomes-Gn; EBG00001092638.
DR   EnsemblGenomes-Gn; EBG00001092639.
DR   EnsemblGenomes-Gn; EBG00001092640.
DR   EnsemblGenomes-Gn; EBG00001092641.
DR   EnsemblGenomes-Gn; EBG00001092642.
DR   EnsemblGenomes-Gn; EBG00001092643.
DR   EnsemblGenomes-Gn; EBG00001092644.
DR   EnsemblGenomes-Gn; EBG00001092645.
DR   EnsemblGenomes-Gn; EBG00001092646.
DR   EnsemblGenomes-Gn; EBG00001092647.
DR   EnsemblGenomes-Gn; EBG00001092648.
DR   EnsemblGenomes-Gn; EBG00001092649.
DR   EnsemblGenomes-Gn; EBG00001092650.
DR   EnsemblGenomes-Gn; EBG00001092651.
DR   EnsemblGenomes-Gn; EBG00001092653.
DR   EnsemblGenomes-Gn; EBG00001092654.
DR   EnsemblGenomes-Gn; EBG00001092655.
DR   EnsemblGenomes-Gn; EBG00001092656.
DR   EnsemblGenomes-Gn; EBG00001092657.
DR   EnsemblGenomes-Gn; EBG00001092658.
DR   EnsemblGenomes-Gn; EBG00001092659.
DR   EnsemblGenomes-Gn; EBG00001092660.
DR   EnsemblGenomes-Gn; EBG00001092661.
DR   EnsemblGenomes-Gn; EBG00001092662.
DR   EnsemblGenomes-Gn; EBG00001092663.
DR   EnsemblGenomes-Gn; EBG00001092664.
DR   EnsemblGenomes-Gn; EBG00001092665.
DR   EnsemblGenomes-Gn; EBG00001092666.
DR   EnsemblGenomes-Gn; EBG00001092667.
DR   EnsemblGenomes-Gn; EBG00001092668.
DR   EnsemblGenomes-Gn; EBG00001092669.
DR   EnsemblGenomes-Gn; EBG00001092670.
DR   EnsemblGenomes-Gn; EBG00001092671.
DR   EnsemblGenomes-Gn; EBG00001092672.
DR   EnsemblGenomes-Gn; EBG00001092673.
DR   EnsemblGenomes-Gn; EBG00001092674.
DR   EnsemblGenomes-Gn; EBG00001092675.
DR   EnsemblGenomes-Gn; EBG00001092676.
DR   EnsemblGenomes-Gn; EBG00001092677.
DR   EnsemblGenomes-Gn; EBG00001092678.
DR   EnsemblGenomes-Gn; EBG00001092679.
DR   EnsemblGenomes-Gn; EBG00001092680.
DR   EnsemblGenomes-Gn; EBG00001092681.
DR   EnsemblGenomes-Gn; EBG00001092682.
DR   EnsemblGenomes-Gn; EBG00001092683.
DR   EnsemblGenomes-Gn; EBG00001092684.
DR   EnsemblGenomes-Gn; EBG00001092685.
DR   EnsemblGenomes-Gn; EBG00001092686.
DR   EnsemblGenomes-Gn; EBG00001092687.
DR   EnsemblGenomes-Gn; EBG00001092688.
DR   EnsemblGenomes-Gn; EBG00001092689.
DR   EnsemblGenomes-Gn; EBG00001092690.
DR   EnsemblGenomes-Gn; EBG00001092691.
DR   EnsemblGenomes-Gn; EBG00001092692.
DR   EnsemblGenomes-Gn; EBG00001092693.
DR   EnsemblGenomes-Gn; EBG00001092694.
DR   EnsemblGenomes-Gn; EBG00001092695.
DR   EnsemblGenomes-Gn; EBG00001092696.
DR   EnsemblGenomes-Gn; EBG00001092697.
DR   EnsemblGenomes-Gn; EBG00001092698.
DR   EnsemblGenomes-Gn; EBG00001092699.
DR   EnsemblGenomes-Gn; EBG00001092700.
DR   EnsemblGenomes-Gn; EBG00001092701.
DR   EnsemblGenomes-Gn; EBG00001092702.
DR   EnsemblGenomes-Gn; EBG00001092703.
DR   EnsemblGenomes-Gn; EBG00001092704.
DR   EnsemblGenomes-Gn; EBG00001092705.
DR   EnsemblGenomes-Gn; EBG00001092706.
DR   EnsemblGenomes-Gn; EBG00001092707.
DR   EnsemblGenomes-Gn; EBG00001092708.
DR   EnsemblGenomes-Gn; EBG00001092709.
DR   EnsemblGenomes-Gn; EBG00001092710.
DR   EnsemblGenomes-Gn; EBG00001092711.
DR   EnsemblGenomes-Gn; EBG00001092712.
DR   EnsemblGenomes-Gn; EBG00001092713.
DR   EnsemblGenomes-Gn; EBG00001092714.
DR   EnsemblGenomes-Gn; EBG00001092715.
DR   EnsemblGenomes-Gn; EBG00001092716.
DR   EnsemblGenomes-Gn; EBG00001092717.
DR   EnsemblGenomes-Gn; EBG00001092718.
DR   EnsemblGenomes-Gn; EBG00001092719.
DR   EnsemblGenomes-Gn; EBG00001092720.
DR   EnsemblGenomes-Gn; EBG00001092721.
DR   EnsemblGenomes-Gn; EBG00001092722.
DR   EnsemblGenomes-Gn; EBG00001092723.
DR   EnsemblGenomes-Gn; EBG00001092724.
DR   EnsemblGenomes-Gn; EBG00001092725.
DR   EnsemblGenomes-Gn; EBG00001092726.
DR   EnsemblGenomes-Gn; EBG00001092727.
DR   EnsemblGenomes-Gn; EBG00001092728.
DR   EnsemblGenomes-Gn; EBG00001092729.
DR   EnsemblGenomes-Gn; Haur_R0001.
DR   EnsemblGenomes-Gn; Haur_R0002.
DR   EnsemblGenomes-Gn; Haur_R0003.
DR   EnsemblGenomes-Gn; Haur_R0004.
DR   EnsemblGenomes-Gn; Haur_R0005.
DR   EnsemblGenomes-Gn; Haur_R0006.
DR   EnsemblGenomes-Gn; Haur_R0007.
DR   EnsemblGenomes-Gn; Haur_R0008.
DR   EnsemblGenomes-Gn; Haur_R0009.
DR   EnsemblGenomes-Gn; Haur_R0010.
DR   EnsemblGenomes-Gn; Haur_R0011.
DR   EnsemblGenomes-Gn; Haur_R0012.
DR   EnsemblGenomes-Gn; Haur_R0013.
DR   EnsemblGenomes-Gn; Haur_R0014.
DR   EnsemblGenomes-Gn; Haur_R0015.
DR   EnsemblGenomes-Gn; Haur_R0016.
DR   EnsemblGenomes-Gn; Haur_R0017.
DR   EnsemblGenomes-Gn; Haur_R0018.
DR   EnsemblGenomes-Gn; Haur_R0019.
DR   EnsemblGenomes-Gn; Haur_R0020.
DR   EnsemblGenomes-Gn; Haur_R0021.
DR   EnsemblGenomes-Gn; Haur_R0022.
DR   EnsemblGenomes-Gn; Haur_R0023.
DR   EnsemblGenomes-Gn; Haur_R0024.
DR   EnsemblGenomes-Gn; Haur_R0025.
DR   EnsemblGenomes-Gn; Haur_R0026.
DR   EnsemblGenomes-Gn; Haur_R0027.
DR   EnsemblGenomes-Gn; Haur_R0028.
DR   EnsemblGenomes-Gn; Haur_R0029.
DR   EnsemblGenomes-Gn; Haur_R0030.
DR   EnsemblGenomes-Gn; Haur_R0031.
DR   EnsemblGenomes-Gn; Haur_R0032.
DR   EnsemblGenomes-Gn; Haur_R0033.
DR   EnsemblGenomes-Gn; Haur_R0034.
DR   EnsemblGenomes-Gn; Haur_R0035.
DR   EnsemblGenomes-Gn; Haur_R0036.
DR   EnsemblGenomes-Gn; Haur_R0037.
DR   EnsemblGenomes-Gn; Haur_R0038.
DR   EnsemblGenomes-Gn; Haur_R0039.
DR   EnsemblGenomes-Gn; Haur_R0040.
DR   EnsemblGenomes-Gn; Haur_R0041.
DR   EnsemblGenomes-Gn; Haur_R0042.
DR   EnsemblGenomes-Gn; Haur_R0043.
DR   EnsemblGenomes-Gn; Haur_R0044.
DR   EnsemblGenomes-Gn; Haur_R0045.
DR   EnsemblGenomes-Gn; Haur_R0046.
DR   EnsemblGenomes-Gn; Haur_R0047.
DR   EnsemblGenomes-Gn; Haur_R0048.
DR   EnsemblGenomes-Gn; Haur_R0049.
DR   EnsemblGenomes-Gn; Haur_R0050.
DR   EnsemblGenomes-Gn; Haur_R0051.
DR   EnsemblGenomes-Gn; Haur_R0052.
DR   EnsemblGenomes-Gn; Haur_R0053.
DR   EnsemblGenomes-Gn; Haur_R0054.
DR   EnsemblGenomes-Gn; Haur_R0055.
DR   EnsemblGenomes-Gn; Haur_R0056.
DR   EnsemblGenomes-Gn; Haur_R0057.
DR   EnsemblGenomes-Gn; Haur_R0058.
DR   EnsemblGenomes-Gn; Haur_R0059.
DR   EnsemblGenomes-Gn; Haur_R0060.
DR   EnsemblGenomes-Gn; Haur_R0061.
DR   EnsemblGenomes-Gn; Haur_R0062.
DR   EnsemblGenomes-Gn; Haur_R0063.
DR   EnsemblGenomes-Gn; Haur_R0064.
DR   EnsemblGenomes-Gn; Haur_R0065.
DR   EnsemblGenomes-Gn; Haur_R0066.
DR   EnsemblGenomes-Gn; Haur_R0067.
DR   EnsemblGenomes-Gn; Haur_R0068.
DR   EnsemblGenomes-Tr; EBT00001547100.
DR   EnsemblGenomes-Tr; EBT00001547101.
DR   EnsemblGenomes-Tr; EBT00001547103.
DR   EnsemblGenomes-Tr; EBT00001547105.
DR   EnsemblGenomes-Tr; EBT00001547106.
DR   EnsemblGenomes-Tr; EBT00001547108.
DR   EnsemblGenomes-Tr; EBT00001547110.
DR   EnsemblGenomes-Tr; EBT00001547111.
DR   EnsemblGenomes-Tr; EBT00001547113.
DR   EnsemblGenomes-Tr; EBT00001547114.
DR   EnsemblGenomes-Tr; EBT00001547116.
DR   EnsemblGenomes-Tr; EBT00001547118.
DR   EnsemblGenomes-Tr; EBT00001547120.
DR   EnsemblGenomes-Tr; EBT00001547122.
DR   EnsemblGenomes-Tr; EBT00001547124.
DR   EnsemblGenomes-Tr; EBT00001547126.
DR   EnsemblGenomes-Tr; EBT00001547127.
DR   EnsemblGenomes-Tr; EBT00001547129.
DR   EnsemblGenomes-Tr; EBT00001547131.
DR   EnsemblGenomes-Tr; EBT00001547132.
DR   EnsemblGenomes-Tr; EBT00001547134.
DR   EnsemblGenomes-Tr; EBT00001547138.
DR   EnsemblGenomes-Tr; EBT00001547140.
DR   EnsemblGenomes-Tr; EBT00001547142.
DR   EnsemblGenomes-Tr; EBT00001547144.
DR   EnsemblGenomes-Tr; EBT00001547147.
DR   EnsemblGenomes-Tr; EBT00001547149.
DR   EnsemblGenomes-Tr; EBT00001547150.
DR   EnsemblGenomes-Tr; EBT00001547152.
DR   EnsemblGenomes-Tr; EBT00001547154.
DR   EnsemblGenomes-Tr; EBT00001547155.
DR   EnsemblGenomes-Tr; EBT00001547157.
DR   EnsemblGenomes-Tr; EBT00001547158.
DR   EnsemblGenomes-Tr; EBT00001547160.
DR   EnsemblGenomes-Tr; EBT00001547161.
DR   EnsemblGenomes-Tr; EBT00001547163.
DR   EnsemblGenomes-Tr; EBT00001547165.
DR   EnsemblGenomes-Tr; EBT00001547168.
DR   EnsemblGenomes-Tr; EBT00001547170.
DR   EnsemblGenomes-Tr; EBT00001547173.
DR   EnsemblGenomes-Tr; EBT00001547174.
DR   EnsemblGenomes-Tr; EBT00001547176.
DR   EnsemblGenomes-Tr; EBT00001547178.
DR   EnsemblGenomes-Tr; EBT00001547180.
DR   EnsemblGenomes-Tr; EBT00001547181.
DR   EnsemblGenomes-Tr; EBT00001547183.
DR   EnsemblGenomes-Tr; EBT00001547185.
DR   EnsemblGenomes-Tr; EBT00001547187.
DR   EnsemblGenomes-Tr; EBT00001547188.
DR   EnsemblGenomes-Tr; EBT00001547190.
DR   EnsemblGenomes-Tr; EBT00001547192.
DR   EnsemblGenomes-Tr; EBT00001547194.
DR   EnsemblGenomes-Tr; EBT00001547196.
DR   EnsemblGenomes-Tr; EBT00001547198.
DR   EnsemblGenomes-Tr; EBT00001547199.
DR   EnsemblGenomes-Tr; EBT00001547201.
DR   EnsemblGenomes-Tr; EBT00001547203.
DR   EnsemblGenomes-Tr; EBT00001547204.
DR   EnsemblGenomes-Tr; EBT00001547205.
DR   EnsemblGenomes-Tr; EBT00001547206.
DR   EnsemblGenomes-Tr; EBT00001547207.
DR   EnsemblGenomes-Tr; EBT00001547208.
DR   EnsemblGenomes-Tr; EBT00001547209.
DR   EnsemblGenomes-Tr; EBT00001547210.
DR   EnsemblGenomes-Tr; EBT00001547211.
DR   EnsemblGenomes-Tr; EBT00001547212.
DR   EnsemblGenomes-Tr; EBT00001547213.
DR   EnsemblGenomes-Tr; EBT00001547214.
DR   EnsemblGenomes-Tr; EBT00001547215.
DR   EnsemblGenomes-Tr; EBT00001547216.
DR   EnsemblGenomes-Tr; EBT00001547217.
DR   EnsemblGenomes-Tr; EBT00001547218.
DR   EnsemblGenomes-Tr; EBT00001547219.
DR   EnsemblGenomes-Tr; EBT00001547220.
DR   EnsemblGenomes-Tr; EBT00001547221.
DR   EnsemblGenomes-Tr; EBT00001547222.
DR   EnsemblGenomes-Tr; EBT00001547223.
DR   EnsemblGenomes-Tr; EBT00001547224.
DR   EnsemblGenomes-Tr; EBT00001547225.
DR   EnsemblGenomes-Tr; EBT00001547226.
DR   EnsemblGenomes-Tr; EBT00001547227.
DR   EnsemblGenomes-Tr; EBT00001547228.
DR   EnsemblGenomes-Tr; EBT00001547229.
DR   EnsemblGenomes-Tr; EBT00001547231.
DR   EnsemblGenomes-Tr; EBT00001547232.
DR   EnsemblGenomes-Tr; EBT00001547233.
DR   EnsemblGenomes-Tr; EBT00001547234.
DR   EnsemblGenomes-Tr; EBT00001547235.
DR   EnsemblGenomes-Tr; EBT00001547236.
DR   EnsemblGenomes-Tr; EBT00001547237.
DR   EnsemblGenomes-Tr; EBT00001547238.
DR   EnsemblGenomes-Tr; EBT00001547239.
DR   EnsemblGenomes-Tr; EBT00001547240.
DR   EnsemblGenomes-Tr; EBT00001547241.
DR   EnsemblGenomes-Tr; EBT00001547242.
DR   EnsemblGenomes-Tr; EBT00001547243.
DR   EnsemblGenomes-Tr; EBT00001547244.
DR   EnsemblGenomes-Tr; EBT00001547245.
DR   EnsemblGenomes-Tr; EBT00001547246.
DR   EnsemblGenomes-Tr; EBT00001547247.
DR   EnsemblGenomes-Tr; EBT00001547248.
DR   EnsemblGenomes-Tr; EBT00001547249.
DR   EnsemblGenomes-Tr; EBT00001547250.
DR   EnsemblGenomes-Tr; EBT00001547251.
DR   EnsemblGenomes-Tr; EBT00001547252.
DR   EnsemblGenomes-Tr; EBT00001547253.
DR   EnsemblGenomes-Tr; EBT00001547254.
DR   EnsemblGenomes-Tr; EBT00001547255.
DR   EnsemblGenomes-Tr; EBT00001547256.
DR   EnsemblGenomes-Tr; EBT00001547257.
DR   EnsemblGenomes-Tr; EBT00001547258.
DR   EnsemblGenomes-Tr; EBT00001547259.
DR   EnsemblGenomes-Tr; EBT00001547260.
DR   EnsemblGenomes-Tr; EBT00001547261.
DR   EnsemblGenomes-Tr; EBT00001547262.
DR   EnsemblGenomes-Tr; EBT00001547263.
DR   EnsemblGenomes-Tr; EBT00001547264.
DR   EnsemblGenomes-Tr; EBT00001547265.
DR   EnsemblGenomes-Tr; EBT00001547266.
DR   EnsemblGenomes-Tr; EBT00001547267.
DR   EnsemblGenomes-Tr; EBT00001547268.
DR   EnsemblGenomes-Tr; EBT00001547269.
DR   EnsemblGenomes-Tr; EBT00001547271.
DR   EnsemblGenomes-Tr; EBT00001547272.
DR   EnsemblGenomes-Tr; EBT00001547273.
DR   EnsemblGenomes-Tr; EBT00001547274.
DR   EnsemblGenomes-Tr; EBT00001547275.
DR   EnsemblGenomes-Tr; EBT00001547276.
DR   EnsemblGenomes-Tr; EBT00001547277.
DR   EnsemblGenomes-Tr; EBT00001547278.
DR   EnsemblGenomes-Tr; EBT00001547279.
DR   EnsemblGenomes-Tr; EBT00001547280.
DR   EnsemblGenomes-Tr; EBT00001547281.
DR   EnsemblGenomes-Tr; EBT00001547282.
DR   EnsemblGenomes-Tr; EBT00001547283.
DR   EnsemblGenomes-Tr; EBT00001547284.
DR   EnsemblGenomes-Tr; EBT00001547285.
DR   EnsemblGenomes-Tr; EBT00001547286.
DR   EnsemblGenomes-Tr; EBT00001547287.
DR   EnsemblGenomes-Tr; EBT00001547288.
DR   EnsemblGenomes-Tr; EBT00001547289.
DR   EnsemblGenomes-Tr; EBT00001547290.
DR   EnsemblGenomes-Tr; EBT00001547291.
DR   EnsemblGenomes-Tr; EBT00001547292.
DR   EnsemblGenomes-Tr; EBT00001547293.
DR   EnsemblGenomes-Tr; EBT00001547294.
DR   EnsemblGenomes-Tr; EBT00001547295.
DR   EnsemblGenomes-Tr; EBT00001547296.
DR   EnsemblGenomes-Tr; EBT00001547297.
DR   EnsemblGenomes-Tr; EBT00001547298.
DR   EnsemblGenomes-Tr; EBT00001547299.
DR   EnsemblGenomes-Tr; EBT00001547300.
DR   EnsemblGenomes-Tr; EBT00001547301.
DR   EnsemblGenomes-Tr; EBT00001547302.
DR   EnsemblGenomes-Tr; EBT00001547303.
DR   EnsemblGenomes-Tr; EBT00001547304.
DR   EnsemblGenomes-Tr; EBT00001547305.
DR   EnsemblGenomes-Tr; EBT00001547306.
DR   EnsemblGenomes-Tr; EBT00001547307.
DR   EnsemblGenomes-Tr; EBT00001547308.
DR   EnsemblGenomes-Tr; EBT00001547309.
DR   EnsemblGenomes-Tr; EBT00001547310.
DR   EnsemblGenomes-Tr; EBT00001547311.
DR   EnsemblGenomes-Tr; EBT00001547312.
DR   EnsemblGenomes-Tr; EBT00001547313.
DR   EnsemblGenomes-Tr; EBT00001547314.
DR   EnsemblGenomes-Tr; EBT00001547315.
DR   EnsemblGenomes-Tr; EBT00001547316.
DR   EnsemblGenomes-Tr; EBT00001547317.
DR   EnsemblGenomes-Tr; EBT00001547318.
DR   EnsemblGenomes-Tr; EBT00001547319.
DR   EnsemblGenomes-Tr; EBT00001547320.
DR   EnsemblGenomes-Tr; EBT00001547321.
DR   EnsemblGenomes-Tr; EBT00001547322.
DR   EnsemblGenomes-Tr; EBT00001547323.
DR   EnsemblGenomes-Tr; EBT00001547324.
DR   EnsemblGenomes-Tr; EBT00001547326.
DR   EnsemblGenomes-Tr; EBT00001547327.
DR   EnsemblGenomes-Tr; EBT00001547328.
DR   EnsemblGenomes-Tr; EBT00001547329.
DR   EnsemblGenomes-Tr; EBT00001547330.
DR   EnsemblGenomes-Tr; EBT00001547331.
DR   EnsemblGenomes-Tr; EBT00001547332.
DR   EnsemblGenomes-Tr; EBT00001547333.
DR   EnsemblGenomes-Tr; EBT00001547334.
DR   EnsemblGenomes-Tr; EBT00001547335.
DR   EnsemblGenomes-Tr; EBT00001547336.
DR   EnsemblGenomes-Tr; EBT00001547337.
DR   EnsemblGenomes-Tr; EBT00001547338.
DR   EnsemblGenomes-Tr; EBT00001547339.
DR   EnsemblGenomes-Tr; EBT00001547340.
DR   EnsemblGenomes-Tr; EBT00001547341.
DR   EnsemblGenomes-Tr; EBT00001547342.
DR   EnsemblGenomes-Tr; EBT00001547343.
DR   EnsemblGenomes-Tr; EBT00001547344.
DR   EnsemblGenomes-Tr; EBT00001547345.
DR   EnsemblGenomes-Tr; EBT00001547346.
DR   EnsemblGenomes-Tr; EBT00001547347.
DR   EnsemblGenomes-Tr; EBT00001547348.
DR   EnsemblGenomes-Tr; EBT00001547349.
DR   EnsemblGenomes-Tr; EBT00001547350.
DR   EnsemblGenomes-Tr; EBT00001547351.
DR   EnsemblGenomes-Tr; EBT00001547352.
DR   EnsemblGenomes-Tr; EBT00001547353.
DR   EnsemblGenomes-Tr; EBT00001547354.
DR   EnsemblGenomes-Tr; EBT00001547355.
DR   EnsemblGenomes-Tr; EBT00001547357.
DR   EnsemblGenomes-Tr; EBT00001547358.
DR   EnsemblGenomes-Tr; EBT00001547359.
DR   EnsemblGenomes-Tr; EBT00001547360.
DR   EnsemblGenomes-Tr; EBT00001547361.
DR   EnsemblGenomes-Tr; EBT00001547362.
DR   EnsemblGenomes-Tr; EBT00001547363.
DR   EnsemblGenomes-Tr; EBT00001547364.
DR   EnsemblGenomes-Tr; EBT00001547365.
DR   EnsemblGenomes-Tr; EBT00001547366.
DR   EnsemblGenomes-Tr; EBT00001547367.
DR   EnsemblGenomes-Tr; EBT00001547368.
DR   EnsemblGenomes-Tr; EBT00001547369.
DR   EnsemblGenomes-Tr; EBT00001547370.
DR   EnsemblGenomes-Tr; EBT00001547371.
DR   EnsemblGenomes-Tr; EBT00001547372.
DR   EnsemblGenomes-Tr; EBT00001547373.
DR   EnsemblGenomes-Tr; EBT00001547375.
DR   EnsemblGenomes-Tr; EBT00001547376.
DR   EnsemblGenomes-Tr; EBT00001547377.
DR   EnsemblGenomes-Tr; EBT00001547378.
DR   EnsemblGenomes-Tr; EBT00001547379.
DR   EnsemblGenomes-Tr; EBT00001547380.
DR   EnsemblGenomes-Tr; EBT00001547381.
DR   EnsemblGenomes-Tr; EBT00001547382.
DR   EnsemblGenomes-Tr; EBT00001547383.
DR   EnsemblGenomes-Tr; EBT00001547384.
DR   EnsemblGenomes-Tr; EBT00001547385.
DR   EnsemblGenomes-Tr; EBT00001547386.
DR   EnsemblGenomes-Tr; EBT00001547387.
DR   EnsemblGenomes-Tr; EBT00001547388.
DR   EnsemblGenomes-Tr; EBT00001547389.
DR   EnsemblGenomes-Tr; EBT00001547390.
DR   EnsemblGenomes-Tr; EBT00001547391.
DR   EnsemblGenomes-Tr; EBT00001547392.
DR   EnsemblGenomes-Tr; EBT00001547393.
DR   EnsemblGenomes-Tr; EBT00001547394.
DR   EnsemblGenomes-Tr; EBT00001547395.
DR   EnsemblGenomes-Tr; EBT00001547396.
DR   EnsemblGenomes-Tr; EBT00001547398.
DR   EnsemblGenomes-Tr; EBT00001547399.
DR   EnsemblGenomes-Tr; EBT00001547401.
DR   EnsemblGenomes-Tr; EBT00001547403.
DR   EnsemblGenomes-Tr; Haur_R0001-1.
DR   EnsemblGenomes-Tr; Haur_R0002-1.
DR   EnsemblGenomes-Tr; Haur_R0003-1.
DR   EnsemblGenomes-Tr; Haur_R0004-1.
DR   EnsemblGenomes-Tr; Haur_R0005-1.
DR   EnsemblGenomes-Tr; Haur_R0006-1.
DR   EnsemblGenomes-Tr; Haur_R0007-1.
DR   EnsemblGenomes-Tr; Haur_R0008-1.
DR   EnsemblGenomes-Tr; Haur_R0009-1.
DR   EnsemblGenomes-Tr; Haur_R0010-1.
DR   EnsemblGenomes-Tr; Haur_R0011-1.
DR   EnsemblGenomes-Tr; Haur_R0012-1.
DR   EnsemblGenomes-Tr; Haur_R0013-1.
DR   EnsemblGenomes-Tr; Haur_R0014-1.
DR   EnsemblGenomes-Tr; Haur_R0015-1.
DR   EnsemblGenomes-Tr; Haur_R0016-1.
DR   EnsemblGenomes-Tr; Haur_R0017-1.
DR   EnsemblGenomes-Tr; Haur_R0018-1.
DR   EnsemblGenomes-Tr; Haur_R0019-1.
DR   EnsemblGenomes-Tr; Haur_R0020-1.
DR   EnsemblGenomes-Tr; Haur_R0021-1.
DR   EnsemblGenomes-Tr; Haur_R0022-1.
DR   EnsemblGenomes-Tr; Haur_R0023-1.
DR   EnsemblGenomes-Tr; Haur_R0024-1.
DR   EnsemblGenomes-Tr; Haur_R0025-1.
DR   EnsemblGenomes-Tr; Haur_R0026-1.
DR   EnsemblGenomes-Tr; Haur_R0027-1.
DR   EnsemblGenomes-Tr; Haur_R0028-1.
DR   EnsemblGenomes-Tr; Haur_R0029-1.
DR   EnsemblGenomes-Tr; Haur_R0030-1.
DR   EnsemblGenomes-Tr; Haur_R0031-1.
DR   EnsemblGenomes-Tr; Haur_R0032-1.
DR   EnsemblGenomes-Tr; Haur_R0033-1.
DR   EnsemblGenomes-Tr; Haur_R0034-1.
DR   EnsemblGenomes-Tr; Haur_R0035-1.
DR   EnsemblGenomes-Tr; Haur_R0036-1.
DR   EnsemblGenomes-Tr; Haur_R0037-1.
DR   EnsemblGenomes-Tr; Haur_R0038-1.
DR   EnsemblGenomes-Tr; Haur_R0039-1.
DR   EnsemblGenomes-Tr; Haur_R0040-1.
DR   EnsemblGenomes-Tr; Haur_R0041-1.
DR   EnsemblGenomes-Tr; Haur_R0042-1.
DR   EnsemblGenomes-Tr; Haur_R0043-1.
DR   EnsemblGenomes-Tr; Haur_R0044-1.
DR   EnsemblGenomes-Tr; Haur_R0045-1.
DR   EnsemblGenomes-Tr; Haur_R0046-1.
DR   EnsemblGenomes-Tr; Haur_R0047-1.
DR   EnsemblGenomes-Tr; Haur_R0048-1.
DR   EnsemblGenomes-Tr; Haur_R0049-1.
DR   EnsemblGenomes-Tr; Haur_R0050-1.
DR   EnsemblGenomes-Tr; Haur_R0051-1.
DR   EnsemblGenomes-Tr; Haur_R0052-1.
DR   EnsemblGenomes-Tr; Haur_R0053-1.
DR   EnsemblGenomes-Tr; Haur_R0054-1.
DR   EnsemblGenomes-Tr; Haur_R0055-1.
DR   EnsemblGenomes-Tr; Haur_R0056-1.
DR   EnsemblGenomes-Tr; Haur_R0057-1.
DR   EnsemblGenomes-Tr; Haur_R0058-1.
DR   EnsemblGenomes-Tr; Haur_R0059-1.
DR   EnsemblGenomes-Tr; Haur_R0060-1.
DR   EnsemblGenomes-Tr; Haur_R0061-1.
DR   EnsemblGenomes-Tr; Haur_R0062-1.
DR   EnsemblGenomes-Tr; Haur_R0063-1.
DR   EnsemblGenomes-Tr; Haur_R0064-1.
DR   EnsemblGenomes-Tr; Haur_R0065-1.
DR   EnsemblGenomes-Tr; Haur_R0066-1.
DR   EnsemblGenomes-Tr; Haur_R0067-1.
DR   EnsemblGenomes-Tr; Haur_R0068-1.
DR   EuropePMC; PMC2849247; 20139321.
DR   EuropePMC; PMC3035366; 21304745.
DR   EuropePMC; PMC5371077; 28321007.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01341; CRISPR-DR30.
DR   RFAM; RF01342; CRISPR-DR32.
DR   RFAM; RF01359; CRISPR-DR46.
DR   RFAM; RF01379; CRISPR-DR66.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000875.
DR   SILVA-SSU; CP000875.
DR   StrainInfo; 125696; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000270
CC   Source DNA and bacteria available from Donald Bryant (dab@psu.edu)
CC   Bacteria also available from ATCC: ATCC 23779 and DSMZ: DSM 785
CC   Contacts: Donald Bryant (dab@psu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6346587
FT                   /organism="Herpetosiphon aurantiacus DSM 785"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:316274"
FT                   /culture_collection="ATCC:23779"
FT   gene            77..1495
FT                   /locus_tag="Haur_0001"
FT   CDS_pept        77..1495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rrs:RoseRS_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02653"
FT                   /db_xref="GOA:A9B496"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B496"
FT                   /protein_id="ABX02653.1"
FT                   /translation="MDTKQIWFTTLGTLQNQILRYDYDTWLKTTALVSVANDLAVIGAP
FT                   NVTTKQVIEDRFMSVLRRALGEVLGYQVNVRVIISSATPAPSEPVAVTPSEPSPTTEVA
FT                   EPSFASFNQAAPMLNQLPLGDPNRSSVLNPRYTFSSFIVGTSNRLAHAACMAVAEHPAQ
FT                   AYNPLFLYGGVGLGKTHLLQAIGNYALDRNPEVNVLYVSSEKFTNDLINAIRRQQTEEF
FT                   RIRYRNIDILLIDDIQFIAGKEGTQEEFFHTFNTLHGAGKQIVLSSDRPPKAILTLEER
FT                   LRSRFEWGLIVDVQNPDLETRTAILRAKGETLQVPVSSEVIDFLAQRIQSNIRELEGCL
FT                   NRVIAYANLNRTPVTVEVASAALADLLDTSRRKRVTADDIFREVSQHYGIDQRAIRGRG
FT                   RSRNVVLPRQVVMYLLREETDASLVEIGELLGGRDHTTVMHGYNKITDDLTSDARLRND
FT                   ITSLRQRLYGENAR"
FT   gene            complement(1544..3412)
FT                   /locus_tag="Haur_0002"
FT   CDS_pept        complement(1544..3412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02654"
FT                   /db_xref="GOA:A9B497"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A9B497"
FT                   /protein_id="ABX02654.1"
FT                   /translation="MSVLDLLFGRPLANEDEEHQRVGVVAGIPMLGLDALASAAYGPEA
FT                   ALTILLPLGLLGINAITPLVAIIIVLLGIVFLSYRQTITAYPNGGGSYTVAHENLGVIP
FT                   GLIAAAALLLDYILVVAVGISAGVGALVSAIPKLQPYMLPLCLLILGLITIVNLRGVRE
FT                   SGLAFVIPTYLFIACMLIILAMGAYFVIMSGGKPIAKIAPAPQPSTMTTLSWWLLIQAF
FT                   ASGCTAMTGVEAVSNGVSAFRQPATHYARRTLTIIIGTLMVMLAGIAWLAKSYQIGATE
FT                   PGKAGYQSVLSQLVAAVSGQGILYTLTIGSTLAVLALSANTGFADFPRLCRILAHDHFL
FT                   PHAFASRGRRLVYSIGIIVLASFAGIILIIFGGITDHLIPLFAVGAFLAFTLSQTGMVL
FT                   HWFKHGGLNARRNMLINGVGAVSTGITLIVILVAKFATGAWITLVILPALVGLFLAVRR
FT                   HYQQVAQQVQLNIALDTSNLTAPIVVIPFGGWNKMAHKALRFALKISPDIYAVQISTAE
FT                   EAATKREQWEQIVLKPIQEAGLAQPHFELIESPYRQLFGPLMRFILDLREANPNRQIAV
FT                   IISELAENRWYYYLLHKQRGMVLKARLFFGGNAQIIVINVPWYLEH"
FT   gene            complement(3605..4564)
FT                   /locus_tag="Haur_0003"
FT   CDS_pept        complement(3605..4564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0003"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: bvu:BVU_1317 leucine
FT                   aminopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02655"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A9B498"
FT                   /protein_id="ABX02655.1"
FT                   /translation="MIQRLWFQRLLQLGLIISLTGCGATTGTPVANPVQTVAATSAPTI
FT                   VPLPKPSLTESPQFNGANAMEFAKVQMQWIPRDTGTPGWQANGDWIVQTLLEYGWDVEE
FT                   QFFNVPENKKGRNIIARRGTGPLVLLGAHYDARRYADNDPDPTKRMQPVPAANDGASGV
FT                   AVLLELARVLKPERLNEEVWLVFFDAEDNGGIGTWNWTLGSIDLAPKLETTPKAVVIVD
FT                   MIGDADQQVYLEQSSTPALRAEIWQQAADLGYTTFISETKHHILDDHTAFLQRGFSAAD
FT                   LIDFDYPHWHTTSDTIDKLSASALEAVGRTLEEWLTKQ"
FT   sig_peptide     complement(4469..4564)
FT                   /locus_tag="Haur_0003"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.816 at
FT                   residue 32"
FT   gene            complement(4561..5760)
FT                   /locus_tag="Haur_0004"
FT   CDS_pept        complement(4561..5760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0004"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: cya:CYA_2514 peptidase, M20D family; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02656"
FT                   /db_xref="GOA:A9B499"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9B499"
FT                   /protein_id="ABX02656.1"
FT                   /translation="MASRPDFRYVAHTLVEQLITDRRDLHQHPELGFEEFRTAKIVADR
FT                   LRELGYEVTEGVATTGVLGHIPAQPGGKVAMLRFDMDALPIHEQNDVDYRSTIDGKMHA
FT                   CGHDGHVAIGLGVAAALMQNREALGTGGIKLLFQPAEEGGGGAQKMVEAGAMQNPRPDI
FT                   SLGLHIWAPMPLGKANVRSGPIMASADTFIVEITGKGGHGAQPETTVDSVLVASHMVVA
FT                   LHSIVSRNVHPEQPAVLSVGSVQAGTAHNIIAHNATLTGTIRSYDPEARERLKQRVHEV
FT                   VQGVAATFGATATLKYDEMCPATICDPAATALVRGAAEAILGAENVDDSVRTMGSEDMS
FT                   VLLNEVPGCYFFLGGQTLERELGAHPHHHPAFSFDEGVLPLGVAILCEAATRYLNGSNE
FT                   "
FT   gene            5996..7444
FT                   /locus_tag="Haur_0005"
FT   CDS_pept        5996..7444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0005"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: rrs:RoseRS_0657 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02657"
FT                   /db_xref="GOA:A9B4A0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A0"
FT                   /protein_id="ABX02657.1"
FT                   /translation="MADKESILQLGIEAARAGDKEEARKLFRLLTRETPYDPQAWLWLA
FT                   GVAEDREEKRAALEKVTELDPSNELARQGLDALGGPAAKSAAPTPPPAPEPAPVFVEPA
FT                   TTTAFDDFDVDWGQPSPRNVEPTPAPAAKKAEPARTRELTPDEEFAMSLDSLGSYSNAM
FT                   SDRQKSSGGDSSVDFDIPDFGDDLDLDAYMNRERVDISTIEVKPEEAKKPVRRSPTLSA
FT                   ATAESNNVTPKGGKRKTTEGSATLKRALIGIFIMVVFVFILWQVFGSKGDQGPVAGRST
FT                   AEPTVIGGPTSPISPTVDLALATPIVEPTIDPNAPPPIEVVPTVDPNAFPVDQQLGSAQ
FT                   PAFLPSDGTIPLNIDGWFFNYAGGNLIADGNAINLQPQGRWVAVRLLMADTFGGRTIPA
FT                   DLVVLKDAQGRVYRANLDASEAVTNVYPDFVNRGFPYINQKQTAPGGNFTIALVFDVAP
FT                   DATDLVLFSPQYLDQGYYVRGNSQ"
FT   gene            7580..8269
FT                   /locus_tag="Haur_0006"
FT   CDS_pept        7580..8269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0006"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02658"
FT                   /db_xref="GOA:A9B4A1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A1"
FT                   /protein_id="ABX02658.1"
FT                   /translation="MGLVFNVLLLGIPLGLTVLGASRGIQREAMTLIGILLGALLAELW
FT                   GPIWGPNNATRFNQDIANTTAWISIILLLVCTIFIGYGGALLLPSRKQLAQGRSRWFGA
FT                   GAGLFNGVLLLSLILRYGNVYNNDLRISDWVASSRVAMLFIERFPTMLLIGIVTIALLV
FT                   NLRLLQRLIYKIHGKDTKPEEKKKAEEKPAAPPPPPEPKPPAPDTVNNPILRDLILAEI
FT                   KKDKPPA"
FT   gene            complement(8321..9760)
FT                   /locus_tag="Haur_0007"
FT   CDS_pept        complement(8321..9760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02659"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A2"
FT                   /protein_id="ABX02659.1"
FT                   /translation="MSRIRASFRLAIVLLAMLFLVGPVFVARAHVSPAQTQAPATPNDT
FT                   QYLWIAGSSFQTRDSTTAFETTRNVNNQPTGCIYATSSGEFTAPVAVPNGATILGLDYY
FT                   LYDTSTTQTKAELTLNDSDMVTPRELITVEISSSVGLTNTYAPMGALYAPYVVNMQTRG
FT                   LFLEWFPRVTNAAMQLCGVRIAYTAPAEPRPSTDYLFIVGSTLVNTNSSTEHGYAGAGC
FT                   TFVKINGRTLNADVDLPQGSQLTAVRSYFRDVNNADLTVKLIASNGQGVTNTLATLTSP
FT                   VSNTAVVNADQSLNYTVNESSESLSVLADFGGVLSNQIRLCGVRFQYTNPSAKPTQDSR
FT                   FITGSTFVPRRSNVSYTSDANGCVNVSNEVEDLTTNVTAPEGAKAARVTFYYKNAAAGP
FT                   TLNLYSFVGSGDFTSITSVPVMGTGTQNAVNINYPIENAEKGFALVWDASSASSEYALC
FT                   GAKIDFLYTQQVFLPAAMNNY"
FT   sig_peptide     complement(9671..9760)
FT                   /locus_tag="Haur_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 30"
FT   gene            complement(9907..10536)
FT                   /locus_tag="Haur_0008"
FT   CDS_pept        complement(9907..10536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0008"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   sen:SACE_0151 phage tail assembly-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02660"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A3"
FT                   /protein_id="ABX02660.1"
FT                   /translation="MQIILADVQPAMVAAWQHICGDLPNVSIQHGSILDCATDAVVSPA
FT                   NSFGFMDGGIDMLYSRFFGWHVQERLQTIIQQAHFGELLIGNAALVPTDHAKIPYVIAA
FT                   PTMRVPMILRGTVNPYLACRAVLLLIKHGRLADGQAIADVVKTVAIPGLGTGVGRVEPA
FT                   ICARQIRAAIEAVNGTNSTFPSSWWEAQAQHQWLYGADPRDLQRAE"
FT   gene            complement(10540..11025)
FT                   /locus_tag="Haur_0009"
FT   CDS_pept        complement(10540..11025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0009"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rxy:Rxyl_2334 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02661"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A4"
FT                   /protein_id="ABX02661.1"
FT                   /translation="MTTLLEQTQQLLARMDEREQQLALTLIKRIGKHQAHGAGFTWSLG
FT                   VVYEDVQPGFSRCSLQIDPGHYNPAGIAHGGVAYSLLDTAMGGAFWTALERPLGCATLE
FT                   LKINYLRPIVAGTIIATAELVERTTRFGILTGRVVNEAGELLALGQGTFAIINYPKE"
FT   gene            complement(11112..11777)
FT                   /locus_tag="Haur_0010"
FT   CDS_pept        complement(11112..11777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0010"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: rca:Rcas_2986
FT                   pyrimidine 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02662"
FT                   /db_xref="GOA:A9B4A5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A5"
FT                   /protein_id="ABX02662.1"
FT                   /translation="MTLRFALYDLDNTLYADSSGLMEQINDRIGLFFQEHLHLAGEEAQ
FT                   RLRQHYYEQYGTTLAGLQKHHGVVETEEYLAFIHQLTLDVLLPDDGTLHVALQALPLQK
FT                   VIFTNSPREHAVRVLNRLGLHDHFAQIFDIRAFEFLAKPDFSAYHTVLTALNAQGHECV
FT                   LFEDTMANLAPAKSLGMTTVLIAPADTQHPFADIIVPNVLAGTLAIHERCGVPLDLAA"
FT   gene            complement(11991..12365)
FT                   /locus_tag="Haur_0011"
FT   CDS_pept        complement(11991..12365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02663"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A6"
FT                   /protein_id="ABX02663.1"
FT                   /translation="MIGGGLIFSLTASPSRCERPAQRSNPMMQEYDLSYQRQHELLEHL
FT                   AELANWWRFANTARRPMLVEAYHETLDALYTAGWNAELAPPQLLPPWLMPDCYLAKHPH
FT                   PCANDPQSLHDLFGERDCIA"
FT   gene            complement(12704..14566)
FT                   /locus_tag="Haur_0012"
FT   CDS_pept        complement(12704..14566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0012"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   rrs:RoseRS_2358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02664"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A7"
FT                   /protein_id="ABX02664.1"
FT                   /translation="MSRLKVRLTGLLSALVMVGTLFNGHANAAPWANRSAFVSPKFEEV
FT                   WRRSDDPRVRDGRSLYWGFGPWFDYNEYYRESPNGLRRVQYFDKARMEINGINGNTDVT
FT                   NGLLVVELVSGQLKTGDNAYDNAIRPAADRVPVAGDGYQTNSNSPTYASFAAVSTYNNN
FT                   GYRDPDRRDQSIADAIDKSGNKSTRNDLRDAYKDQTKIVVYNATTGHNIPQVFWDFLNR
FT                   TGPIIVNGQRTNGSIVDWTSAMGLPISDPYWVKATVGGVQKDLLVQLFERRILTYTPTN
FT                   DAAYQVEMGNVGQHYFQWRYGHLGTPWNSSEPSLPIAFGSKRDGGAEWDTYAMNGDGSS
FT                   QLLYASNDSKETVPYSWVRSWDPSKVKLFVDSRRGNGSNRQIWTVGADGTMTRVTYTDG
FT                   TPTPPGVPYQGYVGTPSNDFNASVSPDGSKMAFVSDRSGKPQIFVSYTNGASQTQVTLD
FT                   DCDHQTPSWSADGRYLYWASNCGTNAKYNIYRAELNWLADQPSNDYPYLSLELRNKVNL
FT                   TNSTTSDNGFPRVSPDGTKIVFTSNRDGNSEVYLMNADGTNQTRLTNSSAEDGAPSWKL
FT                   DGTKIAFDSNRDGNWNVYVMNTDGTGQAQLTNNSADDRWNVWGQ"
FT   sig_peptide     complement(14480..14566)
FT                   /locus_tag="Haur_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 29"
FT   gene            14745..16076
FT                   /locus_tag="Haur_0013"
FT   CDS_pept        14745..16076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0013"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: rrs:RoseRS_0406
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02665"
FT                   /db_xref="GOA:A9B4A8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A8"
FT                   /protein_id="ABX02665.1"
FT                   /translation="MEHAEVRRMPNAHVWPISASVVHERLQIASCDLAALAAEYGTPLY
FT                   LLDAETIRTIAMRYSAALRHAYGSNVSIHYASKALLNVGVARLVHSLGLGLDVVSGGEL
FT                   AIAQRAGMPLDHVHLHGNGTPPAELAQAVEAGIGRIVVDNLDQLKWLADYCAKRPTPQT
FT                   ILLRIAPDVTAGAHAHIRTGAASAKFGMPLDDGTAAEAVRLALQAPGLNLVGLHAHIGS
FT                   QMRDWAALREMIGRLLAFADQQRRERSWLLTEFSPGGGLAVAYMPNEQAGDIETYANTI
FT                   ANAVRLGCERYQIPLPRLIIEPGRSLVARAGVALYSVTGHKTVVGGSDYLHIDGGMGDN
FT                   LRPSLYNAQYTAALVARPCAPPIAPVQLAGRFCESGDVLIREVALPAAEVGELVAVPVA
FT                   GAYTLSMASAYNGVPRPALVLLDRGQAMLIQRRETYADLMARDI"
FT   gene            16213..18150
FT                   /locus_tag="Haur_0014"
FT   CDS_pept        16213..18150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0014"
FT                   /product="DNA primase"
FT                   /note="KEGG: rrs:RoseRS_0288 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core domain; SMART:
FT                   Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02666"
FT                   /db_xref="GOA:A9B4A9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4A9"
FT                   /protein_id="ABX02666.1"
FT                   /translation="MNSVIDDIKERIDIVSFISDYVPLRKAGRNWVGFCPFHSNTRTPA
FT                   FTVFADSNSYHCFGCKASGTIFDFLMQREGIDFPEALNQLAARAGVQLRQRTAQDDQED
FT                   VLRSRMLELNAAAARFWSHQLLQSPKAAHVRSYIEQRGLTPQTVEQFQLGYASEDWSSL
FT                   LGYLHDRHGANPSEVAEVGLALEREQGGYYDRFRGRLMFPIHNAKGQIVGFGGRILGDG
FT                   HPKYINSPQTLLFDKSSLLYGLFQARETIRSTDSVVVVEGYVDVIMAHQAGFRNVLAPM
FT                   GTALTDVHAGQLNKMTKRITLAMDGDAAGQSAALRGLETLRETLDTHVRPVPTASGMLR
FT                   WERELDATIKIALLPDGRDPDDIVRNNPEEWRSLIANAQPLMDFYLATLTRGLDLNSAK
FT                   GKSTAVERLTPLLNQIADPVEKAHYIQRLANQIKIDQRLIEGSIGGDQPERQRKPNHRQ
FT                   SRPAAPPPVFSILEQEARREDFLLSLLIRFPQVQAVVSEQLRDDLAAAPTLRELWSGDV
FT                   SELFERVENRVLWDLWRSAQAMATPNPIEWLETVPAELQAHGERLLNWDHAPPTRSFRV
FT                   TREAEECLRPLRHRLGKRWSDRLGQIIAAAEPDQQERLLEQAMAIQHYLRATSEPRRSS
FT                   YFLDTRDSLK"
FT   gene            18166..19368
FT                   /locus_tag="Haur_0015"
FT   CDS_pept        18166..19368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0015"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70 region 1.2; KEGG: csc:Csac_0883
FT                   RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02667"
FT                   /db_xref="GOA:A9B4B0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B0"
FT                   /protein_id="ABX02667.1"
FT                   /translation="MALDDEILDSELAGDETDDFPALRTLSDLLATGKKRGYVTPGEIQ
FT                   QIIDSQRDEDKQLEEIRDTLQKANIRVEETGDDDDEITVSENPEADFSNEGISVNDTVR
FT                   LYLREIGLVPLLKGEQEVELARAMEDGDKAQQELIENDHTLSDVERLALRRRIDRGEQA
FT                   REHLTTANLRLVVSVAKKYIGRGLSLLDLIQEGNVGLIRAVEKFNYTKGFKFSTYATWW
FT                   IRQAITRAIADQARTIRIPVHMVETINRMMRTARRLTQENGREPSDEELAQALDLTVEK
FT                   VRSIRKTSMEPVSLETPVGQEEDSQLGDFLPDEKLEAPSDAASHQMLREQVAQVLDQLT
FT                   EREKRVLKLRFGLEDGTQRTLEEVGKEFGVTRERIRQIEVKALRKLRHPRFGKKLRDYL
FT                   E"
FT   gene            19806..20792
FT                   /locus_tag="Haur_0016"
FT   CDS_pept        19806..20792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0016"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gvi:glr4409 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02668"
FT                   /db_xref="GOA:A9B4B1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B1"
FT                   /protein_id="ABX02668.1"
FT                   /translation="MDIGIWPWVGFTIFVFAMLALDLGVFHRNSHEVSVKEAAIWSVVW
FT                   ISLALTFNVGLYFWQGGDVALKFLTGYLIEKSLSVDNIFVFVLIFSYFQVPAKYQHRVL
FT                   FWGVFGALVMRAILIFVGAALIERFEWIIYVFGAFLIYTGLKMFRQGETHLDPDNNPVV
FT                   KLVRKVLPVTSEYHGEHFFTRHAGKLMATPLFLVLVLVEASDLIFAVDSIPAIFAVTTD
FT                   TFLVYTSNVFAILGLRSLYFVLAGVVDKFYYLKYGLAVILTFVGSKMLIIALGYHVPTP
FT                   VSLAVIIGVLAVAVIASLRRAKRLEGVDTPLDNPVTNKPVIKPDSQV"
FT   gene            complement(20847..21971)
FT                   /locus_tag="Haur_0017"
FT   CDS_pept        complement(20847..21971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0017"
FT                   /product="conserved hypothetical membrane spanning protein"
FT                   /note="KEGG: bce:BC2165 hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02669"
FT                   /db_xref="GOA:A9B4B2"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B2"
FT                   /protein_id="ABX02669.1"
FT                   /translation="MAIVSRSKTTNVVKDSQRIVGYDVARALAILAMVIVHFALTFVNI
FT                   EQPTTNGLLSLIVQFCEGRAAALFVVLAGVGLSLIARTQANPSSEAIQAKRWTLTKRGL
FT                   FLLGLGLLNLTIWPGDILRVYGVSFLLIAWLFQSSNRRILGLALGFMLAFVGLMLRFNF
FT                   NQNWDWTTLEYTNLWTIKGGLRNLFFDGFRSVFPWTSLIFFGIWLGRQNVQAAHVRWRL
FT                   FWIGLSVALGVQIGSIGLTYVFSNVWPILGQADAELLFSTGSIPPMPLFLLSAGGVALA
FT                   IIMSCVQLSQLFGASRIIHGLAATGQLALTWYIGHVVIGLGVLTSLGFYQNQSLATSLW
FT                   LALGFFGLAVGCSVWWKKRFNNGPLETVLRWATS"
FT   gene            complement(22004..22594)
FT                   /locus_tag="Haur_0018"
FT   CDS_pept        complement(22004..22594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0018"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gvi:glr1417
FT                   TetR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02670"
FT                   /db_xref="GOA:A9B4B3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B3"
FT                   /protein_id="ABX02670.1"
FT                   /translation="MSNKAQARQRQILDAAAICFARRGFHQTTMDDICREVQLSPGSVY
FT                   RYYRSKDEIIAAFVEDDSRDMSDLLRQVGALPNLWQGLDWLVDQLVAAINSPLYAELSA
FT                   EIGSETIHNPRIASLVRQSDQANHQALIELFSLAQQRGQLPTDLDLPQIADLIIMLIDG
FT                   LTWRKGLYPEHDLTLYAAGLKHTIKYLLSGTRF"
FT   gene            22982..24307
FT                   /locus_tag="Haur_0019"
FT   CDS_pept        22982..24307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0019"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="PFAM: glycoside hydrolase family 29
FT                   (alpha-L-fucosidase); KEGG: cpe:CPE0324 probable glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02671"
FT                   /db_xref="GOA:A9B4B4"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B4"
FT                   /protein_id="ABX02671.1"
FT                   /translation="MTHEHPLITARNQRTEWFLAARFGMFIHWGLYAIPARGEWVRSLE
FT                   KISNEAYQPYFEQFNPTEYQPREWAKLAKAAGMRYAVLTAKHHDGFCLFDSQLTDYKST
FT                   NTPAGRDLVREYVAAFRAEGLQVGLYYSLLDWHHPDYPAFDDEYHPMRGNEAYRDQPRD
FT                   FQRYLDYMHGQIAELLTNYGKIDIMWFDFSYGDLHGEAWRASELINKARSLQPDLIIDN
FT                   RLAASGEGNNSFGTPNPEIYAGDFACPEQLIPPTGLVDQFGRSVPWEACITLNQHWGYS
FT                   ASDRDFKSSRQVVHGLIECVSKNGNLLLNVGPDAKGRIPAECQLILQEVGVWMAEHSES
FT                   IYGCGRSQLEKPEWGRYTQHGSTIYAHIYERGIGPINFRGLNGKVKRARLIADNSEVKL
FT                   ELPWIAKDYAADLFLNWPSAQLPNQTATVVALELDEGPEARG"
FT   gene            complement(24490..24696)
FT                   /locus_tag="Haur_0020"
FT   CDS_pept        complement(24490..24696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0020"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG: kpn:KPN_00374
FT                   exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02672"
FT                   /db_xref="GOA:A9B4B5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B5"
FT                   /protein_id="ABX02672.1"
FT                   /translation="MSNNLSYETVFHELEQTVHALEAGDLPLEQALSHYERGMVLAAQC
FT                   NQLLQNAELRVQQIINGQLISTE"
FT   gene            complement(24708..25772)
FT                   /locus_tag="Haur_0021"
FT   CDS_pept        complement(24708..25772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0021"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: gtn:GTNG_1402 naringenin-chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02673"
FT                   /db_xref="GOA:A9B4B6"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B6"
FT                   /protein_id="ABX02673.1"
FT                   /translation="MPRIQAIGLGVPQYCVPQRAVQELVAQRFAPAFPEIQRYLTIFRH
FT                   AQIDTRYLVRPLEWWHEPRSFAECNAIFIEEALNLSCQAIEACLQPLDLTPNDIDHLVV
FT                   VTTTGLAAPSLDARLMQRLGMQPQTRRTPIWGLGCAGGLGGLNTAFDYLRAEPNQRVLL
FT                   INVEFCSLTYLADDFSKRNLIATSLFGDGVTAVLLEGDQVAPRGSGLGQIVGTLSHLYP
FT                   DSAEIMGWNVVNSGFEVVFSSRIPSIVREEFRPLLEQFLAQHGLSQADLGRYLLHPGGA
FT                   KVVQAYQESLHLADADLAVSRAVLREYGNMSSATIFFVMQQALAAQPLAKDEYGLLAVF
FT                   GPGFSAELGLIRGE"
FT   gene            26163..28562
FT                   /locus_tag="Haur_0022"
FT   CDS_pept        26163..28562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02674"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B7"
FT                   /protein_id="ABX02674.1"
FT                   /translation="MDSQQQFTAASHLTADNLRSIAHSISISQVSRLSLPEIDAVVDQI
FT                   SRVVPAGNVPGVILSGLAKLTGRRPAGNVIKRDVNLLFRGVEQALDKAVFSTFFAGPAA
FT                   VIWGYQKLLELAGKDPQDAFPEGTWQFYVGYALREDTARHANETIGFDETLNDHKINLP
FT                   PIDRMTAWVMAAIHILHSYPDLLENEWRERVSLALLRDLTKVNPETRQFADLYNQWERQ
FT                   RPYGRGPDVQSQENYALYRKRKFDEFMAESTRDLPKEIRERWGKQFQRAREIALPAYQR
FT                   QMALAAYLDPTPYNENMVALPRQSWHIGLIWRGHYYLIPACAPNSTRPNDVSSVRSQIA
FT                   ALLASPANHAPTSLIPLATTKRTILPSILGKLRPETSQQLEALRCAPIWFNADGRPRHL
FT                   PLAELRLTERGLGDHGLTLIDTGSSMVFDQSHIFFDGAWGSAVAEIMTLEALAWAVYLR
FT                   GQPAPVAGTVRPYAPNIELNDEEKQILADSPKIVAEASAESIGVDLKKILELRKLFKQR
FT                   NDQIRITVNDILVLYRAIHAVSYKPNPELQASLQEASNDANLKAAVEATITAFEESLAN
FT                   PAILIPVDGSIPNPSDRLHPMTFEVPLEELEISKLHERALSLLDQARQEWRAEVWDTFE
FT                   ATQKHYLATIAGFGEVSARAKDIAQSGESTSSGALRLLAHVPMALQRLLDAIPGKFDVL
FT                   NDLIKGREVLSNVGAVADTSSLTRFITAKDDNEKKTLAWGVITDANGVMHVSLRDFRPH
FT                   VGLFVAAGRRDLARRIANDYLESYVNGLNRFISELTKITQGRHSRQ"
FT   gene            28950..31190
FT                   /locus_tag="Haur_0023"
FT   CDS_pept        28950..31190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0023"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; protein
FT                   kinase; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: rrs:RoseRS_0666 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02675"
FT                   /db_xref="GOA:A9B4B8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B8"
FT                   /protein_id="ABX02675.1"
FT                   /translation="MTDDLIGKQLANFRIDRVLGRGGMGLIYVGHDIKLDRPVAIKVID
FT                   GRYRQVPSYAERFVREARAIATWRHENIVQIYYADDTDNLYYFVMEYIDGVDLSKVLAQ
FT                   YTSTNSLLPHSAVMHIARSLASALDYAHKKGVIHRDIKPSNVMVAHDQRVVLMDFGLAL
FT                   DTQLGSQGEVFGTAHYIAPEQARRSADAIPQSDLYALGVMLYELLTGSVPFDDPSATSV
FT                   ALQHLTQPPPPPQEKNPKLNNATAAVLLQALAKAPAERFQTGAELIAALEQALGITGSH
FT                   QLAANANAAPGVRPPSQPGALGFATFDPEKPLEGQYLDGYRVEALLGRGGMANIFRGVD
FT                   VRLNRTVAIKVIDTPFRNDQSYAERFNREAQAIAQLEHPNIVRLYHYGDSYGLLYMVME
FT                   YIEGDNLHKVIEQVRTSAQEWTPRTLCRMIREVCAALDYAHSKGVIHRDVKPSNIMINK
FT                   DGRAILADFGLALLTEVGTRGEIFGSPHYVAPEQAISSAKVVAQTDLYSLGVILYELWT
FT                   GQVPFDDADPLAIAMLHMAEPPKAPRSINPAISAQLEAVILKMLAKDPAERFPTGLDLA
FT                   EALEAALGISSTGTGEYVRSQITPVLDQAVNAPSTPAISNPTPPVVASEPKTPTTPTAP
FT                   KTASQPIPNVIPAESVPTPPTPATKYEKASSEPTKRRVQPLPPTPAAVAKAPEPTSAPT
FT                   MPMPPADNTIREAPAPRLYTNRQQRSNLLIMAIGVIVLITFIVIMWQLMSMI"
FT   gene            31252..32151
FT                   /locus_tag="Haur_0024"
FT   CDS_pept        31252..32151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0024"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: ttj:TTHA0872
FT                   amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02676"
FT                   /db_xref="GOA:A9B4B9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4B9"
FT                   /protein_id="ABX02676.1"
FT                   /translation="MYTNAHTHLELSALAEVCPTGQEFGSWLQTMLARRMQLDNATLER
FT                   GIHKAIEQLQQNQTTTVGDISATRLSIEPLLSSGLAGVVYLEVLGFDPTVALERLSAAQ
FT                   REIDTWRKRETAMKIGLSIHAPYSCAPSLFEAAARWCRAEAVPWAIHIAESPAEVAFLQ
FT                   QGIGSLRELNRRITPHIEWQAPQCSPIAYLERLGVLEAQPVLVHAVQVDAHDLALIAQY
FT                   DCAVVHCPRSNHNLLCGRMPLEQMLAQGIRVGLGTDSLTSAQSLDMRDEISFAQQLHAY
FT                   KVAPNIIEQLATQPSILG"
FT   gene            32386..33102
FT                   /locus_tag="Haur_0025"
FT   CDS_pept        32386..33102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0025"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: rca:Rcas_3336 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02677"
FT                   /db_xref="GOA:A9B4C0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C0"
FT                   /protein_id="ABX02677.1"
FT                   /translation="MTFSTPIHTNDQSFERVLNTGYPLMVVWSSKTDPQSQAFDKVLNL
FT                   LAIQFEGRALIVKVNPEENPKLTKDYAISAIPSAVFIRQGEVQGRCVGGLSKEQLQPVL
FT                   EALVNGQALGNLPNAASTPLTPAAAVAGGSTPLTLTDANFEQTIRSGQTVLVDFWAAWC
FT                   GPCRAIAPSIESLAKEFAGRAVVAKLNVDENPRIAQRFNIQGIPALLVFKGGKVVEQVT
FT                   GAQPLPALRQVLARHA"
FT   gene            33262..33489
FT                   /locus_tag="Haur_0026"
FT   CDS_pept        33262..33489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0026"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: mxa:MXAN_3118
FT                   MbtH-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02678"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C1"
FT                   /protein_id="ABX02678.1"
FT                   /translation="MGWNEEEDTTIYKVVVNHEEQYSIWPADRENPLGWNDEGKVGPKA
FT                   ECLEHIKQIWTDMRPLSLRKKMEELAREGQ"
FT   gene            33570..34424
FT                   /locus_tag="Haur_0027"
FT   CDS_pept        33570..34424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02679"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C2"
FT                   /protein_id="ABX02679.1"
FT                   /translation="MSHILPAWHRELRRNQTLNQWGFRWHSQRRLSRTPARADGLISLG
FT                   SCPSVTTRHTRASILLDPSQPQQLWLDFCGEPDAPRLSCEPSFDALSLVYQRYFQRFNG
FT                   RPQSRGINLLRQVVQLRSQPAPFDLATFLGDGYHQFHLFLGLIDDQTIIELENSMVFNP
FT                   WLSLQALALDSGSGCGYSQYRTAFSGSILTMEFNRQFVTKDAACIARIAYHPVPVAEQA
FT                   SVQRWQMQNPANVVATLPQAVPFDVLGLYHHLDWQWWQTAEHAQSMAAEGDKHAAIVVR
FT                   LLT"
FT   gene            complement(34479..36947)
FT                   /locus_tag="Haur_0028"
FT   CDS_pept        complement(34479..36947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0028"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: rca:Rcas_1200 ATPase AAA-2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02680"
FT                   /db_xref="GOA:A9B4C3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C3"
FT                   /protein_id="ABX02680.1"
FT                   /translation="MKLERFTEKAQEAFQHAQELMHEQHHSQLDVEHIFLALLRQSDGI
FT                   AGRVLGRLSVNVESVIARVERELDKSPKVYNYGYPQQSVYVTPRTQRLVKRAEQEAERM
FT                   GDQYVSTEHLLIAIAGEREGASARILASFGIDTERLLSILMEIRGSQRADDPTAESRYE
FT                   VLEKYSTDLTALASQGLLDPVVGRDSEITRVIRILSRRSKNNPVLVGETGVGKTAIAEG
FT                   LAQRIANGDVPELLRNRRVLALDLAGMVAGSKFRGEFEERLKAVMDEVRSAKGKVIVFI
FT                   DELHTVVGAGSAAGSIDASNMLKPALARGEMQAVGATTTDEYRKHIEKDAALERRFSPV
FT                   YVEEPDVETTIEMLRGLRRRYEEHHNLTISDAALKAAANLSHRYINDRFLPDKAIDLID
FT                   EASAKLRIDIYSMPKELREKQQAIRDLHRGEEDAGNQRDYERAAILKAEALALESEFQL
FT                   ERQQWLETNQLDDVVDEEDVATIVANWTGIPVQRMLETEKLKLVEMEERLHARVVGQHE
FT                   AVTAVADAIRRARSGLKDPRRPIGSFIFVGPTGVGKTELAKALAAFLFDDEDAMTRVDM
FT                   SEYQERHTVSRLVGAPPGYVGYDEGGQLTESIRRRPYQVILFDEIEKAHGDVFNSLLQV
FT                   LDDGRLTDAQGRTVDFRNTVIIMTSNVGTDEIRAGSIGFRRENKIDMGEVRKRVDDAMK
FT                   RTFRPEFLNRIDEIILFKPLEMAELTGIIDILASEVAGRLGELQITLHLTRAAKELLVQ
FT                   EGYNPVYGARPLRRTLQRLVETPLSRALLKGEFSAGDVVEVDVENGVIIFNKGERLQIT
FT                   SSKPVEPLSA"
FT   gene            complement(37027..38031)
FT                   /locus_tag="Haur_0029"
FT   CDS_pept        complement(37027..38031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0029"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: rca:Rcas_2836
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02681"
FT                   /db_xref="GOA:A9B4C4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C4"
FT                   /protein_id="ABX02681.1"
FT                   /translation="MDYKDYYTILGVTKTATEAEIKKAYRKLARQYHPDLNPGDSEAER
FT                   KFKEINEAYEVVSDKDKREKYDRFGADWGRAQSTGSGFNWSQYASQPGGFGSNFGGDFA
FT                   NGEFSDFFEMLFGNASRRQTSGVYGNRRPQRGQNVEQAIDVTLAEVLSGTQRTLQLQAP
FT                   EMCSNCGGSGASRGSICPTCGGTGVSGTSTRTINVRIPAGVDQGSRIRVAGEGSPGIDQ
FT                   GKRGDLMLVVNLVPDSRFERKGNDLHTDLAVDWHTLILGGKIKVPLPDGKQLTLTVPEQ
FT                   TQNAKVFRLRGQGVPSLRDQNTRGDLLVKVQAVLPTSLTPKQRELVMALRDSE"
FT   gene            38337..38798
FT                   /locus_tag="Haur_0030"
FT   CDS_pept        38337..38798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02682"
FT                   /db_xref="GOA:A9B4C5"
FT                   /db_xref="InterPro:IPR025461"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C5"
FT                   /protein_id="ABX02682.1"
FT                   /translation="MVAQLFSLSSLFVMPFWFLMVVLPFWKWTQRIIQSPWIILGPALI
FT                   YAIVLLPIFATVWADVSNPTLPGVIELIGNESGATLSWVHFLAFDLFVARWIYLDSRER
FT                   NIFALIISPILVSVLMVGPVGFLIYMVVRTIHGLVRSPNLTTIAQPVTK"
FT   gene            38809..39813
FT                   /locus_tag="Haur_0031"
FT   CDS_pept        38809..39813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_2490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02683"
FT                   /db_xref="GOA:A9B4C6"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C6"
FT                   /protein_id="ABX02683.1"
FT                   /translation="MTTTAQFPEARRTTSGAGAILRQFWATSKGMTIFFLLSCFFLVLA
FT                   IAGVTVDPREVLGQPVWMKSLKFAVSFVVYAPTVLWMFSYVKLRPRLMRFVMDACAAAL
FT                   SIEIVLFITQAVRGQPMHFNVATPIDETLWSIMGTTITVFYLINIVGFVVFLRQKPIAD
FT                   RVFMLSLKLGMGLMLLGFGLGFLMTNPSPAQMEVLQAGGSVPAIGAHTVGAADGGRGIA
FT                   ILGWSSEHGDLRIAHFVGIHGAQVLALIGWLLYNAKQRFNDKQRLALTWGAAVAYLGLV
FT                   ASVTVQALRGQALLQPDATTWISWIGLVVGSVLFTSVVVNQGSVARVQGSGSF"
FT   gene            complement(40219..41676)
FT                   /locus_tag="Haur_0032"
FT   CDS_pept        complement(40219..41676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0032"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG:
FT                   gbe:GbCGDNIH1_1969 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02684"
FT                   /db_xref="GOA:A9B4C7"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C7"
FT                   /protein_id="ABX02684.1"
FT                   /translation="MDEQEQLTTAHGAPIADNQNSLTAGPRGPLLMQDYQLLEKMATFN
FT                   RERVPERVVHAKGSGAFGTFTVTNDVTAYTKASIFGAVGKQTPMLLRFSTVAGEHGAAD
FT                   AERDVRGFAVKFYTDEGNWDLVGNNTPVFFVRDPYKFSDFIHTQKRDPKTNMRSPQAMW
FT                   DFWSLSPESLHQVTILFSDRGLPISYRFVHGFGSHTYSFINAQGERFWIKFHFRCQQGI
FT                   KNWTNAEAAEVVGVDRESSQRDLFDAIERGEYPSWKLCVQVMPEADAETYHLNPFDLTK
FT                   VWPHGDYPLIEVGTMELNRNPENYFAEIEQAAFEPSNIVPGIGFSPDKMLQARIMSYAD
FT                   AHRYRIGVNYAALPVNKPHSPVNTYHRDGQMRFDGNGGGSVNYEPNSFGGPVQNERYAE
FT                   PALKISGDADRYNHRDGNDDYTQPGNLFRLMNADQQQQLFNNIAAAMQGVPEFIQLRQI
FT                   GHFLKADPAYGRGVAAALGLDISSLEA"
FT   gene            41857..42765
FT                   /locus_tag="Haur_0033"
FT   CDS_pept        41857..42765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0033"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rba:RB2983 hydrogen
FT                   peroxide-inducible genes activator"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02685"
FT                   /db_xref="GOA:A9B4C8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C8"
FT                   /protein_id="ABX02685.1"
FT                   /translation="MEIHQLLYFVAVAETGGFSRAAQRCAVSQPSLSQQIIKLEHELGQ
FT                   ALFERLGRTIRLTTAGQALLPQAQQLLTQWRSIKQHVSDSVEQHACRLAIGIIPTLAPR
FT                   FFPNVSQAFQHHFPRTTLSIVEHTTSQLLIQLIEYSLDLLIASGPIEHPLIQIEPLFDE
FT                   VLLVALPHDHQYAQRSVLQLNDLYHMPLLALHDDHCLSQQVDAFCYEQYLEPQVVGRVT
FT                   NLTTIQRCVAAGLGMAFVPQSLTQAEPHPNVVYRRLLDAQPQRKIIAAWHHQRPPSSSV
FT                   LDLLRTNLGASQKAEVKRQKS"
FT   gene            42959..43624
FT                   /locus_tag="Haur_0034"
FT   CDS_pept        42959..43624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0034"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   hch:HCH_05424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02686"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4C9"
FT                   /protein_id="ABX02686.1"
FT                   /translation="MEPNLLNVSSSYRQLIDANRAEITVRIKGSSVISNNTALEKAKEV
FT                   RQLVEALTSYGLDKTAIQLQSVVAEVNNGVLLRSSSATYSLLIRCTDLEQLPDVLGIIT
FT                   SQKQANLEHVTWGFPDDPAILNGWLQAALELAKAKAKAMAQTLGVRIIGVHRVDDQYGS
FT                   EHHPYAQDGEFRKSASFMRSGGSGISKDDLGLAMIHRKQIEVNVQVAFIISPDENFTI"
FT   gene            43726..44142
FT                   /locus_tag="Haur_0035"
FT   CDS_pept        43726..44142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0035"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   rca:Rcas_2009 CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02687"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D0"
FT                   /protein_id="ABX02687.1"
FT                   /translation="MTAQLTVGDTMNAEVISCRTETSLREAITLLQGNRIQALVVVDGP
FT                   GSLAGVFSQTDALGAWSRGLDYERSMDSPVGEFMTRDVITCMPHVDLSRAANLLTSNRI
FT                   HRLVVVEERNDGRVWPIGVLSQTDIVRKLGEEGH"
FT   gene            44387..44965
FT                   /locus_tag="Haur_0036"
FT   CDS_pept        44387..44965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0036"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   rba:RB8456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02688"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D1"
FT                   /protein_id="ABX02688.1"
FT                   /translation="MDGECMSAESISPMTIEEYLAGERTSPAKHEFLNGQVYALAGASR
FT                   NHNLIVANLIAELHSQLKQRSCTVFPSDLRIKISATGLYTYPDVSVVHGETWFDDSHQD
FT                   TLLNPTLIIEVLSPSTEHYDRGGKFQHYRQIPSLREYLLVAQDPYHIEHYSRQAANQWL
FT                   LSEIDDPQVVLELRSIQCRLTVQEVYAKI"
FT   gene            45672..47507
FT                   /locus_tag="Haur_0037"
FT   CDS_pept        45672..47507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0037"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: rrs:RoseRS_1551 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02689"
FT                   /db_xref="GOA:A9B4D2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D2"
FT                   /protein_id="ABX02689.1"
FT                   /translation="MAVVDYQTEQQPAEIAREDVNINDFAIIVATPNGSGSQTANNTIL
FT                   RACFNMGIPVTGKNLFPSNIKGLPTWYSIRLSKDGYQARRHKRDVLVAMNPASFGDDLQ
FT                   SLEPGGICLYPDDSRQELSRSDVTYFPMPVKELVKNSGVDASLRDYIANMVYVGVLAHL
FT                   VGIEVAEIESALNKHFKGKQKAIASNMNVVNAAVAWAAANISTPSPFRVERMDKTKGMI
FT                   MLDGNTSGALGSVFGGVSFVAWYPITPSTSLVDALNDYLPELRIDKETGKPTYAVVQAE
FT                   DELAAIGMIIGAGWAGARSMTATSGPGISLMAEFTGLAYFTEVPCVVWDVMRMGPSTGM
FT                   PTRTGQGDLLSAYFLSHGDTQHVCLLPASVKECFEFGWRSFDLAERLQTIVFVLSDLDL
FT                   GMNQWMSEPFEYPTEPMDRGKVLDAEALTAVGDWGRYRDVDGDGIPFRTLPGTNHPKAA
FT                   FFTRGSGHNQDAKYTERSDEWVANMDRLARKFETARTIVPAPIMVNEENATIGILSYGS
FT                   NDPAIIEALDRLRELNINAAYQRVRALPFTKEVGEFVAKYERIYVVDNNYNGQMAQLLR
FT                   MEYPELAGRIIAVASCDGLPLTARWVTESVQKGEA"
FT   gene            47511..48557
FT                   /locus_tag="Haur_0038"
FT   CDS_pept        47511..48557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0038"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: rca:Rcas_2309 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02690"
FT                   /db_xref="GOA:A9B4D3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D3"
FT                   /protein_id="ABX02690.1"
FT                   /translation="MATTKATPKPKINLLGFEQGEYKGAPSTLCPGCGHDSISSRIVSV
FT                   CFELGVQPYQVAKFSGIGCSSKTPAYFLGRSHGFNSVHGRMPSVATGAIVTNRNLIGLA
FT                   VSGDGDTGSIGMGQFKHLVRRNVPMVYIVENNGVYGLTKGQFSATADIGQKLKYAGLNE
FT                   LPPIDLCAEAIIGGATFVARSFAGDPRQVEALLKAALSHRGLAILDIISPCVTFNNHED
FT                   STKSYAYGKEHEERLHDMTFIRAQEEITVDYEEGEAIPVKMHDGSTIVLKKLENEYDPT
FT                   NRVAALARLDAARENQEFITGLIYVNQNNNRTIHDLLHMDEQPLSQLSAEQLRPSKEAL
FT                   ESVLADLY"
FT   gene            49098..49556
FT                   /locus_tag="Haur_0039"
FT   CDS_pept        49098..49556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0039"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rca:Rcas_0729 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02691"
FT                   /db_xref="GOA:A9B4D4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D4"
FT                   /protein_id="ABX02691.1"
FT                   /translation="MISLGLLLIDFRHFGQYGYVGVFVLVLLGNATVVVPAPAFMTALA
FT                   AGRTLNPWLVGVISGLGAGIGELTGYIAGRAGRSAFDQQRFTRIQGYVERWGAFAIFGL
FT                   AALPNPLMDLAGIAAGIARMPWYKFLVACCAGKIVRFTILALIGQSTT"
FT   gene            49590..51005
FT                   /locus_tag="Haur_0040"
FT   CDS_pept        49590..51005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02692"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D5"
FT                   /protein_id="ABX02692.1"
FT                   /translation="MHHLPTFRTLGLLGLLGLLLVAIQPSQAQQPLSPKIRPEPSLSNR
FT                   QPLLSAAPQGGSEWLVPCAANAENWQSSVREDTAALNCEIYVPESAMIFVMATGSFSMQ
FT                   TNAVTNTYEGRIGLTLDGVLRESSNRWGNVYALGQLNTGETSIFASTTVFTASAGVHTV
FT                   SLVGGFVGYGPLTLNNAQLSVLAFPTNSANIRVCATDTGLGVWRATPTMSTIRSCSFNL
FT                   PSNSTVFVSADGSALPIPGNEVALQFRLGVDEATTGDVRTDRYVDVDSLEPNNEQIDGN
FT                   DISTSIAASFNLTAGNHTINFLGNGSGSNQAYLSRSSLAVLAFPSGSPFRTCTSMNDTS
FT                   TFFSNSEFSSWANCLLTVSGAHRGIIVGNVTVGQQNGEPQVRTRLRANTEVVLGSTRTS
FT                   DLTIFRMVGGQGDDKTMTSVGMSELAGGLNIFNFDGYPSNSSTVRMIDPNIHVLAFPDP
FT                   FRYKQYTPLALGE"
FT   sig_peptide     49590..49676
FT                   /locus_tag="Haur_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            51027..51620
FT                   /locus_tag="Haur_0041"
FT   CDS_pept        51027..51620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0041"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: fnu:FN0808
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02693"
FT                   /db_xref="GOA:A9B4D6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D6"
FT                   /protein_id="ABX02693.1"
FT                   /translation="MRVYLIRHGQSEENAADLKRLIGLEDFRQLLEHAQHSPLTALGRE
FT                   QAATVAEEIAAFKPTHLYSSPYIRAFDTAQIIAARVGLPIQTINELHEISAIVPFLMRR
FT                   ERHRALRTMYIRGYLSQLIPHRPLWGETWWVAQRRVIKAWNTMLEQWSPSTRAVVVAHR
FT                   AFIWMTLRYLQRHGGWRIIRRSTDNTGISELESI"
FT   gene            complement(51606..52706)
FT                   /locus_tag="Haur_0042"
FT   CDS_pept        complement(51606..52706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0042"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rrs:RoseRS_0424 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02694"
FT                   /db_xref="GOA:A9B4D7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D7"
FT                   /protein_id="ABX02694.1"
FT                   /translation="MKQATIALDLRVLDDHFPGIGRFCYELSLALLQTPIAEQLHLILP
FT                   QQPRTQFDLRPLLQHPKVSRVSHSLFSVGQHREWRSLLSEIQADLAIFPYYIRPLFQPC
FT                   PSLTLIYDTISWRVPATFSRRKRWQIAALHHVAIQQSAAIGTISHSAASDIAQFYGVNP
FT                   QRLAYLGVGISAQFQPQPATTIAALRAKYGLPERYIVYVASDKPHKQIDFLLDAWQAAQ
FT                   TAEVGLVLGGRWRNPTSEQLLEHPKLHGRVWRIADVPEDELAALYSGALALAFPSLYEG
FT                   FGLPALEAIACGTPVLAQNSSSLPEAVGAAGCLLPNEQATWIKALERMCHDSTWRESLA
FT                   AQTSAQAAKFSWQQVAERLEQQLNTL"
FT   gene            complement(52703..53551)
FT                   /locus_tag="Haur_0043"
FT   CDS_pept        complement(52703..53551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0043"
FT                   /product="Glycosyltransferase probably involved in cell
FT                   wall biogenesis-like"
FT                   /note="KEGG: gsu:GSU0621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02695"
FT                   /db_xref="GOA:A9B4D8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D8"
FT                   /protein_id="ABX02695.1"
FT                   /translation="MTEIPQIAVVIPALNGEITALRASIARQTWQPCQIEVAVGVRPNG
FT                   KARNTATVRTTAPYLVFIDDDAILANDDAIEQLVKPLLTDPTIGVTGASKLLPPDASTF
FT                   QRWVAREVPRIEHAIVPTPLESNPDPPSFYCELTTTCCAMRREVYDEVAGFNNELIRGV
FT                   DTEFFTRIRRAGYRFILVPNTWTWHPAPANLWALLRKHWLYGVGHAQEVRRDSARGRGR
FT                   VLKTPLHALAYWLLRTLILPINIFLPYSFAAPSWRPSFKPLKALTSYVGALGYIWGWYQ
FT                   V"
FT   gene            53702..57784
FT                   /locus_tag="Haur_0044"
FT   CDS_pept        53702..57784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0044"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rrs:RoseRS_2662
FT                   adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02696"
FT                   /db_xref="GOA:A9B4D9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4D9"
FT                   /protein_id="ABX02696.1"
FT                   /translation="MSIQPPSSEFASLLRQVQQAEVMPTQTQLDDVYRQLDQRIQQLQR
FT                   YVPDPIVQRLKHGELPIPYGERWLGSLLFADLSGFTALSESLTRLGKEGAEQVTSIINR
FT                   LFNQLVADIEAHGGALIKFGGDAVTAFFDQTKLGEQHALYAAHAAQAMQTSMATLGKIQ
FT                   IRAGQFNLTLRIGVHSGEAFAALLGDQQHAELMLTGIAVNLVARAQELARPGEVVCSKE
FT                   TMRLLGLPTDPMNPFTALTTALEHPPYQSTSQAPSIPQTITLADVQALASIYAGIQRLL
FT                   PQRMSEEQLLSNAASRTGEIRLVTIVFAHIAPFSTIVELCNDASATQLLNHYYQRMQQI
FT                   VNHYGGVVNKLDMAADGDKLLAIFGAPIANENDTELAVRTGLDMQSAMNEINALIQQHD
FT                   PRLPLLDQQIGINQGHVFAGIVGSETRREYTVMGDPVNTAVRLMSVCRYGEVLASPTIK
FT                   RLTSHAFAYETLPALPLKGKSQPIEPARVDRAYNVRRETMRADLVGRVQELEQLATISI
FT                   QALQGQGQIINIFGEAGIGKSRLLEELLSRLSLASFDPNLNVPEFMPITIECQLYEQTT
FT                   PFASASEVLRQVLRLSSSLNGERLVQVISQRVNRLVPELERFLPLLSDILHVSLDENEL
FT                   TQALAPEQRHDQTIELVVALMLATANTTPLVILWDDAHWIDASSRQLLERLAKHADQAA
FT                   IALLIGSRTKGLSAMTWPEQTVHLELSELSMPESEALASAIIGHAPLPAALLERWRRSD
FT                   ERFFNPQGNPFFIEEMMRSLIQQGVIVETAAGWDLRGELDSLPTTIEGVITARLDRLDN
FT                   RIRETVQVASVVGRRFELNILRGITNDDDLVNQMDRLTNADVVLPDHIAAELAYLFKHT
FT                   LTRDVAYEGILYARRRELHRRVAARIQEVHRQNLVDVLPILARHYARAEDWHEAVRYYR
FT                   EAGIASQKRYYNAEACAHYRDALELLPNLSAFDRSLEQELTERLGYVMMQAGDYAEALP
FT                   ILAQAQIQLRQSSVYSSSREARILRHITTIYERRGEYEPAFEHLQQALNLLGESQSAER
FT                   VRALLLGSGLHQRQGRYHETITWAEQALAIAEQLNAQPEQARAYLLIGGTHRVLGSREQ
FT                   AVGYLAKSIELYQAVNDISRLADAYNNAAINFSDLEQWEESIALYQAALNIKKTINDSY
FT                   GQALVSLNLGELYRKTQQFDQALETFNQSLQLWNKLNSKLGAAVTQMNMGNTLFAQGQS
FT                   ATAESMLDRSRAIFDEIHVDSFLPELYRIYAELFYSRHNYAKALDYCDFALEQARQHSA
FT                   KADEGLAQLTQSKILLALDHYDPALHAAEQALKLLQECDNQADVERCLEQLIALTQTND
FT                   PQRMADYQNQLDQLTKA"
FT   gene            57811..60849
FT                   /locus_tag="Haur_0045"
FT   CDS_pept        57811..60849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PFB0285c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02697"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E0"
FT                   /protein_id="ABX02697.1"
FT                   /translation="MRRFSKVRLLGICVLLLSLTAYQRTPNSSAQVLRSLVPVPEVESN
FT                   DTWQNAHDLTSSCLWPSITICDVTGELDDGEDLDWYKITVRPATTLSISLTDTFGDYQV
FT                   ALFYDLAKPITQTGHVSLGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGNLNA
FT                   IGNLNAIGSNGYSDASIDSFLWTPGFYYVLVYPLDEDQSGDYNLAIEATFDQNLTKPLP
FT                   IPFMINQSEPPDCKRSLYITNSDYFNIYEAFAPYNTSVYTELLGLASKPGDTSGLVLDL
FT                   ANISWIQPSNAFSDQSTQWDNNRNNPFYANRIAEGVHHLITQYARRCASLRYVTIVGGD
FT                   YVVPFYRVPDETVIANEGDYLASSGINTNSFTASSLKYKTILTDNIYGAIKPIPYRGRQ
FT                   LWVPELSVGRLVEGADAIHLYLKSMNLHTDFPSGSMINLNPQPQQANLVTGYDFLLDQA
FT                   KVISGTLTNLVGARPVGLISDTWDADDLLSIWWPDVNNGMSNSPYPAQSINAHFTHYQA
FT                   IPANFETSTDVVEAKVLFQHPFSPVALEDAYQRNRLGYSVGCHSGYSVYDNDVAGGLTN
FT                   PVAIDFPQAYMKQHGAWIGNTGFGYGDSDLVGYSEKLMAQFTLEIGREWKNQSGFYGGM
FT                   PIGYALVRAKRSYLREGTPGTFSVYDEKVLLQSTLYGLPMIRVLVPNPIPFPPNDRQDF
FT                   ACLTCPPSVAHRATVTDRAIDRDITFNINYTTAQDNARGKILRAQATVVNDTEGLLTGQ
FT                   MFNSSLVNAAGLPSLPNFSIPLSLTDGFGEQRIQGIQFLGGTTTTAATFNPVITRLITD
FT                   EIYLSHEPTFDFTDRWYPDQPFSYSVFESDNLDDDGPLNQDRRFSQLLLTPTQFKGNTS
FT                   GGELRQFSTITLRLKYLSDGADDDLLDDTFDPIVRDTQRTSDGKIRAIVIERDNDGPGD
FT                   ELDAEMVVKTNTGAWQTVSMNTFQIGTTERWQIEGSLPANTFLPLQLLIQAEDEAGNVG
FT                   VETYGGRFDIDYEMYLPNVNVNR"
FT   sig_peptide     57811..57882
FT                   /locus_tag="Haur_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.741 at
FT                   residue 24"
FT   gene            61205..62137
FT                   /locus_tag="Haur_0046"
FT   CDS_pept        61205..62137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0046"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rca:Rcas_0654
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02698"
FT                   /db_xref="GOA:A9B4E1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E1"
FT                   /protein_id="ABX02698.1"
FT                   /translation="MEEQPTKPVKDGLIAQSYIPTDQIATVLYLADRLEKPLLAEGPAG
FT                   VGKTELAKAWAAATGRELIRLQCYEGLDETKALYEWEYAKQMLYTQLLRDKLNNLLSDA
FT                   DSLRSAADRLAAEEEVFFSQRFLLQRPLLKAILNPKPTLLLIDEIDRADAEFEAFLLEV
FT                   LSDFQITVPELGTLKAAHRPIVILTSNNTRELSEALKRRCMYLFIGYPSLEEELRIVEM
FT                   KVPALGAKLARQAVEFVQRLRNLDLKKSPSISETLDWARALVLLNAKQLDQDILDQTMT
FT                   VLLKHESDLQRTQRAIQTGRNRNDEGRRK"
FT   gene            62267..63649
FT                   /locus_tag="Haur_0047"
FT   CDS_pept        62267..63649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0047"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; KEGG:
FT                   rca:Rcas_0655 VWA containing CoxE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02699"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E2"
FT                   /protein_id="ABX02699.1"
FT                   /translation="MHERIVAFVKALRAAGVRVSLAESLDSFNALEQLGISDRQLFHDA
FT                   LLATLVKDASQQAQFEELFPLFFGHGDAPMISGANGLSGLDPDELQQLRQEIAQLRERI
FT                   RELMQRLMDGQNLTPEELAALARSSGINHIQSLNQRRWVERRMEQQMGLNEFKQALEAL
FT                   LKQLEEGGMDAAALAEIMQQMQGNAQAMRDQISQFVGSGLAERMSDDYNPQTGDDLQHR
FT                   PFGSLSDADVQRMRQEVRRLAALLRSRAALRQKRDKAGQVDIKRTMRNNMRYDGVPMKL
FT                   EYRKKQQKPKLVIICDISTSMRPVAEFMLRMIYELQDQVSKTHSFAFIANLHDITEQLN
FT                   DSRADISVNDVLESIPPGYYNTDLGHSLDTFLHSHLSTVDWRTTVIIVGDGRNNFNNPR
FT                   LESLQTIRRHAKRLIWFTPEDRWQWGTGDSDMQLYAPLCDRVHLVTNLAELTAAVDRLL
FT                   AN"
FT   gene            63851..64852
FT                   /locus_tag="Haur_0048"
FT   CDS_pept        63851..64852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0048"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ter:Tery_1865 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02700"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E3"
FT                   /protein_id="ABX02700.1"
FT                   /translation="MTTMTVRFWGVRGSHPVSGPEYLKYGGNTLCVEVEANGHTIILDA
FT                   GTGIINLGKSLNARAKASGKPIDVTILFSHMHHDHTQGFPFFTPAYRGDTNMHIFGPGI
FT                   FERDLEETLAKTMLPPVFPVSMAELPAQKIVSSIRETDVLLLSEAVGGAMLRNRFHDNL
FT                   SDIDENMIVIKALRSYAHPDGVLVYRIEWQGMSVVYATDTEGYINGDQRLAQFAQGADV
FT                   LIHDAQYTEEHYLGKAPGFGSTQGWGHSTATMACDVAKSAKVGTLVLFHHEPTYGDDVI
FT                   ETIENHAKSMFAGAVAAREGLELVLNQPQPEVASVADASTAVTEPLSSDVAS"
FT   gene            64882..65640
FT                   /locus_tag="Haur_0049"
FT   CDS_pept        64882..65640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0049"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: mav:MAV_0092 transcriptional regulator,
FT                   Crp/Fnr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02701"
FT                   /db_xref="GOA:A9B4E4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E4"
FT                   /protein_id="ABX02701.1"
FT                   /translation="MNPTITTITPSFGWRMLGDSPMLSDTELALLRDVELFDGLAPEQA
FT                   AQISRRLVRRTFPAGTNLMSVEQPGEVVYIILNGTVKIHVEQADGTDVIIAMLGAGDTV
FT                   GEMSLIDSAGRSATVVTQEESTLLWMNRTAFLEALQNAPVITLNLVRMLSSRLRLANEQ
FT                   IQALATLDVHGRVARQLLAFAQKYGHADETGTVQIPIRLTQSDLAGLVGASRERVNQVI
FT                   GYFKQRRYLSVDQHYHISLHNLEALAKRIR"
FT   gene            65732..66385
FT                   /locus_tag="Haur_0050"
FT   CDS_pept        65732..66385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02702"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E5"
FT                   /protein_id="ABX02702.1"
FT                   /translation="MLYYPKMPDSRNAPLTRCWAFEKYDGTNLHWDWDREAGWHRFGTR
FT                   REAFELTSHGIEQFSQAHAHIQAAPSLFQATLAQPLTEILLSHANYQSYKAYNEIRVFA
FT                   EFFGPNSFAGLHKTSDPKQLCLFDVWLEGYGFIGPQQFVADFASLNSARVVYEGKLTGQ
FT                   FFEDVRNGKFGVQEGVVCKGGTGGSDLWMVKIKTRYYQARLKQAFAERWEDYWE"
FT   gene            66439..66858
FT                   /locus_tag="Haur_0051"
FT   CDS_pept        66439..66858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02703"
FT                   /db_xref="GOA:A9B4E6"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E6"
FT                   /protein_id="ABX02703.1"
FT                   /translation="MTTNQELAATPSNSARVIGLIVGDVAIFALFVIIGRRSHAEGVNA
FT                   MDVVNVAAPFVIGWGIAAPLLKLYTPAISDHTKTALQRTALAWCLAAPIGLTLRSVLWK
FT                   HDFKPGFAITTFIFNMILLLAWRGWSAYRTGKQSR"
FT   gene            67020..68072
FT                   /locus_tag="Haur_0052"
FT   CDS_pept        67020..68072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0052"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: rrs:RoseRS_0787 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02704"
FT                   /db_xref="GOA:A9B4E7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E7"
FT                   /protein_id="ABX02704.1"
FT                   /translation="MSADKSIGQSYRQIQQELLNKILRTILTSTSVLFVVMLIALAFPS
FT                   IRTIPFIIMTLVAFTGVVVISISQYWIRKGYPRRGAFFFIMSSILLGAMLSIVFSIPSF
FT                   IALVSILLIIISAILIGFRYTIYPLMLSICSSILLMLADYNQWFAALQFDNTTLLSLII
FT                   QIIVVLSMLIVTALVINMAVKRLEESANEAFLRARDAEEARFDQIALNDQLHHDNLEKQ
FT                   KLLDVIAALETPAIPILADTVVIPIVGYVSDDRLEKIQKLVLEHIHRERLQTVLLDITG
FT                   VTSVDQSFAQGLKRLVQAIYVLGAKVFLTGIQPKTAHIFVDLDLHTALPSTYATIADAI
FT                   EDLTALHRKG"
FT   gene            68112..69212
FT                   /locus_tag="Haur_0053"
FT   CDS_pept        68112..69212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0053"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   swi:Swit_2419 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02705"
FT                   /db_xref="GOA:A9B4E8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E8"
FT                   /protein_id="ABX02705.1"
FT                   /translation="MNQPIYLEWAKQQPATAILSNSSVYLPSVRNAIQQQLADAAWFAA
FT                   AQQANPWGYPSLQQALQAWHRSSYSPLIVAGASSALAVVCQALLQPGDHALIETPQYEP
FT                   FSRCVAARGATWSAWPRHPQSFELQLDQLASGITPRTKLLLISNLHNPSSTLSNQSQLL
FT                   RLQQTLTQATDTLGIAPITMVVDEIYWHLVAQAEFRSVAELGPQWIGINSLSKVYGLSM
FT                   LRCGWIMAAPQLLDQLRPAYLDLINIGSPLTEYLAASIIEQLANYQTAAQAHVAVNRQI
FT                   VQRYMQPLLERELINGVIPAAGCTYFPKIMLDQTQIDHVAQQTGCVPGRFFGSAYQQQL
FT                   RIGFGGPSNLIEAALKPFTQTILPLQ"
FT   gene            69559..70764
FT                   /locus_tag="Haur_0054"
FT   CDS_pept        69559..70764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0054"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mxa:MXAN_0706
FT                   sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02706"
FT                   /db_xref="GOA:A9B4E9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4E9"
FT                   /protein_id="ABX02706.1"
FT                   /translation="MDLHHVRIVLLDQDGQATRQITSLITAIQAVRYQLVTVTEVAQAL
FT                   DILATQRIDVVIVALTAHADELNWLQTIRLKAPICPVIVYAEDTDESIALHALHSGAHD
FT                   YVLASDLSPSVFQRTIRYARAIVAQSVAEQQVQALTLALATAMSAAQQLEQNLDVAIHE
FT                   IQTPLSILLGYIQLFERRVASWGGIPLRERQMLNTMRLQTIHISRLVGILLDSTQMATN
FT                   YGKLERRPLELGAVLRAVVASIQGMRAPHLLVLRLPEVAVWIDGDYGRLMQIFHNLLLN
FT                   ALKYSDLHSEITLTLRADGQISVQDYGIGIPNNAQPQIFNPFFRAANAQLQGGTGYGIG
FT                   LAVVQDLVQQHDGTITVTSELGSGTTMTLQFPCTVRPNRLVELPTLINELDEVLIRQRS
FT                   LS"
FT   gene            complement(70791..71075)
FT                   /locus_tag="Haur_0055"
FT   CDS_pept        complement(70791..71075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02707"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F0"
FT                   /protein_id="ABX02707.1"
FT                   /translation="MDPKTYIHTRSQRLAANAAAKERLLDERIAQVVAAAHVAEAARLV
FT                   EVCPGCRQAPCQTPRSCTIRLRAITQHRLREAELAALWPSKHELQIKLT"
FT   gene            71377..72540
FT                   /locus_tag="Haur_0056"
FT   CDS_pept        71377..72540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0056"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: rfr:Rfer_3545
FT                   PGAP1-like"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02708"
FT                   /db_xref="GOA:A9B4F1"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F1"
FT                   /protein_id="ABX02708.1"
FT                   /translation="MPKAHLYGRDLQGISRLAIEATTQVTNISEGLFATIMRRPNRRIG
FT                   GIPGLVYRQIHGITRLVGWSLDQLFGALAPANSQRVSSRQRNDLIAALNGVMGDYLVAS
FT                   NNPLQTSMSLRVAGAELEPAAIAAPQSRILLYIHGVCMHEQQLQQQGHDHGLAAAATLG
FT                   YSPIHVRYNTGLHIAENGQQLSQLLEQLLADWPVPIEELVILGYSMGGLVARSACYYAE
FT                   QLGHSWSQRLTKLVFLATPHHGSAFERYGAWLHYLLERNRYSALFGQIARLRSAGITDL
FT                   RYGTILPHAQPTFDRFEQPAYRPDLMPLPAHVACYALAATRSEPQSLSNLRGDGLVAIA
FT                   SALGHDSEQPSHNLHIPTTNQAIVYATNHFGMIANQAAYQQILAWLQ"
FT   gene            72641..73558
FT                   /locus_tag="Haur_0057"
FT   CDS_pept        72641..73558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0057"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   sat:SYN_02739 ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02709"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F2"
FT                   /protein_id="ABX02709.1"
FT                   /translation="MLERYRGCLLGLAVGDAVGTTVEFSPPGSFKPLTDLVGGGPFNLP
FT                   RGAWTDDTSMALCLAASLIERQGFDAADQMQRYCRWRDYGYMSSTGSCFDCGITVGNAL
FT                   STFQRTGNPYSGSTDPATAGNGSLMRLAPVVLAYANQPEQAMQLAVDSSRTTHGAVAAV
FT                   DACRYFAGLLIGALNGVDKATLLAPRYSPIANYWQQQPLQADIDEIAAGSFWQRQPPEI
FT                   QGTGYVVRSLEAALWAFAKSDSFREGCLMAANLGHDADTTAAIYGQIAGAYYGEAGIPS
FT                   EWREPIVSHDLIVEFAERLYRLQG"
FT   gene            complement(73658..74212)
FT                   /locus_tag="Haur_0058"
FT   CDS_pept        complement(73658..74212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02710"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F3"
FT                   /protein_id="ABX02710.1"
FT                   /translation="MLHTIDLVVEPVTDPRITLVLQALRGMYLNGGVIFRSIRPNDASA
FT                   YDSLFANTNLNPSHLIYRFLSHPTLNRELPELGLPTEIPFDLPLTFYSGYEYEGALTHA
FT                   LVSGGAYTSSPFSDGDARTMSKVCVEAMLGGEMATTTVCRIEGPWAPWFNSSQWDRSFA
FT                   TFNHGQRRWTLLCLTDTKHTA"
FT   gene            complement(74258..74899)
FT                   /locus_tag="Haur_0059"
FT   CDS_pept        complement(74258..74899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0059"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: syn:slr2121
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02711"
FT                   /db_xref="GOA:A9B4F4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F4"
FT                   /protein_id="ABX02711.1"
FT                   /translation="MAHLIDISVPISPALPVWEGDPPIEQKRAADMNKGDICNVTRLNT
FT                   GVHIGTHVDAPLHFINNDLAVESLELDRFVGDCYVVELIGTGPITGAELAAANVPSDCT
FT                   RLLLKTSNSAFWQEEPLRFHRDFRALDSSAARWVIEHDLRLIAIDYLSIEPFEAEPGNP
FT                   THCILLGGRVAILEGINLTEVAPGPYNLLCLPLKILGSDGAPARAVLQPR"
FT   gene            complement(75032..78229)
FT                   /locus_tag="Haur_0060"
FT   CDS_pept        complement(75032..78229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0060"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   MGS domain protein; RimK domain protein ATP-grasp; KEGG:
FT                   cya:CYA_1749 carbamoyl-phosphate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02712"
FT                   /db_xref="GOA:A9B4F5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F5"
FT                   /protein_id="ABX02712.1"
FT                   /translation="MPKRSDIHSILVLGAGPIVIGQACEFDYSGTQAIKALREEGFRII
FT                   LVNSNPATIMTDPSLADRTYIEPLDVPTVSEIIARERPDALLPTVGGQTALNLAMDLHR
FT                   AGVLEQYNVQLLGANVEAIATAEDRELFKQAMDRIGLQSARSGIARSLEEALELVKATG
FT                   FPSIIRPSFTLGGAGGGIAYNSEDFRRIVEEGLKLSPIGELLIEESLLGWKEYELELMR
FT                   DSAGNGVVVCSIENFDPMGVHTGDSITVAPAMTLSDREYQRLRDMGLAVMEVVGVATGG
FT                   SNVQFAINPHDGRVIVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLPELPNDIT
FT                   KSTPASFEPSLDYVVVKIPRWNFEKFPGSQPVLGTAMKSVGEAMAMGRTFTEALQKALR
FT                   SLENGRMGWGADGSQPVAQERLRELLITPTPQRIFAMRTAFDLGWTVDQIHELTKIDYW
FT                   FLDQLASLIALEKDVRNYDLATIPADLLLQAKRNGYSDPQLAYLLNATPAEVRQQRFEH
FT                   NIKPTYHHVDTCAAEFPAQTPYLYSSYETESEANPSDRRKVMILGGGPNRIGQGLEFDY
FT                   CCCHAVFALRELGYETIMVNCNPETVSTDYDTADRLYFEPLTLEDVLNIVDVEQPAGVL
FT                   LQFGGQTPLKLAKGLEAAGVPLWGTSPAAIDRAEDRGQFGAVLAECGLRATPYGSATSW
FT                   DEARAIAERIGYPTMVRPSYVLGGQGMAIIHDQAGLDDYLRHITEASPEHPVLLDRFLE
FT                   DATELDVDAVADGETVVIAGMMEQIERAGIHSGDSACVMPTVGIKPQVIEQLKIATDKL
FT                   ARALGVIGLMNVQFAVKDDEIYVLEVNPRASRSIPYVAKASGVAWAALAAKVMAGVSLK
FT                   QQGISSAPELRGFHVKEVVLPWRRFPGATIALGPEMRSTGEAMGSGDSFGAAFAKAQAG
FT                   CGRSLPTSGAIFVSVNDHDKPALVPVAKQYSELGFKVIATAGTAQYLREHGLVVETIYK
FT                   VNEGRPNAADYIINGQVDIIVNTPLGRASLFDEQAIRQTALRQGVISITTVASAAAVAD
FT                   AIQALRQGGLGVRALQD"
FT   gene            78743..79495
FT                   /locus_tag="Haur_0061"
FT   CDS_pept        78743..79495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02713"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F6"
FT                   /protein_id="ABX02713.1"
FT                   /translation="MRFVRARLTTFDDPHYRAFVEQMTLARENQRAIRPPRQRDLFGGE
FT                   AEQLLREWLAEQGQVLSERRILEYDERSGRQTIRKYREIDALVELGRSVHVFEVKASRS
FT                   AHTIRKAATQLHDIRAALQLIIPRVYTTLLLVDTGIPTAETVSALMRSPDAPHTPPPTI
FT                   ADIIGDQSRFHLIEQPDEAQQWPDQVSIRRFSLEQLINMAGDRPLHLDWDLDEDEEPPA
FT                   PPVINRQTVADDPDDETDNPFAALLGAI"
FT   gene            79505..80182
FT                   /locus_tag="Haur_0062"
FT   CDS_pept        79505..80182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all0736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02714"
FT                   /db_xref="GOA:A9B4F7"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F7"
FT                   /protein_id="ABX02714.1"
FT                   /translation="MSALYDSAVEADRIAATTAYPPAPWVMQGTWVWCVHPVKRNAVAD
FT                   LLPAPLKPLWLPTGRTLAFSLVGQYGTGSTLHYGEAACGLILKFGPRPAIWIHGLVVDL
FT                   DQSVAGGRNIWHLPKELARISWTNPNRDRISADQHGRLLLSFEGIPKRINGFNAGMNFD
FT                   VLVVHQEELYRIPARFAGTVGITRKIRPFFPASGAWAKFGVSGYSISGLGHGRGDFGEL
FT                   IKV"
FT   gene            80277..82202
FT                   /locus_tag="Haur_0063"
FT   CDS_pept        80277..82202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0063"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="KEGG: rca:Rcas_2978 excinuclease ABC, C subunit;
FT                   TIGRFAM: excinuclease ABC, C subunit; PFAM: Excinuclease
FT                   ABC C subunit domain protein; helix-hairpin-helix motif;
FT                   excinuclease ABC C subunit domain protein; UvrB/UvrC
FT                   protein; SMART: Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02715"
FT                   /db_xref="GOA:A9B4F8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F8"
FT                   /protein_id="ABX02715.1"
FT                   /translation="MPDLSHTNIANHALFEERLRNLPLSPGVYIYRDQANTIIYVGKSK
FT                   SLRDRVRSYFGAPRGLTSKTRRLVQNIADFEFITTDTELEALLLEMNLIKKHRPRYNVL
FT                   LKDDKSYPYIKITKEAWPRVLRVRKVIEDGGIYFGPFAKASSVYATIELLNKLFAFRLC
FT                   NDDMFKKHERRNRACMYYDIKRCLGPCANNCTTEEYSTAINQVRLFLGGKPEAILRDLK
FT                   VKMNQAAEDLQFERAAYVRDQIKAVERVMERQKVLNTAASDQDVIAFARDEGKAVVQVF
FT                   YIRGGKLIGSEPFTLQGTEEEHPEALMSSFLTQFYDAAADIPPNILLPDYPEETQIIEQ
FT                   WLESKGGHKVSLQVPRRGDKKDLVDLAARNASQTLDQLRLQWLNAEQRATAGLSQLREL
FT                   LNLAELPQRIECYDISNTQGTNSVGSMVVFEQGEPAKKHYRRFKIKTVEGANDVASLSE
FT                   VLQRRFARADDTGQTDEPESTEQTSAEPTNNDETWAVLPDLILIDGGIGQVNAAAKTLA
FT                   AAGFEHIPVVGLVKGDTKGHLPYGLVKPGQRVPIAFAQNDPGLHLVQRIDEEAHRFAIS
FT                   YHRKLRTKGMLRSTMEDIPGIGPKRKKALINAFGSLEGIRNASIEELAAVPGMTRKAAE
FT                   EIKGLL"
FT   gene            82592..82668
FT                   /locus_tag="Haur_R0001"
FT                   /note="tRNA-Pro1"
FT   tRNA            82592..82668
FT                   /locus_tag="Haur_R0001"
FT                   /product="tRNA-Pro"
FT   gene            82736..84370
FT                   /locus_tag="Haur_0064"
FT   CDS_pept        82736..84370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02716"
FT                   /db_xref="GOA:A9B4F9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4F9"
FT                   /protein_id="ABX02716.1"
FT                   /translation="MACAMQRSRFFQFQSLLWLLIAGVCAGGLAAWSWLENEQWRGVAT
FT                   SVDQPIAWANVPQGGVNLPSLHLESPEVISRTLDTAKAAGFYWLRVQFPWEDIEIHAKN
FT                   DFRDYRHDYNGDGMVDQTDAISAWTKYDGIVAAAQARNLQLIVRLDRPPSWARQNLPMD
FT                   SFRVAKRQQDPGSTGPPDNYGDYGDYVTAVVERYRGKVRFFQIWNEPNYGHEWNWADPN
FT                   PDEFFKLLQLGYTRAKAANPDAIILFPSLTPADGFDWQAMNDLQFLEQLYQLGAADYFD
FT                   IFTAQGYGLGQPATENRYVRPLFNADGSLRRDTLWQRPLDSRTDVTRVVFLREVMERYG
FT                   DAHKAVWISEFGWNSSAVATQYGPPVSEEQKAQYLVEYLQRARQQWPWLGAMNIWFLRP
FT                   GVNFSPEDPTIHFALLKNDWTELPAYTAVKAYLTQAPQLGIGRYQPNDLLWQQGEYSAN
FT                   WWGEHLIVQSAGPIEVVVDGQVLAEPEFRGELGQHQLEIRGDWQALTISRQRAWWWLWA
FT                   SIPFGLWLGLLLALKRFYRVLVRKRTV"
FT   sig_peptide     82736..82828
FT                   /locus_tag="Haur_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.700 at
FT                   residue 31"
FT   gene            84367..85875
FT                   /locus_tag="Haur_0065"
FT   CDS_pept        84367..85875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0065"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: rca:Rcas_2722
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02717"
FT                   /db_xref="GOA:A9B4G0"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G0"
FT                   /protein_id="ABX02717.1"
FT                   /translation="MMLARWRWHPLTTLGLSGLAALAIVALYRPKRFVPLIGIDEAAAH
FT                   NLLFALALLVLFALLAWLRPEIGLAGVAATIPFNYRSRGFWDGNYPFIDGKYFPLHELL
FT                   LLVVLGVTALDVGWRLIQRQIAWQMWWREHWRMLLLPLAWLLVATFAANLAVPEGQAEA
FT                   WREWRWMIIEPLLLYGLILYWQPRYPVRRWLLWGLLAGSVIVAIIGILQWRDLDWTPID
FT                   GTGMCFSDLIVDSGGTKRTSSVYCHPNNLALWMDRASMLAVVAAAWACWQWWRKRTWQT
FT                   AIWSLLYLGASSLLLLSLMLTYSKGARFAVALVLIGLSCLPRRWWLPLITSAVLGGLLL
FT                   YSSLSGPERLNVTGDSSSARLSIWRSATAMIIDHPIVGIGLDQFYFYFNPQFNRGYIEP
FT                   RLAADPAERNTAHPHNLLLDLWLRVGIAGVLIFAALAWRSLRRTWQIWHSEQPERWLAL
FT                   AALAALMAGWLHGGVDQGYFSSDLAMVTWLTLGMIDSFTLKGQN"
FT   sig_peptide     84367..84438
FT                   /locus_tag="Haur_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.530 at
FT                   residue 24"
FT   gene            86034..86420
FT                   /locus_tag="Haur_0066"
FT   CDS_pept        86034..86420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02718"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G1"
FT                   /protein_id="ABX02718.1"
FT                   /translation="MTTSTDIYSVVRETLRANSLHNAGTLPPPRLHTIAMQIGQFLLDE
FT                   QPTSATLMGRMLFQQGIGLKSLLAVVGAVQADYLRHGEQLRAIESYELLKVVIESFVEH
FT                   QIAHVRSEHDRFRQTVGLLQRSLG"
FT   gene            86433..87212
FT                   /locus_tag="Haur_0067"
FT   CDS_pept        86433..87212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0067"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   rrs:RoseRS_1762 protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G2"
FT                   /protein_id="ABX02719.1"
FT                   /translation="MEFDPSQPNAGRIYDYLLGGSHNFAVDRMAAERLVQMIPTIENGA
FT                   RLNRWFLDIAVNRLADLGFNRYLDLASGLPTQGYIHEIRPDALVLYNDYDQATVAYARE
FT                   IIGNNPRVIYHQANIAELESILAQAEQHFAGERKLAICMIGVSYFLNDQVLSQTLQRLY
FT                   EWCAPGSQIAISWIALPENPNPKLQELLARYSAMGSPIYARTVEQIKQFIAPWTLLEPG
FT                   FQRLSEWNEIDGTWVIDGDRQEGDEQSDMYGTFMIKG"
FT   gene            87438..87788
FT                   /locus_tag="Haur_0068"
FT   CDS_pept        87438..87788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02720"
FT                   /db_xref="GOA:A9B4G3"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G3"
FT                   /protein_id="ABX02720.1"
FT                   /translation="MLRGFIGRCPLCGKGKLFRSYYDIHPTCSACGVGYEATGNQSTGA
FT                   MGINIVLTIFLGFIGGIFLVIYASDQLMQGLLALLLIMSIFHIIFYRFARGLWLGLMVA
FT                   TGDLETGKDERG"
FT   gene            88237..91098
FT                   /locus_tag="Haur_0069"
FT   CDS_pept        88237..91098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0069"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rrs:RoseRS_3415 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02721"
FT                   /db_xref="GOA:A9B4G4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G4"
FT                   /protein_id="ABX02721.1"
FT                   /translation="MQQRPTLVLVDGHALAFRAFFALRDTGMSVRATGEPTYAVQGFLS
FT                   ILLNLLRERQPEYVAVSFDIGRTFRDDLYPDYKAGRAETPADFHPQLERIKQIINALNI
FT                   PIYTAENYEADDVIGTLCRQAEAQGVDTLIITGDTDTLQLVNDYTKVLLANPYGKGNVS
FT                   LYDEAQVRERYKGLAPNQLADLRGLKGDTSDNIPGVKGIGEAGAISMLNEWGSVENIYA
FT                   NLDKVANRYRSKLDGQQEAARFSTHLATIVTNAPVTLDLEATKVHDYDRDTVLALFSQL
FT                   EFRKLVDKLPLSSQVSAVQVVAIPQTTNPNQLTMFDDATPPSAEPIAQSGDYQAVTTSE
FT                   QLAELVRILTAAERLIFDVETNSLNLFSPVPAKVVGIALTHTAGCGWYIPLGHRSGQQL
FT                   PIAEVVAALQPLFSDPQKAVVAHNGKFDMSALSLIGLDVPHLSFDTAIAAALLGKRQSL
FT                   KDLAFAELRDADDRPIEMTRIETLIGTGKKQITMDQVAIEQVTPYASADVDMTARLLAL
FT                   FMPQLGAIPAVREVFEQIEMPLSPVLMRMEACGIGLDRAQLVQQGQVLGQSLREIEQHI
FT                   ADFVGEPLNINSRFDLNDLLFIRLKLPTANLKRLAGTTRSGGAVYSVNAETLEDLQTHD
FT                   QSGIVAMILRYRRLSKLKSTYVDALIELINQQTGRVHTQYRQIGAETGRLSSDSPNLQN
FT                   IPVRSEEGREIRRAFVARPGHVLMTADYSQIELRVLAHITADPALVEVFKTGQDIHAAT
FT                   AARLFDIPMDEVSKNQRRIAKMTVFGIIYGISSFGLAARTALSRTEAQQMINGLFAQYP
FT                   GLKSYIERTLERVKAVGYVETLFGRRRYFRELQDGGVTGPRRSAFEREATNAGIQGTAA
FT                   DLIKLAMIRLEQALIAGGYQAKMLLQVHDELVLEVPEDERDAVAQLVCDTMTQVYPDLA
FT                   VPLEVNVETGLNWDQLQRWHAPA"
FT   gene            91117..93225
FT                   /locus_tag="Haur_0070"
FT   CDS_pept        91117..93225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0070"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rrs:RoseRS_2694
FT                   putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02722"
FT                   /db_xref="GOA:A9B4G5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G5"
FT                   /protein_id="ABX02722.1"
FT                   /translation="MTEMHEFSQQPLVLIVDDQSSNRSIVRRYVEAAGYLAAEAEHGVA
FT                   ALDFVRQTPPDAILLDIFMPGIDGIEVLKTIRAQRDHHYIPIIVVTAAAELAVRQQAYF
FT                   EGADDFLLKPVDSATLRARLRAAIRLKHVLSRVEAERERFALIADITRDITQIESISGM
FT                   LAHVVDVSTKALQADHGNLFLLHDVADVEILTTDDGVSHNLDRVKRVVKEGAAGYALRS
FT                   RETVRITDVHEDVRWLQLDQSAASVRSALIVPIGDASGPLGVLAVYHSVVDHFSADDQA
FT                   LLELIAHQIIGPIRQAQMREQLARQTRQLQLVNNLAQSLSANLDLDSLYRSIEQELQQI
FT                   MGPVAIAWYSYRNAIIDLAYTSQQHAFCMPNDQQSLHLLTELGTITRVYSCVLGTDTLV
FT                   PITQQLLDAGYQGCAAVPLLHQARLLGVLIIAIKHRQITNEEVALLEMARPHFAVALAN
FT                   AQTVADQAARQTEQAELGYLRNMAQLAGQMAHHFNNLLAVILGNTQLAELDAIDEGQRE
FT                   LLAEVVKHVRGGKEMVQRIHLLKGASRISPAPFPIDLSDALPSLIDQALQIHRSVEHLQ
FT                   LEIQPNLHILLQERELLTLCTELLNNALESGSSHAGIVIKAYQTEHATVLAFRDAGRGI
FT                   PVEALGDIWQPFWTTHGPQRLGLGLPICAAVMWRASGSISLIPNDPEPGITALLQFPLL
FT                   PNEAANSA"
FT   gene            93328..94242
FT                   /locus_tag="Haur_0071"
FT   CDS_pept        93328..94242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_1340 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02723"
FT                   /db_xref="GOA:A9B4G6"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G6"
FT                   /protein_id="ABX02723.1"
FT                   /translation="MQQSPSSTPTPMTFFNLIREAINLLRRYSGLFMGLAALQVGPFLI
FT                   GSLWLQANGIQARATAQLNVIMAEMQRRIDNGQTGDGMWVLDYPRADIAPYLLALFGFG
FT                   FISIFIMRNLAMAASVIAVGDHYRQATPRWASVVLSSLRRLPALIAWGCICVLGLVIAL
FT                   FFAIVPILGTILALGLLWFFGVRLSLVPQIIVAEQVNVFRAIHHSWILTRGAFGRITNI
FT                   WITLVVLLAVLASYITTIISAIAMALFGETSALTIAMTEGFSTVTSIMILPMAYIGFTL
FT                   LYYDQLRLAYSGIPTNPSITAQQ"
FT   gene            94265..95170
FT                   /locus_tag="Haur_0072"
FT   CDS_pept        94265..95170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02724"
FT                   /db_xref="GOA:A9B4G7"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G7"
FT                   /protein_id="ABX02724.1"
FT                   /translation="MDRIWRITACLLLFGWLLAQPLTAMAQASEVSVSEYTQLLREAFT
FT                   AAQRNDEIGLREVSDKIIALKQLRTADNQTLAVNHQWLKDSLASNTPNLLLIRERLAAM
FT                   LEALTAGRETGPQDLETLKVILNNPPFDALNPERNQSRPDFDFGFLSWLFNDGLTGCFT
FT                   IIALVFVVGLLGYIVSTVRRNSVSVARRKAPAEEQKLTSVQAIERADKVAAEEGDFRDA
FT                   VRYLYLSTLLWLEERGLLRYDRTLTNREVLAAVPSNSPLHQRLAPVVQTFDRVWYGIAE
FT                   VDQGTFDQYRQQVTTLREVR"
FT   sig_peptide     94265..94345
FT                   /locus_tag="Haur_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 27"
FT   gene            95172..96338
FT                   /locus_tag="Haur_0073"
FT   CDS_pept        95172..96338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02725"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G8"
FT                   /protein_id="ABX02725.1"
FT                   /translation="MNSKVKFFAIFIGIVALSFFLFRSCDPQARNLRPGSMYNQGGDGT
FT                   AALQLWLSKIGYQTESFEYRDFDELDQTIDTLLVIKPSDTNNWRKEEIDAVLAWVEDTG
FT                   GTLIVADDQQNGLLTRLDLTVTRIEALEMVSTSDTSHALVNPIVNGLQGYQTISYFERV
FT                   RPNSQVIVGSEAQPTTLGISRGRGMIYASTNIWLFTNAGLFYESNAKIILNMVNRMPAG
FT                   SVIAFDEVHHGRALPPKAAPVPAQPYSPLVAAMVYSAMVVGLWALLSGRRFGQIVPSRI
FT                   DLMRRNSSEYVQSMANLFQRGRQAEHMQAHYKTYLKRRVAKPYGINPKLDDQSFLSEVQ
FT                   RYSDTIDRNHLAHLLNHLSQPNPSEATILALVNDIDRFINLWEQQGRA"
FT   gene            96404..97351
FT                   /locus_tag="Haur_0074"
FT   CDS_pept        96404..97351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0074"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rrs:RoseRS_1835
FT                   ATPase associated with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02726"
FT                   /db_xref="GOA:A9B4G9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4G9"
FT                   /protein_id="ABX02726.1"
FT                   /translation="MLVKQLADYMRQEAAKVIVGQEDTWTQLVVALLSGGHVLLEGVPG
FT                   TAKTLMAKTLAHLVQAEFKRVQFTPDLMPSDVMGTSVYEMQTSQFRLRKGPIFTQILLG
FT                   DEINRAPAKTQAALLEAMEEQQVTIDGDTMPLPQPFFVIATQNPMEYEGTYPLPEAQLD
FT                   RFLFKVLVGYSPPEIEFEVLRRYNQGFSARNLSTANLQPTVTPETIMRCREEIGRLRVE
FT                   DGVINYINAIAQESRRSPDLVLGGSPRASIALLLTAKTFAAMQGREYVVPDDVKFLARP
FT                   VYRHRIILKPEAEIEGLTPDTAMTRILGRIEVPR"
FT   gene            97351..98661
FT                   /locus_tag="Haur_0075"
FT   CDS_pept        97351..98661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0075"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   rrs:RoseRS_1836 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02727"
FT                   /db_xref="GOA:A9B4H0"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A9B4H0"
FT                   /protein_id="ABX02727.1"
FT                   /translation="MIPSRRLLALLLAGLVPVIIGAATPSLRWTIWVYVLLLIGFVALD
FT                   WFMTPKPKLLEVARINEPKLSIGEQNLITLAVHNQSPRTLEIQIRDEFPVEFPSDTLIL
FT                   KTKVEPDTVQEVNYHVRPLRRGDYRFGNINLRYTSTFGTFLRQTKIAFDELVKVYPNVL
FT                   DVRKYDMLARKGMLFELGLRTARVFGSGTEFERLREYTPDDEFRSINWKASARRNKLIA
FT                   AEYETERSQYVVSVIDTGRLMRPTINDIAKLDYAINASLMLGYVAMLKGDHIGMLSFAD
FT                   HVGRFLQPRRGKAQFYQMLEMLYNLPSQPVEADYGRAISYLGLKNKRRSLIVIFTDLST
FT                   MDTAKPLIQHMARLAKTHLALCVVMSDPNLVGYAGKAAYSSTDVYERAVAEMVLDERRV
FT                   VLDTLNQAGVHTIDVPANKLTVSVINKYLEFKGRGLI"
FT   sig_peptide     97351..97419
FT                   /locus_tag="Haur_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.944 at
FT                   residue 23"
FT   gene            complement(98901..99794)
FT                   /locus_tag="Haur_0076"
FT   CDS_pept        complement(98901..99794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0076"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sat:SYN_01619
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02728"
FT                   /db_xref="GOA:A9B5A3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A3"
FT                   /protein_id="ABX02728.1"
FT                   /translation="MAAALSRRSFLKIMGYSALATTATTLGAAAYGFQVEAEWLSIHEE
FT                   TIVLPRLASAYDGYRIAHLSDIHIDDVLMTREHWLTTVRMVNAQKPDLIAISGDFITHD
FT                   PSRFTEDLAAGLAMLEAPDGVVGVLGNHDYWGDGNGETVRQVLRTTGITDLTNRAISLN
FT                   RGSSKLHLAGHDDLWPNPIGPNDPSTMKPVLDRLVAELPKTDAAIILVHEPDTADFTAS
FT                   YNRFDLQLSGHAHGGQVRVPVKGALLLPYLGMRYPDHRYDVGSMVQFTSWGLGCSWPQV
FT                   RFGCRPEIVMLSLACA"
FT   sig_peptide     complement(99702..99794)
FT                   /locus_tag="Haur_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.480 at
FT                   residue 31"
FT   gene            complement(100187..101365)
FT                   /locus_tag="Haur_0077"
FT   CDS_pept        complement(100187..101365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02729"
FT                   /db_xref="GOA:A9B5A4"
FT                   /db_xref="InterPro:IPR019012"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A4"
FT                   /protein_id="ABX02729.1"
FT                   /translation="MEMEGFRWLLSDAGQQLLAELSNDRDLNEANFLRYTTKLRKHYPA
FT                   EAVTAALETNLLRRAAQAKFPQASQLYFTREALEQATPWLVASYRQRHFATGSRLVDLG
FT                   CSVGGDALALAQSCSVLAIDRDPLRLAMLEANAQALGLSQQISIQEADFTTLEFAGYAG
FT                   LFIDPARRSNGKRIWDVEHYQPPLSTLERWRGQVPIHGAKVAPGIPDDAVPAGYDLEFI
FT                   SLDGDLREACLWWQAGQVGGQRKAVVLTSAGAEHSLIADSTQAAAALSEPLAYLYEPDP
FT                   AVIRAHAVADIANQLDLAQFDASIAYLTSDRLVQSPFLRAWQIEQWLPFNLKLLRQILQ
FT                   AREIGRVTVKKRGSPITPEELSKQLRLKGRYEQTLVLTKLQGQPVVLLVKLL"
FT   gene            complement(101365..102357)
FT                   /locus_tag="Haur_0078"
FT   CDS_pept        complement(101365..102357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0078"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   aba:Acid345_2686 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02730"
FT                   /db_xref="InterPro:IPR023856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A5"
FT                   /protein_id="ABX02730.1"
FT                   /translation="MQSYDVIIIGAGPSGLSAAIAAQQAGFNYLVLERGAITNTIIDYP
FT                   LQTVFFSTAPNLTIGNVPWSSIHPHPTRTEALAYYRGVVEHFQLNVQMYEPVQALERLS
FT                   DGTFQLHTTRHDQTSARYAARAVIVASGSYDTPNRLAIAGAELGKVKHYYREGHPFYRQ
FT                   NVAVIGGGNSAAEAALDLYYHGANVTIIHQFAGLDQRIKPWIAADLKAWIEAGKIQTFW
FT                   EANLSAITPTSIHITSAAGSQHEQANDWVFALIGYRPNTSMLEAVGVTVDQDAVPSHNS
FT                   TTFETNVPNLFIAGVLAAGAHPSKIFIENGREHGPAIIAELRQRWAGPR"
FT   sig_peptide     complement(102292..102357)
FT                   /locus_tag="Haur_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.553 at
FT                   residue 22"
FT   gene            complement(102430..104334)
FT                   /locus_tag="Haur_0079"
FT   CDS_pept        complement(102430..104334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02731"
FT                   /db_xref="GOA:A9B5A6"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A6"
FT                   /protein_id="ABX02731.1"
FT                   /translation="MAFATPEQVHRYPRRFKWIFEVLCTVLIVVAVVRWGRAVLQYLWD
FT                   SRNINAAFAARDTFYEPLVNWFNQTGTTRPRLRDLADLAPYFGWLGLTLLVVVFVRNFF
FT                   PTIRTSSRGILIEWGNGWLPVGWEQVSGLRVTEDLSGERFVVLLQTNNKALTGWHRFYS
FT                   VLYRFSLRRGILITSGISDFLPLVRMLTSELEQVARQTKQPAVKLDEKASSPLFQLLLS
FT                   PAGFFSRRSKSDKDYVEYATQAGLTAQPGRVASIMATYPKRISSLLVIGTAVMAVLGLL
FT                   RVLEMLRQWIGLSFGVGGIFKSAPLPLDQSAWWLPVAAVLLLVVLIPILVVIRNILPDI
FT                   ESRQEGLMVRYFNRWLLVRWEEIIAVKTASLSENNHVMLIQTTNQSLKMMHHISSLLFD
FT                   GSNARGVLLTSALSVYDPLVQQIVLEVSRRQRPSEQDEGILTEDAPAWLLRLMFKPSDA
FT                   IDRMVSNILRREDSTKIKFDTMMILGRPMVWLTAIPTLMLLVERHINGVHYPTVSSIIN
FT                   VLVFVFICLLEYPIAAAVAQFSERNLDGDAHLARPFYLYPTAQLPRIVVMLGALLLLVL
FT                   NVPLLPVLLWIGAAIWSFLLTAGLWEGLYGWSGGKLLGIGAIPAIIQVLALMMWASMS"
FT   gene            104516..105655
FT                   /locus_tag="Haur_0080"
FT   CDS_pept        104516..105655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0080"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   amt:Amet_1614 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02732"
FT                   /db_xref="GOA:A9B5A7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A7"
FT                   /protein_id="ABX02732.1"
FT                   /translation="MIRRWIRGLWGLTLCGVLLSCGQGTATQAPQTQAPTATTTVAASP
FT                   TTAASPTTAASPTLAATATSEASPTPAGLSDADLAKYAPNEIGWVLVLEYHLIESPDAD
FT                   YSRSPENLRKDLEWLYANNFYPMTLRDLVDNNISVPLGKSPVVLTFDDSSDGQFRYLED
FT                   GTLDPTSAMGILQAFAAEHPDFPAIAVFFPLIDVDVKERVLFGQPEFATQKLQEIVALG
FT                   GEVGTHTYTHQRLDEADAEQIQWQLAFSIKELEERIGDGYQVTSLSYPLGMFPEDESLV
FT                   REGESEGESYTLSAAVDVTGGASPSPYSQNFDPYHIRRTQAVDSQLEYWYQLFEERPDL
FT                   KFISDGDPDTITVPSEETLGEEQQGRLRPDLEVRRYERK"
FT   sig_peptide     104516..104596
FT                   /locus_tag="Haur_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.632 at
FT                   residue 27"
FT   gene            105986..106990
FT                   /locus_tag="Haur_0081"
FT   CDS_pept        105986..106990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0081"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: rrs:RoseRS_3973 PBS lyase
FT                   heat domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02733"
FT                   /db_xref="GOA:A9B5A8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A8"
FT                   /protein_id="ABX02733.1"
FT                   /translation="MTEEQNERDIEEALAEIGDHNRPIVLSELKVFNDLDQDETEIFEI
FT                   EWLRIEPSHRRNLAQAMQEVGEASLELDFRAVFSILLTDQDPAIRIAAVKGMAEDTRRS
FT                   SLRRLSELLTTDPDDGVRANAAITLGAWALRAGEGNLDQRTSNELLQTLWAVFDDRQTS
FT                   TLVRQRLLETLGYLADSDPRVNQEIGAAHQRLDDGWQAAALCAMGRTGLDQWLPTITAS
FT                   LRSHEPLLRFEAVRAAGELGDLAESIVNHVARATADGDVEVATTAIWALGQIGGAAARR
FT                   FLEQLVNDSEGVRREAAAEALKELQFFDDPIQSLPLDDDEDEDEYWYGDDEDE"
FT   gene            107428..108180
FT                   /locus_tag="Haur_0082"
FT   CDS_pept        107428..108180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0082"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: rrs:RoseRS_3974
FT                   LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02734"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5A9"
FT                   /protein_id="ABX02734.1"
FT                   /translation="MFYVLMYQHICLSPHFDDAALSLGGALAGWHAAGERCLIVTICSA
FT                   PPSGELNQFAAYLHERWGAASDPIAIRRAEDQAAANRLGADLLFLEQHDAIYRHAGYDS
FT                   AAAIFGTPIADDLLWASLTTQLQALVQQYPDAIWYAPLAVGNHVDHQITHGVAAKVLSN
FT                   VRWYEDLPYSARNNARDQRLAQVQPTLDQVIAIDQTLAIKLASVADYASQIFELFGTVA
FT                   AMEQELSTYAASVAEQGFAERLWRGGLV"
FT   gene            108177..109241
FT                   /locus_tag="Haur_0083"
FT   CDS_pept        108177..109241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0083"
FT                   /product="Methicillin resistance protein"
FT                   /note="PFAM: Methicillin resistance protein; KEGG:
FT                   rca:Rcas_1415 methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02735"
FT                   /db_xref="GOA:A9B5B0"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B0"
FT                   /protein_id="ABX02735.1"
FT                   /translation="MSFALRELDAAQWSAELAANPAVHLLQRAEWGQLKAQFGWQPQRI
FT                   AIYNQHGFCAGAQVLWRSQYGLRVAYVPRGPVWSADQAANRLLLQSLERLARKRWAAFL
FT                   RLEPNLLDAGAADQLHSELLLAGYEQSRSMQPSASIHLDLQPELASLQAQCSKGHRADV
FT                   RRAERQGVSIRVGTTEADLDQFYAIMQATSQRANFGIHSREYYAQAWRLFGGDQADGAA
FT                   RLLIAEREGRVIGSFLVFAQGTEAQYMYSGTNEEGLKFAASHALQWAAITWAKQRGCTL
FT                   YDFWGIPEAFLALEATTDPAERERLDQAAQATGMAGVYRFKKGWGGQPVRYLPAYDRVF
FT                   LRPAYWLWQRRRSE"
FT   gene            109251..110795
FT                   /locus_tag="Haur_0084"
FT   CDS_pept        109251..110795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0084"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: rrs:RoseRS_0794
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02736"
FT                   /db_xref="GOA:A9B5B1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B1"
FT                   /protein_id="ABX02736.1"
FT                   /translation="MKSFAELLLHVTHQASGDHHVAISNVAYDSRKVTPGALFVAIKGV
FT                   HVDGHRYIATALEQGAVAVVYDDPHQAPPATIPSALVADAKVALSPIAAAFYDYPAQQL
FT                   EVVGITGSKGKTTTTFLTAAALEASGELVGFMSTVDFKIGQRQWANKTRQSTPEALEIQ
FT                   AMLREMVEAGCRYAVVESTSHGLSPRWNRLGDCAYDVALITNVTHEHLDYHGTVEQYRA
FT                   DKAQLFQLLATSPSQKSILGQPTPVEKVAIVNADDPHAAQFRAAAGEQVRHLSYAIHAE
FT                   ADLRATEIVSTSKGLRFTAITPQGNFALNLQLVGTFYVYNVLAALSVCLARGVDLAAAI
FT                   QRLEAIPGINGRMEQVELGQPFSVLVDYAHNPDSFEQVMSMLRPLTQGRLIAVFGSAGE
FT                   RDLAKRPIQGQIAAKWCDLLYLTDEDPRAEDSLQILQEIAAGAKAEGKIIDQNCWLIPD
FT                   RRTAIEQALATAQAGDVVLLLGKGHEGNIIYASGDIEWNEHAEAERALQGLGYIKR"
FT   gene            complement(110780..111388)
FT                   /locus_tag="Haur_0085"
FT   CDS_pept        complement(110780..111388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02737"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B2"
FT                   /protein_id="ABX02737.1"
FT                   /translation="MPSTKYYAYLQTFQVKRLERDYKYLLAEPQYHGLAQFFLEDMYGP
FT                   YDFHARDTQARRLHQFIHLAPGLSIEDIEVTLDLLNLTVRLDQQVADWLEHNNFTIPFT
FT                   EAQYEEAYYRVNSFEPRVRQIELINESLRRVHRLSKISLLGAALNNTKTFAKLMGMGEL
FT                   HRFLRRGYHALLPVQDLKPFLTEVTHTELDRLKRIYRLM"
FT   gene            complement(111634..112326)
FT                   /locus_tag="Haur_0086"
FT   CDS_pept        complement(111634..112326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02738"
FT                   /db_xref="GOA:A9B5B3"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B3"
FT                   /protein_id="ABX02738.1"
FT                   /translation="MRWIWGCLIILIVLLPATPAAACSMIEPTLDSLTQQADLVVVATV
FT                   SNIDGDQAFFTIDTAIKGSVANEPLSVLNYTIGIDPSCRSELGSGNHFAEGSKWVLFLG
FT                   PNQFDGSAVWQTISFGDYGALKVEQDQVRYHEHSQEQTQALADLVGTLTNYSMAGMATA
FT                   TILPAGQTAEPNAPKPMPTATFDVVPIANPPQTTEPPAKQPSNIAWVLVGIGVLAGVGA
FT                   LIGWRRSQ"
FT   sig_peptide     complement(112258..112326)
FT                   /locus_tag="Haur_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            complement(112339..113070)
FT                   /locus_tag="Haur_0087"
FT   CDS_pept        complement(112339..113070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02739"
FT                   /db_xref="GOA:A9B5B4"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B4"
FT                   /protein_id="ABX02739.1"
FT                   /translation="MRWMFGFFATCLALWQISPAAACKMIEPTLDSVTQQSELVVIATV
FT                   TKIEGSQATFSVEAPIKGNLPQNDLDVLNHQINNGADCQPTLGDGERFAEGSRWVLFLV
FT                   PTTLDPDITWQTASFGDYGALKVEQDQVSYTEQGTPQQISLPDMVETLSNYASLAPNEL
FT                   VDPLPGGGAAAPAVEPQILPAPAPELIDTDPNANPVAQVDVAPTIAPTAAAPSWLPWVL
FT                   VGVGVVAAIGALIGWQRSRRA"
FT   sig_peptide     complement(113002..113070)
FT                   /locus_tag="Haur_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.965 at
FT                   residue 23"
FT   gene            113386..114111
FT                   /locus_tag="Haur_0088"
FT   CDS_pept        113386..114111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0088"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; KEGG:
FT                   rrs:RoseRS_1148 primosome, DnaD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02740"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B5"
FT                   /protein_id="ABX02740.1"
FT                   /translation="MAAFHGFSTENLVPLPAEFFSDVLPSISNLAELKVTLHVFWLVSQ
FT                   QRGRAKRVSWDALSSDSALAQSLRAVSQLRPTSDVLEEALGLAVERGTLLHLISPEPGR
FT                   VVSWYLVNTQANRHWVERQAGQRVLAPEASPTAQPTIFGLYEQNIGLLTPLLIEQLHEA
FT                   SAKYPAVWLEEAIAKAVEANVRNWRYIRRILERWETDGKESTSHRSEQLFDLSKYTTGK
FT                   YAALFGRSGDSDGGDLSDL"
FT   gene            113984..114784
FT                   /locus_tag="Haur_0089"
FT   CDS_pept        113984..114784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0089"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: rrs:RoseRS_1147 IstB domain
FT                   protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02741"
FT                   /db_xref="GOA:A9B5B6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B6"
FT                   /protein_id="ABX02741.1"
FT                   /translation="MEKNLRRIDPSSFSISANIPRANMPPSSEEAAIPMEETCPICKGA
FT                   GYFCMDVPINDPNFGHLITCQCKLAEKEGRQRDKLWQQSNLQAFETKNFDTFNSHIVGV
FT                   NESFARAKAFAQAPKGWLLLVGGYGCGKTHLAAAIANEAVRREYQTIFMVVPDLLDYLR
FT                   STFGPNSEVAYDERFDKIRSIQLLVLDDLGAESSTAWAREKLFQIINHRYNNHLPTVFT
FT                   TNVDLDKLDPRIASRLLDVELCRQTVIQAKDYRQTTRNNNIRYK"
FT   gene            114888..118160
FT                   /locus_tag="Haur_0090"
FT   CDS_pept        114888..118160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0090"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rca:Rcas_3987
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02742"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B7"
FT                   /protein_id="ABX02742.1"
FT                   /translation="MAGNQAIFDRALEQYQLASRAGDWNKALTEAARAMTEFPTHEQAR
FT                   IAVATALFHTNKLPQALQLWQELLKRNPDNPIFTEYIAKIYRAQGDTDQAIELFMQLAE
FT                   RLIAQKLPLKAVRAYRDILDIHPSHEEARVRLAMVLAESGDKPGAIREYLHLGQQFYDA
FT                   EQYDAADEAAVEALNVDPASLSAQEFKKKVDLARQALITAATGDQLPDQGRLQTKEQIE
FT                   RAVNEAIEYQNNGLLEQAAQMYERVVEVLPERADMQYSLGLIYDELERHKDALRVLEIA
FT                   SHNDEYALSAHFAIGTIYQKLGQMERAAQEFEQAIRYVDLQSIGKEEANDLIDMYEATS
FT                   AIYLELGDVARAASLYSTLAGFLQGKRWGAEQAAQYNAKAKELTDRSMMSKLRMLGTGI
FT                   LNAPPPEEAVPEPQTETWGKMPSITDFLSPKSRVEASPVDDMASLEALLSANTGPAPQT
FT                   MLTDIDPLDVLAANLPPAGEVHFAPLTPIDTEGRSERIQRLVEASESFAEQNFLYAALD
FT                   ACHEIIRYDLEFYAIHLRMAEILERLGRMDQALAKLNLLIETYKARGETHKAIGVYHKL
FT                   IDLSADSTIIRAELAEVLRKQGRSDEAAEQLAYVANQQFRQGQTVKALEQFRKLLEWAP
FT                   DSVNLRAQYGQVLLKLERWEAALEEFRRVIVQKPDDLVVMAQANIALAMMGEFPDAIWD
FT                   SVAALIQKLASNPQQLNDVQAEYRAVTLITDRAIIQFLLGLIQQSTKQHPAAMHSFNQA
FT                   LELLEIDADPLVPPVLVYQAIADSYIAEGNAAGSIEQLRKIEAILVTGTVPAMSTKHAF
FT                   AQPFNEGELQRRLAEAYAANENFEGAIQALQRVKQLLPYDRQAYTKLADIYFRQGRLNE
FT                   ALTQLDELATYYESQSQLDRALEILATGLQLAPKNIPIKSRHAQLMMRRGYLDEGLVGL
FT                   DELAELQRKQGLVKDAVASIQQVADVYWTLGKVDKAAEMYNRIVQIAPNDTEARQHLVS
FT                   FNILSLRTKDAIIQLREIARLSIQQRNYEEAIASYHQVIALDQKDADAYEQLADVLMRA
FT                   QEYGQAVRTYKQLAKLLPDDDRVEALQSAAQRMLDQQQVAKG"
FT   gene            118259..119095
FT                   /locus_tag="Haur_0091"
FT   CDS_pept        118259..119095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0091"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: pen:PSEEN3375 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02743"
FT                   /db_xref="GOA:A9B5B8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B8"
FT                   /protein_id="ABX02743.1"
FT                   /translation="MQAPLNRETVHFWQDRVLNNLELLHAHYITQRFAPHSHEEFAIGV
FT                   IEAGGQAFTYQRRSEWLMPAGSIAVINPQVVHTGHAATPQGWVYRMFYPPAQILQQAAS
FT                   QLAGRNQATPFFPQPVIHDPFLMQRLLQLHQLLEDPSTTALERESRLLWTMAQLIIRHA
FT                   QSKPALSAQQLHPKAVTTIREYLAVHYADSISLEQLAQLVNLSPFHTLRMFRQATGLPP
FT                   HGYLIQLRINQAKQLLHTQLPLAEVAVQTGFSDQSHLNRHFKRVLGVTPLQYRRQG"
FT   gene            119178..119864
FT                   /locus_tag="Haur_0092"
FT   CDS_pept        119178..119864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0092"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: hma:rrnAC1920
FT                   branched-chain amino acid transport protein AzlC"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02744"
FT                   /db_xref="GOA:A9B5B9"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5B9"
FT                   /protein_id="ABX02744.1"
FT                   /translation="MHSISATFRAGIRAFLPIAVGIIPFALISGIAAMSVGLSIPQAIA
FT                   MSMIVFAGSAQLVAMQLLAEHTPMLLIILTTVIINLRFVMYSASLADHFAQLKQRWKWL
FT                   SAYLLTDQAYALAISLYQRKPHMHYKPWFYLGAAISMWITWQIGAVVGMLVGQQFPASW
FT                   QLDFTIPLTFIALAMPAIKNRRLAAVALCAAIMAGATVMLPYKLGLVLSVLAGVGLGLY
FT                   LEGRQA"
FT   gene            119861..120172
FT                   /locus_tag="Haur_0093"
FT   CDS_pept        119861..120172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0093"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   pla:Plav_1961 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02745"
FT                   /db_xref="GOA:A9B5C0"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C0"
FT                   /protein_id="ABX02745.1"
FT                   /translation="MMILLLIIGMGCVTFLLRLSFISVAGKTSMPQWLQRCLQFVPIAV
FT                   LMAIIVPDLIYQQHRYQLLNNNERLIAGLVAALVAWKTNNVLLTIGTGMGLLWLLQSL"
FT   sig_peptide     119861..119938
FT                   /locus_tag="Haur_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.836 at
FT                   residue 26"
FT   gene            complement(120426..121454)
FT                   /locus_tag="Haur_0094"
FT   CDS_pept        complement(120426..121454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0094"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   bha:BH3665 N-acetylmuramoyl-L-alanine amidase, major
FT                   autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02746"
FT                   /db_xref="GOA:A9B5C1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C1"
FT                   /protein_id="ABX02746.1"
FT                   /translation="MKRWSLIVGTLFVVGCSDAAMLVEAPKPAAVQQIAIATSAPTRVV
FT                   PTATPAPSATPAPPTETPVPQPPRVGIQVGHWQTEDLPDDLAKFRTSTGAFVNGITESD
FT                   VNLPVAEQVKALLEAEGITVDLLPATVPVAYKADAFISIHADGSTSTSSRGFKMATPWR
FT                   ASEASLLLLDSLVSEYAAGTDMPQDSAITANMRGYYAFSWRRHRNAIAPTTPAVIVEMG
FT                   FLTNPTDRAFMLNQSDVIAQSIANGLLRYLEVRDPNDLEALRVIEYAIQRPKTADVTVH
FT                   SAPDAESRVLHTLEEDQRFMPFRQRDGWYEGFVRGSSNIVGWVQVSNMQGTSDQLPPPT
FT                   DR"
FT   sig_peptide     complement(121395..121454)
FT                   /locus_tag="Haur_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.828 at
FT                   residue 20"
FT   gene            121695..122441
FT                   /locus_tag="Haur_0095"
FT   CDS_pept        121695..122441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0095"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   lic:LIC10332 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02747"
FT                   /db_xref="GOA:A9B5C2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C2"
FT                   /protein_id="ABX02747.1"
FT                   /translation="MQTIQTLVVEDHPALRAAMVAGLQATKEITVIGEAGSGEDAIEWC
FT                   AQHTPQAILMDVALASELNGIQAAVIIRREHPRIPVVFYSIQDDDAYYRDFQRSGILSH
FT                   YAYVRKSNYLLPAMVAPLLRDAFQGRAFIDPDIASRVQEVRHRDEQSALDLLEPAEREV
FT                   MTLVAHGFTNDQIAQRLGFRDARAVSRINGQIYTAWGLNENTTDEKVARTRATIIFHER
FT                   QLIVWDEEGRGRAYMPDGQWQARWND"
FT   gene            122510..125185
FT                   /locus_tag="Haur_0096"
FT   CDS_pept        122510..125185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0096"
FT                   /product="alpha-1,6-glucosidase, pullulanase-type"
FT                   /note="TIGRFAM: alpha-1,6-glucosidase, pullulanase-type;
FT                   PFAM: glycoside hydrolase family 13 domain protein; alpha
FT                   amylase catalytic region; KEGG: art:Arth_3767
FT                   alpha-1,6-glucosidases, pullulanase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02748"
FT                   /db_xref="GOA:A9B5C3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C3"
FT                   /protein_id="ABX02748.1"
FT                   /translation="MLDQSVVEEQPSVGQLDRLRAYWVRRDTIVWNIHALPNARYELHY
FT                   SLDGSLELTPQGIQHGTVLPLERDPLGLDSTLAAAFPHLQGLPVLRLAPEHHDLVATIL
FT                   RGQVAVQAYHADDQSLIDATALQIPGVLDDLYHYTGELGVSFDEQKRPILRLWAPTARS
FT                   VSLLLYADSAKGTRAIRSGMMFDPQTGVWSIVGKPSWKNQFYRFLVDVFVPSTGQFEQN
FT                   SVTDPYSLSLSTNSQHSQIVDLQSQRLKPKGWSKLAKPSLTQPTDIVLYELHVRDFSIT
FT                   DSSVSAELRGTYKAFSQVESNGMQHLQRLAKAGVSHVHLLPVFDIATIEEHRPDRTRID
FT                   FDYLASLPADSTEQQAYLFPIRDRDGFNWGYDPRHYTTPEGSYSTDPDGSTRIYEFREM
FT                   VQALNQIGLRVVMDVVYNHTHSSGQASCAVLDRIVPGYYHRLDADGNVCNSTCCANTAS
FT                   EQHMMEKLMLDSLRTWAVDYKVDGFRFDLMGHHLKRNMLAIRAMLDSLTLAEHGVDGKA
FT                   IYVYGEGWNFGEVADGARGENASQYAMAGTGIGTFSDRLRDAARGGGPFVGFQVQGFAT
FT                   GLLDRPNVYEQRAFVERHYQVAVLSDVVRLSLAGNLAEYPILSCEGQQTLGGHLYINGK
FT                   PAAYGLRPDDHIAYVSAHDNETLFDGVQVKAPLESPIAERVRMHNLALSLVALAQGIPF
FT                   FHAGDELLRSKSLDRNSYNSSDWFNRIDWTGQQNTWGSGLPPSADNHEHWATVGPLLAN
FT                   PALKPTPEDMAFSYAHFQTMLQIRRSSGLFRLNSAELIKQKVWFPNTGPDQVVGLVLMV
FT                   LDDGVGEQCDQQFSRIVVAFNGSHHDLSYSDASFGHYNLQLHPLLANGYDPVLAQASFD
FT                   RNLGSISVPGFSCVVWVEYR"
FT   gene            complement(125245..126696)
FT                   /locus_tag="Haur_0097"
FT   CDS_pept        complement(125245..126696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0097"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: rca:Rcas_3949
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02749"
FT                   /db_xref="GOA:A9B5C4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5C4"
FT                   /protein_id="ABX02749.1"
FT                   /translation="MKYTATIGLEVHAQILTKSKMFSGCNAAYASAPANSCIDEVSIGL
FT                   PGTLPVVNQEAIRKAALLGLALNCEIPEYCEFSRKSYTYPDLPKAWQITMYDKPICING
FT                   ELEITLGNGETKRVGITRAHLEEDTGMLQHGDETHSLVDYNRSGVPLLEIVSEPDMTTP
FT                   EEARLYATKLRQILVFLGVNSGNLEEGALRVDANVSIRPEGQKEFGTKVEIKNMNSFRN
FT                   LERALVYELERQEKVLREGGTIIQETRGWDDAAGITLSQRSKEHAHDYRYFPEPDLPPL
FT                   ELSREWVAERRAELPELPDAKFARYLSEFGLSKQDAALLSGERETADYFETIVATAGAA
FT                   NAKPVANWITGELFRLIKDGAETLAEVAKRVTPANLTSLIDVVAKGEIGSTVAKQVFEE
FT                   MYRTGETPTAIINAKGLRQISDSSVLTQAARDAIAANPKVVADYKSGKLPAIKFLVGQV
FT                   MRATKGQANPQVVEEALKTELDATN"
FT   gene            complement(126764..127735)
FT                   /locus_tag="Haur_0098"
FT   CDS_pept        complement(126764..127735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smu:SMU.162c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02750"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C5"
FT                   /protein_id="ABX02750.1"
FT                   /translation="MLAIKPFIGQHCETTTSGTLLYQQGIELSEPLLFGLGEGLSFIFW
FT                   HMNSMPMPFIGGRVKPDQLTETLAKQLNLKLERQETSSSTKAWAIVKDLLDQGQVVGLK
FT                   LDCFYLEYFSNPIHFAGHYVAIYGYDHDHAYLVDTHQQGSIVQTSLASLAQARAAKGSM
FT                   ASKSMAYTLKPQGSYDLAQAVRQAIINNAQAYLNPPITNVNYKGIRKASAALQPWFEAS
FT                   ANIEYDFCTTALLMERAGTGGSLFRKLYRDFLAEASTIIAAPQLRQAEPTFTTISENWQ
FT                   EVANLLDQAGKQHDLGAIQKASRLMNQIAEQEYTAMHLLATL"
FT   gene            complement(127983..129485)
FT                   /locus_tag="Haur_0099"
FT   CDS_pept        complement(127983..129485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rci:LRC48 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02751"
FT                   /db_xref="InterPro:IPR008508"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C6"
FT                   /protein_id="ABX02751.1"
FT                   /translation="MSFTPADFKYTSRTGELGRQLYPHQLRDDRYLAAIDYAIGYYEQM
FT                   LGRARREFEAATLLEFFGDPKLARGLVACLSQTYRWHQPQLAEVLDQPTYAQLVERGLR
FT                   NSADFRALLYAHANQTHGFILPSERWPAVSQLAAELGLTPSQFERVLYLDDEQEALLVR
FT                   SAERPEPSAIVALYNFHSLETGLRNCRSLQLRLDGDINALAVSAHNLAQRYNLRYELSE
FT                   PEDCIATFVTLTLHGAKDALGNWTRTGRRIARCALRLLAAHPNAASEGLIQVHMQGKNS
FT                   LIKLAKRELTVLGGTARQQPDNLGDSWETTLEQQFSQAWSRLVSKSQNAGWRIRRDPVP
FT                   FSLAHRLLVPDFIAQRGSERIPIFVPATEAMAASLAQRLVGQPKVLVVIAKSYQNLLRN
FT                   CQVAKVMYQTTPDMLTVLAQLEQLTPAQAPLDRWSRLALRFDQAGFVAETELLEILECR
FT                   NPVEISLALRGWREGTAQYVPNLGLFTPQKLRELGSMLGKAA"
FT   gene            complement(129796..131118)
FT                   /locus_tag="Haur_0100"
FT   CDS_pept        complement(129796..131118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0100"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: mma:MM_3000 DNA repair
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02752"
FT                   /db_xref="GOA:A9B5C7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C7"
FT                   /protein_id="ABX02752.1"
FT                   /translation="MTRPATQAEQPEQEQWLLDEASLLDASLLDEPDEDLPEVDARLQG
FT                   GFKAKLQFAPRPYQTEAVAAWTANEGHGVIVLPTGAGKTITAMLAIAKLGLRTLIVVPT
FT                   IELLYQWRDTVVQTLALDPKLVGVVGDGQREWRPITVITYASAAMPDAPLENLGLLICD
FT                   EVHHLPSPAYSTIALRSRTPYRLGLTATPERSDGSHTALDRLVGKVVYQRAPADLAEEG
FT                   HIAKFREKRILVDLTADELVRYETLMTTWRWFLAKHRHKLASGGDFFGELIRRSGSDPQ
FT                   ARNALQAQHQARMIALNAEKKLEHVGQLLSQHPNDKIIIFSEYNALVNTISRQFAIPSI
FT                   TYRTAADERKSILDGFRSGRYSKLVTGRVLNEGVDVPDANVAIVVSGSATAREYIQRLG
FT                   RVLRKKPDEALLYELVTRNTSEVQTARRRKKAVAAHNLQAK"
FT   gene            complement(131127..131672)
FT                   /locus_tag="Haur_0101"
FT   CDS_pept        complement(131127..131672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0101"
FT                   /product="DNA polymerase IV (family X)-like"
FT                   /note="KEGG: afw:Anae109_0459 PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02753"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C8"
FT                   /protein_id="ABX02753.1"
FT                   /translation="MNNRAIAQILFNIATLLKRQNANPYRVRRYREVARAILRLRHSLT
FT                   ERALAGKALGINKLGASLTRKITVLAAQGQLDFYDDLCALLPPSQQRLLKIAGIGPILA
FT                   ERISQELGDVELATLLREAAYQRLTAIWGVGPQRADLIVSNMFPDDPPPPANAAHSARK
FT                   SNIIYTQPTLWEYGQKAA"
FT   gene            complement(131843..132079)
FT                   /locus_tag="Haur_0102"
FT   CDS_pept        complement(131843..132079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02754"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5C9"
FT                   /protein_id="ABX02754.1"
FT                   /translation="MPDYLYDLEAQELANGDWALVIHCEAAYAQTVNIATPNFAIERRF
FT                   DATGYAAVTIPRQQFNGINASDLQIQIQTKINV"
FT   gene            complement(132307..135936)
FT                   /locus_tag="Haur_0103"
FT   CDS_pept        complement(132307..135936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0103"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: AAA ATPase; KEGG:
FT                   gvi:gll4356 WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02755"
FT                   /db_xref="GOA:A9B5D0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D0"
FT                   /protein_id="ABX02755.1"
FT                   /translation="MTNVVLSLPVFHATEGLGAFLGDLRSWVFRSKNRAARHFGLAHTT
FT                   IMRYENDQILCPLGYIAALAQLVIEQLDLPPYQRGLAEQQLLATIQYALTEYAIDHTPL
FT                   ATWPELTNLAAAYLAEVQQQKQEQAKTGPLMGVLHDWGDAPDVQNFVGREDETATLVKW
FT                   LQLDRCRLVAIIGLGGMGKTSLATRVAQQAQDDFKVIVWRSLQQGQQANDFLLECLHRI
FT                   MPSPNSAYPSQFEHRLSVLIDYLRTTRCLLILDNIEAILQPQYPAGRYREGYEQYAQLF
FT                   QAISERSHESCLILTSREKPYEFNRLEGVHTRSMVLTGLMRDDAQMLLDNQELYGTPQL
FT                   WQELIKHYTGNPLALKLVAQVIKTMFFGQIAEFLQHEELIFGDVRTILAQQFERLSDQE
FT                   QELLYWLAIERHTVKLAELKHDLVRSKYQHMLLETLESLLRRSLVERHQDGFMLHNVVL
FT                   EYTTDRLIDQIAQELLDGTQGLLYRHALIKANSLDSIREHQSRAILRPLLHRIFVELGQ
FT                   ERLLASLRQLLQTMQPLSALEMGYAPGNIFNLLVELKADLSQFDFRHKPLWHANLRGIN
FT                   PKQLDLSHSDLSRSVFSEQFGALIALARDPADRFLAVATADDQLIVWQNLDLKKLWQVP
FT                   SNHDGIRAICFSGDGRYLISAGNDGLIRLWETSQGQNPRILAGHTRPVIGVAIAPQSQQ
FT                   LISASLDGEVRLWDRLSGKCLHRFNAHADGLSSIGLSANGQYLATAGLDRQIKLWHGPQ
FT                   LNYQTTITTHHEPIEILAFSPNPTILAGTGLDGDVYLWDLQANQLITSLPNEDRVFDLQ
FT                   FSPDGANLATAGLDQCIRIWQVETAHLTHMLYGHAHWVRALHYNRDGSRLYSVSSDQSL
FT                   RIWEQASGRLLHTLQGYRGGVRSLALSNNADLLFNAGEAQAVTLWQLAEPFYRLNLPQA
FT                   TNNGRELAYHQASQLLAISQEQVIQLWDCQRLQLATILTGHQALIRAIAFRPDGSMLAS
FT                   CSEDHTVHVWSMPHGQIVQVFGCHDDLVTTLAWSQNGSLLATGSADRTIRIWGVAEHSC
FT                   LSLLAGHSAGIISLAFSPDQRHLVSAGADQQVRIWDLSNQCYEIVLLHKPGLLKAVQWS
FT                   ADGRWIVIAAGSLALIWDWQNQQLVQRFEHQAAVDSICLSSDGHMLITGDQQGAIAIWQ
FT                   LATGKLLKKLHSDRPYQGLIINQAIGLNAAEQASLLNLGALIN"
FT   gene            136808..137887
FT                   /locus_tag="Haur_0104"
FT   CDS_pept        136808..137887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0104"
FT                   /product="Cytochrome c oxidase subunit II"
FT                   /note="TIGRFAM: Cytochrome c oxidase subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: rrs:RoseRS_2263
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02756"
FT                   /db_xref="GOA:A9B5D1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D1"
FT                   /protein_id="ABX02756.1"
FT                   /translation="MPNRSPAKALLRPTATLLLGSVVLAACGQKTPQTTLNPASESTRA
FT                   IYNLSELLFWLGVVVFLIVQTWLIVSIIKYRQKDSSQIPTQIHGNTKVEIAWTIVPAII
FT                   AIVIFVFTFDTIRKIEFMPDEAAGNTLNVKVIGHQWWWEFQYPDIKDASGKPLVTANEL
FT                   WIPSGSYIDVKMTSVDVIHDFWIPGLAGKRDVMPNRESGLWFKADDVADGSPAVFWGQC
FT                   AEYCGGQHAYMKMRVVVASPADFQKWSSEQSQVAVNTTLPESFTKNCIGCHVVRGTNAA
FT                   GITGPDLTHFGGRMTIAAGTTDNTREHLYAWLDDPDAVKRGNIMTTAIKADTLTEAEIT
FT                   ELVDYLESLNPGTSVKGQQ"
FT   sig_peptide     136808..136894
FT                   /locus_tag="Haur_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.391 at
FT                   residue 29"
FT   gene            137897..139744
FT                   /locus_tag="Haur_0105"
FT   CDS_pept        137897..139744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0105"
FT                   /product="Cytochrome c oxidase subunit I type"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: rca:Rcas_3557 cytochrome c oxidase subunit I
FT                   type; TIGRFAM: Cytochrome c oxidase subunit I type; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02757"
FT                   /db_xref="GOA:A9B5D2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D2"
FT                   /protein_id="ABX02757.1"
FT                   /translation="MATDVSTLHHAPAKQRRGWLEWITTVDHKKIGIMYAVTAFLFFVI
FT                   GGLEALLIRLQLGTPQNTLLTPEAYNQVFTMHGTTMVFMAIMPVNAGFMNYFVPLMIGA
FT                   GDMAYPRMNAMSYWLLLFGGIVMYSSFVFGGGAPDAGWFAYAPLTSTTYSVTRGMDYWV
FT                   LGLQLLGVSSLAGSVNIIVTIIRLRAPGMRFNRMPLFVWMSFVTSFLLIFALPSITVGI
FT                   TLLFFDRNFGTNFFLPAAGGDPLLWQHLFWFFGHPEVYIMILPAFGVVSEMLPVFSRKP
FT                   IFGYEFVAYSGVAIGVLGFTVWAHHMFATNLGVIADTFFAAASMLISVPTGVKIFNWLA
FT                   TLWRGELRFKTPMLFSLGFIAMFVIGGISGVSLAAAPFDLQVTDSYFVVAHFHYVLFGG
FT                   AVFALFGASYYWFPKITGKMMSERIGKWHFWILMLGFNLTFFPQHMLGLQGMPRRVWTY
FT                   QQNQGWDFYNLLSTIGAFCIALGTLVFIVNFIISLRKGAPAGNDPWDAATLEWATTSPP
FT                   PAHNFDVEYIVHSRRPLWDNKYSGEGRGMTINYDFHPHLPPPSFAPIIFSFGLFVLAYG
FT                   MLNLASAPLIGIPLILVALAIAFVGMNRWVGEIAQDPVL"
FT   gene            139805..140431
FT                   /locus_tag="Haur_0106"
FT   CDS_pept        139805..140431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0106"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   rca:Rcas_3556 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02758"
FT                   /db_xref="GOA:A9B5D3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D3"
FT                   /protein_id="ABX02758.1"
FT                   /translation="MAQAVVRDIDKNDPGRGLDLRKLGMWTFLGSEVFFFGALVVTHLS
FT                   MRGVVAPSSSKANYDVAAVRNLFGDNVLTSILAFILLTSSLTMVLALDGVKTNNQKRFR
FT                   FWLGATIACGLVFLGGQVYEFYHIVHEGVTIKNMMFGSTFFFVTGFHGTHVAVGVVWLT
FT                   SLLVSAIRHPERYNAGNYMAVELGGLYWHFVDLVWVLIFTVIYLI"
FT   gene            140457..140789
FT                   /locus_tag="Haur_0107"
FT   CDS_pept        140457..140789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0107"
FT                   /product="caa(3)-type oxidase, subunit IV"
FT                   /note="KEGG: rca:Rcas_3555 caa(3)-type oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02759"
FT                   /db_xref="GOA:A9B5D4"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D4"
FT                   /protein_id="ABX02759.1"
FT                   /translation="MAHGHDEHAPTEHEAHHSHAKLYVIIFFVLLVMTGIEIALPIINK
FT                   AEIMAKQLEVALLLGLMTIKGAIVMMFYMHLKGDRRMFGTLFVFPIVCVLLMMLGFFAL
FT                   FQPELW"
FT   gene            140794..141606
FT                   /locus_tag="Haur_0108"
FT   CDS_pept        140794..141606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0108"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: rca:Rcas_3554 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02760"
FT                   /db_xref="GOA:A9B5D5"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D5"
FT                   /protein_id="ABX02760.1"
FT                   /translation="MNDWTLDWPLLFGLIAATVGYLWAVGPARKRLGGPAAFPVGKAVA
FT                   FLSGLLALGLSIMSPIGIWADRYLFTMHMVQHMILTMFCAPMLLIGIPEWLLRPLVQLP
FT                   WVYSIVRFAVNPIVAFSAFNISFNGWHFPQFYDLALRNELVHILEHQMMMGSAILLWAP
FT                   SLIPLPELRSSYPVQMLYYFVNSIIPTILGALITFADSVLYPTYELAPRIWGISAIADQ
FT                   QIGALIMWIPGGSIFILAITIAFFKWMNREDEEQSLPSIADQKAAARQ"
FT   sig_peptide     140794..140868
FT                   /locus_tag="Haur_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.809 at
FT                   residue 25"
FT   gene            complement(141655..143475)
FT                   /locus_tag="Haur_0109"
FT   CDS_pept        complement(141655..143475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02761"
FT                   /db_xref="GOA:A9B5D6"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D6"
FT                   /protein_id="ABX02761.1"
FT                   /translation="MDFYAKACMGTFKLTSIKDRYIIVFGTFCIFLCYALFIFNSDVAY
FT                   LAFTQPQDDSFYYFLPAWNFKAYGFYTFDGLNETYGFQPLWMVLLTIMAFFISSKILFF
FT                   KLSLLVGCLFYLLTGLIIYKISKLLIRQRLLTFIPWFVWVSNIYLLRIFASGKENSLSV
FT                   FLYALIALSLLNIHFKNRQQSSLYGLIDASFMLVRINNLMFVGPILLYRLYHNRQQKSQ
FT                   IGFYLATFSLVLSLWFGYSYAAFGTLFPNSGSLKTVISKPSIVYWLNQQTGVELGGMLS
FT                   SQEQLLLQHPEFLDVPRANFFWQYLSQIVPQKVTDIYFDQKFSSITLVSTLNQVLLLSI
FT                   GLGLIGFLGGLWQRSITINQQLIKLLSYCGIIALANSVVNWLFFQRYLSFTIWYPVPEL
FT                   FWFSLVLGLLVVASIIGWQQLSQIKPIIKPVQYIMLLAIGIFLLSPLSRFPQELLPQKT
FT                   SEHYRGTYRFFSYIWQDEALKATSWANQALAPNTTIGSWNAGIVGYFYENGSTINLDGL
FT                   ANSPAFVDEVLRQNILFTRGLANENVLWNYIQHQDIRYIIDSWYSGEMGKSRFINSIPP
FT                   EHYEIIYEGAVTFSDGNRPDRRMYVLKLKY"
FT   gene            complement(143562..144386)
FT                   /locus_tag="Haur_0110"
FT   CDS_pept        complement(143562..144386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0110"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: rrs:RoseRS_1224
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02762"
FT                   /db_xref="GOA:A9B5D7"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D7"
FT                   /protein_id="ABX02762.1"
FT                   /translation="MNDQSIKASVQAYYGEWAEQVQQEQPKTSCCSSHDISLSSTLYRD
FT                   TTTADLPATAVNSTRGCGNPVVRAALQLGQVVLDLGSGGGLDVLLAAKQVGPSGFVYGV
FT                   DMTDAMLDLARQNAHKAQIENVAFLKGDIEQLPLENEQVDVIISNCVINLAPDKGMALR
FT                   EAYRVLKVGGYMAISDIVIDGSLADFPLPEASLRAAMNWAGCVAGAPTREQYQQFLAQA
FT                   GFQAISFEVTHRYSFEDIGGKLPEELAGLSDLQGQQLAERFTSCLIRAHKQI"
FT   gene            complement(144432..144854)
FT                   /locus_tag="Haur_0111"
FT   CDS_pept        complement(144432..144854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0111"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rca:Rcas_2311 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02763"
FT                   /db_xref="GOA:A9B5D8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D8"
FT                   /protein_id="ABX02763.1"
FT                   /translation="MQLELITSDQQPTFEHLLSTVGLGNEGLATAQAYGWWQDGKLQAG
FT                   GALEIYGELGLLRSVAVRPDQQNQGLGAALLDALEQQARQLGLQTLYLLTTSAAKFFAA
FT                   HGYQPIERAEADSRLHASVQWGSICSSATLMVKHLV"
FT   gene            complement(144910..145269)
FT                   /locus_tag="Haur_0112"
FT   CDS_pept        complement(144910..145269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0112"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: rca:Rcas_2310
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02764"
FT                   /db_xref="GOA:A9B5D9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5D9"
FT                   /protein_id="ABX02764.1"
FT                   /translation="MTGIIELIAQTTGCCAPASAGLNETEAEAISADFQVFAHPVRVQL
FT                   LTLLTNSTDDVCVCDLEAAVAVKQPTVSYHLKLLREAGLVSCERRGPWAYYRVERERLA
FT                   SLKARINRHLDTWNR"
FT   gene            145408..146697
FT                   /locus_tag="Haur_0113"
FT   CDS_pept        145408..146697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0113"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: gur:Gura_3531
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02765"
FT                   /db_xref="GOA:A9B5E0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018656"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E0"
FT                   /protein_id="ABX02765.1"
FT                   /translation="MQLQSSAVTDSLNTLQLLNRAATIRGASAWVQRTAQALSAKQLAD
FT                   NQLVASLGFGLLPQNPSQPMDDFLAELGSSEPNQWVAQLQQHLLELSASAGPLTSERLW
FT                   QALRNAGIYSELATQQELLAAMQQPDQLLARVCQHLEHMWQLCLQAEWQQAQTAISQLN
FT                   RQLQAQVPNEAALKGFRQSLGYAVNQEWQQLQGQRQIVLFAATQNGSLTTFLADRQRLW
FT                   VGIGFGISNELQPRVVSRNELLFRLQALADAARIQIMELLAQGELSAQAIISQTQLPQS
FT                   SVSRHLNILRNAGFVQERRAGGATKSYRLVTSHIGATLAALEQTLNQPSASPSSSAQSA
FT                   SAVPTSIQRFFNREGRMVTWPSKHIDRIPILEYFAQQFEFGREYSEREINELLKPHTGS
FT                   DVANLRRYLIDVKLFERDGTGSRYWRKKEE"
FT   gene            complement(146839..147900)
FT                   /locus_tag="Haur_0114"
FT   CDS_pept        complement(146839..147900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0114"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rca:Rcas_1939 DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02766"
FT                   /db_xref="GOA:A9B5E1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E1"
FT                   /protein_id="ABX02766.1"
FT                   /translation="MDRLLWFRKPRLLNLLAGWRDLTALVALRASILATTSHLADYADG
FT                   IADQAESVAFDYAFLLGELQQISEAQTLERAHYYIERLARSIATVRTTAINDINLNRWK
FT                   EYDDINTDSLWMIDRRDGSGVHSAGYWGNFVPQIPNQLMRRYTKQGDWVIDTFAGSGTT
FT                   LIEAQRLGRNVLGVELQPHMVEYANQAVEREPNPLAIVARSVHGDCTTINWQALLADYG
FT                   QCHVQLAIMHPPYFDIINFSDDERDLSNAPSVEDFLGQMAAAVAQVKPVLQRGRHLAVI
FT                   IGDKYMHGEWVALGFRTMEVVQQQGFQLKSIIVKNFEDTTGKRHQKELWRYRALVGGFY
FT                   IFKHEYIFLFRKK"
FT   sig_peptide     complement(147781..147900)
FT                   /locus_tag="Haur_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.659 at
FT                   residue 40"
FT   gene            complement(147983..149488)
FT                   /locus_tag="Haur_0115"
FT   CDS_pept        complement(147983..149488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0115"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: rrs:RoseRS_1549 carboxypeptidase
FT                   Taq"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02767"
FT                   /db_xref="GOA:A9B5E2"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E2"
FT                   /protein_id="ABX02767.1"
FT                   /translation="MQEQLADLKEKIGVAQDLSYASAVLNWDQSTYMPAGGAEARGRQM
FT                   ATLSRLAHEHSTAPEVGRLLEQLVPWAEQQDPESDDAALVLVTKRDYDQAVRVPSEFIA
FT                   ELYSHVAKTYTAWTQARPNNDFASVAPLLEKTLDLSRRYAEFFGPSEHIADPLIDMADQ
FT                   GMTVAKIREIFGPLREQLVPLVKTITEQPAADDSCLLQHYPEAEQLAFGESLIREIGYD
FT                   FERGRQDKTHHPFMTKFSIGDVRITTRFRENDLSDGLFSTIHETGHAVYELGVNPAYEN
FT                   TPLASGASAGTHESQSRLWENVVGRSRAFWQYAYPKAQAAFPNQLGKVDLDTFYRAINK
FT                   VQRSLIRTDSDEVTYNLHVMIRFDLELALLEGKLAIRDLPEAWHERYRSDLGITAPDNR
FT                   DGVLQDVHWYGGIIGGSFQGYTLGNILSAQVFDAAVRANPNIPTEISQGQFANLHNWLK
FT                   SNMYVHGRKYSVPTLIRKVTGQDLSIEPYIRYLRTKYGELYSL"
FT   gene            150124..151197
FT                   /locus_tag="Haur_0116"
FT   CDS_pept        150124..151197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0116"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: rca:Rcas_1485 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02768"
FT                   /db_xref="GOA:A9B5E3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E3"
FT                   /protein_id="ABX02768.1"
FT                   /translation="MSLLPAAIDDNELSPARKTLLDRIHLVWIFVNGSTALSLFFLFLF
FT                   NFFSGNSAWVQMLILSISSIGSTGILWYTNSKPVQWRLWAALISSMVALLEIALFFQNG
FT                   YLIAISVTSVVSIYAVTADRHELITWSAVIGVIFTIIFAILNGVEQTPPKWLNDLHLNL
FT                   LISKVLVPAFIGGGIVMIALLLLGLSNTLRQSLNEANERRRIAEEAQAAQAKTLAQVER
FT                   QAAEQARLLELVRDLETPVIPVLDGVLVLPIVGHLESKRLENLTELLLNRVSQERAHTV
FT                   LLDITAVSVVDTATAQHLIQLARAIRLLGAECVITGIRAHVASTLVALGITWEGLRTAG
FT                   SLRDGIAKIIAEKNIAI"
FT   gene            151209..152342
FT                   /locus_tag="Haur_0117"
FT   CDS_pept        151209..152342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0117"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rrs:RoseRS_1560 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02769"
FT                   /db_xref="GOA:A9B5E4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E4"
FT                   /protein_id="ABX02769.1"
FT                   /translation="MVFDDTDLTPNRIEMARRAATGHFIDLTSSNPTQQDLLFPPDVLE
FT                   QAAQKYWSQRCYEPNPRGLEPTRQAIIDYYAQRRPALALTLDDIFITASTSEAYSLLFS
FT                   LLTAPGDNILGPNVTYPLFEYLADLHHVELRTYELDPANNWVIDQASLLAAADQNTRAI
FT                   LLISPHNPTGAIISEPIAALNQLGIPLICDEVFAPFALAKSHVPALGGLHPDVPVFQLN
FT                   GISKLLALPDLKLGWIALNQAAQGYAERLELINDTFLSCSTLIQTMLPDLLHAAPPFID
FT                   QMLERVRANIAYAREHLAQHPRLIWSEPDGGYYLFLQVRDEFDDEALVVRLIEQGVLVH
FT                   PGFFFDWIDDCRIMLSALTEPHQWQAGIQKLAQILTI"
FT   gene            152408..152493
FT                   /locus_tag="Haur_R0002"
FT                   /note="tRNA-Tyr1"
FT   tRNA            152408..152493
FT                   /locus_tag="Haur_R0002"
FT                   /product="tRNA-Tyr"
FT   gene            152519..152594
FT                   /locus_tag="Haur_R0003"
FT                   /note="tRNA-Thr1"
FT   tRNA            152519..152594
FT                   /locus_tag="Haur_R0003"
FT                   /product="tRNA-Thr"
FT   gene            152689..153891
FT                   /locus_tag="Haur_0118"
FT   CDS_pept        152689..153891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0118"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG:
FT                   rrs:RoseRS_1187 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02770"
FT                   /db_xref="GOA:A9B380"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A9B380"
FT                   /protein_id="ABX02770.1"
FT                   /translation="MAKQKFERNKPHINIGTIGHVDHGKTTLTAAITKTMALRGRAEFR
FT                   AFDQIDNAPEERARGITISISHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDGAIL
FT                   VVSAPDGPMPQTREHILLAGQVEVPAMVVFLNKVDMMDDPELLELVEMELRELLSKYGF
FT                   PGDEIPIVRGSAKGALDSASTDASQPEYQSIQELMQAVDDYIPTPERAIDKPFLMPIED
FT                   VFSIKGRGTVVTGRIERGIVKVGDTIEIIGMGPDVRTTAVTGVEMFKKLLDEGRAGDNV
FT                   GALLRGIERTDVERGQVLAKPGSIKPHTKFKAEVYVLKKEEGGRHSPFFSGYRPQFYVR
FT                   TTDVTGAIGLPEGVEMVMPGDNIQMTVELIVPVAIEQGLKFAIREGGRTVGAGIVTEII
FT                   A"
FT   gene            154076..154207
FT                   /locus_tag="Haur_0119"
FT   CDS_pept        154076..154207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0119"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: sha:SH1572 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02771"
FT                   /db_xref="GOA:A9B5E6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5E6"
FT                   /protein_id="ABX02771.1"
FT                   /translation="MACTECGDRNYTTTKNRKNDTNRLELMKYCPRLRKRTLHRETK"
FT   gene            154273..154491
FT                   /locus_tag="Haur_0120"
FT   CDS_pept        154273..154491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0120"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: rca:Rcas_4322
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02772"
FT                   /db_xref="GOA:A9B5E7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E7"
FT                   /protein_id="ABX02772.1"
FT                   /translation="MVAVATEEKEDYKPNPIAQFFRDAFSEMRKVVWPSREETQRLTLV
FT                   VIGISLLVGSILAVFDLLFETLVRLIQ"
FT   gene            154517..155083
FT                   /locus_tag="Haur_0121"
FT   CDS_pept        154517..155083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0121"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: rca:Rcas_4321 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02773"
FT                   /db_xref="GOA:A9B5E8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5E8"
FT                   /protein_id="ABX02773.1"
FT                   /translation="MSDNEEEKSTTPEGVHWYVIHTYSGYENKVMQNLRHRIESMDMRN
FT                   QIFRVVVPTEEEIEIKNGQRRTVQKKVFPGYVLVQMAMTDDSWYVVRNTPGVTSFVGMG
FT                   TKPSPLADEEVRFILKQMEEEAPKVKVNYEIGQTVKITDGPFTDFEGVVDEIDEERGRV
FT                   RVLVSFFGREAPVELDFLQVIRVIE"
FT   gene            155119..155544
FT                   /locus_tag="Haur_0122"
FT   CDS_pept        155119..155544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0122"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: rrs:RoseRS_3326
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02774"
FT                   /db_xref="GOA:A9B5E9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5E9"
FT                   /protein_id="ABX02774.1"
FT                   /translation="MAKKVTAVVKLQLPAGKATPAPPVGPALGATGINIMAFCKDYNEK
FT                   TSAQVGTIIPVEITVYSDRSFTYILKTPPAADLLRKAAGIQRGSGKTGTQGAGSITRAQ
FT                   LRQLAETKMPDLNANDIEAAEKIIAGTARSMGIAIKD"
FT   gene            155749..156462
FT                   /locus_tag="Haur_0123"
FT   CDS_pept        155749..156462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0123"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: rrs:RoseRS_3327
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02775"
FT                   /db_xref="GOA:A9B5F0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F0"
FT                   /protein_id="ABX02775.1"
FT                   /translation="MAKQHGKKYLAAAAKVEADRLYTPEEAAALVKETSFTNFDATVEL
FT                   HVRLGIDPRHADQTVRSTASLPHGTGKSVRVLVFAQGDTENIARNAGAEIVGGDELIQR
FT                   IEKENFIDFDVAVATPDMMGKVGRLGRILGRRGLMPNPKSGTVVPPGDLPQAIKALQGG
FT                   RVEFRNDKTGLLHVAIGKISFTPDQIRENLVVLLDAIKAAKPSGSKGVYIKSLTLTSTM
FT                   GPGIPLDVNVAQATA"
FT   gene            complement(156515..157291)
FT                   /locus_tag="Haur_0124"
FT   CDS_pept        complement(156515..157291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0124"
FT                   /product="Dimethylargininase"
FT                   /EC_number="3.5.3.18"
FT                   /note="PFAM: amidinotransferase; KEGG: sus:Acid_1735
FT                   dimethylargininase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02776"
FT                   /db_xref="GOA:A9B5F1"
FT                   /db_xref="InterPro:IPR033199"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F1"
FT                   /protein_id="ABX02776.1"
FT                   /translation="MPTAIVRPVSPAIQQCELTHLERQPIDFSRAQSQHASYCTTLAAN
FT                   GYQVVELSVAEDLADSVFVEDTALVLPELAIITRPGAASRRPELAAMAAVLQNYRQLAW
FT                   LSEPATLDGGDVVVLGKTIWIGLSSRSNQAAVEQVQAVTKAFGYRVQGVELGQCLHLKT
FT                   AVCAVDSNTVLLNPQWVEPQVFAEYQVIEVDPREEFAANVVQLHYGRLLYDQAYSATAE
FT                   RLRQRGYQLILVDNSELTKAEGALTCCSVLIHETEG"
FT   gene            157444..158829
FT                   /locus_tag="Haur_0125"
FT   CDS_pept        157444..158829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0125"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 DNA-binding
FT                   domain protein; KEGG: dsy:DSY4842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02777"
FT                   /db_xref="GOA:A9B5F2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F2"
FT                   /protein_id="ABX02777.1"
FT                   /translation="MEFRMGMSPEALAQQAMSTKASPALIALNNMLVLSTHELQQLIQQ
FT                   ELEENPALENVDLEPDETCSRCGRPLIEMLCLYCVHEDQRLAEAERGDYTAAGEDDEFD
FT                   PLMMVATPAQLSEVLLRDLRASLPEQDYFIAEYLVGCLDDQGFLDANTGDIAATLTIDE
FT                   ERVIAVLLKLQDIAPVGVGARDVQECLLLQLRRLDEEDVRHPYVERVITEFWNDLAEHR
FT                   YGAIAQALNAEYDAVVEVREFIREHLRPYPLALSGEGSARTNYIMPDVIIRENEGKLEA
FT                   EVLMSDRSFLRINPLYQSLVKRGREAEAEMSSEDRDHLSQYVARAQMFLTNIRQRRETI
FT                   RRISEFLIETQEDFLRQGVRFLRPMTRAEVADGIGVHESTVSRATANKYVQLPNRSVIP
FT                   FSHFFTASLNVKDVLLELVQNEVRPLTDQELVELLAERGFEVARRTIAKYRNQLNILPS
FT                   TLR"
FT   gene            158856..159146
FT                   /locus_tag="Haur_0126"
FT   CDS_pept        158856..159146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02778"
FT                   /db_xref="GOA:A9B5F3"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F3"
FT                   /protein_id="ABX02778.1"
FT                   /translation="MQRWRHWLEWLVLGGLSVLIARLMLLLFAANPEQPFTQIVLWLSQ
FT                   GLVWPLAWLDQTQPTTGVRFERGTFLLIMFGLVGMSIWQLRQARRTNHGME"
FT   sig_peptide     158856..158945
FT                   /locus_tag="Haur_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.961 at
FT                   residue 30"
FT   gene            159133..159513
FT                   /locus_tag="Haur_0127"
FT   CDS_pept        159133..159513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02779"
FT                   /db_xref="GOA:A9B5F4"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F4"
FT                   /protein_id="ABX02779.1"
FT                   /translation="MEWSSFFRIVGWTIAIAGGLGLAGLALIWYRLKSLNVPDGASYRE
FT                   TMLRVPLSLVIVLDLLDLAFDVFAAPISWIVLSHFNLQGLRRVSVVEALIPGTQVIPWM
FT                   TVSWFAVRLFDRYAQPDERVEP"
FT   gene            159510..160454
FT                   /locus_tag="Haur_0128"
FT   CDS_pept        159510..160454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0128"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   oih:OB0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02780"
FT                   /db_xref="GOA:A9B5F5"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F5"
FT                   /protein_id="ABX02780.1"
FT                   /translation="MSNEATLKISLIMNPASGTSEQGALLLETLAPMSGVTILTTDAAG
FT                   EGERLARQAVADGAELVVAAGGDGTINEVVKGLIEAERRVPLGIIPLGTGNDLARTLAL
FT                   PTDPLEAWKLILVGERRKLDVIEIRTPRELHYALNVSAGGFSGQLNEAMSSEVKSAWGP
FT                   LAYLRGALGVLPDLTSYRTTIQYDDQAPEQVDALNIIIANGRTAAAGVQVAPLANPEDG
FT                   LLDVVIVHYGSIMQLAGAAARLLVNGNYLNSELVELRRAKKVQVISDPEIWFNADGELI
FT                   TNEPIVFEVLPQALEVVVGAEYQAVIEDVTTGS"
FT   gene            160601..160903
FT                   /locus_tag="Haur_0129"
FT   CDS_pept        160601..160903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02781"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F6"
FT                   /protein_id="ABX02781.1"
FT                   /translation="MSDDLRDELRDLAGYRNDESDILGVFNADEIENTQDFTVTDIEQG
FT                   ETEAYADLSEPLESLDELTSENLREGETDDVIEAIQEGLSYVPPIDDPLDFDDAD"
FT   gene            161241..162062
FT                   /locus_tag="Haur_0130"
FT   CDS_pept        161241..162062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0130"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: rca:Rcas_0300 6-pyruvoyl
FT                   tetrahydropterin synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02782"
FT                   /db_xref="GOA:A9B5F7"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR022470"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F7"
FT                   /protein_id="ABX02782.1"
FT                   /translation="MDVFATRRFNFSASHRYWREEWSLEQNEAVFGKCTNRYGHGHNYE
FT                   LFVTVAGAVDPITGMVMNMVELKRLVTMVLDQFDHKHLNEDTPYFREVIPTTENLVRVL
FT                   WGLIEPQLPKGVRLAKLRLYENSDLYAEYFGRQQQATFNRRYEFSAAHRLHAQSLTDEA
FT                   NREIYGKCNNPNGHGHNYQLEVTVDGLIDAQTGMVIDLVDMDRRVQSVLDNWDHRHLDY
FT                   QVAEFAEQPSTAENIVVVLWQRLEALFGSQLKHLRLWETANNVFDYPLSQH"
FT   gene            162124..162744
FT                   /locus_tag="Haur_0131"
FT   CDS_pept        162124..162744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0131"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: rrs:RoseRS_0705
FT                   GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02783"
FT                   /db_xref="GOA:A9B5F8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F8"
FT                   /protein_id="ABX02783.1"
FT                   /translation="MTLIYSGNGLNGNSAPAVREDMEAAVRTILEGLGEDVDREGLQRT
FT                   PHRVAKMFGELTAGYHTDPVALINDAIFTVEYNEMVLVRDIEFSSLCEHHMLPFWGKAH
FT                   VAYVPNGKVLGLSKIPRIVDMFAKRLQVQERLTREIADFVAQTIDASGVAVVVQGAHMC
FT                   SMIRGVKKANARMVTQSLQGVFKTDPQIRAEFMGHITANFSDD"
FT   gene            162737..163438
FT                   /locus_tag="Haur_0132"
FT   CDS_pept        162737..163438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0132"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rca:Rcas_0302 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02784"
FT                   /db_xref="GOA:A9B5F9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5F9"
FT                   /protein_id="ABX02784.1"
FT                   /translation="MTKTMVITGAGRGIGRAIALACAANNQLVLLARSAAELQAVAIEI
FT                   QSAGGTAQVVVGNASDPAIVQQAIDLAQQAGQGHIDGLILAAGVAHVAHVGALSLQQWQ
FT                   QSLDVNLTASFLACQAALPYLKAGSQIIAISSIAGKSGFPGWAAYSASKFGLMGFLQAL
FT                   REELRPQGVRVTAVVSAAVDTALWNDVAGSWNRQNMLQASEVANAVAHILSQPSHVLID
FT                   EISIGHVVGKL"
FT   gene            164250..165329
FT                   /locus_tag="Haur_0133"
FT   CDS_pept        164250..165329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0133"
FT                   /product="isocitrate/isopropylmalate dehydrogenase"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: rxy:Rxyl_2072 isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02785"
FT                   /db_xref="GOA:A9B5G0"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G0"
FT                   /protein_id="ABX02785.1"
FT                   /translation="MSKPTIVVLEGDQTGQELLEESLRVLDPAVTGVDIELKRYDLSLE
FT                   SRRATNNQIVLEAAQAMKEAGFGLKAATITPEKAGDVGSPNAILREQINGTVIVRTGRR
FT                   IPGVRPVGGAYAPISVIRMAVDDAYGAKEWREGEGDNEVAYRTEKITRGTCRAVSEYAF
FT                   MHARRMKAKVFGGPKYTVSPIYEGMLKEEMDAAAKRYADVRYEPQLIDATYALLLTNSG
FT                   DPMVIPALNRDGDCLSDLVLQMFGTIAGAESLLLAFDKDFKVNVVMAEAPHGTAPSLEG
FT                   KNVANPMAMILASAALLDYIDTPQANMAARAISEATLEAVYDGVRTADLGGHTTTSDFT
FT                   DEVIRRVKTKMEVWPSLGN"
FT   gene            165545..165919
FT                   /locus_tag="Haur_0134"
FT   CDS_pept        165545..165919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02786"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G1"
FT                   /protein_id="ABX02786.1"
FT                   /translation="MIFDLCLLPFRGIAMANSISDFFGSNNAGFGDVNIDAVIAGNNNQ
FT                   INKYLQLPTQTDPLPAALARLATLPLCDVRSRKKLLYGANTGWSLLFHQQYPTRYCGTV
FT                   TSRGKPEDNVSTTDWSGQGL"
FT   gene            166364..168046
FT                   /locus_tag="Haur_0135"
FT   CDS_pept        166364..168046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0135"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="KEGG: ecs:pO157p35 similar to SwissProt accession
FT                   number P19593; PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); HNH endonuclease; Group II intron
FT                   maturase-specific domain protein; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02787"
FT                   /db_xref="GOA:A9B272"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A9B272"
FT                   /protein_id="ABX02787.1"
FT                   /translation="MMAETSAGAASRSEVEWHAINWQHVNQTVRRLQSRIVKATQAGRY
FT                   GKVKALQRLLTHSFSGKALAVRRVTENQGKRTPGVDQVIWDTPEKKATAIRSLRRRGYQ
FT                   PRPLRRIYIPKKHGKRRPLGIPTMHDRAMQALHLLALAPIAETTADPNSYGFRSERAPA
FT                   DAIGQCFVALAKRKAPTWILEGDIRSCFDRISHDWLLAHVPMDKAILQKWLKAGYMEGT
FT                   TLYPTEHGTPQGGIISPVLANLALDGLERILLEHCPRRTVRGIAAKVNLVRYADDFIIT
FT                   GRSRELLEQTVKPLVEAFLKERGLELAPEKTRITTIEEGFDFLGQNVRKYKGILLIKPS
FT                   TASQRTFLATIRATIKANMALDAEKLIRLLNPIISGWTAYHHHVVSKAVFQSMGHAIYQ
FT                   ALWRWAKRRHANKPKRWIKEKYFRPVNGNQWVFSGDSAGRPIRLVAAGYVPIKRHVKIR
FT                   AAANPYDPAWEMYFETRLGVKIASTLKGRRQLLHLWKRQNGICPCCQEPITMLTGWHNH
FT                   HVIRRIDGGTDTAENRMLVHPTCHTQIHSQRLTEVKPCLERGK"
FT   gene            168061..170391
FT                   /locus_tag="Haur_0136"
FT   CDS_pept        168061..170391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0136"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ani:AN9426.2
FT                   hypothetical protein Pfam: PNP_UDP_1 NB-ARC NACHT DegS
FT                   Laminin_I TPR_1 TPR_2 TPR_4 TPR_3"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02788"
FT                   /db_xref="GOA:A9B5G3"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G3"
FT                   /protein_id="ABX02788.1"
FT                   /translation="MRGNSHVRFLGGGSVVIRSCYPTDHLPERSQLPPHSVMPYQPLSD
FT                   FVGREAQLYQLAQAMLRSDPTLITPTALATGMGGIGKSSLALEFAHRYGSYFAGGVFWL
FT                   YAATNETLQASLDRCWDSLKPDEWRYEVKPETRLRVVRELFNQPIPRLLIFDNCEDPAL
FT                   LTAYRPQASSGCQLLVTSRRSQWQGTNLITLDTLPPLESRQLLQQLAAQPNINNYLSDT
FT                   DADQLAELVGHLPLALHLVGSSLKFYFRKPAAEYIAALQNQRIASLQAMVKPTSKLHQN
FT                   TINNFWSVRDTVEVSYGLLPAELGQACRRLLLMMAYCAPNVVIPWELLQAASGYDDDSL
FT                   TEYLWELTQAGFFNDPTQPRLHPLMADVIIDLDAANEPENYRSLEQALIMLSNRYHDQW
FT                   AMREIEMLLPHLEYSDRQASQHPDYAGELGYQAGLCLYRQGKYVDAEHIYREVLSTQNQ
FT                   LFETENPIILNTKHALADVLGDQGLLQEAEQLFNEVYRLRKKVLGQYHPHTLKSKKEYA
FT                   TAMFLRGNYADAEQILREILTIQEQSLGKEHWDSLLTKHNLASIRSKQGYYALAERMYR
FT                   EILKDQEQIFGVNHPDTLATKRQIANNVGYQGRYAETERIYREVLPIYELILGLNHPYT
FT                   LTTKHGIAWALNGQGLYKQAEYMYREVLLICEQTLRINHPEIITTKHNIAWILSKQQHY
FT                   LEAEVIYREVLEIREQSLGTNHPDSLSTKYNLAATLYHQSCYREAELLFDQVLSIREKV
FT                   LGTQHASTQATQEWLELVRSKLC"
FT   gene            complement(170476..171135)
FT                   /locus_tag="Haur_0137"
FT   CDS_pept        complement(170476..171135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02789"
FT                   /db_xref="GOA:A9B5G4"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G4"
FT                   /protein_id="ABX02789.1"
FT                   /translation="MHSTQKWGGIAALINGFAYIIGIGIVFTLLAPFLEASQAEKISFL
FT                   IEHQNLMALWYLIIYLVAGVWMVPLAIALHHRLQQAHPLLIQVTTAMGIIWATTILSSG
FT                   MLLVNNIKIIADLQQQNPEQTLAVSTAISAVASGLGGAIELPGGVWVSLISIAALQTKR
FT                   LPKALNYLGLLIGASGIAMTVPAIAAVGTLFGIGMIGWFLWVGVVLVRTKNIEHRT"
FT   gene            complement(171488..171760)
FT                   /locus_tag="Haur_0138"
FT   CDS_pept        complement(171488..171760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02790"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G5"
FT                   /protein_id="ABX02790.1"
FT                   /translation="MSQLSLDTSAKAEEIQINILRSMSIIEKLRLVEQLNQTRDRLAFY
FT                   GLRKRFPHASNRELQRRFFDIKLDYELANKVYGSIEQWCNDEIIE"
FT   gene            complement(171868..173226)
FT                   /locus_tag="Haur_0139"
FT   CDS_pept        complement(171868..173226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0139"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   rrs:RoseRS_1738 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02791"
FT                   /db_xref="GOA:A9B5G6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G6"
FT                   /protein_id="ABX02791.1"
FT                   /translation="MSPINLFKEFPVTDLLTTIPGPRATALVDRDTAVMAPCSGRVYPF
FT                   VMDRGLGCEVWDVDGNRYLDLNAGIAVVSTGHSHPRLVQALQDQVSKFIHMAGTDFYNE
FT                   PMVKAAEKITSLMPGSGEWQVFFANSGTESVEAAIKLARYYTKRQNVIGFYSSFHGRSY
FT                   GSLSITASKPYQRKGFFPLMPGVFHAFYPNPYRTPWGVEPERVAEICLDFIEKTLFTTT
FT                   TPADDVAAIIAEPIQGEGGYVVPAPGFWQGLRDLCDRHGILLIADEVQSGVGRTGKMWA
FT                   VEYEGIVPDIITSAKGIGSGVPVGAMVARKEISSVWKPGAHGNTYGGNALAMRAVYETL
FT                   CLAEEELMANANEVGGYFKQRLHELEDRYECIGDVRGRGLMIGMEFIKDNVNKDPHGDL
FT                   SNAVMEESFRRGMLLLTCGKSTIRFCPPLVLTKDQVDEGINLLNDTLQALGAK"
FT   gene            173699..174223
FT                   /locus_tag="Haur_0140"
FT   CDS_pept        173699..174223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0140"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: rca:Rcas_4318
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02792"
FT                   /db_xref="GOA:A9B5G7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5G7"
FT                   /protein_id="ABX02792.1"
FT                   /translation="MPTQAKVATVAELTDRLNRAQMLLVADYRGLTVAELNELRKKVRE
FT                   KGGEVIIAKNTLTRLAAREAGKTEIEEFLGGPTALAFSYDDIPGVAKAIDDFFKASKKD
FT                   IKVKGGIVGTSKITGADVERVAKMPTRDESLAKILGGINAPASRIVGGLKGVMRNIAYI
FT                   LGAHAQKGAEG"
FT   gene            174309..174701
FT                   /locus_tag="Haur_0141"
FT   CDS_pept        174309..174701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0141"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: cyb:CYB_1224 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02793"
FT                   /db_xref="GOA:A9B5G8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5G8"
FT                   /protein_id="ABX02793.1"
FT                   /translation="MASEKVTALLEELKGLTLVEAAELAKEMEEVFGVSAAAPVMVAGV
FT                   AAAGDAPAAAAEEQTEFTVILKGAPADKKIAIIKAVREVVAGLGLKEAKDLVEGAPKPV
FT                   KEGVSKEEAEAAKAALAAAGAEIEIK"
FT   gene            174842..175339
FT                   /locus_tag="Haur_0142"
FT   CDS_pept        174842..175339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02794"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5G9"
FT                   /protein_id="ABX02794.1"
FT                   /translation="MLVVVQLIKTRWTVPLGQRPPQLCQGTPERLSVMPLPPNGFVQGA
FT                   VLHHAEFDETNAYTRPTRANLRTYSDLRHLYHNGLGLRLNTIPQLEVLLRLPEQTISTS
FT                   LMQLAIGEWGQLSYKTRFGLEREATYTKYVFNITYRAYLDPFVFMRGSPQHTIHLPLEQ
FT                   TP"
FT   gene            175336..176115
FT                   /locus_tag="Haur_0143"
FT   CDS_pept        175336..176115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0143"
FT                   /product="PfkB domain protein"
FT                   /note="KEGG: rrs:RoseRS_3963 PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02795"
FT                   /db_xref="GOA:A9B5H0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H0"
FT                   /protein_id="ABX02795.1"
FT                   /translation="MSLKYLLIGALTRDRTATGWQQGGTGTFAARALAAWGVATTIITP
FT                   AHAKLIFDLPSTSTLVRLPSRATATFENRYQGDARTQWLHAAPTQLDWANLAPYWQQAS
FT                   LVHLAPLAQELTTIPPRKLFPQALIGLTAQGWLRHWDSSGRIQPKRWQPTPTELAQIDA
FT                   LVVSDEDVAGDVQLVADWAQHCGLVAMTQGSRGATIWVNAEVQHVAAYPAQVSDPTGAG
FT                   DVWAAAWFWRIQQGSSALQAADWACQQAALQISGQLI"
FT   gene            complement(176419..176799)
FT                   /locus_tag="Haur_0144"
FT   CDS_pept        complement(176419..176799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0144"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: rrs:RoseRS_2960 putative
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02796"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H1"
FT                   /protein_id="ABX02796.1"
FT                   /translation="MTREVISTPNAPAAIGPYSQAIAIDGLLFCSGQIPLDPATGQVIE
FT                   GDVTAQTRRVMENIRAVLTAANTSFEKVVKTTIFLADMNDFAAVNAVYGEYFPENPPAR
FT                   STVQVARLPRDVQVEVEVIVLR"
FT   gene            complement(176821..177195)
FT                   /locus_tag="Haur_0145"
FT   CDS_pept        complement(176821..177195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0145"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   rrs:RoseRS_1723 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02797"
FT                   /db_xref="GOA:A9B5H2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5H2"
FT                   /protein_id="ABX02797.1"
FT                   /translation="MADDRKALGRWGEQYAAEYLQQLGYQLIASGWHCRWGEIDLIAYD
FT                   QATLVIIEVRTRRGTAHGSAAESLTLKKRQRLARLLQAYLQALDAAQTPWLGDYRIDAI
FT                   AITLSRGQPQLEHFQAISIE"
FT   gene            complement(177260..178546)
FT                   /locus_tag="Haur_0146"
FT   CDS_pept        complement(177260..178546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0146"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: rrs:RoseRS_4532 phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02798"
FT                   /db_xref="GOA:A9B5H3"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H3"
FT                   /protein_id="ABX02798.1"
FT                   /translation="MALITHVRGREVLDSRGNPTVEVEIGLEDGTLARAIVPSGASTGA
FT                   HEAVELRDGDKSRYGGKGVLKAVKHVNEDIAEAIEGLEALDQITLDKTLIELDGTKNKG
FT                   KLGANAILGVSLATAKAGALSVGLPLYRYLGGVFGHTLPVPMMNILNGGKHAQDSTDFQ
FT                   EFMVMPVGAPSFREALRWGAEIYHTLKNVLHDRGLATNTGDEGGFAPSLPSNEAALEVI
FT                   VEAIQKAGYTPGKDVMLALDPACSEIYENGIYNLAREGRKLSSEEMVGYWENLVNKYPI
FT                   ISIEDGLHEDDWGAWSSLRQRIGDRVQLVGDDLLVTNVERLNRAIKENSANSILIKLNQ
FT                   IGTLTETLDAIQMAQRAGWTAIVSHRSGESEDVTVADLVVATNAGQIKTGAPARTDRVA
FT                   KYNQLLRIEEELDSQAKFAGWSAFAVKRG"
FT   gene            complement(178868..179554)
FT                   /locus_tag="Haur_0147"
FT   CDS_pept        complement(178868..179554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0147"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   rca:Rcas_3361 acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02799"
FT                   /db_xref="GOA:A9B5H4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H4"
FT                   /protein_id="ABX02799.1"
FT                   /translation="MTHVIKISGYEVDHADSLQTLISALSSIDDQVVLIHGGGSILPRV
FT                   LNAIGGTNHPAAAEIAAMALRGGINPRLVAALTQHHLQAIGLCGSDLELMYLLPKSDEP
FT                   IVRFEVLHYLLEQAWLPVLAPLAMESATGAVKLLNADTAAQMIASALAADQLTYIVQTP
FT                   GVYASGRRISGISGRQCERYIKQGAFDATYTSVVKAASLAAPHVGRVRITDLNGFLDGV
FT                   ETVVVA"
FT   gene            complement(179641..180549)
FT                   /locus_tag="Haur_0148"
FT   CDS_pept        complement(179641..180549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0148"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sma:SAV1511 sugar
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02800"
FT                   /db_xref="GOA:A9B5H5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H5"
FT                   /protein_id="ABX02800.1"
FT                   /translation="MEQSIVVFGDLNLDTSVSIGQFPLHEGDTLFSFDGISDAIGGAAA
FT                   NVAVGLTALGHQVHFGSVVGQDRMAELVQQLAQAKGLATNSIRPDWPTTSRTVVLIDAA
FT                   GNRQCINDPKAVHRYRYPEAALPTLFEQSQWVYCSTQNWCRYVAQAARDAGSTVIVDVQ
FT                   ALVDIDEYHRDFLQAASIIILSTEQLAMHSHEFMRRLWQQFEIDIVVATHGNHGATLGV
FT                   RATNTIEYQPAFELGSVVDKTGAGDAFCAGFIAGLASDLTPRQALSFGQYVAASKIAIK
FT                   GSTNGFPERTHVLQALAQLPT"
FT   gene            complement(180591..181106)
FT                   /locus_tag="Haur_0149"
FT   CDS_pept        complement(180591..181106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0149"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sco:SCO4373 mut-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02801"
FT                   /db_xref="GOA:A9B5H6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H6"
FT                   /protein_id="ABX02801.1"
FT                   /translation="MELPSFIFPLLKRFRLPPRLHWLAANLINPHFLLGVAGIITDEQG
FT                   RLLLFHHTYRRSHPWGMPGGWMSKGESPLETLEREVHEESGLHVRAERLALIGVTRDRP
FT                   KFEFVVCGKLVGGTFQASREVDQMGWFAPDQYPALAPFHQHILQQWRDQPNHEVGWYEA
FT                   PWIIAHPR"
FT   gene            complement(181135..181806)
FT                   /locus_tag="Haur_0150"
FT   CDS_pept        complement(181135..181806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0150"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   bfr:BF0634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02802"
FT                   /db_xref="GOA:A9B5H7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H7"
FT                   /protein_id="ABX02802.1"
FT                   /translation="MAMIKKEIKPVTGNFLNNFWGIGAKHALYHKDGNWYHQLKKFPGV
FT                   LFDAHGYILFETDDEFFNSPSLRIRKDVRVPQGIASIKEYIKLSKNLPIETISRIKVNN
FT                   KPAGNRLTRRTINTIDRIQRDTKVSSWVKYIYNYACQICGIRLQIGQDKFYAECHHIRP
FT                   LGGVHQGEDIVENVLCVCPNHHALLDYGAIRIDFSTLHSHPNHLIDPESVDYHNNNLSN
FT                   T"
FT   gene            182016..182660
FT                   /locus_tag="Haur_0151"
FT   CDS_pept        182016..182660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0151"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: rca:Rcas_1071 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: LexA
FT                   DNA-binding domain protein; peptidase S24 and S26 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02803"
FT                   /db_xref="GOA:A9B5H8"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5H8"
FT                   /protein_id="ABX02803.1"
FT                   /translation="MSGLSQRQQRIYDYIKQFIRTNGYAPAIRDIQRELSISSTSVVAY
FT                   NLRALESKGHIRREGNISRAIELINAEQPLPTVLGGQRVPVLGVIAAGQPIPVPNDSAN
FT                   SDDSVLVPEEIVGNDKLGDVYALRVKGYSMVDALIADGDIVLLRYQATAENGEMVAARI
FT                   RDENEVTLKRIYWEGDRVRLQPANVTMEAMYYPSTNVEVQGRVVGVIRNLG"
FT   gene            complement(182697..182993)
FT                   /locus_tag="Haur_0152"
FT   CDS_pept        complement(182697..182993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02804"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5H9"
FT                   /protein_id="ABX02804.1"
FT                   /translation="MVKQKILSTFSNITKVRAQVEAYRQKFQDLRPWWPVLIPFLLWRG
FT                   KRAYDQEMKNVGIKLGEAALQKAQEQHKLQEQQAKLIETQEKINQRSNKKGRK"
FT   gene            complement(183085..184431)
FT                   /locus_tag="Haur_0153"
FT   CDS_pept        complement(183085..184431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0153"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: ppd:Ppro_2145 molecular chaperone-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02805"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I0"
FT                   /protein_id="ABX02805.1"
FT                   /translation="MRVGLDFGTTNTTAAIYDGANVSLVPLDSVAANPNVLRTALFITP
FT                   EGQQRIGRAAINAFTEGNVGREIVYERRYLGTVTNTYAGVGTITQAVEGLVDSNPPGRL
FT                   FQSIKTMLRDPSYIKTNVFGQETTLEELIAKILRAIRREIERFTGEKISAITVGRPVHY
FT                   ASTAEGDALAIRRMREACELADLPNVSFMPEPVAAAHAFAASQRERRNIIVFDFGGGTL
FT                   DVTVMAIDGAKRQVLATDGVPIGGDVLDSKIVTGALRQYFGDGARLGPRKLPLPAALME
FT                   HLDNWQNILEMHTPKMLDIIEESVRTSDKPKELKALRSLVRENYGLVLYEHAEEAKRRL
FT                   SSERQVEISMHVKDIDFDHLLPRFEFERLVGPEARAIGDCVDRTVRAAGLSHEQIDVVL
FT                   RTGGSSRIPRFIKLLADRFTEDRLREQDPFTSVGAGLAVAAYEGLGEAN"
FT   gene            184887..185924
FT                   /locus_tag="Haur_0154"
FT   CDS_pept        184887..185924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0154"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rrs:RoseRS_3190 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02806"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I1"
FT                   /protein_id="ABX02806.1"
FT                   /translation="MSLALISHDHYLDHDQPEHPENANRLRAIHAMLAADYELQQHLTP
FT                   LAPRHATAAEIEAVHVPSHLPTLQRMAQFGDWADAETYILPDSVEIAQLAAGGAIVATD
FT                   AVLSGRHANSFALVRPPGHHATADQAMGFCLFNNAAIAAAFAQREYGLKRVAILDWDVH
FT                   HGNGTQDIFYQNPDVLYISTHGWPLWPNSGHWKEMGANAGLGTTLNLPLRPLTGDMGFH
FT                   LVFEQAIAPAIRRFKPELLIISAGYDAHIYDPLGNLALSTGGYAQLSSIVYNLAAECCD
FT                   GRLVGLLEGGYNLEALAQSLTATLQTWVSGQPAPIFNQEVSHTPEPDVTWLIEHLRREH
FT                   PLLKG"
FT   gene            186333..186965
FT                   /locus_tag="Haur_0155"
FT   CDS_pept        186333..186965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0155"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: rrs:RoseRS_3191 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02807"
FT                   /db_xref="GOA:A9B5I2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5I2"
FT                   /protein_id="ABX02807.1"
FT                   /translation="MIAVINYGAGNLPNAVRALEYVQAPIEVVTDPAAVRAAQAVVLPG
FT                   VGATADTMRSLREMGMDSAIREVIARGTPFLGICVGMQVLAEQSEEFGLHECLGLVPGT
FT                   IRRFDQGLKVPQIGWNGVQHDGSALWDGIPNGAEFYFVHSYYLATDDVALVTGRTEYGL
FT                   NFPAAIARDNITAVQFHPEKSGQWGLKLLGNWVELALSRGSGVGDRA"
FT   gene            187107..187829
FT                   /locus_tag="Haur_0156"
FT   CDS_pept        187107..187829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0156"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: rca:Rcas_2920
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02808"
FT                   /db_xref="GOA:A9B5I3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5I3"
FT                   /protein_id="ABX02808.1"
FT                   /translation="MQLIPAIDLRDGRCVRLVQGDFEQTTVYGDDPVAVAQQWEAAGAA
FT                   RIHIVDLDGAKAGRPTQTSTIAAITKAVSVPVQLGGGLRDAASIAAAFELGVSDVILGT
FT                   VAVRNPELVAELVRQYGKAITIGIDARNGVVATEGWLASSRQRATELAEQMGQLGVARI
FT                   IYTDISRDGTLSEPNYAQTAALVTPNGPAIIASGGIARVEHLARLAELGISGAIIGTAL
FT                   YTGHIDLASAIQTIEHGG"
FT   gene            187832..188929
FT                   /locus_tag="Haur_0157"
FT   CDS_pept        187832..188929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02809"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I4"
FT                   /protein_id="ABX02809.1"
FT                   /translation="MSSSKQDITARYEEERLRAQEQSQLLYLQNQIDELRRQIKDVNGK
FT                   YAWSTEQSRKSEAVVAQLQGMIERQAQEQAQTLESYRRELTTLRKEIANSTVRMDDSVK
FT                   PIRDIQLSLAQQQEHRKQDLQTSQSWFARIELMEQRMSDFEARMREQTEHYRSLGGQIE
FT                   HLRAADAETVQDMRKLSEDVQIEKQQMRRQAVETQQMVIDIGEGIRELRSRFERLEDLQ
FT                   KGLEAQIEPLPEQIEVVRAQLPDMIAEIKRIERVSTERFLMNQERLEELRGQHNEQLDE
FT                   LRSADETHLRQIMGSLERIDTWCHEYESKLSRTQNRLEDAQISNLSRMQDFERREVQAL
FT                   SDMLAAIQGRLQIAQSEILERGSEI"
FT   gene            188932..189723
FT                   /locus_tag="Haur_0158"
FT   CDS_pept        188932..189723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0158"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: rca:Rcas_2922 imidazoleglycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02810"
FT                   /db_xref="GOA:A9B5I5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B5I5"
FT                   /protein_id="ABX02810.1"
FT                   /translation="MLTRRIIPCLDVKAGRVVKGISFLNHRDAGDPVQLAAFYNESGAD
FT                   ELVFYDITASSDERNIMVEVVENVARQVFIPLTVGGGIRTVDDMYRMLRAGADKVSINT
FT                   AAVLNPQLIEDGAKRFGSQCIVLSMDARRINEPGQPSQWNVFTHTGRDPRPTGLDAIEW
FT                   AKRVVDLGAGELVINSMDADGTGAGYDNELLSAISQQVGVPVIASGGAGKPEHLLAALH
FT                   EGKADAVLAASIFHFGTYTVEAVKEYLANQGIPMRRTPRPV"
FT   gene            189720..189959
FT                   /locus_tag="Haur_0159"
FT   CDS_pept        189720..189959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0159"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: olu:OSTLU_94198
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02811"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I6"
FT                   /protein_id="ABX02811.1"
FT                   /translation="MIISIRLFAGLREALNQSSLNLDVAETATVGTALAQLAELHPKLP
FT                   LTGLAYAINRQYVTLEATLQPNDELALIPPVSGG"
FT   gene            189961..190377
FT                   /locus_tag="Haur_0160"
FT   CDS_pept        189961..190377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0160"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   rca:Rcas_2923 molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02812"
FT                   /db_xref="GOA:A9B5I7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I7"
FT                   /protein_id="ABX02812.1"
FT                   /translation="MQAFLVTEAVLQPEPLRQLVSDPGHGAIVLFEGVARNNFGGRATA
FT                   YLEYEAYPEMAEQQLVLLARQAQVQFGIGKVAIHHRVGVLQIGETAVLIAIGSAHRGAA
FT                   FAAVAWLMDQIKVVVPIWKCEHWTDGSQEWVGQR"
FT   gene            190394..195169
FT                   /locus_tag="Haur_0161"
FT   CDS_pept        190394..195169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3939 alpha-2-macroglobulin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02813"
FT                   /db_xref="GOA:A9B5I8"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I8"
FT                   /protein_id="ABX02813.1"
FT                   /translation="MRLLEKLARWWWRWLLTTISLLGTALLGVIVASIAGWVPQPSVLR
FT                   LTPLAGSRELPPATALEFNFNLPMDRSSVEDALVITPPVRGRWHWEGRARARWQPEFGW
FT                   TPGTTVTVQLRPTAQSMLRQTLATTVTTQFTAAPAPLLVFRSPLPNAIIAPNTPILLRF
FT                   NRAMIDYASQTERGLAELSIEPNAASQVRWLDDRSVLVQAQWQIGQHYQLKLQDLNDLL
FT                   GIPVQTTEWQVQVSEPNLIAPPTTQTLQADQALEWAFEGLLDQTTTQQLIKRIQFTPAV
FT                   STTWQVQYQPDPQPQTIIQALPEAAWPAQTLTTSLQLSQPITQVWQIQPNLQLIGSVPG
FT                   RGGSLAVDDPLRLLFNQTPERQQLVEQLFIEPEVANVAININNQQALISAAWQPSTVYT
FT                   LTLAGSAPLTFRTQTQAQPLQIEGAAYSLLLPETTAELRLSGRENSRLTANLYAVDRAV
FT                   LAAALQQPQTPLNPQRYNLQPQQQWQIAAGPERTISITPTQAALLLQVQAPNAELVQHV
FT                   LIWTPYRAQLLATPEQAQAWIVDLVNRQPVAAANLSILAGANQLATGQSDSQGLWQSSI
FT                   QGSSGRLVLLGGEPQAPIVAETIIRPQRQAPSLSSQLLLDRQSYLANQQLTIIGSSEFA
FT                   ADGMTTPTLTLAVLDPSGQAIAPEQTLVLSQSLWITKVQLAADVQPGLYEVRLRYANQV
FT                   IASQNFVVNQPDLAYRVVLPELQATNAIVSAEIISDLPSQHGLWRLLDQRNRQVNAGSW
FT                   HSNAAGIAQFDYQQSQTLLGDYVLEIQLGEQVSYHPSQIHYPAQLAAKAEQQLLNPNQP
FT                   ATINFQLRDQQGMALSNRALQIEVQGAISSTQSLRTNAAGEVVWRTNGLRAGLWLIRAS
FT                   SPDAASVEVPLWVLGAKSDQLIGRSQSSLVETTELALAPLTNLAATNVLVSWFEGSSIR
FT                   QQIQPWVAGQSIAITPSLSNTQQLEVALAWLDAEQLISSSSQIPFQAVAPLDLTMVVSG
FT                   SQLVLATQRAGRPVASMVGLSFQSIQTSASQQRLVRTASNGQAVLDLQGFGEGWRIQAL
FT                   ASDGLNSAEATTLYAANPLIDAQMLLPERLIVGDQLSVTARLNLLATRGGIPSVSLSVD
FT                   SAYLAALAEPTTGNSGRIYTTTQALVAANLGTTTLTATIEVNQQTQIITKALTIQPPSQ
FT                   VRLQQSRLLTEATDITWQVPTANQAASINIVIASLAQASQALPSQLPGDDPLTLAGRIA
FT                   LSRYAAQPAQAEIELLAKQQLTNGSWSWDAQAGDLQLTALIVQLIATEQRSPQLRQLED
FT                   QAARWLALVSPLDPDLRSEMLLALAHSGKTVEAQITSLLKNRQLTTAQRLRLIYALVLL
FT                   DSPQADQYLLEVSQMLAQPLTPSAWMSRTRQAALIGLIFERSQPSSALRAQVLKLIAEG
FT                   WNGTTWEDLPSSVAVFQLTQQDFPTRGDYRLGLNGAALSDYDQASSLMLPITNQLNVQI
FT                   EPNGPILLASQASWQNPATQAYLLHSSSEDQLAYGEQWLWQGYLVLEQDLSLLQLRLAA
FT                   PSGVEWQLGSATGLNWHDGLFSAANVRAGIYPIQLLGVARHKGQFAWPAPQLTSGGQIV
FT                   ELKQTAPPVLIR"
FT   sig_peptide     190394..190501
FT                   /locus_tag="Haur_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.948 at
FT                   residue 36"
FT   gene            195214..196023
FT                   /locus_tag="Haur_0162"
FT   CDS_pept        195214..196023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02814"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5I9"
FT                   /protein_id="ABX02814.1"
FT                   /translation="MRIPEAIQWIEQSGNVLAQAKITHMLEATPADDELLDQLAALQND
FT                   DGGFPLNGVTGRPSTLNDSCNIIRHFVELEASDHPAVAAASRFILDAQSPRGWWRENSN
FT                   LAIYSPPLWMDSESDAALIYTTAVCSASLALLDNPEVNVAADKANTWLLGQIANNGLLP
FT                   GFRVEATGWAMLAAVLLGHRESRPVKRMLGGLGDLLSTDWDAPSLAVMLNAAGIARIPR
FT                   MTRAVTQAINLLRNLQQPSGAWLNENGLPDPLLTAWIVRIVRRFGLR"
FT   gene            196410..197075
FT                   /locus_tag="Haur_0163"
FT   CDS_pept        196410..197075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0163"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: rca:Rcas_0024 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02815"
FT                   /db_xref="GOA:A9B5J0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J0"
FT                   /protein_id="ABX02815.1"
FT                   /translation="MAEPTTEILYRAQRNDPEAMGALIVSQQHYIYNIAMSVMRQPEDA
FT                   ADLTQDACIKLLRVIGQYNGESRFTTWLYRLVINLGRDELRKRGRRAPEMPPMTDDDGE
FT                   TVDPLSSIADDNRWADPQEVATNHELRAEVTQALDKLEDHYRLALTLYYFDDLRYNDIA
FT                   EILEVPLNTVKSYIRRGKERLALLLGANQSEAILPAKREPVTDERPNRGRFAFALGWR"
FT   gene            197084..197620
FT                   /locus_tag="Haur_0164"
FT   CDS_pept        197084..197620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0025 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02816"
FT                   /db_xref="GOA:A9B5J1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J1"
FT                   /protein_id="ABX02816.1"
FT                   /translation="MKRCEHRTNYDLREEALDPQLTDHLAECESCAQRARRAEAFDTVV
FT                   RSAMITSVPDDLTAKLLALVPGLMPPMLVRSKHWKLQRRAFVGLSGFASILALGLLIYG
FT                   VYLLANTVGVGDWLATASTWPGVAIDWLYRHIPSSRSFVAAMIAVRQPLQWMILLLLIW
FT                   QVWERMPLPNNRQTA"
FT   gene            197673..198344
FT                   /locus_tag="Haur_0165"
FT   CDS_pept        197673..198344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0165"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: rca:Rcas_3242 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02817"
FT                   /db_xref="GOA:A9B5J2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J2"
FT                   /protein_id="ABX02817.1"
FT                   /translation="MINRLWNSLLDLVYPPRCYSCGKAGTQFCPACFAECIPLTPPQRP
FT                   QPLAANSPLERALGIYPFQGSLRAAIHAFKYQNAHPLAQILAPLLFDFCAWNDVVLMPV
FT                   PLHGVRKRERGYNQAELLARHLAKAWQLPLSTDLQRVRATEHQVGQQAQARASNVAGAF
FT                   AWRGQQPAPNHVLLIDDVLTTGSTFEACASALIAAGSTAVEGLALAKAVIKPAPPLDSP
FT                   E"
FT   gene            complement(198310..198747)
FT                   /locus_tag="Haur_0166"
FT   CDS_pept        complement(198310..198747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02818"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J3"
FT                   /protein_id="ABX02818.1"
FT                   /translation="MPTTEFCLECGAPLVEGFNCWEQLGALIAWEYNDPALHAQHFLIV
FT                   ASYNLQHPAQFTDMAIEQLRSAFNDYLDHGVSAATLRQRAAKTYAGATRVLRPEAERRP
FT                   QLQQWAMTIADVYLPEQPAGAVERLLRWASVIQANQAVAQA"
FT   gene            198843..199397
FT                   /locus_tag="Haur_0167"
FT   CDS_pept        198843..199397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0167"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_00228 histone acetyltransferase HPA2/related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02819"
FT                   /db_xref="GOA:A9B5J4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J4"
FT                   /protein_id="ABX02819.1"
FT                   /translation="MQREVTTTYLEMLAISELKPSSRDEPAFGFAQVQRISPELNRFLY
FT                   TAVGGQWYWLDRLGWSYQQWLDYLRQPTIQTWLGTYQGIPIGYCELVQEADGSAQIGYF
FT                   GLLPQWYGQGLGGLLLTKVIQQAWQLTSSRVWLHTCTLDGPTALANYQARGFKLYDQKT
FT                   EVVELPSQAAGPWLGAYSNSI"
FT   gene            199418..200158
FT                   /locus_tag="Haur_0168"
FT   CDS_pept        199418..200158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02820"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J5"
FT                   /protein_id="ABX02820.1"
FT                   /translation="MIKPFRWLSVGVVCGILIGCATTVQPTATPEPTTVPTAINNPQEA
FT                   WQQWPTVLTDSFRDNRHKWMVGPLQSGDLTGEFAIGPDLYQMEMDLNEISIFPSLMPEY
FT                   RVDREKGFYVSVEAKSMVKLNSSYGLVFLSQRKNNAKIVIDINEYYFEITGNYYRLLYY
FT                   EQNNWNEIIASTNLPKKSEHGFDRLGVLVQGETVTLLFNDTYLTDIEVDDLFKSGLFGL
FT                   VCGAYQPKVSQICEFDNLEVRMPE"
FT   sig_peptide     199418..199504
FT                   /locus_tag="Haur_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.576 at
FT                   residue 29"
FT   gene            200207..200605
FT                   /locus_tag="Haur_0169"
FT   CDS_pept        200207..200605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0169"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="KEGG: pfl:PFL_3331 ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02821"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J6"
FT                   /protein_id="ABX02821.1"
FT                   /translation="MADHAALMILIAGPYRSGTGDDPAKIAANVHLMESYVLPLFNAGH
FT                   LPVLGEWLALPMVDLAGSKRIGDEIFNAVFHPIAERLVIRCDAVLRVGGPSAGADQMLE
FT                   LAKAHGRQCFERLQDIPNCSELIDPQEY"
FT   gene            200618..201427
FT                   /locus_tag="Haur_0170"
FT   CDS_pept        200618..201427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0170"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mgr:MGG_02101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02822"
FT                   /db_xref="GOA:A9B5J7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B5J7"
FT                   /protein_id="ABX02822.1"
FT                   /translation="MSANSEWPELNAQSNAVWETNAEHWDNSMGQDGNRFHLQLVRPAM
FT                   LSLLELQAAQRVLDIGCGNGLFARHLAELGAMVLAVDASTSLIERAKQYPNPATLEYQV
FT                   VDATNLAQLLALGASSFDALVSTMVLMDLPTIEPLFQAAAKLLKSQGRFVLATVHPCFQ
FT                   TPHNRKIVEQFENAQGEVETHSRLQIGNYLTPTVHQGVGVAGQPSAQFNFHRSLTSLLG
FT                   IAFAAGFVVDGLLEPRYPTGTTSTHPFSWANFSEIPPVLVLRLRLAN"
FT   gene            201502..201822
FT                   /locus_tag="Haur_0171"
FT   CDS_pept        201502..201822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02823"
FT                   /db_xref="GOA:A9B6C0"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C0"
FT                   /protein_id="ABX02823.1"
FT                   /translation="MMMNIEDFFEFRADGAIRIRGHRIDLAHILPYYHDGYSPEMIGLE
FT                   FPSLPLTTIYAAILYYLSNQVRVDAYMETYFASAQAAITAHEAQATSPVSQRLVMRRNQ
FT                   AA"
FT   gene            complement(201896..202597)
FT                   /locus_tag="Haur_0172"
FT   CDS_pept        complement(201896..202597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0172"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dre:692295 zgc:136363 Pfam: Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02824"
FT                   /db_xref="GOA:A9B6C1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C1"
FT                   /protein_id="ABX02824.1"
FT                   /translation="MLRFPVVCFDVGFTLLDERVDAHDLIGEVLQELGLQVEPNLIRDA
FT                   RKATNRWYHQRYHSLDNNDWSSDATIRTLWLEFYQHLFDQIDPSLDHARLGDRLIAHYE
FT                   QPENWVPFNDVRETLDSLHAKGIRIGIVSDWASSLRPILTYNKLLPYFDFAVISADAGY
FT                   AKPMTDLYQLAIKRSGVAADQIIHIGDSYYADVLGARAVGMQAALIDRHKRIPKADCPI
FT                   LHDLRDLLPLV"
FT   gene            complement(202673..202906)
FT                   /locus_tag="Haur_0173"
FT   CDS_pept        complement(202673..202906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0173"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: rca:Rcas_0253 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02825"
FT                   /db_xref="GOA:A9B6C2"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C2"
FT                   /protein_id="ABX02825.1"
FT                   /translation="MAYVIAEPCVGTKDSACVKVCPVDCIYEGEDQYYINPDECIDCGA
FT                   CEPECPVSAIFSSDSVPEQWASYTQKNVDFFG"
FT   gene            203292..204662
FT                   /locus_tag="Haur_0174"
FT   CDS_pept        203292..204662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0174"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; cyclic
FT                   nucleotide-binding; KEGG: rrs:RoseRS_1786 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02826"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C3"
FT                   /protein_id="ABX02826.1"
FT                   /translation="MSTYVIDGQELHIRDNRRNAPVALLIHGWSSSWFTWTPLLQALGT
FT                   RYSYMAVDLPGYGRSPAPKHPITIDWYADLMAKLIEEASDRPVVVLGHSMGGQIAMTLA
FT                   LRHPMLVERLILLNPVVSGRLSTFINLFVAPHILLERTRLGGKILSYLENTPLSYINQL
FT                   MKPILFAERAAISQQDYDRIRADARRPGQGRVRAACYEAMKMGDLRGKLKQIQPPAQVI
FT                   WGAEDNTVPLRDAGAVADEWPQADLRLIPNAGHWPHFEQYETTMRYIASFLGLPILPSL
FT                   PNDQVQQQRDLDVGEIAQFLSNTELGQDLSESQRLRVAGLCHQHHFAPQDVLALEDSSG
FT                   DELFIVQDGQVDVLVRISNELGIEESRRVNVLMAGQIAGEMALIQGKGGRRTADLRAGK
FT                   SGATVLSIDSRYLFALFEDDASLGLKLMQNLARSLVQRLRVQNWQLQLAEQRAEVHR"
FT   gene            204764..206662
FT                   /locus_tag="Haur_0175"
FT   CDS_pept        204764..206662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02827"
FT                   /db_xref="GOA:A9B6C4"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C4"
FT                   /protein_id="ABX02827.1"
FT                   /translation="MNRQRMIGLGGLLGLALLILILPNSRFWFAALVCALAPGYVLERW
FT                   LDLDLAPLVRPSLWIGLSLAVWPLGYLWLTTLGLSLSTGMITLIAFGLLAGVGWRLWRE
FT                   GERPWALPAPVPILGLALLIVTFAISTRISHIRNVAFPPWVDSLHHATIMRVIAESGQV
FT                   PYSLRPYMPVDNFGYHWGFHATAATIYNLSGMSIPQFMLWYGQFLGVLVVISVGSATIG
FT                   LTKSPIAGLAAATMTGFISIMPAYYLSWGRYTLLSGLAMVPVVLLLAWVALDRPDRKGL
FT                   ILLTLVVGGLLPTHFVAAGFALLWCVAVWLGRDVWTEQRWQILGKQAASVGMAILLMSP
FT                   WLALLIREIQPAGSGTPKQLIGGGYNTYEAAKGLYWTWNNLLLFLVGLLAAWIGLFQHW
FT                   RLVLISFLWASLVMLFANPVVIGLPYLSFFNNNIVALAIFLPISLWFGFGVASLDQGLS
FT                   KHLKQGVARGWRAIRTAILAITVLISATKMHSVINDGTIIAKADDLTALNWIVQRIPKN
FT                   ARFAINTEGWLYNVARGSDGGWWILPYAGLQVSTPPVVYNQGTAEYIAAVEAETSWLRN
FT                   ANEKSAAELAQWMREHNYDYAYATTNGKIFNQAKLANTAEFELVYENASVAIYLRR"
FT   sig_peptide     204764..204871
FT                   /locus_tag="Haur_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.658 at
FT                   residue 36"
FT   gene            complement(206700..206987)
FT                   /locus_tag="Haur_0176"
FT   CDS_pept        complement(206700..206987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02828"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C5"
FT                   /protein_id="ABX02828.1"
FT                   /translation="MHMRLPAAHTQLLRQLKDERSKLQDLVWELDDLEHAVADLEQHVC
FT                   DTPDPSKHQELEQLRQRHDHIEDAVLYQMMYIDRLQERYDLLPYSAIPAA"
FT   gene            complement(207253..207987)
FT                   /locus_tag="Haur_0177"
FT   CDS_pept        complement(207253..207987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0177"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: rrs:RoseRS_2015 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02829"
FT                   /db_xref="GOA:A9B6C6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C6"
FT                   /protein_id="ABX02829.1"
FT                   /translation="MTVQQLETTVAPRHVAIIMDGNGRWAQGRGLPRLAGHHAGTGNIK
FT                   RIVREAISLGIPYLTIYAFSTENWKRPSWEVRGLMRIMAEYLDRELRELHAEGVRLHLL
FT                   GTLEGVDSALAKKIQNAITMTANNTALTLSVAFNYGGRADIVNAVREIVAKGINPEDIS
FT                   DEMIAGHLYTSGIPDPDLIVRTSGEQRLSNFLIWQAAYSEYYMTPLLWPDFGPDQFREA
FT                   VSNFGNRERRYGGRIGEGEMAK"
FT   gene            208131..208724
FT                   /locus_tag="Haur_0178"
FT   CDS_pept        208131..208724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0178"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rrs:RoseRS_1054 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02830"
FT                   /db_xref="GOA:A9B6C7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C7"
FT                   /protein_id="ABX02830.1"
FT                   /translation="MLLKGLILGFSIAAPVGPIGVLCIRRSLIHGRLAGFLSGLGAATA
FT                   DGLYGMLAAFGLAAALNKLDQDSGWLLGLRIISGLFLGYLAIKTMLSRPATEAAHAKAD
FT                   NLWAMYASTLFLTLTNPLTILSFATVFAGLGITAYGWDSVWLVLGVTTGSALWWLLLSG
FT                   SVSLLRERVQAYSVWINRISGLIILGFAIAVLLG"
FT   gene            complement(208779..209441)
FT                   /locus_tag="Haur_0179"
FT   CDS_pept        complement(208779..209441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0179"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: rca:Rcas_0896
FT                   phage shock protein A, PspA"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02831"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C8"
FT                   /protein_id="ABX02831.1"
FT                   /translation="MSLLSRVRDLVSANLNAMLDKAEDPEKMVNEYMRQLQEQLYEAKT
FT                   AVASAMADETKLHNKMVTFQTEADQWQSKAEAAVRASDDELAKAALGRKANAQKMADTY
FT                   RQQYEQQDEQVEQLQKALVSLESRLSEAKAKKELIIAKKNRAETQEAIQRTVQGLGNLN
FT                   AMDKLSQMEERVDDRLAQADAMSKLEGSSLETRFADLERDTAVEDELAALKAKMGKQ"
FT   gene            complement(209540..210250)
FT                   /locus_tag="Haur_0180"
FT   CDS_pept        complement(209540..210250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0180"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: rrs:RoseRS_2216
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02832"
FT                   /db_xref="GOA:A9B6C9"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6C9"
FT                   /protein_id="ABX02832.1"
FT                   /translation="MIDRELLQTTLAEWQLTLSTSQIDRLEHYVALLTQWSERMNLVAP
FT                   STLPEATRRHLLDSFSLATTCEQAPASLADIGSGAGLPGIPLAILWPETEVLLIESISK
FT                   KAEFLRHVAQELQLERVLVEVERAEVVGRERRWREHFALVTARAVANLATLAEYCLPLC
FT                   QVGGMWLAPKGFEIEPEVQDAEQAITILGGQLRAVYNVTIPAEPVRSLVVVDKVASTPL
FT                   TYPRTVGTPSKKPL"
FT   gene            complement(210247..211146)
FT                   /locus_tag="Haur_0181"
FT   CDS_pept        complement(210247..211146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2749 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02833"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D0"
FT                   /protein_id="ABX02833.1"
FT                   /translation="MTIDDELAKGIAAVRAGQRELARQHLQKVLLTDSKNESAWLWLSG
FT                   VVETRTQKRDCLQLVLSINPNNTAARRGLEELAQSEAADFLSTFEPPAPPPAPPPAPPP
FT                   APPPVAPTPTPAAPISSMASFEEPPAAMFEPVPIELDQPMAGFGFAPMVTEVTPEPAPV
FT                   LGNMPTNVPKPPQNLEAPCAFCGTPTQSTGECSNCGTEQTFDCPNCGHVLDVRENWICE
FT                   CGHSFENFLTPERKLDRERLGQMYSDRDFPAAAVKQWKAALPTSRRPQQLHAAIGRVYD
FT                   NLGLYEQAEMHYRLSKQK"
FT   gene            complement(211248..211928)
FT                   /locus_tag="Haur_0182"
FT   CDS_pept        complement(211248..211928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1834 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02834"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D1"
FT                   /protein_id="ABX02834.1"
FT                   /translation="MSSVHETHLLAEGITAAKAGQRAAARDFLTQVIALNARNELAWLW
FT                   MSAIVDTPEQRRDCLVRVLLINPSNEAAQRGIAALEVQNKPAPSMPEPTPIVAIAAASS
FT                   NLIQCPFCQANTDSSKLDCQVCGENIILTCPSCDSTINLWETTRCPCGEGLRHYIFFPD
FT                   GIDHEGLGQRYALMERWEPAARQWDRALKDGSHVVMLHRKLAQAYDKIGRNQEAEFHRQ
FT                   VAQS"
FT   gene            complement(211951..212871)
FT                   /locus_tag="Haur_0183"
FT   CDS_pept        complement(211951..212871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0183"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: syf:Synpcc7942_0542 lipoic acid synthetase;
FT                   TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02835"
FT                   /db_xref="GOA:A9B6D2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D2"
FT                   /protein_id="ABX02835.1"
FT                   /translation="MPSTPHRQRKPEWLRKPVLSPELRNVRQLLRDLNLNTVCEEASCP
FT                   NIAECFGHGTATFMIGGDRCTRRCHYCDVTTGKPFPLDPREPSNVAEAAARLGLKYVVV
FT                   TAVARDDVKDGGARHFARTISAIRQRLPEAEVEVLIPDFKGEAEALKTVLDAEPHVLNH
FT                   NIETVRSVFKSVRPQGDYDRSLELLARSREFAPQITTKSGFMVGLGETTDEIYQTMDDL
FT                   KHVGVELVTIGQYLQPSLNHVAVSEYIPPERYGLYRDHGQQLGFRATFAGPFIRSSFHA
FT                   GELQHHQPSSDVASPVQEWIALEPR"
FT   gene            213199..214629
FT                   /locus_tag="Haur_0184"
FT   CDS_pept        213199..214629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0184"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: rca:Rcas_2017 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02836"
FT                   /db_xref="GOA:A9B6D3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D3"
FT                   /protein_id="ABX02836.1"
FT                   /translation="MAKQRTIFVCQQCDAQFPRWMGRCTECGSWDSLVEQVIAKSAGTT
FT                   GGSTRSPIGVSEPLRLPDIQLGDVQRLPVRGSEFARVLGGGIVPGSLVLIGGDPGIGKS
FT                   TLLLEQSAALAETAGDVLYISAEESQQQIKLRATRLGLSAQRLYILAETSLDTAIATIE
FT                   RMKPVLVIVDSIQTVYSESVTSAAGSVSQVREGALRLQRVAKQHNISIMLVGHVTKEGA
FT                   IAGPRVLEHIVDVVLYLEGERFHQYRLLRSVKNRFGSTNEVGVFEMNQGGMVEVTNPSQ
FT                   IFLAERSTNSPGSAVAVMLEGTRPLLLEVQALTSHTANAQPRRTANGFDQNRLAMIIAV
FT                   LSKRVGVPLFNQDIYVNVVGGLKVTEPAIDLAVATAITSSFRNQRVEPNTVLIGEIGLS
FT                   GELRSVSQLDRRLNEAAKLGFHNAIVPQIDALPQIDAFQVTGIRSLIEAVRAALIGAPR
FT                   PSPGEPPTAKATTDTNDD"
FT   gene            214663..215820
FT                   /locus_tag="Haur_0185"
FT   CDS_pept        214663..215820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0185"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: rca:Rcas_2018 PilT protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02837"
FT                   /db_xref="GOA:A9B6D4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D4"
FT                   /protein_id="ABX02837.1"
FT                   /translation="MTISEKKAVAVNRNRLLSIDFWVRILGMVVLGYIGWYFGSSSASN
FT                   PRTSDETLAMQLLTLSGAGLGLLISHRITLYPIRNINQRLRRSTAQELIALALGSLLGV
FT                   MLAALLSIPLSQLPGLLGSYSPALASFFIIYFCVVAFEYHKKNLVNFGVSLQTPKVRAV
FT                   KEAVPMRRTCLVDTSAIIDGRVLAVVRSGFLDGILVVPRFVLNELQLLADSSDDMKRMR
FT                   GRRGLDMLEEIRKDDQLRLEMPNDDIANARGVDQKLVTLALQDGHALITNDKNLSQVAE
FT                   LQGVQVLNLNVLSDAVRPPVGAGEMLVVKVREEGREREQGIGYLEDGTMVVVEDARERI
FT                   GDEVRVIVSRVWTNDRGRMVFGRIMGSAGAFYGGKNDAGNYPARS"
FT   gene            215792..216253
FT                   /locus_tag="Haur_0186"
FT   CDS_pept        215792..216253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0186"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   rrs:RoseRS_2445 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02838"
FT                   /db_xref="GOA:A9B6D5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B6D5"
FT                   /protein_id="ABX02838.1"
FT                   /translation="MRAIIQRVANASVTVAEQIVGQIETGLLVLLAVSPSDTSDDLQKL
FT                   ADKILNLRIFPDAHDRFDRSLIDCQGQLLVVSQFTLYADTRKGRRPSFTGAAAPALAEP
FT                   MVDQFIAYCRGQGITTASGQFGAAMQVQLINDGPVTIILDTAEWQHGRG"
FT   gene            216240..216497
FT                   /locus_tag="Haur_0187"
FT   CDS_pept        216240..216497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02839"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D6"
FT                   /protein_id="ABX02839.1"
FT                   /translation="MAEVDDSEQVLVQLAQSLHRHRLSGVAQLFLRSGHVASIVLSQLC
FT                   LFGQTFVPSPLRQRLASYANALETEASWQRLIEHLNALES"
FT   gene            216584..217378
FT                   /locus_tag="Haur_0188"
FT   CDS_pept        216584..217378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02840"
FT                   /db_xref="GOA:A9B6D7"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D7"
FT                   /protein_id="ABX02840.1"
FT                   /translation="MSPFEILVVSLILTLAIALPFVYARLVTGGRKINRRPLPPIDLIN
FT                   SALARSAETGQPIHVSPGSGSLDGSTINPETLAGLVLAQRITDIAARRGAGIAASSGDP
FT                   IAHLALRGTIRRAYRDAGYSEDYRPELIQLLAANDPIAFSAGLSNRITSEPMEASITVG
FT                   SFEQGYLLFAEPGRAHNILQIAGTTDQQALTAALLTANGTLLGEEIYAAEAYITPTPLG
FT                   FARILTHDVLRSVIIGVIILGIILVSLGQLAILPQDFPLLPR"
FT   sig_peptide     216584..216658
FT                   /locus_tag="Haur_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.931 at
FT                   residue 25"
FT   gene            217391..218056
FT                   /locus_tag="Haur_0189"
FT   CDS_pept        217391..218056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02841"
FT                   /db_xref="GOA:A9B6D8"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D8"
FT                   /protein_id="ABX02841.1"
FT                   /translation="MRRIDLLRNPKRLIPILIGSVAGIFVLIDRLFPGIDSINNGSQIL
FT                   LSWATVIAAFALIAGSINVIIHHIKRLASTDPKRWYSIALLLGVIIPPALAVYGYTTQG
FT                   RANVLELGLFQDVIRWVYAPISISLLALLTFFALTAAIHAFGAGQREAIIVVSVALVFL
FT                   LLQLPLLAGLPYLGETVGWIQRYIVMAGLRGLIFGSAIGAIVASIRILLGIDLPYLDR"
FT   gene            218069..222409
FT                   /locus_tag="Haur_0190"
FT   CDS_pept        218069..222409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2219 putative FHA domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02842"
FT                   /db_xref="GOA:A9B6D9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6D9"
FT                   /protein_id="ABX02842.1"
FT                   /translation="MNCPRCGTPNTPDRQFCGQCQAPLAVTPSASNDLPPWLQDLDQQQ
FT                   TVVPAKRGTSSLPPWLQEASPPPPVAANAESLPPWLQESAAPIPAPNVAPAPANSEELP
FT                   PWLRDLQATAPALPADEPLPNAPRSEQPLPNWLSDLQSGSTPPPPTPVVNADVPSWLQG
FT                   SVETTPPAPKPSANADVPSWLQEPALPAAPAPTPVAPSADVPSWLQGSVETAPPAPKPS
FT                   ANADVPSWLQEPALPAAPAPTPVAPSADVPSWLQEPALPADPAPTPAAPSADVPSWLQG
FT                   SVETTPPAPKPSANADEEPMPAWLQQLRPSEPAPPPGIASFVEDNEEPVIARRGGTGNL
FT                   PDWLKDFDTEPPVVQLSDVDLDAAGPSDDVPPWLKPATAPLTSPAAPAASSGVPAWMQA
FT                   DSAPPAPPAAPAASAGDDVPSWLRGDLDVVPPAAPAASGDVPSWLQAESAPPAVPAASA
FT                   GDDVPAWLRGDLDVAPPAAPAASGDVPSWLQAESAPPAAPATSAGDDVPAWLRGDLDVA
FT                   PLVAPAVSAGDDVPAWMQADSAPLAPPAASTGDDVPAWLREDLDVAAPAAPAASGDVPA
FT                   WMQADAAPPAPPAASAGDDVPAWLRGDLDVAAPPAAPAASAGDDVPAWLRGDLDVAPAA
FT                   PAASGDVPAWMQADAAPPVPPAASAGDDVPAWLRGDLDVAAPPAAPAASAGDDVPAWLR
FT                   GDLDVAAPPAAPAVSAGDDVPAWLRGDLDVAAPPAAPAASAGDDVPAWLRGELDVAAPA
FT                   ASGDVPAWLQADVAPPAAPTASGGDMPAWLQADAGETVRLDSADASADVPAWLKADLEA
FT                   APPAAPAASGDIPSWLQADAGETVRLDSADASADVPAWLKADLEAAPPAASAASGGDIP
FT                   SWLQADAGELPQVSPTVRLDPEDSSDNVPAWLKADLETASPAAPAPIDTPNWLHEDAPT
FT                   VKLDNQAAGIPAWLQEDLPTVKLDSPAGNIPAWLQDDVTPIAPAPVKPEPVAPATPSYD
FT                   PEGANVPAWLRDDLDIEIPASKPTVAPIIPSSTSPSWLLDDEPTQATQDDTLLGSVDLP
FT                   AWLRQTVKLEEPSLVVEQEAASAVAESADWLRVLGEPEPAIAATSPTTRRLIDSEPPAL
FT                   LSRTPERVSAMHLLQDLVTKPLPEPVEAPPVALAPWWQRIGTQRIVASLMIISLLVGLL
FT                   VPNLLAINTQALTIGGNTSDLYNYVETLNPESRVLIAYEGDLRHNAELGPLEHAISQHL
FT                   IERKVPMLLLSTDTEGSLLASQRAAQFPVIDANTGYTGEGAEYLNLGWVKGNELGIAQL
FT                   GSNLRGAIANLLLNREGADVNLLRIMSKLNSNNQLDRPRITTTKDLDLLIVVADEPGDV
FT                   QRWMEQFWAREPALPVAILTTNEVLPQIQPYVDVNVNGTPAAIYTAAGLVGEQQYMALR
FT                   SNNTNTNTNGPITALSLGMITTVVVVLVGGLLQLQRRIRGKRNS"
FT   gene            222409..223077
FT                   /locus_tag="Haur_0191"
FT   CDS_pept        222409..223077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02843"
FT                   /db_xref="GOA:A9B6E0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E0"
FT                   /protein_id="ABX02843.1"
FT                   /translation="MTTLGPWIAFGLTLIVLSRAFGENPLFRFSQYLFVGLALGYTLTV
FT                   VVTTIFIVPSGDMLDNPDSVGTALFIVPVLIGVLLLTRLRTQQFSWLANIPLSLLFGVA
FT                   AAVAIAGTLLGTLLPQLQASFFSVTSFTDGSNLGAAIGKLVLVIGIVLVLLSFRFSKAA
FT                   TPEAADHTETLKPSLVAKFGRMWLLLSLGAVFAATLITYQSALIDRIQFLLRQIIGVIS
FT                   "
FT   sig_peptide     222409..222477
FT                   /locus_tag="Haur_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.761 at
FT                   residue 23"
FT   gene            223097..225274
FT                   /locus_tag="Haur_0192"
FT   CDS_pept        223097..225274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02844"
FT                   /db_xref="InterPro:IPR006230"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E1"
FT                   /protein_id="ABX02844.1"
FT                   /translation="MTTADPAALLVVDIGTLFTHVALLELVAGEYRLLGRAQALSTLEP
FT                   PIADAWHGILAAIREIEQLTFRAIAHVDGLMTPHRADGSGVDGMVVTTSAAGTLPIVLA
FT                   AISNDTTGASLRRVARSSYTTVLDMVTLDEYGDPDLAEGESWIDYQLANLVRLPAATVL
FT                   LAGGIDGGNSAPLERLAHMLGFTVLRLEQINSREFAHVIFAGNTAAYPGIEEALSTIAP
FT                   ITATANVLPAIGVEQLMPARLELIRSYNDRVLPKLPSFNRMRAMSSDMIRCTSDGFGPL
FT                   VRFIAKHHGRNTLIVDIGAMTSAGYASDGTQLHLTVETNCGTAYGIAGLVDKVGVTNIT
FT                   RWLPFEMSDSALREHMLNRLIRPQIVPIDRESLLIEQALVREALRVVSNDLFDEQPQLA
FT                   SDLIIATGGALTHTMHPAQALLSIVDGLDFGRLQQYRDRSLLISDIYLDRDGLLALCGA
FT                   TAWKYPDASFCLLEQDVLRNGALASYLAINSSLRLGDLVAEVELVPVSGAPIIMQIHHG
FT                   EIRRLPLALGKRATLRLRPTKQVQIGANLPGEVVETGLAAITGSALGLVIDARPRPLAQ
FT                   RNSDIPSRNQQWQWLNQLGVVDGLNPYAPQYDDQPLPFEMAPALTRIPDPAPAPAQMLP
FT                   EREEPNAIPDWLREEGENANDLTMPPPSDFGVEEPLPDWLGGMDVPVSSDPVLDLGERR
FT                   PSQPIAPADFSALRNELEEQNKPKRGFFRRK"
FT   gene            225533..226576
FT                   /locus_tag="Haur_0193"
FT   CDS_pept        225533..226576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0193"
FT                   /product="conserved repeat domain"
FT                   /note="TIGRFAM: conserved repeat domain; LPXTG-motif cell
FT                   wall anchor domain; PFAM: protein of unknown function
FT                   DUF11; KEGG: fjo:Fjoh_3952 conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02845"
FT                   /db_xref="GOA:A9B6E2"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E2"
FT                   /protein_id="ABX02845.1"
FT                   /translation="MHKRLTRVLGTIFCVLGLGLALFGFDGAWRAYGQTAGPTPTPDFD
FT                   LPITKAVSPSNALPGDTVTFSINVTNDQPQTQTNVVITDSVVNFLEVVGASSSKGTASF
FT                   SGQEVRADVGTLASGESVRLTITTRVRVGTAPGTIGQNVAFVNTASGSSSSSNVVTVTI
FT                   GGEGTPTPSPTPVPAGSKLVVEKSASPASGKVGDLITFKIVVRNTGGSTAPNVVVNDRI
FT                   LDFLEVVSVQTSKGSAATTGQDVKVTVGDLAAGESVTIAITTKIRAGTVSGQQGINIAE
FT                   AVASDGSGGSSSIPSNPVAIAVDRNPPAGLPDTSAPNQASWIFWLGLGMAITGGLLLMV
FT                   SRRRRVA"
FT   sig_peptide     225533..225607
FT                   /locus_tag="Haur_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.491 at
FT                   residue 25"
FT   gene            226580..228307
FT                   /locus_tag="Haur_0194"
FT   CDS_pept        226580..228307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0194"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: rrs:RoseRS_4270 non-specific protein-tyrosine
FT                   kinase; TIGRFAM: capsular exopolysaccharide family; PFAM:
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02846"
FT                   /db_xref="GOA:A9B6E3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E3"
FT                   /protein_id="ABX02846.1"
FT                   /translation="MNIIRRYITGLRRWLWLLVLGPVVAAGAAYGISSQQTPRYASSTR
FT                   VIVGQTLKNSNPDYGSLVASERLVATYAQIAQSRTTMQAVEQRLNLSDMASSAIITTRP
FT                   VQETEFLDIAVEANDPQQAADIANAIADQLILTSPAGPQSAEAKLLDEVNRQIATLNEE
FT                   ITRTDEEIKTLKAEIEQIGADKPAAESLIANLQLKQQSQNQNRQTLSTLYSTALGNRAN
FT                   SISVVEAATVNPTPIAPRPIRSAILAGILGFALVFGLALLIEYFDDSVQTPDEGVDLVN
FT                   APLLAAIVKQETKVTKASQRLVSRLDPRSPTAETFRTLRTNLQFSNVDTKARTLIVTSS
FT                   QPEEGKSTVAANLAWVLAQAGQKVVLIDADLRKPMMHRVFEVSSEYGLTNLLTNNEDPT
FT                   IRERTVLSVAENLWLIPSGPLPPNPSELLSSKRMEMLIWLLQQEYDWILFDTPPILTVT
FT                   DPIALIPRVDGVVLVAEAKRTRRDMLAKCRAAVQTVGGRVIGLVFNKLDPRSEGYGVYY
FT                   TYYYDQHHTSNRGRRFWNRKDDHQPVPSMSEPAPLDLHDPALDRSEAAYEMASHERSK"
FT   sig_peptide     226580..226675
FT                   /locus_tag="Haur_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.646 at
FT                   residue 32"
FT   gene            228345..231122
FT                   /locus_tag="Haur_0195"
FT   CDS_pept        228345..231122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0195"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   art:Arth_3208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E4"
FT                   /protein_id="ABX02847.1"
FT                   /translation="MRRFFLFGLALLGLWLGLIAWFSYQLADQRQSLHTLMQTRPLQSS
FT                   QAQAFCSELDSTHSNMVWLRRLSLPLHPILRQSDTWLGALPAASDAAQQGAELAQGYCQ
FT                   QFNPLIAILDLPANQRTKALLDWLSANPPNWLELQTELSQLQQTWQTVPSNIQTAPFFR
FT                   NYQTQLAQFDQQLTSAQTTLGLLEQAWPLVEAGWGWQKPLRLLIAGQNPLELRPSGGFI
FT                   GSIATLTIEQGQIRTMAYFNSADFAAVAPTGSAMPKPYNDYLRASIWTLRDANWWPDWP
FT                   TSAQSLQTFWQLNQQPEVDAVIALDLYALQGLIQVLAPLEIAGYGQISQAESLEQIFGL
FT                   YDGRSVTGDKQFLAALFNSTLETARHASFSQWLGIGASLQQALQQRHLSIYFNDQPSQA
FT                   LMLANGWAGTMPALEHDVLALVDADLSYSDGQNFIEQRMQLEVQLDAQARPLTNTLTIT
FT                   YTNRYDDWRADLSKHAVYGYCYNVKLAVQQRIPGCYGDYARAYLPINAIPLSLDGADTP
FT                   PDLTQEGQFTSVGWYMLLYPGQTRTIRLRYLPNIQSQPYQLTWFKQAGTLGHPITLIIN
FT                   QANLQAQWHGSLRHDRQLRFEAGTIQASASDSPAPEPQQSAEQAWQLWQQGQTSVALDL
FT                   WQSSNTLDRALDWVVALRWTDDPGTANQFLSQLQPLLPNSGRAAFLAGWLAELNDDQPT
FT                   ALQAYQTALEHEPTSQAARLALALLQLQLGDAQAAQTTLQQLENPRLALQRLAFDQRMA
FT                   GDLAQAERYYQLLLTLDPRDREVWEERYWLRRYANDQPDWQAVEQLANQAIGIFANDAQ
FT                   WLSRRAESYERQNLPQQAIADWQQVTTISPTNSLAWYYLGLQQRALGDWSAAQSSLETL
FT                   IALDPQADYYLVLGDTLRELQLFDAAREAYANAAKLEPEHPGLAERLRLLEASP"
FT   sig_peptide     228345..228428
FT                   /locus_tag="Haur_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.862 at
FT                   residue 28"
FT   gene            231119..232534
FT                   /locus_tag="Haur_0196"
FT   CDS_pept        231119..232534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0196"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: gka:GK3163 polysaccharide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02848"
FT                   /db_xref="GOA:A9B6E5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E5"
FT                   /protein_id="ABX02848.1"
FT                   /translation="MSRRLLKDTALYALTGVATKMIGALLLPLITRLLSPELYGSVDLI
FT                   SLVGLFAIELVTLGSDFALALYFHEATIERRRLVGSLWVARLLLGLLIALIGHLLAPYL
FT                   AWQLLQRSDAQTILALRLGLWGQLANGIIGLWFTTLRQESKALRLFGLTVLRVASTALL
FT                   TIGWMLQSSQRLSAYFGAMLLVDSLLALGLTLQMRRQLGWPDWRLLKTLLGKGLGFLPR
FT                   SIYFVAMTLINRQILLHFGSLEQIGQYAAATKISFIVWIVISAANQAWLPYSLSIASTP
FT                   TANANYRQYLTSYTMLMGAATTGLGLFAPELLRLLTTGDYLPAAPAVGWYALNLMAIGL
FT                   LTVAATGLTITKATAVLGQTSLLTAGLNVGLAIVLVPWLGLVGAAIAAAGDQLIAAWLV
FT                   YRAAQKRYPIDFDGKAVIGWLSLTIACVALASWLPLTLSWPLIGLKLLIVGVWLGCVWR
FT                   WGQPKMLLSVLKR"
FT   gene            complement(232536..233366)
FT                   /locus_tag="Haur_0197"
FT   CDS_pept        complement(232536..233366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02849"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E6"
FT                   /protein_id="ABX02849.1"
FT                   /translation="MKQPDILPNTKVLISVKTYPLPSHKYDELVCTAGFLEDGSWIRVY
FT                   PVPFRGLPYHQQYQKWHWVTVDLIKNTQDHRPESYRPTSQLDIGENIPTTNNWILRKQY
FT                   ALRNVYTSMTDLLGDLKTKNTSLATVKPSEIIDFVIEPTERDWKESWRNQMLQFSLFDM
FT                   DDKGQGRERKVIRKLPYKYFYKFRTHGDQNPRKLMIEDWELGALYWNCLKTCNGDENEA
FT                   NKLVRQKYFDTFVQQNDIHLFLGTTLQYHFVAPNPFVIIGVFYPKIETQGRMEL"
FT   gene            complement(233469..233819)
FT                   /locus_tag="Haur_0198"
FT   CDS_pept        complement(233469..233819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02850"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E7"
FT                   /protein_id="ABX02850.1"
FT                   /translation="MPAYNFKERFATAVEQGIKRSTIRPRRRNPSRPGDPLYMYTGMRT
FT                   RACRKLTTATCRQVRPIIIDSDQVWLDGEQLSAEQIRQLAQGDGFSRVAEFFDFFRQHY
FT                   GLPTAEMDLIEW"
FT   gene            complement(233910..234407)
FT                   /locus_tag="Haur_0199"
FT   CDS_pept        complement(233910..234407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0199"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02851"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E8"
FT                   /protein_id="ABX02851.1"
FT                   /translation="MHGVLFDSFEHNRWATALLLQTCSDLSAEQLATTVVGSYGDIIAT
FT                   FNHIIRADARYLQHLSGKAPDWLINREETSDFARLQVWAEEAASNWAEFLTMPFDAEQI
FT                   VTLVTGDYEIHGGALIAQALHHSNIHREQICAILTSLGIEPPDLQPWAYAHETGRGHNR
FT                   ST"
FT   gene            complement(234770..235246)
FT                   /locus_tag="Haur_0200"
FT   CDS_pept        complement(234770..235246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02852"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6E9"
FT                   /protein_id="ABX02852.1"
FT                   /translation="MQAKHVLDRFNLWLEQSDKVLEYLAIEDAINLMLGFYREIRIDDC
FT                   DLANDGDMLLFQWGLEPNGLNPSFRYNLTRHLVVEKTYVDDDGEWIDDSVKQLSLTFRY
FT                   ISNLKLNSLNHGNQWCLHPEELEQFAHLLRTHPATLAIKHLHAQSIDLSFKHIE"
FT   gene            235861..237018
FT                   /locus_tag="Haur_0201"
FT   CDS_pept        235861..237018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0201"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: dge:Dgeo_2272 putative transposase,
FT                   IS891/IS1136/IS1341; TIGRFAM: transposase, IS605 OrfB
FT                   family; PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02853"
FT                   /db_xref="GOA:A9B6F0"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F0"
FT                   /protein_id="ABX02853.1"
FT                   /translation="MRTLTRCYKYRLQPSPTHVETLVQWAGCRRFVWNWALGQKTDHYR
FT                   ATGQRLSYSQLAAALVDLKRQPKTAFLRECHSQPLQQALIDLETAFTNFFAKRAKYPRF
FT                   KARKVTLHSLRFPQGVAVVNERTISVPKIGHMQAIIHRPLLGIVKGATIKQDTTGAWWV
FT                   VFVCHTERPDVLLTTDRPVGIDVGLESFTTLSTGEKTAPPKFYRRSQKKLARAQRKLSR
FT                   AQKGSNNRLKARKRVARIHKKISNQRADWLHKQALGMVQRFDVVCIEDLNIKGLARTKL
FT                   AKSFSDAALSTFMQRLQEKAEWHGRRVIKVGRFYASSKTCHHCHIKTALTLADRVWTCH
FT                   ACGTTHDRDGNAAINIVHEGLRLLAVGTAESQNAARDGVNPAKRW"
FT   gene            complement(237419..237745)
FT                   /locus_tag="Haur_0202"
FT   CDS_pept        complement(237419..237745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02854"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F1"
FT                   /protein_id="ABX02854.1"
FT                   /translation="MHARDFVQPGEQLLVLFTRGHLLTFNNDGTGTSGNWDMAGNRKID
FT                   RVLIYYRDDSSNINKLYLATYKDVEKVEDGRYCVYFEHCQYVGKTEQNWVEFTGAQQAV
FT                   RYFE"
FT   gene            complement(237823..238557)
FT                   /locus_tag="Haur_0203"
FT   CDS_pept        complement(237823..238557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chu:CHU_0224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02855"
FT                   /db_xref="GOA:A9B6F2"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F2"
FT                   /protein_id="ABX02855.1"
FT                   /translation="MSMQRLRQLTGWGFILGAILVNIPYALLISNFDYPDILRAPVEQV
FT                   LTQFAAGGSGLIYTWLAFAWVGLPLLFASIMLKRLPEFSAVPLIETASTIGVIGFVVQV
FT                   VGLLRWVFVVPIIAQAYLDPLTSTETKASLVTLFQVVHQYGGVVLGEHSGQLFMIIWML
FT                   LLSTIIYRLEQFPKWLAWLGWLAALIYSLAQTELLATVLPTIPVIDWAGLVGSLLWLGW
FT                   MASLGIVILRQKIPNNSMQINP"
FT   gene            complement(238569..239144)
FT                   /locus_tag="Haur_0204"
FT   CDS_pept        complement(238569..239144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0204"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gsu:GSU0205
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02856"
FT                   /db_xref="GOA:A9B6F3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F3"
FT                   /protein_id="ABX02856.1"
FT                   /translation="MSKRDLILSTALELFNQKGTAEVSTNHIAEACSISPGNLYYHFRN
FT                   KAAIIQALFEQLYAAWDTELSLPNDHTPQLSDLTNLVETNYQIIWRYRFVYRELVALLR
FT                   QDLALHASFLSTRQRGFSGFQQLVEQFIAAGIMRPIEAKTLDQLMQICWLISEFWLNNL
FT                   EIQQQSIEPSTINSGVSLMLRVLQPYII"
FT   gene            complement(239628..240950)
FT                   /locus_tag="Haur_0205"
FT   CDS_pept        complement(239628..240950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0205"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   pca:Pcar_2835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02857"
FT                   /db_xref="GOA:A9B6F4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F4"
FT                   /protein_id="ABX02857.1"
FT                   /translation="MKLNVLLKPWRGDKRFTAIAKYAAALKKSGSKDLQIVAQVEAEFG
FT                   KPTELARINEQPQPYKAYGQIGVDIEAAALEQLLLALRLPIAAQGALMPDAHPGFALPI
FT                   GGVFAAHNAVSPMMVGVDIGCRMHLTIFAEAPMEIQRQREQLFRDLADVTVFGSGASRK
FT                   RGPDHPILGIKHWNITAQTRSLREKAIAQLGTSGGGNHFANIVVGERIGENDLPRQFVG
FT                   LLTHSGSRGVGYAIAKHYSNIAVQETARQAHVPKMYEWLNLDSEAGQEYWAAMELAGAF
FT                   AQANHEVIHRLFAQRTKLQPITTIQNHHNFAWREGDLIVHRKGATPAGVGVRGVIPGSM
FT                   ASASYVVEGLGNPEALHSASHGAGRLLSRSKARATISPSEAKKVIKAHGVHVEGWSIDE
FT                   SPLAYKDIERVMELQIEADLIKPLARMKPIAVIMAGEAGEN"
FT   gene            complement(241105..241476)
FT                   /locus_tag="Haur_0206"
FT   CDS_pept        complement(241105..241476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0206"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rca:Rcas_0674 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02858"
FT                   /db_xref="GOA:A9B6F5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F5"
FT                   /protein_id="ABX02858.1"
FT                   /translation="MHILLVDDNQDIIRLVQQVLALEGHRVSIARDGLEALQKVASQRP
FT                   DAVILDVNMPMLEGTEVCRRIKMSYSIPVMMLTVRSEQVDFQRGADAGADAYLSKPFDI
FT                   PVFIEYLNAMLRLRYGKTH"
FT   gene            complement(241511..242764)
FT                   /locus_tag="Haur_0207"
FT   CDS_pept        complement(241511..242764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lbl:LBL_2953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02859"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F6"
FT                   /protein_id="ABX02859.1"
FT                   /translation="MAHNFYATLPIITDFVQITDANCYHRVPDDWVIVVSDIEQSTKAI
FT                   GEGRYKDVNFIGASTIVALLNLQPNLDIPFVFGGDGATVLLPPWLVEQAKPALQAVQHL
FT                   SESIYNLHLRVGIMPVSEVYAHRYQLEIAKFAASDNYAQAMINGDGLTFVEQTIKDPVA
FT                   GAKYLLAAQSSDQPGLLDGLECRWQEIPSRYGETVSLLVRAEANTTTQRNAINRQVIEQ
FT                   IEAIYGADDSHHPVDVQQLSLTLRIQDLWGEARLRGGTSKLQQLRYLNNIWWLNVLGKL
FT                   LLATGAKTELTDWAEYPQILQASTDYRKYDAMLRMVIAGTPEQRQQLEQFLNAERAAGR
FT                   LNYGLHVSDSALMTCIVFERMGRQVHFIDGNNGGYAKAADQLKQQSHYLEPPVTTKPVS
FT                   QPKTGLLGDTSSPSWGTC"
FT   gene            242902..243648
FT                   /locus_tag="Haur_0208"
FT   CDS_pept        242902..243648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0208"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   rrs:RoseRS_3728 peptidase C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02860"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F7"
FT                   /protein_id="ABX02860.1"
FT                   /translation="MRRILLIFVGWSLVACGGTTNNPSATAVASLEPTSQALVASVVPT
FT                   NTIVATPAATPTRLPTQTVAPEVTSKPVELDTPTLNDQNAPPTAAPQPTADASNAPSQP
FT                   VRIVIDAIGLDLAPVSVGLDQRNVPIVPKHDAGWYNLSAQPGQGENVVFWGHVLRWKDA
FT                   PNVPAPFARVKDVAIDETITVYSADGSEYRYRVTEQVWVTPDQVQYILPVGSERLTLVS
FT                   CIGDQVIVEGNLEMSHRLITIAEPLR"
FT   sig_peptide     242902..242985
FT                   /locus_tag="Haur_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.402 at
FT                   residue 28"
FT   gene            243659..244330
FT                   /locus_tag="Haur_0209"
FT   CDS_pept        243659..244330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02861"
FT                   /db_xref="GOA:A9B6F8"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F8"
FT                   /protein_id="ABX02861.1"
FT                   /translation="MSESLPNLHVPAVQTLGERYSKLRLWWYMFAVLFVGDFFGLMAIV
FT                   AINDLNDSVRSPVIWQLGMQRLSIVSIGVASLIFASFGWLIGWILRKVAICQVRWVVLA
FT                   VFVGYWSAYILFNWPPSLLWLTNSPHTTYYRHMLSAMLTAIGCVAGPIALVMRPSSWAV
FT                   VWLLSQLGLGFVIASISHWLVLNNFDGFAITFFIISILAIYPLVLSIWFSYYLRRQIVP
FT                   F"
FT   gene            244360..245679
FT                   /locus_tag="Haur_0210"
FT   CDS_pept        244360..245679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0210"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: gvi:glr4164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02862"
FT                   /db_xref="GOA:A9B6F9"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6F9"
FT                   /protein_id="ABX02862.1"
FT                   /translation="MKQSVPASARKLLDSRWLKVGIGVKRWLALMLFGLMFSALGLAFG
FT                   LRELYTTVELPAIFYYLTLQFWPRTIRMIILCLVGISATGFAFRHLNRVLLSAALPRNT
FT                   APIDLAETLIGRSRTRHGPKVVALGGGHGLSTLLSGLKQYTDNITAIVAVADDGGSSGR
FT                   IRQEFGILPPGDIRRCLAALAEAEPLMTRLFEHRFQAGSLEGHTFGNLFITALAEVTGS
FT                   FGEGVREANRVLAVRGQIVPATLDDVVLWAELENGEHISGESRIAKSGQRIKRVYLQPH
FT                   GALAVRAAIKAIEEADLIIVGPGSLYTSLLSSLMISEINQAMREAVQAVRVYVCNVATE
FT                   PGETDHFGVRDHLQALVEHVGPDVFDVALANSDDRQNHRFAPEWQGRTTIVPLDQTQDL
FT                   PIRVRTANVINPANPLRHDPVRLARELMRVLEKERQMGRL"
FT   sig_peptide     244360..244491
FT                   /locus_tag="Haur_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.704 at
FT                   residue 44"
FT   gene            245974..247152
FT                   /locus_tag="Haur_0211"
FT   CDS_pept        245974..247152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02863"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G0"
FT                   /protein_id="ABX02863.1"
FT                   /translation="MPLDFNQVGQQIKQMGGDLRQTANHHDQLVAHAWAKLEEQSPRWE
FT                   HWARHAEENYLRSPWLLAAPAEPIINRYQLPKFPPNYCLAAVDGSQIDLDRHWAVECYL
FT                   INLGLVTIQYGQQPYSKLHSVPALHYNDQELLLRDKDGRSYKMAGALVHAERDTREGIA
FT                   LARLAQEILEQSTTPLVAMQDGTLIRWSLSGLDPWVRAHFLQRYLDEGLAALRAADVPT
FT                   CSYISHPKAPEVTGIARLIVNPTLNNTNKAEGLVDPYPGINDTKLFGNGWLGDGERSAL
FT                   FKSLSKINVEEYRDHAIYFFYLNVGSELARIEMPEWVAQRPEWVDLIHAVAYDQAHRGG
FT                   GYPVALARAHEQAVVRESDRRVFRQMIEQALWHARLNNGSSLKQDAKAQVRV"
FT   gene            247198..247806
FT                   /locus_tag="Haur_0212"
FT   CDS_pept        247198..247806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02864"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G1"
FT                   /protein_id="ABX02864.1"
FT                   /translation="MTEQRIGEVIEASSTQWTTGAYELLNAPPFGSLIKAGCHDNDLCI
FT                   YGLVYDIRTGSRDLGGKAMVRGGRRYDGSEFYDGQIYSEHPDLAAVLQTEWSALVIGYE
FT                   RAGRIIHYLPPQPPTVHYSVHLCDDDTVERFTQHCDFFRMVLHANLPIADELLGTAIRH
FT                   AAALQANRREYELYAGRELARLLRDDYDRLRVLVRMLTS"
FT   gene            247816..248295
FT                   /locus_tag="Haur_0213"
FT   CDS_pept        247816..248295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02865"
FT                   /db_xref="GOA:A9B6G2"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G2"
FT                   /protein_id="ABX02865.1"
FT                   /translation="MPNLIVNGREYRSVDEMPAEDRQLYQQTLSLLGDHDGDGVPDIFN
FT                   QTGKVQSVNLNQQQINLTNGANDQLKQVFVDRDGNGIPDILEGQTNLGNAQSNFGNPQA
FT                   TTSSTTWKTAAPTADPLGSSPLPWNQPQQSNGFMLGLVVGGVVIGAALLIWLLVM"
FT   gene            complement(248414..249409)
FT                   /locus_tag="Haur_0214"
FT   CDS_pept        complement(248414..249409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0214"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system-like"
FT                   /note="KEGG: saz:Sama_0028 conserved hypothetical
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02866"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G3"
FT                   /protein_id="ABX02866.1"
FT                   /translation="MKQLFMFTAFLLIASGCTMQTPMTQIPTTPITPTQLAVPAGIYSG
FT                   LAWLDQGLVLQARTANNPVENLYWIDQQGNLGESLSIPLEQAFVMTSYYFPQRLPNGKL
FT                   GLRRYNWNPNLETGISEREFGVWQFDPTTNDLTPLLQPALPQDLSQHLRFSLAPDMQRA
FT                   MLSDGGYLQSRLFWWSAEAGHQPLDAGVAICQYFAWSPDGTTIAYAGSPHAADSMATLG
FT                   GVRSTLYLMDSDGGNRREIGTNIRNVSGLQWSPDGQWLVVLGYFDGFDNQVWLVNPTKA
FT                   EWHQLTTTVGNYQWPAWSPDGKQIAVIWRKPADLGPSDYVMTLDVSAFMQ"
FT   sig_peptide     complement(249335..249409)
FT                   /locus_tag="Haur_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.825 at
FT                   residue 25"
FT   gene            complement(249477..249818)
FT                   /locus_tag="Haur_0215"
FT   CDS_pept        complement(249477..249818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02867"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G4"
FT                   /protein_id="ABX02867.1"
FT                   /translation="MGPGTWASWADAGVLEAIQNGFFLFQNEGSPIPAGFNDCAGAASA
FT                   WKEFFFQQASGLEQEKLIPCWAMAEQLGVTYGSDAANLRAGVPAPGTTAGDLIPQFVAY
FT                   GNFYRLMAA"
FT   gene            complement(249984..250421)
FT                   /locus_tag="Haur_0216"
FT   CDS_pept        complement(249984..250421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02868"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G5"
FT                   /protein_id="ABX02868.1"
FT                   /translation="MPAPIIQVEYNHLLQVAQRFRTKAEAVVSLRQQLRATVGQLRNDW
FT                   SGIAATAFFHEFQAEVDPALERLREALETARDVAMAIHTGMRSAEEAAAALFKGNFGDI
FT                   ATEAVAAGLGAALGTTIGLRTAPPAPRLGSANLPGGPSSML"
FT   gene            complement(250618..251691)
FT                   /locus_tag="Haur_0217"
FT   CDS_pept        complement(250618..251691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0217"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: tde:TDE0205 adenylate/guanylate cyclase catalytic
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02869"
FT                   /db_xref="GOA:A9B6G6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G6"
FT                   /protein_id="ABX02869.1"
FT                   /translation="MALNEEQHSTSSSALVAELANYGVAATVRTALTSILDTAPGAMLY
FT                   RFNPAYLAEELGLSRRAGLQLMAAAVRVGLFDLNWEARCIYCGYQAHAFDKLTQAHSQQ
FT                   YCAMCRDNFPAKLDEGIHVTFTVAAQVRSLPAGIDNDTWREAIDQRLGVTTSHELLTVQ
FT                   AFRDLFIDEPLPDGESFQIKWAALMFTDLGGSTALYARKGDPRAYSLVREHFNILFAVV
FT                   DQAGGAVVKTIGDAIMAVFVDGAAAVKAGQNALAAIEQFNIDRELGDDERLTLKVGVHA
FT                   GPTLAVTLNDRLDYFGTTVNAAARVQSSANYAELVVTQQVLEAPGVAEILPSDLANETL
FT                   ILRGLDDLPFNVVRFHN"
FT   gene            complement(251766..253577)
FT                   /locus_tag="Haur_0218"
FT   CDS_pept        complement(251766..253577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0218"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   rrs:RoseRS_2270 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02870"
FT                   /db_xref="GOA:A9B6G7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G7"
FT                   /protein_id="ABX02870.1"
FT                   /translation="MFAGLDTENYDRQYGDRELMGRMLSYFRAHRRTAFWTIALICGLG
FT                   LLNTIPPFLVAQAVQRIGEANPDWNFIWLLASGGVVFGVLQWAMGWLRQRMTAQIVADV
FT                   ISALRNDAFNAAISHDLSFFDELRSGRIISRITSDTQEFAQVSRLIIEIVSQVLTVIAL
FT                   LVYLLSVSVPLSLGIIGFTPIVIGLALGFRRLARFVTRKGFQVLGEVNSSIQEAVTGIS
FT                   IAKNFRQEARIYGEFSEINQQSYGVNLRRGFVLSNVFPTLNIVSGFGTAALIYWGGLSV
FT                   IDLTISLAAWYVFVRSVDLFWFPLLNISAFWSQFQAGLAAAERIFALIDAEHSVKQHDQ
FT                   QTTKRLRGEIVFDHVEFRYGRKEPVLNDFSLNIAPGESIALVGHTGAGKSSIAKLITRF
FT                   YEFQSGKITVDSHDIRSLDLRSYRQQLGIVTQTPFLFDGTVADNIRYAAPQLSDAELEA
FT                   VANQIGGGEWLETLPQGLQSQVGERGNKLSLGQRQLVALTRVLAAQPAIFILDEATASI
FT                   DPFTETQIQQAMDLILSRSTAILIAHRLSTVRSADRIIVLNQGQIIEEGNHDQLMQQGG
FT                   HYADLYDTYFRHQSLSYIESRGAVRSV"
FT   gene            complement(253695..255443)
FT                   /locus_tag="Haur_0219"
FT   CDS_pept        complement(253695..255443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0219"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: rca:Rcas_3549
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02871"
FT                   /db_xref="GOA:A9B6G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G8"
FT                   /protein_id="ABX02871.1"
FT                   /translation="MALSNSEFVVERSWKINRSTPLRWVWSHARRNLWWIIGLFIGAFG
FT                   NALFAAQVPVVTGQAFEAVKAGDKNGLWWAALLIVGGQFLRAFVQLLRNFSSEVIGQRL
FT                   ERDVRDELYTSLLGKSMAFHDSQPTGDVMARATNDVREMNLMLNPGVNLVVGSAMFLIM
FT                   PLIASPHPQLLVVPILYLVFYGLLVWHYLRQLKPVTTAVRQSFGELNATLAEAIDGVET
FT                   VKATAQEERERNRFRTAVSKWRNAFVAQGNVEAVFLPVLLLGLGQGLGFIHSLILFRNG
FT                   LINVGDVVSFNGLLLLFGFPTFTAQFAYSQLSSGLAGGRRILELITTETELDENAQGYA
FT                   EPMRGEIIFENVAFGYHSDVDAVQKVSFRIAPGQTVALVGQTGAGKTTLTKLLNRTYDT
FT                   REGRILIDGVDVRDWNLAALRRQISIIEQDIFLFSRSIADNIGFGVPNATREQIIEAAK
FT                   AAQAHDFIGRLADGYDTIIGERGVTLSGGQRQRLALARAFLTDPTILVLDDSTSAIDSA
FT                   TEDRIQQAIEQASQDRTTILITHRLSQIRWADLIIVIRKGTISAVGTHEDLMQQSEAYR
FT                   AIFAKL"
FT   sig_peptide     complement(255291..255443)
FT                   /locus_tag="Haur_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.658 at
FT                   residue 51"
FT   gene            256057..257043
FT                   /locus_tag="Haur_0220"
FT   CDS_pept        256057..257043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0220"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: sus:Acid_5840 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02872"
FT                   /db_xref="GOA:A9B6G9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6G9"
FT                   /protein_id="ABX02872.1"
FT                   /translation="MGSLPRVFSGIQPSGNLHLGNYLGAIHTWVQEQNQYDNFFCIVDL
FT                   HAITVPQDPAELRKNVRDLAALYLAAGISLEHATIFVQSHVPAHVELGWILNCQTPLGW
FT                   LNRMTQFKDKSQKQETVAAGLMNYPTLMAADILLYDTQVVPVGDDQRQHIELTRDIAER
FT                   FNHLYGETFVIPEALIRPVAARVMGLDDPTQKMSKSNKAANHSIPLLGDLKATRKAMMR
FT                   AVTDSGSEIKFDETRPGVNNLLGIYQALTGKDKATIEAEFEGQGYGKLKGAVADVVIAT
FT                   LEPLQQRYNQLTADPAELDGILKRGAERAAEVANATLLRAYQQLGLR"
FT   gene            complement(257239..258852)
FT                   /locus_tag="Haur_0221"
FT   CDS_pept        complement(257239..258852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0221"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system-like"
FT                   /note="KEGG: sat:SYN_00188 TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02873"
FT                   /db_xref="GOA:A9B6H0"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H0"
FT                   /protein_id="ABX02873.1"
FT                   /translation="MAQSCVVCRAALADGSVYCSECGSRQPAAGQSTQVLGSAVFGSQP
FT                   LPSSSDHDDSPYAPRRSGTQPLNDPPTQVVNNYQSPSSTSNVGGFGQGPSTQPNFPLPQ
FT                   YTPPTPPNYAQPTAKSKNLGHWLIGGGLALLLIGGGAGAYYFLGNNDSNNGESGNVATG
FT                   PTWTPIPTKIAEPTEQAAGDPLVEPTSEPTVEPTQGQSDPADQPTPTNESNDLPTQAAG
FT                   GSAPTDLTGELIYLDDSFELVRQTMSTGSVSPLDLGGQAYYNDLLSWSPDGKTMAFFVR
FT                   DGAKTNIYLADGDGSNSRSVIELQNMAPQSLSWSPDSSKFAFITSDIDFETKEDQNLYV
FT                   YDLASNNEKQLTTTGLIDFDPLSWSPDNQTILFAAGQDGIEFNVINADGSNLAKLADVF
FT                   TSDAWWTKDSKIIYDDFCDRSNFDRGVCLLDPATGEVETLQKIGDFYLSGISPDANWYM
FT                   LDNYNDGSLLLINADTGDKELVAPPSSGGSYEVRVWGKWSPDGRYVTYETIGQGTFIYE
FT                   IGSGQAAAPFVNGSIMEWLP"
FT   gene            complement(258893..260092)
FT                   /locus_tag="Haur_0222"
FT   CDS_pept        complement(258893..260092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0222"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: rca:Rcas_2763 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02874"
FT                   /db_xref="GOA:A9B6H1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H1"
FT                   /protein_id="ABX02874.1"
FT                   /translation="MTDHAVLDELNGRYGDFGGRYVPETLMAAIEELTEAFFRIRTDPE
FT                   FQAELQHLHQTYTGRPTALTYARRLTEELGGAQIWLKREDLTHTGAHKINNALGQGLLA
FT                   KRMGKQRIIAETGAGQHGVATAAVCALLGLQCVVYMGTEDMERQKPNVFRMRLLGADVR
FT                   GVSTGSKTLKDAVNEAMRDWVSNPDSYYLLGSALGPHPYPLMVREFQSIIGIEAREQIL
FT                   AATGKLPNTIIACVGGGSNAIGMFHAFINDEHVDLRGVEAGGHGIELGRHAARFAGGRL
FT                   GVFQGTRSYVLQNSDGQIANTHSISAGLDYAAVGPEHAWLHDEERAFYTYATDEEALNG
FT                   FQMLCRTEGIIPALESSHAIAEAVRLAPTMSKESIILVNLSGRGDKDIFTVADVLGVQM
FT                   "
FT   gene            complement(260103..260645)
FT                   /locus_tag="Haur_0223"
FT   CDS_pept        complement(260103..260645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02875"
FT                   /db_xref="GOA:A9B6H2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H2"
FT                   /protein_id="ABX02875.1"
FT                   /translation="MPSPYYDQGRRDAENGTLNQLFYHTYHDYKRGYDEIVNGPPKPKP
FT                   NFLFFLIPALLLVGLAGGWFLRDRGVLSTPPTPLVVMVTVTPVTASPTFPPFAIATPAP
FT                   PTPTQLVIEIGGEAITLEQVRIRPDPSIQGEPIGALDPGELITIIDGPRQGDDYTWWLI
FT                   ESAIGQGWVAEDFIQAR"
FT   gene            complement(260701..261324)
FT                   /locus_tag="Haur_0224"
FT   CDS_pept        complement(260701..261324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0224"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: rrs:RoseRS_2783
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02876"
FT                   /db_xref="GOA:A9B6H3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B6H3"
FT                   /protein_id="ABX02876.1"
FT                   /translation="MTIGIHEEQQLWRNGARIVAGVDEVGRGCWAGPVVAAAVSFPTHL
FT                   LNDPVALAGINDSKTLSAEARQAMAQQIRHLASGIGLGVVSAHLIDLFGIAEATKWAMM
FT                   HAVLSLPSLPDGLVIDWVKLPELPLLQRSLPKGDAISISVAAASIIAKVYRDNLMHEYD
FT                   QRDPRYGWAAHKGYGTAQHQRALAAHGPSGLHRRSFKPLAAFVD"
FT   gene            complement(261373..262041)
FT                   /locus_tag="Haur_0225"
FT   CDS_pept        complement(261373..262041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0225"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   rrs:RoseRS_2782 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02877"
FT                   /db_xref="GOA:A9B6H4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H4"
FT                   /protein_id="ABX02877.1"
FT                   /translation="MLQRMQALVIWAFERFYHEAAFTYDLVAWLMSQGYWSQWVLAALP
FT                   DVADQHLLELGCGTGYVQQARQDQPSLTIGLDESRQMLGLSRRRAPQATLVRAVAQALP
FT                   YADASWSAVLSTFPAPYLFDRRTLAELQRVLTSDGKLYIVDGGSIPNSLYAMIIGLIYR
FT                   LVFGRHSNPEAPTSQLDPRIQRLQEAGFRVNTHIKQVGRSQVQIFIAEKANQLIDIRLD
FT                   "
FT   gene            complement(262123..262479)
FT                   /locus_tag="Haur_0226"
FT   CDS_pept        complement(262123..262479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0226"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: rca:Rcas_2561
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02878"
FT                   /db_xref="GOA:A9B6H5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B6H5"
FT                   /protein_id="ABX02878.1"
FT                   /translation="MQQAPVIHEIENEYLRKDVPEFRVGDTVRVSVKVVEGTRERIQDF
FT                   EGVVIRRRRMGVNENFTVRRIASHGIGVERTFLLHSPRIDGVKLVRTGKVRQANLYYLR
FT                   GRTGKAARIKERRG"
FT   gene            262731..263645
FT                   /locus_tag="Haur_0227"
FT   CDS_pept        262731..263645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_2625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02879"
FT                   /db_xref="GOA:A9B6H6"
FT                   /db_xref="InterPro:IPR032713"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H6"
FT                   /protein_id="ABX02879.1"
FT                   /translation="MRALLLGLLASLFFASTFVLNRLMELAGGHWLWSASLRYLFMLVP
FT                   LLAIVVWRGKLGLVLQELRQQPWQWLCWSTIGFGLFYAPLCFAAKYAPAWLVASTWQIT
FT                   IIAGALVAPLLQTKAAPSQPAWHWRSLAISSLILLGVAVIQLQHAAAIGWREVLLGFVP
FT                   VVIAAFAYPLGNRAMMQLCGQRLATFERVLGMTIASLPFWLILAGVAATTVGWPSTSQI
FT                   FQSLLVALLAGVIATVLFFKATDLAQHHQGQLAAVEATQAGEVVFALVGEIVLLHSPAP
FT                   TALTLAGLGVIILGMILHSWFSH"
FT   sig_peptide     262731..262796
FT                   /locus_tag="Haur_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.598 at
FT                   residue 22"
FT   gene            263710..264813
FT                   /locus_tag="Haur_0228"
FT   CDS_pept        263710..264813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02880"
FT                   /db_xref="GOA:A9B6H7"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H7"
FT                   /protein_id="ABX02880.1"
FT                   /translation="MLRRLLLAGMVLLLVGCQEPLAQLDCFRPLINTPTTQLPTGQRLV
FT                   MIDRILAIEPAPTKPITLQFALVNNPSTQFSFNFNQKNNHVKFVDLENFFGIKPIATLE
FT                   CQDSFAPQHYSFVLEVIASTKTYTQPFDVEYKADINDFNYYGFQFTQSIDGILMTVTII
FT                   GIGLIFLSIMYGVILVILFRNKLYTKKLVVAILLSKLFLIIVIFHIDFYNFNQKPPLYC
FT                   YSMIIVANETYQPLGEGIKMFPNAIQSQTTDLEFYPMYTDLYNDSERYIYNNDIYRYRF
FT                   YLKHMPALHSVPTYPNCEREFDFTYIDMYKFKQNNEVSTIPIIIKPFYKDQLDNNADFI
FT                   LAYDFAGAILTLSILAIPMLLFIRSQR"
FT   sig_peptide     263710..263778
FT                   /locus_tag="Haur_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.872 at
FT                   residue 23"
FT   gene            264904..265998
FT                   /locus_tag="Haur_0229"
FT   CDS_pept        264904..265998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0229"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ava:Ava_1430 FMN-dependent
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02881"
FT                   /db_xref="GOA:A9B6H8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H8"
FT                   /protein_id="ABX02881.1"
FT                   /translation="MSKPINLHEYEQQAMTLLDGPTCDYYAGGCEDEVTLRANLLSFEQ
FT                   VRLRPRFLVDVREVSTATTLLGKPLDSPILVAPSAYHGLAHAEGECETARGVAQAGSIF
FT                   TVSTLATRSLEEVAAAAECPLWFQLYVYRDRSVSERLIARAEAAGYQALMLTIDRPWLG
FT                   RRERELRSGFGVPAHLSMANFRDVPAAQNYRRAGPNALPDPKADMFDAGLTWESIAWLR
FT                   SVTSLPIIVKGILTAEDALLAAEAGAAAIVVSNHGGRQIDGTVTTLEALPEVVAALAQS
FT                   PCEIYIDGGIRRGSDALKALALGAQAIMLGRPVLWGLAVAGSAGVADVLTTMQRELQRS
FT                   MALCGRPNLASIDRSLVRPSGMVF"
FT   gene            266134..266385
FT                   /locus_tag="Haur_0230"
FT   CDS_pept        266134..266385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02882"
FT                   /db_xref="GOA:A9B6H9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6H9"
FT                   /protein_id="ABX02882.1"
FT                   /translation="MNGFVIGLTLTMIVGGLVLIIGPIYLRRRWDNETQRNWEHDEFDR
FT                   KVKRYNDDIANRQRDYDIVNVLSGRETPTVVDRYRDKD"
FT   gene            266404..267999
FT                   /locus_tag="Haur_0231"
FT   CDS_pept        266404..267999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0231"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ace:Acel_0943 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02883"
FT                   /db_xref="GOA:A9B6I0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I0"
FT                   /protein_id="ABX02883.1"
FT                   /translation="MIDFQQVCYYYPQATAPALDRCTLQIAEGEFVLVCGASGSGKSSL
FT                   LRAINGLIPHFHGGTWQGQLKVCGRDTRRNSPRDLAELVGFVFQDPDAQFVVEIVEDEL
FT                   AFAMENAGLPQAIMRRRIEEALDQLEIAHLRHRSLTSLSGGERQRVAIAAALTVQPQIL
FT                   VLDEPTSQLDPHTAEEVLTALQKLNADLGLTIVLSEHRLERVVQYVDRIIWMHAGKIGL
FT                   ADTPQVVLAQMPFAPPLVEVARHFNWQPLPLTIKQGRAAARQQLITPQAQPKPVTTVGP
FT                   ELLRSEALDASYADQPALQGVNVRLYAGEIVAIMGRNGSGKTTLLRHLVGLQQPIRGRV
FT                   LLQQQPITNRPVEQLAQQIGFVPQNPSDILFHPSLEQELAWTLTNHGQAADPAQIEQTL
FT                   QRLNLLHLRERHPRDLSGGEAQRAAFAAIVVARPQILLLDEPTRGLDYAAKQQLANFLQ
FT                   SLASEQHGIIVVTHDVEFVALCAQRVVLLGEGEVVVEGTPQVVLGDSLLFSTQVGKLFP
FT                   KFGWLSVADVLAGT"
FT   gene            complement(268064..268723)
FT                   /locus_tag="Haur_0232"
FT   CDS_pept        complement(268064..268723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0232"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: rca:Rcas_0896
FT                   phage shock protein A, PspA"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02884"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I1"
FT                   /protein_id="ABX02884.1"
FT                   /translation="MWKRIKDLIRAWLHALFDRAENPVTMADEYIRQLEAQYGEAKRAT
FT                   AMAMGQATRMEQKRDENRKQAEDWERKAVNALERGDEELARSALERKRHFSAAASEYAT
FT                   QSETQNAQVKDFRNSISRLELQINEARAKRDLIKAKTSRADSQEAATRALQNMQGSGEL
FT                   GDRLGAMEERIDDRLYKAEAMAKLEGDSLENKFRNLEQETSLESELAALKAKVNQS"
FT   gene            268899..269627
FT                   /locus_tag="Haur_0233"
FT   CDS_pept        268899..269627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0233"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: dsy:DSY1185
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02885"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I2"
FT                   /protein_id="ABX02885.1"
FT                   /translation="MADKEKKGLFGNLADQMKDAIEQSRESAEAKPTAPAPGNVIGQMM
FT                   ERLHDIQEKQEEAASSSVSNAVNVIKDAQEAAKEAREKAEAQSAATNNAVADALRQAQE
FT                   AAKAQEVAKAEAAKAEAAKAEAAAEQRYTVQGGDTLGKISARFYGDAAQWRRIYEANRA
FT                   IIGNNPDVISVGQEFVIPDASTPLPVQRTYTVRSGDTMRAIAQRFYGDEMQWKRIYQAN
FT                   RDRIPNPDVIHVGQEFIIPE"
FT   gene            269886..271043
FT                   /locus_tag="Haur_0234"
FT   CDS_pept        269886..271043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0234"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rrs:RoseRS_2548 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02886"
FT                   /db_xref="GOA:A9B6I3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I3"
FT                   /protein_id="ABX02886.1"
FT                   /translation="MFYNVLSNYLSASITLAMHILHVYKDYFPVLGGMENHIRVVAEGL
FT                   AERGHQVTVAVSNTYPKTEIERRNGVAIIKAAQWLRKASTPISPMSLPLSWRVPADIIH
FT                   LHHPFPPGDLLYWLRGGKAKLVITYQSDIVRQRRLLQLYRPLLTRTLNAADRIIAASPQ
FT                   YIQTSPWLAPHAAKCRVIPLSVDTERFNQLDHAAIQALREQVAAPMVLFVGRFRHYKGL
FT                   HFLLEALPKIPKAKLVLVGIGPEEARLRELAQRLGVGERIIWAGEVPDQALPNYYAAAD
FT                   VFVLPSHLRAEAFGIVQLEALAAGIPIVSTELGTGTSFVNAHGQTGFVVPPADPAALAR
FT                   AITVLLENPGLRAQFGANGRQRASSTFSPQRMLDQIEELYREIVS"
FT   gene            271046..272293
FT                   /locus_tag="Haur_0235"
FT   CDS_pept        271046..272293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0235"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rca:Rcas_0336 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02887"
FT                   /db_xref="GOA:A9B6I4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I4"
FT                   /protein_id="ABX02887.1"
FT                   /translation="MLLQAGTELLGRYHIVRAIGQGGMSAVYAAFDRQLNTPVAIKHFR
FT                   NHDPALHASLDREAQILARLQHSALPRVYDIRRENDDAYLIMDLIEGETLGTLLSQRGS
FT                   GFEPATVVAWAATLAEPLSYLHQQTPPVIHRDIKPHNVMRTPAGKLILLDFGLAKQWST
FT                   GQQSVIAYTLPYASLEQIQGTNTLDQRSDVYGFGATLYHLLTNREPVDALTRASAQIYA
FT                   NPDPLPLPSSLNNTVTPALDRVLMDSLALRADARPASISAVVSLLQAAQSATVSVPLIA
FT                   ANSAGQPTIRVDSQLPDGVSYATPRRFEPRPAPASTPAAPPRPRRSISRWSAAEQMSRA
FT                   QWSMPNYQQLYQDREDPKPFSPLNNPQWMIAQDATKSRINAALDDDDDVISPSQVMNVL
FT                   FFLLIIIFIGACQYLG"
FT   gene            272303..273376
FT                   /locus_tag="Haur_0236"
FT   CDS_pept        272303..273376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0236"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rca:Rcas_0336 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02888"
FT                   /db_xref="GOA:A9B6I5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I5"
FT                   /protein_id="ABX02888.1"
FT                   /translation="MSLGVGSVLLGRYQILRLIGQGGMGTVYAAFDQQLNHQVAIKYFR
FT                   GQDATFQSNLQREAQILARLRHPSLPRVYDLQRVGDAAFLIMDLIEGENLDTLLFQRGA
FT                   AFEPDVVLAWAKALAPALSYLHYQTPPVIHRDIKPQNIIRTPDGQLILVDFGLAKQWAS
FT                   SNQSVVAYTLAYAALEQIQATSPVNQRSDVYSFAATLYHLLTNCEPADALTRASSLING
FT                   QPDPLVNPVNLNPAVSPAMAAVLAQAMALPAHERPASIDQFIQQLQQSFYNQPSLMSSA
FT                   GQPTIVQRPAVATIVLPTATKPALSAQQILQPQVPPQQITYQEKSESSLNLEQLWTFLM
FT                   VLLFLVGLMVWITNAMN"
FT   gene            273470..274051
FT                   /locus_tag="Haur_0237"
FT   CDS_pept        273470..274051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0237"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   rru:Rru_A2605 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02889"
FT                   /db_xref="GOA:A9B6I6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I6"
FT                   /protein_id="ABX02889.1"
FT                   /translation="MADYSAYIEKSFREHIAMAERVLAEQSATINTMANVLIACYQQGH
FT                   KAIFCGNGGSAADAQHLAAEFVGRYLIDRRPIPALALHTDTSTLTAVGNDYGYDQVFSR
FT                   QVKAHMNPGDVLVCLTTSGNSVNVIKAAEVARELGNPVLALLGGDGGKILPLCDHALVV
FT                   PFKLPYLVQEISMVVGHLLCDLTEQALFAK"
FT   gene            274132..274671
FT                   /locus_tag="Haur_0238"
FT   CDS_pept        274132..274671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0238"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   pca:Pcar_1283 hydrolase, HAD-superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02890"
FT                   /db_xref="GOA:A9B6I7"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I7"
FT                   /protein_id="ABX02890.1"
FT                   /translation="MSQPAVFIDRDGTINVEVNYLHQPELVQLEQTVGQAIARLNQAGF
FT                   LVLVVTNQSGIARGYYRAEDMHLVHQRISELLQPFNAHIDAWYYCPHHPEVTGDCACRK
FT                   PNLGMFEQAQAEFAIDLSRSWMIGDKLLDVQAGINLGVPAIMVATGYGTQHQHDLPEHA
FT                   MLVANLNAAVDLIVQE"
FT   gene            274674..275054
FT                   /locus_tag="Haur_0239"
FT   CDS_pept        274674..275054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0239"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   sus:Acid_4599 protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02891"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I8"
FT                   /protein_id="ABX02891.1"
FT                   /translation="MQPQAPQPLQPPPVQIVPPWMISATFDLPGFRVVQNRGIVRGIVV
FT                   RSRSVFGTIGASFQTLVGGNITIWSKLCEQTRMEAFEIMSLHAAEIGANAIIAMRYDAT
FT                   EISTGVTEVLAYGSAVIVEPIR"
FT   gene            complement(275083..275904)
FT                   /locus_tag="Haur_0240"
FT   CDS_pept        complement(275083..275904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02892"
FT                   /db_xref="GOA:A9B6I9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6I9"
FT                   /protein_id="ABX02892.1"
FT                   /translation="MMKIQWLNFGRTLIVGILFGLWCAVLGGAIGFWLGESASYLLGVI
FT                   AGIASIFLFVRLSHRWINHTLLGVICLLNIGTLIGTAIGTSSERLYYGQVQIDNIRAEQ
FT                   ISQHPEAMIFTLEQAVVQHEYGVTFAYTTSDARRSSTTWHAISVAPLTSPDWQPDQPVP
FT                   AWAVCGGYFEYECEEWQQPIKAALISKPTNQNPQQTAITKNLDTHGYSAIENAPRLYVG
FT                   SSVESLMADHRFIWRSTWLFVNGIWAVPFFIFVGAELLWNTLKQLFTKKPS"
FT   sig_peptide     complement(275809..275904)
FT                   /locus_tag="Haur_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.184 at
FT                   residue 32"
FT   gene            complement(275916..276716)
FT                   /locus_tag="Haur_0241"
FT   CDS_pept        complement(275916..276716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC10776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02893"
FT                   /db_xref="GOA:A9B6J0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J0"
FT                   /protein_id="ABX02893.1"
FT                   /translation="MFDSWRSLGFHLAAGFYNSVLCVVIGGILGFLTPPPWSFALLGIA
FT                   WLGISAYWAGATDGRISSSFAGMIIIWHVVILMFAGMGWRYMRYTAGKETINNITAAEI
FT                   PYYPNGAIFYFNDAVVQTNYATVHKVASKDRKSSRITYSYYSLAPLTTSDWQYGDPVPA
FT                   WAACNADYNIACYDWDEPIRNGALPEELYLDKYTVAKLTNLATYDYVELNNASMLEVGS
FT                   GSNSFNTAKRWQWLFVWIIMVLVWAVPIVLIGCVRFTWRWLRNK"
FT   gene            complement(276873..281504)
FT                   /locus_tag="Haur_0242"
FT   CDS_pept        complement(276873..281504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0242"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: rca:Rcas_1597 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02894"
FT                   /db_xref="GOA:A9B6J1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B6J1"
FT                   /protein_id="ABX02894.1"
FT                   /translation="MLEINEFNAIRISLASPEDILSWSHGEVTKPETINYRTLRPERDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRYKGIVCDKCGVEVTRSKVRRDRMGHIKLASPVSHI
FT                   WFVKGTPSRLGLLLDISPRNLERVLYFASYIITDVDDLALGNVREQMKTDFGVRRKDLE
FT                   EKIIEQRGEKATRLSKDLAAMDNAMEGTLERTHEQFARQRQEIEDEANALREHLEELIG
FT                   IDALADEDIVYRGTVLLEENEPVRERSLEQLEQLIDQEREKLEQRREYEIENVRLLADG
FT                   ERDQRQSVADAEQERLTTALIKQLEDLNKEEKDKLDRLDDIQLHRIISENEYRILRDLA
FT                   PYTFKADMGAGAVRDIVSMVDLDELSNQMQAEVQSSSGQRRKKATKRLRVVEAFRKSGN
FT                   RPEWMIMTVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMELNAPEII
FT                   VRNEKRMLQEAVDALIDNGRRGRPVSGKGKHRLKSLSDMLKGKQGRFRQNLLGKRVDYS
FT                   GRSVIVVGPTLQLHQCGLPKKMALELFKPFVMRRLVDKGFAHNIKSAKRFVERVRPEVW
FT                   DVLEEVIKDYLVLLNRAPSLHRLSIQAFEAKLIEGSAIQLHPLVCAAFNADFDGDQMAV
FT                   HVPLSRKAQEEARRRMISTYNLLSPATGDPIITPSQDIVLGCFYLTQVRPGAKGGGKRF
FT                   GSIDEALLAYTNGVVHIQAPVWIVIEDYILPGSDLREKELPSLDGVTPRVLIETSVGRI
FT                   IFNNALRYQGEPKAGENGYRSPLHYRNFLVGKSGLKALIADCYRFHSQRENIIADVYQE
FT                   LIERFGPETSEESLLRFYASERTARLADRIKALGFKHATLGGMTFSASDVEVPDTKDAI
FT                   VQETYKKVQDIEKMQRRGLITDDERYREVVTAWLDATNQIKVEVQRSLNPFGPVSMMST
FT                   SGARGNVEQIRQMAGMRGLTTDPTGRIIELPITANFREGLSVIEYFISTHGGRKGLADT
FT                   ALRTADAGYLTRRLVDVAQDVIVTIEDCGTTEGMWIRVSRDILASVEDRIVGRVTVAPV
FT                   TNPVTGEVIFDTDSEILEDDGKHIANVLKSLDKEAQAEFGIYVRSVLTCNADYGICRKC
FT                   YGRNLATGKMVEIGEAVGIIAAQSIGEPGTQLTLRTFHTGGVATDTDITQGLPRVQEIF
FT                   EARIPKGKAVLAQIAGRVQIVREEEGIRRLRIVSEEVYTDEQMLPKDYRVVVKNGDAVE
FT                   IGNLLAESNVDGDGRAPLVAGLAGNVYVDDDRLVIQAKDIEEHEEVIAHAARLRVKDGD
FT                   LVQVGQQMTEGSSDPQEMLQLRGREAVQEYLTNEAQKVYRSQGVGINDKHIEVIVRQML
FT                   RRVRIEEPGDTELLPGELVELHELNRINASIVSQGGDPALAVPVLLGITKASLSTDSFL
FT                   SAASFQETTRVLTEAAVNGKIDYLRGLKENVVIGKLIPAGTGMEQRRKLAEEAALRVAQ
FT                   ITSTPADREVPAATPAPAVMSEPKPAPPRSFDEALNAVTNIDSGNGPKDDLFAQAMARL
FT                   QAEEGRKPTLSELLGTDEDEENV"
FT   gene            complement(281522..282214)
FT                   /locus_tag="Haur_0243"
FT   CDS_pept        complement(281522..282214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bat:BAS2504 intein homing endonuclease-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02895"
FT                   /db_xref="GOA:A9B6J2"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J2"
FT                   /protein_id="ABX02895.1"
FT                   /translation="MARPAASNPFFRTWSPTMAYVLGYWWADGYMRIHSNTGGHFVQIA
FT                   SIDIEHLQAIADAMGATTALRQVRKESTCHEMVICNQGLYHDLLNLGGIPNKSHVIGFP
FT                   NVPTEYLVDFIRGFIDGDGTLVWNGDRPVIQIYSGSQQLLLETGRCIELMTGIPAPNIS
FT                   HNRNNYYIKWSTIRAKCLAIWLYHNNSLMLARKAAIAQQFEQWQPKKSPERGTITEKMR
FT                   LHFANYLP"
FT   gene            complement(282293..285946)
FT                   /locus_tag="Haur_0244"
FT   CDS_pept        complement(282293..285946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0244"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG:
FT                   rrs:RoseRS_1265 DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02896"
FT                   /db_xref="GOA:A9B6J3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B6J3"
FT                   /protein_id="ABX02896.1"
FT                   /translation="MPQVQSTVILPPLITSSIFRDDQGRAMIASRRSFARITDAIELPK
FT                   LIETQIDSFRWFQREGLRELFDEINPIDDFTGKNLELSFSDYEFGEPRYNEFECRERDM
FT                   TYAAPLRVRVRLKVKTTGEIKESDIFLGDFPLMTNNGTFVINGAERVVVSQLIRSPGVY
FT                   FKEEKEPTSGRSLHSAKLIPNRGAWLEFETNKRDVLSVKVDRKRKLPVTILIRAVLGLF
FT                   GDKPLDQCGLNEDVIALFANVDVNRDHQYIASTLDKDPSTNAKEAIMELYKRLRPGDPA
FT                   TVDNARSLLETLLFNARRYDLGKVGRYKLNRNLWEKSRLFEGQEIPSLTMRVLSKADLF
FT                   KIVERLIDLNNGIGNPDDIDHLGNRRVRTVGELIQTQFRVGLLRMERVIKERMSLQEPE
FT                   AATPNGLINIRPVVAAMREFFGGSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRDRAG
FT                   FEVRDVHHSHYGRICPVETPEGPNIGLIGTMSTFARVNEMGFLETPYRRVYREVDNAPL
FT                   WLERGMTTRDVRHLSTGELIARAGARVDAELAKIIAIGVLNGQLLREDIVNPATGDLIA
FT                   EAGSEIDRALATKIADLPLRAIKIHPVVTNETDYLPADEEDKFIIAQANALLDERFRFI
FT                   DPTVSCRHAEDFVQAPIASVDYMDVSPKQVVSVSTALIPFLEHDDANRALMGSNMQRQA
FT                   VPLLRPDAPIIGTGMEHKAARDSGQVVVARADAVVLSSNSERILVRENDGTERTYPLLK
FT                   FLRSNQDTCINQRPSVFIGDKIRAGEVIADSSSTQNGELALGQNILVAYMPWEGGNFED
FT                   AILVSERLVREDIFTSIHIEKYEVEARDTKLGPEEITRDIPNVGQDSLKNLDERGIIYV
FT                   GADVQPNDILVGKITPKGETDLTAEERLLRAIFGEKAREVKDSSLRVPNGVKGKVIDVK
FT                   VFTRDETTEMPVGVNQTVRVMLCQKRKISPGDKMAGRHGNKGVVSRVLPIEDMPFLPDG
FT                   TPVDIVLNPLAVPSRMNIGQILETHLGWAASRLGFRIATPVFDGARDEDIIKALAESGL
FT                   PSDAKIDLYDGRTGEKFDNPVTVGYKYMLKLAHLVEDKIHARSTGPYSLVTQQPLGGKA
FT                   QFGGQRFGEMEVWALEAYGAAYILQEMLTVKSDDVVGRVKTYEAIVKGDPINEAGVPES
FT                   FKVLIKELQSLGLSVDVLTADERPVELTDSEADDLISLDGINLSGMEKGEL"
FT   gene            complement(286305..287249)
FT                   /locus_tag="Haur_0245"
FT   CDS_pept        complement(286305..287249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0245"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: rrs:RoseRS_3756
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02897"
FT                   /db_xref="GOA:A9B6J4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J4"
FT                   /protein_id="ABX02897.1"
FT                   /translation="MNWNQAMHFAELASVHYQTPTLLTIGKFDGVHQAHQQLLRRLVER
FT                   ARQHNCHSAVLTFDPHPDEILRPEREIRYLTTINERAALMQELGIDLLAVLPFTHATSQ
FT                   LSPKAFLQLLLNHVPVRELWVGPDFKLGHRGTGTIPVLQEFGQELGFTVEPIPYWTLDG
FT                   EIVSSTAIRTSLAAGDVQTANHYLGRAFSLQGTVIPGDQRGRKIGFPTANVQIASNHTL
FT                   PADGVYVCKVQLLDDRRSFGAVTNIGVRPTFGVLGRAVEAHLFDFNEDIYGRPLRVSFL
FT                   QHIRGEQKFAGIEQLVAQIGRDAQFAREWLANA"
FT   gene            complement(287602..288333)
FT                   /locus_tag="Haur_0246"
FT   CDS_pept        complement(287602..288333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02898"
FT                   /db_xref="GOA:A9B6J5"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J5"
FT                   /protein_id="ABX02898.1"
FT                   /translation="MIATKAYPTTNQTERSMTSTYRWAAGLLFAQFSVFLVAFLVLSSA
FT                   IDWPASLDNPASQSLPLILQERSAVALGYTAYFLSATMLIPIALLLWQILASESALMRV
FT                   TAGLGMLAGFAKLLGIGRWLLMMPTLAEQYSATSDPNLRATIEVIYTSFNNYAGGVGEQ
FT                   IGVALFGGLWTAGVALTILRQTTLPRWLGYSGLIAAASVLVSLIELYGISAGPMLTVSG
FT                   SLWQFWLITLGGMLLRHKSKA"
FT   gene            complement(288335..289198)
FT                   /locus_tag="Haur_0247"
FT   CDS_pept        complement(288335..289198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0247"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: ana:all0345
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02899"
FT                   /db_xref="GOA:A9B6J6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J6"
FT                   /protein_id="ABX02899.1"
FT                   /translation="MFKIGEFSRLAQVSVRMLRHYDKLGLLIPNQIDQWTGYRYYSVEQ
FT                   LPRLHRIVALNGLGLSLQQIGELLNHDDLSADQLRGMLRLQEARLTAELAKKQAQLAEV
FT                   SARLAQIEHEQEPWPYAMMLKSTAAEPIVSMRAIVPSLDQMGYYCHRLYASLYQQVQQQ
FT                   RIPILAQEITIYHNEEFIETDIGVEVAVSLAEHNMAQLPDSNIKFQTLPSLELAATLAF
FT                   EGSFSEIHAAALALLGWVGLHNYEMIGPLREFHRSGPAHNAQGGIQEPAVIELQLPIKL
FT                   RDNERN"
FT   gene            289305..289814
FT                   /locus_tag="Haur_0248"
FT   CDS_pept        289305..289814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0248"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02900"
FT                   /db_xref="GOA:A9B6J7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J7"
FT                   /protein_id="ABX02900.1"
FT                   /translation="MAITIDRLGVGDEAIIQQLALDDALFGLEPETDEPLTALDDQAAR
FT                   QFLANPAVLYWVAREAEIITGFLYCVVVPLRSGEGSEVLLYEIGVHHHWRRKGIGQALL
FT                   QTMEAWMREQTISAVWVLADNPEAASFYQACGFEVEHEQPTYLVKNVKSGERLLGSGDR
FT                   NFTQNE"
FT   gene            complement(289880..292732)
FT                   /locus_tag="Haur_0249"
FT   CDS_pept        complement(289880..292732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0249"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; protein of
FT                   unknown function DUF1355; KEGG: rrs:RoseRS_3544 von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02901"
FT                   /db_xref="GOA:A9B6J8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J8"
FT                   /protein_id="ABX02901.1"
FT                   /translation="MLSFVRPEYLWFLLALPLVWLLGWLNNRGRTGQRRWWALGLRTLL
FT                   LLCLIGSLAGTQVRQPVQNLTTVFLLDSSDSIAPGQRSNNEQFIAQALETMQEGDKAAV
FT                   VVFGENALVERVPSEIQRLGTIQSVPIAARTDISEAIQLGLALFPADTQKRLVLLSDGG
FT                   ENSGRALEMIPLAQRRNVPIDIVPTGIGQGNPEVAISAFRAPSAARSGQEIQLIATIES
FT                   NTAQSAQLRWRADEQIVLEEAINLPVGTSSFTTTLVVNDQGFHRYSAQVVPTSDTRAQN
FT                   NVAASLVQIGGPPKVLLVEGEVGDASALKPALEAANLVPVVVPATGLPTDLAALSDYEA
FT                   VLLLNVPSRDIDQDTQKLLRSYVGDLGRGLAMIGGRQSFGVGGYTATPIEEALPVNMDV
FT                   RNRQQRPDIALVFIIDKSGSMDACHCNGGDMAAREGGGTRKIDIAKEAVAQAAAVLGKD
FT                   DKLGVVTFDDSAHWTIELDKVPSQDDVVAALAPVPPSGQTNVVSGMNAAYEQLRQSDAK
FT                   IKHAILLTDGWGHATDIGSIAENMNKDGITLSVVAAGNGSDNALQRYAELGGGRYYPAR
FT                   VMEEVPQIFLQETIQAVGTYIVEEQFTPAYAGDSPVLADLQEGLPSLLGYNGTVEKDNA
FT                   QVILTASDGSPILAQWQYGLGRSIAWTSDLKGKWASNWVTWEEFPRFTAQLVGWLLPRI
FT                   SNDNVSGEASLIGSDVQIDIVANDEKGNPQTAMNVNARLIGPTGEAIDATLAEVGPGQY
FT                   RARVASPIAGTYLIQVIGNDANGKPAFARTLGLIVPYSPEYRQGQSNPELLSTLAKATA
FT                   GRSLSQPMQAFDHTLDAVRRATPIDLGLLFAALVLLLLDIAIRRLNLRRKDFAALQAAR
FT                   KERQTIAAAPTATMNSLQGAKGRARQQMFSDKSEREVKPKENPATTPLPSTPNNPTKAV
FT                   DEAEDPLERLRAAKNRARRQ"
FT   gene            complement(292961..294865)
FT                   /locus_tag="Haur_0250"
FT   CDS_pept        complement(292961..294865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0250"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical membrane protein;
FT                   PFAM: von Willebrand factor type A; KEGG: rca:Rcas_3820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02902"
FT                   /db_xref="GOA:A9B6J9"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6J9"
FT                   /protein_id="ABX02902.1"
FT                   /translation="MGFIAPLMFIAGGTVLAGIVAMYILRLRREERTVSSTFLWNQLVR
FT                   DVEANAPWQRLRHNWLLWLQLLIALLLAFALARPFSPTVGVSGQNLIVIIDRSASMGAT
FT                   DVAANRLEAAKAEAIRLVDQLPDGARATIMAIGGELDVPAAATTDRREIRDAIEGIELR
FT                   LGGGSDMSQALSLAGALAAREEESEVAILTDGQVTVPMSATLPAKIRYFPVGTSNNNQA
FT                   IAAIALNELAPGTLTFFARVTNEGQERVTRRLLVNLDGTLFNAYDLEILPGQDQTVNID
FT                   VPATATTVEARLDGSDSLPSDDVAWAIRPSSDAIPVRFVTPGNRFLATALGLMPRVQVS
FT                   AYLTETATFTDTALLTVLDASLPEPLPAGNLLFIAPYRSTEYFSVTGSLDRPVPRPAPT
FT                   DDPLLRNVELGEVNILKSARIENAPWAHTVIDSAAGPLLIAGEVDGRRIAVLGFDTHDS
FT                   DLPLNISFPLLIANLVGYLAPGTGGDSAILPPDQELAFAVTNDISGVRLIQPDGETHEA
FT                   TPNNGLISFDGSLMNQAGIYSVELLRDGVVSKTQRYVVNAYRESEAKITPVQVLDVAQI
FT                   GGGQVGSSETTQAKAGREEWWRWLALAALIFVLIEWVFAQRSAFTRLKLWWNARRSAA"
FT   gene            complement(294875..295435)
FT                   /locus_tag="Haur_0251"
FT   CDS_pept        complement(294875..295435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02903"
FT                   /db_xref="GOA:A9B6K0"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K0"
FT                   /protein_id="ABX02903.1"
FT                   /translation="MQPTELNYQLNFNDYQEANLSIFKHIPKYQEALNLNRYYVLLLYV
FT                   LGIGMLAFFVAALFQFDRLSVWLIVFGLILIGIWVIYTNRDMREFTLDYFKKSYQLEKA
FT                   NFESPVRLTVYPTYVQQINAFSSVEFKWLFIQAILDEAEHIILVTHNNRVVVIPKRAFK
FT                   SPADQQIALQQFAQYHADAQLAE"
FT   gene            complement(295465..296349)
FT                   /locus_tag="Haur_0252"
FT   CDS_pept        complement(295465..296349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0252"
FT                   /product="protein of unknown function DUF58"
FT                   /note="KEGG: rrs:RoseRS_1889 protein of unknown function
FT                   DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02904"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K1"
FT                   /protein_id="ABX02904.1"
FT                   /translation="MSEQAALFEPQFLKQLDRLALLTRRNIAGQMQGERRSPRRGSSVE
FT                   YADFKPYTPGDDFRQIDWNLYARLEKFFLKLFVAEEEITLHLLIDTSASMDWGEPNKLR
FT                   YAAQAAGALGYIALASLDRAQVTSFGGGNEQRIPAGRGRAGVPPLFNLLNRLKGNGNTS
FT                   LLQASRRYIQTARVAGPLLLCSDLLTPDWEEALRTLGRRPFEITVLHVLSPDELNPPFE
FT                   GDLKLLDVEGGESLDVSADLDLLQRYVERLQAWREEVEHFCTTRGINYIFVDTSLPLES
FT                   LLVSVLRERQIVR"
FT   gene            complement(296377..297102)
FT                   /locus_tag="Haur_0253"
FT   CDS_pept        complement(296377..297102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0253"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rca:Rcas_3717 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02905"
FT                   /db_xref="GOA:A9B6K2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K2"
FT                   /protein_id="ABX02905.1"
FT                   /translation="MTRRIALIVLALALASCGSYASDSSRQVSIRPTIVPSTPAPPATQ
FT                   DPLGIASEFIPLAKPAQIPADDQRSMGDPNAPVTIVEYSDFQCPFCQRHHVSVFPELKA
FT                   KYIDTGMVRYVFRNYIAVESHTSAPAAGVASFCAMDQNKFWEMYDMLFVRASEWGVDPN
FT                   LAPTVMLKYAEELDLDTAAFAKCQADPEVLAKVNAETAEAVAAQATGTPAFFIGNYIIP
FT                   GAYPLAGFDAAIALANQNQ"
FT   sig_peptide     complement(297037..297102)
FT                   /locus_tag="Haur_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(297099..298088)
FT                   /locus_tag="Haur_0254"
FT   CDS_pept        complement(297099..298088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0254"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: rca:Rcas_3818 ATPase associated
FT                   with various cellular activities AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02906"
FT                   /db_xref="GOA:A9B6K3"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K3"
FT                   /protein_id="ABX02906.1"
FT                   /translation="MQYTERDAEMFRRTAAAIEAEIGKVIVGQRALIRQTLITLIAGGN
FT                   ALLEGVPGLAKTTLIRTLSEAVDCQFSRIQFTPDLMPADIIGTTIIAEDEQGQKEFRFQ
FT                   RGPIFSNLVLADEINRATPKTQSALLEAMQEHTVSVARTSYKLEEPFFVLATQNPLEME
FT                   GTYPLPEAQLDRFFFKINVPFPSPQELVEIAQRTTGTDQAKPQKVINGATLIQLQQMAR
FT                   SVPVATHVLSYAARIISATHPDSPLAPEQVKRYVSYGSSPRGMQALILAGKIAALLDGR
FT                   TNVAFRDLREMATPTLRHRIILSFEGQAEGVNSESIVNSILESIKEEA"
FT   gene            complement(298387..300078)
FT                   /locus_tag="Haur_0255"
FT   CDS_pept        complement(298387..300078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02907"
FT                   /db_xref="GOA:A9B6K4"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K4"
FT                   /protein_id="ABX02907.1"
FT                   /translation="MAQPTEIVHLLRPFGRRLRLADTLQWLSRTFWLPALGFALIQGAG
FT                   RLFPIPNWTLWSLVPFAVWLVALLVVALRPQSSNRIAQRSDLELDLRERLSTALELHKR
FT                   DDRGPLDDVQYNDALEKARNANAKDIRVAPPRKHRLWWGLATMFLVLGITSAVLPNAQS
FT                   NVLAEREAVKTDLERIADRIDQTREEIAKDETLSPEERVELDRQLAELSKDLRENTGSR
FT                   EDALAKISRTEQQLQKRLDSRASARQASLQELAQALKNQRGASQEQRPEASDAAKELEQ
FT                   AAQDAEKMTPEQREQLANALEQQANQTAATNPELAQSLRDAASALRNGNLADARSALQR
FT                   ASNQASQSAEQLQDQQGVEQALSEVQNSRDQAAQAGQQGQQNQQAGQQGQQGQQGQQGQ
FT                   QGQQGQQGQQGQQGQQGQGQGQGQGQGQGQGQGQGQGQGNGAGGGGGSQSNNLGSGNSN
FT                   GSGNGTGRNDRDFPGTGNDKGLVYQPWKPGAANDPSSVSGQPNGSGNAPSQPSGSTGPG
FT                   IANGSQVPYNQAGSDYQESAGRAVDSGYIPPQLKNFIRDYFNQLEQ"
FT   gene            300413..300913
FT                   /locus_tag="Haur_0256"
FT   CDS_pept        300413..300913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0256"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   sye:Syncc9902_1524 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02908"
FT                   /db_xref="GOA:A9B6K5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K5"
FT                   /protein_id="ABX02908.1"
FT                   /translation="MKRILLSMLVAVTLIGCGEIARPENPTAVPTSATTGVDISDVSAV
FT                   IPALPNGLEVKQTASGLRYVDIVVGSGPEVTAGSTAEVFYTGYLKSDGSQFDSNVGGQP
FT                   YAVEGVGGAMVITGWNEGLVGIKQGGKRRLIIPSALAYGEQGQGTIPANADLVFDVEVM
FT                   TVR"
FT   sig_peptide     300413..300478
FT                   /locus_tag="Haur_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.582 at
FT                   residue 22"
FT   gene            complement(301129..301938)
FT                   /locus_tag="Haur_0257"
FT   CDS_pept        complement(301129..301938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0257"
FT                   /product="sulfate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tel:tlr0276 sulfate
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02909"
FT                   /db_xref="GOA:A9B6K6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K6"
FT                   /protein_id="ABX02909.1"
FT                   /translation="MNWRKWLLISIVVGYMGILIIAPLGAIVFGAFREGAPAVLEALQH
FT                   PHVLRSFGLTLIICLVVVSIHGIFGTLVAWVLVRHQFVGKALVNRLLDLPFAMSPVIVG
FT                   FTLIVLFGRNGVLKPLTEALDWQIAFALPGMILATLFVTLPFMVRELMPVLEAFGRKQE
FT                   EAAATLGASGWQTFRLVTFPALRWAFLYGLGLTCARALGEFGAVLVISGGIQGRTETAT
FT                   VYIFRALDDRQYAGAYSAALLLGAISLVLVLVIDVFHRRSQKSIEQR"
FT   gene            complement(301935..302774)
FT                   /locus_tag="Haur_0258"
FT   CDS_pept        complement(301935..302774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0258"
FT                   /product="sulfate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rha:RHA1_ro01272 ABC
FT                   sulfate/thiosulfate porter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02910"
FT                   /db_xref="GOA:A9B6K7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K7"
FT                   /protein_id="ABX02910.1"
FT                   /translation="MTTQTIERTAPRLPWGRWSIRGAALTYLAVFLVLPLIVVVVDGLG
FT                   AGVESIVSVVSSPIARHAIWLTIWTGLVMSLINAVMGLLTAFVLVRYEFPGKTLLNAVV
FT                   DLPFAIPTLVTGVMLVILYGPQAAIGGWLNQQLGWQVIFAPSGIILALLFTSFPFVVRS
FT                   VQPVLINLDRSSEEAAATLGAPAWQIFWRVTLPALLPALVSGTLLSFARAIGEFGAIVV
FT                   VAGNIPLRSQTAAVYVYGEIESGSQRDASAMSLVMLAIALGTMSLVDWLSRRREVQA"
FT   gene            complement(302771..303808)
FT                   /locus_tag="Haur_0259"
FT   CDS_pept        complement(302771..303808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0259"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: syf:Synpcc7942_1681
FT                   thiosulphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02911"
FT                   /db_xref="GOA:A9B6K8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K8"
FT                   /protein_id="ABX02911.1"
FT                   /translation="MKRLHFSLLSLLLVGLLAACGEASQTTTSNATVTTITLGAYTTPR
FT                   EAYAKLIPLFQAKWKADTGGEVKFEESYQGSGAQSRAIVEGFEADIAALSLEADINRIT
FT                   DAGLITHDWKAGTHSGMVSTSIVVFAVREGNPKGIQDWADLAKPGVQILTPDPRTSGGA
FT                   QWNILALYGAAKRGQITGVPANDEAAAQAFLASVLKNVVVFDKGARESITNFEKGVGDV
FT                   AITYENEILVGQKGGQTYQMVIPTSTILIENPIALIDKSVEKHGNRQAVEAFINFLHSR
FT                   EAQEVFAEFGLRSVDADVAKATAERYPAINDLFTINEFGGWSKATPEYFGDDGVYAKVL
FT                   AQVQQ"
FT   sig_peptide     complement(303737..303808)
FT                   /locus_tag="Haur_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.395 at
FT                   residue 24"
FT   gene            complement(303805..305703)
FT                   /locus_tag="Haur_0260"
FT   CDS_pept        complement(303805..305703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0260"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; UspA domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ava:Ava_1495 sulphate transport system permease
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02912"
FT                   /db_xref="GOA:A9B6K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6K9"
FT                   /protein_id="ABX02912.1"
FT                   /translation="MSIVLDQLTKRYEHHTVVNRVALQIHDGEFFVLLGPSGSGKSTIL
FT                   RMIAGLAPVDTGRIVLHGRDVTDLNPQARDVGFVFQNYALFEHMTVDENVEFALRIRKV
FT                   ERKQRTERRDQLLDLVGLAGLGKRLPRQLSGGQQQRVALARALAHNPAVLLLDEPFGAL
FT                   DAKIRTDLRRNLRSIQRELGITTIFVTHDQEEAFELADRLGVMNMGRLLEVGTPNELYQ
FT                   RPQTEFVATFLGSANVLLGQCNDIGVQVGSMTFPLQTSSPAEHHPAVQVVIRPEDVVLA
FT                   RTEAALRCPALGQATVETQTFVGAFERIRLRLPALPDVHSIAPVRPFGEQAILIDALRN
FT                   PDEARNLPIQSGDQLWIGVRRLHALSQRGLNVLMLADNQPVAETALNIGGNLARLAHAR
FT                   ATVVARDGSEASLRARIQAVREQLGAGLPHLQTRLSTASLIETVRKETEHEPCDIVVLG
FT                   TEARNAERDATQLLSVAQQHVLLVPPSAKPCNKALICVSDGEPSKEDVAFAGRLLGSVG
FT                   ASATLVSVASHSNDIERLERFLQTSAASLRRHEVVTETKVLVGNVAQTINAEIKRGGYD
FT                   LVIVGAPLGAYSSNYDLGSVVGPLLSQISVPVLIIRSSYLQPMPERLALNVLETVA"
FT   misc_binding    306230..306332
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 73.11"
FT   gene            306391..307551
FT                   /locus_tag="Haur_0261"
FT   CDS_pept        306391..307551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0261"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: sco:SCO5646 putative solute binding
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02913"
FT                   /db_xref="GOA:A9B6L0"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6L0"
FT                   /protein_id="ABX02913.1"
FT                   /translation="MKRWLLSFLTIGSLVLTGCGAAATPTAETAIQPTPATTAAADVTP
FT                   AATQATQAPTDSGQFAGQTLVVVSHDSFAISSEVISGFEQMTGATVQILESGDAGEALN
FT                   KSILAKGAPLGDVLYGVDNTFLSRALDADIFEAYAAKNLEQIPAELKLDSQNRVSPVDV
FT                   GYVTINYDKAALAEAGLSLPTDLRDLTKPEWKGKLVVENPATSSPGLSFMLATIAHFGE
FT                   SSDYTWRNFWSDLRANEIKVASGWEEAYYGDFSGASDGQYPLVVSYATSPAAEVIFATT
FT                   PLTDAPTGNLLLPGGAFQQIEFVGLLKDAKNPELGKAWIDYMLSDTFQSDIGGQMFVYP
FT                   ALPSAKVPAEFTQYAQVPSNVTTLAPAEIAANRERWLNEWQETVLR"
FT   sig_peptide     306391..306459
FT                   /locus_tag="Haur_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.568 at
FT                   residue 23"
FT   gene            complement(307616..308188)
FT                   /locus_tag="Haur_0262"
FT   CDS_pept        complement(307616..308188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2993 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02914"
FT                   /db_xref="GOA:A9B6L1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6L1"
FT                   /protein_id="ABX02914.1"
FT                   /translation="MADTSDEKKARLDAIRAANAAKKAAAGEEPAPAPAAPVVAATTEA
FT                   PASAAVGANMSDDKKARLEAIRAAKKAAASDAPVAPVAVAATPTPAAAPVVAATPAAAP
FT                   AAPVAPKPAAPASNGNDLITANSIISLTMLGRLKRIVAGVAFCVLIGLGLATVTGEYLL
FT                   GGGFGALIGVVGGLMVGDWPAVKTTGD"
FT   gene            308571..310058
FT                   /locus_tag="Haur_0263"
FT   CDS_pept        308571..310058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0263"
FT                   /product="glutamate formiminotransferase"
FT                   /note="TIGRFAM: glutamate formiminotransferase; PFAM:
FT                   Formiminotransferase-cyclodeaminase; Formiminotransferase
FT                   domain protein; Formiminotransferase domain protein; KEGG:
FT                   aba:Acid345_2130 formiminotransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02915"
FT                   /db_xref="GOA:A9B6L2"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6L2"
FT                   /protein_id="ABX02915.1"
FT                   /translation="MGLVESIMNFSEGRRTEVVHAIRDAITAVAGVQLLDVQSDADHNR
FT                   TVISFAGEAEAVGEAAFQATRTAQGLINLDTHRGEHPRIGATDVLPFVPLGQTTMKQCV
FT                   ALARKVGKRIGDELGIAVYLYEEAATRPERQNLADVRKGEYEAWRKAIGVDPAREPDFG
FT                   PAVATPAGATVVGARQPLIAYNIYLNTTDVEIAKKIAKSIRYLGGGLRYVKALGLLVDG
FT                   RAQISMNLVNFRGTPIHRVQELVRAEAMRYGVTITEGEVIGLVPQDALVDAAEHYLQLN
FT                   RFRRDQVLESKLAAPSAGDDWLPTNTFQAFAAGTPTPGGGSAAALAGALAGSLGQMVAN
FT                   LTVSRKKYAAVKPSMQAALERLSEATTSLGKLALSDSAAFNAISVTRKLPEEQADRAQQ
FT                   LAAAIVHACEVPLQVAQQAASLFDDLYLLATQGNVNARTDAQVGGYLAYAAVNGAGLNV
FT                   LVNLGDLSDAQLREQFSAAVAKLRQQAEQGLQKLTTL"
FT   gene            complement(310748..312301)
FT                   /locus_tag="Haur_0264"
FT   CDS_pept        complement(310748..312301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0264"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: deb:DehaBAV1_0314
FT                   polynucleotide adenylyltransferase/metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02916"
FT                   /db_xref="GOA:A9B6L3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A9B6L3"
FT                   /protein_id="ABX02916.1"
FT                   /translation="MKISHIQLPQSSAYLSLRQALSVLKHLLGSQPAWVVGGTLRDLVI
FT                   GRPLHDVDLVVNQPAIGLAQSLAKQLNASLVVLDAERDIGRVVLADGKYLDLAHLRAAD
FT                   LTSDLTDRDFTINAMAAPLYEQAQLGQIIDPHAGLNDIATGTLRMVQANALANDPLRML
FT                   RAVRIAAQLGWQLDPATDQAIIAHAELINQVAVERVRVELLAILATRWSASWLRYLDRV
FT                   NLLPSLIPEIRPMYHHTQPNIHFLDVWEHSLETITAGEWLLAQLEHDQQPVPPAPPALA
FT                   DDWHPPAFFQQPATLRMLPNLTLQLQWAEQVVAQMQQPIGHTASNRALWKMAILLHDCA
FT                   KPATRVDKPDGSVSFHEHQTIGADIARAVYQRLRFSNQEIEYMCKVIAGHMRPGQLYSQ
FT                   PETTAKAAYRFFRDLKESAVDTLLHALADHMATRGPLLQEHHWAYQAAWTDAMLGFYWD
FT                   AEAEQKRVPLLDGHTLMQELGLAAGPQIGLLLEAIREAQAAGEVTDRESALALARRLHT
FT                   "
FT   gene            312379..312945
FT                   /locus_tag="Haur_0265"
FT   CDS_pept        312379..312945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0265"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rrs:RoseRS_4097 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02917"
FT                   /db_xref="GOA:A9B7E4"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E4"
FT                   /protein_id="ABX02917.1"
FT                   /translation="MSLTVTQTALDGVVIIKPSVFADERGFFLETYHQIKFADLGLPTD
FT                   FVQDNHSRSKQGVLRGLHYQDERQPMAKLVRCSVGSIFDVAVDLRVGSPTFGKWVGVEL
FT                   SADNFLQFLIPSGFGHGFVVLSEFAEVQYRCTGLYAPETEGAVRWNDPQIGIEWPISEP
FT                   TLSGRDQAAMSLADYLENPAFRYRG"
FT   gene            complement(313141..314760)
FT                   /locus_tag="Haur_0266"
FT   CDS_pept        complement(313141..314760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0266"
FT                   /product="Shikimate kinase., 3-dehydroquinate synthase"
FT                   /EC_number="2.7.1.71"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: shikimate kinase; 3-dehydroquinate synthase;
FT                   KEGG: rrs:RoseRS_4545 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02918"
FT                   /db_xref="GOA:A9B7E5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E5"
FT                   /protein_id="ABX02918.1"
FT                   /translation="MQPSGQSIALIGPSGAGKSTVGVGLAQALGWRFIDLDQLIIERAE
FT                   KSISDIFSQEGEAGFRERETAALVQALQTDQAVIACGGGIVLREINRQLLREQAWCVYL
FT                   TSAISTLVKRLTADQANPRPLLASDINEQLVIQLAERLPLYSTLANWTIQTDGLAPQIV
FT                   VEQLIRAWGLVGKPQVSEVFSSFNSRYYVKSGALAALPNELANLGLTGTCWLISDSHVG
FT                   PMYAPTLIQALENSGFSCQRYDIPAQEASKSWQQAGELYTWLLENGVQRGDTVLALGGG
FT                   VVGDLAGFIAASILRGIAVVQLPTTILAMIDSSIGGKTGINHPRGKNLIGAFHPPRLVL
FT                   IDDAVLSSLPRRERAAGWAEAVKHGVIADAQLFADLEQAGASLNDVPAKITSDLLVRSA
FT                   AVKIGVVNRDERETGERMLLNYGHTLGQAVEAATQYKRYVHGEAVAIGMTFAANLAVQL
FT                   GMWSSAEAERQRALLQALELPTALPRDLDIEATLAALNLDKKRAKGSVRWVLPTRIGHA
FT                   QVESHVDPELVRKLVHELVEQT"
FT   gene            315134..315985
FT                   /locus_tag="Haur_0267"
FT   CDS_pept        315134..315985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0267"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: rrs:RoseRS_3525 modification
FT                   methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02919"
FT                   /db_xref="GOA:A9B7E6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E6"
FT                   /protein_id="ABX02919.1"
FT                   /translation="MAITTVREALIEAASSLISASLTPQLDARVLLGHVLGLTQTQILA
FT                   AFNDQLSTEQVEQFQGLIERRSALEPIAYLIGSREFYGLMFNVDRRVLVPRPDTEILVE
FT                   QALTWIKQQQRPLVVADIGTGSGCIAVAVTKHAPTIKMYAVDLSPAALAVAQSNVERHG
FT                   LQQQIELIHGDGVSQLPEPIDLLLSNPPYTLLDEIEPGVRLHEPTLALDGGPDGLDCYR
FT                   QLLPATAAILRQGLPSAALFEIGAWQGSEVIALAQASFPQAKIQLVRDLAARDRVVQIE
FT                   QV"
FT   gene            complement(315982..317025)
FT                   /locus_tag="Haur_0268"
FT   CDS_pept        complement(315982..317025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0268"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; SMART: Allergen
FT                   V5/Tpx-1 family protein; KEGG: rrs:RoseRS_4116 allergen
FT                   V5/TPX-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02920"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E7"
FT                   /protein_id="ABX02920.1"
FT                   /translation="MRLRFLLMMILVIGSLSFSPKPAAAQTSLCFADVPGISNCISGRF
FT                   LSYWQQNGGLAVFGYPLSPAQSETTANGTFTTQYFERQRFELHPELAAPYDVLLGRLGA
FT                   EIYERNHGNWRNAPKTNPSTQGCLVFNETGRSVCEPFLSYWLNHGLLDGSLNAYEQSLS
FT                   LLGLPLTEPLLEQNPDGDWVMTQWFERARLEDHGAKGVLLGRLGAELKAQPTPSYPSEI
FT                   TALVDAINRQRNQAGLSSLTINPTLNQAAQIHSDDMARNNFFEHTGSDGSNAGQRMQRV
FT                   GYSWRAWAENLAAGYTDAQAIIDAWMQSPGHRANILYADVSEIGVGIARNPNSEYQIYW
FT                   TVNFGAR"
FT   sig_peptide     complement(316948..317025)
FT                   /locus_tag="Haur_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 26"
FT   gene            317238..319427
FT                   /locus_tag="Haur_0269"
FT   CDS_pept        317238..319427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0269"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART: AAA ATPase;
FT                   Tetratricopeptide domain protein; KEGG: gvi:glr1376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02921"
FT                   /db_xref="GOA:A9B7E8"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E8"
FT                   /protein_id="ABX02921.1"
FT                   /translation="MQRIGFPTFTTPLIGRDADVAALVTRLRQSPTRFTTLLGPSGTGK
FT                   TRLSIQIADRLHAEFRDGVAFISLATLDDPDLVIPTIARTFGLAERGSLVYEEALVQFL
FT                   RERQYLIVLDNMEQVIEAAPHVIGLLSQTEHVRVLVTSQQAANDPQEEVIPIPPLAIPL
FT                   GGGSVQIETISMSPAVALFLDRIRRVRPEFMLDPNNALHIVEICRRLRGLPLAIELVAA
FT                   HSDKLRPADLLLLLRNYLPAEQNVGAAPAPEQVLHPVLDWCISYSIPAIRWLLPRLGVF
FT                   QGEWTLNQVQLLANEAPNTIDIAKTLEAMVAKGLLLSNAASEEPTYSMLDTIRQYAARQ
FT                   LKRNAQLDHACHELHAKAFQQLAIDIDTGIRQGQGMVWSKCLNQAMPNVRSALQWLYQQ
FT                   QRYSEIARLISSMVLPLFQQGYIREGLSWIARIGAHAASFEPEIQLHFGYANGLLSYAI
FT                   SDYPSALQAYGAALTHAKTLGDLDYQARLLNNQGMIYAEQTNYEAARQAYEAALTIRQQ
FT                   QSNVWGEAIILNNLGSVTQFQAEHQAAREYFQASLAIYQQMGDQMSQAVSFQNIAGTHL
FT                   NMHEYAEAEHLYRESIAIHRQNEESPPLIMALYGLGLALLRQNADERRESGEVLHQAVT
FT                   MAARLNVQRSLAIAFEGFAEWLATSNPEHAAYLVGGAASLRNACDVGYSAVSWRDITSL
FT                   REQLDRNLGQAERQAAEATGEALSQAELLLLVSQA"
FT   gene            complement(319418..319915)
FT                   /locus_tag="Haur_0270"
FT   CDS_pept        complement(319418..319915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0270"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sme:SMc00380
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02922"
FT                   /db_xref="GOA:A9B7E9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7E9"
FT                   /protein_id="ABX02922.1"
FT                   /translation="MHDQVDSFIAEWQRERPELDATPMGLIGRIARLEQHLSRDLARIF
FT                   GQFGLQRGEFDVLASLRRSGAPYQRSPTALFNTLMLSSGAMTNRLDRLADRGLIERIPD
FT                   PHDRRSLLVQLTAEGLDLINRAVEAHLANEQRLIASLSSEQREQLATLLRCWLLDLEPN
FT                   QA"
FT   gene            complement(320214..320564)
FT                   /locus_tag="Haur_0271"
FT   CDS_pept        complement(320214..320564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0271"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02923"
FT                   /db_xref="GOA:A9B7F0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F0"
FT                   /protein_id="ABX02923.1"
FT                   /translation="MVPQTIAVVNNDVALLDLLQEFLLEAGYATTTYLTTDLTYQQLRD
FT                   SQPSLIILDVGLQASAPGWPLLKLLHFDPNTVQIPVLVTTVDHAFIQGKQLAAMCSNFR
FT                   PVLPTSLPTLQH"
FT   gene            complement(320711..321139)
FT                   /locus_tag="Haur_0272"
FT   CDS_pept        complement(320711..321139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0272"
FT                   /product="protein of unknown function DUF1452"
FT                   /note="PFAM: protein of unknown function DUF1452; KEGG:
FT                   pol:Bpro_2306 protein of unknown function DUF1452"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02924"
FT                   /db_xref="GOA:A9B7F1"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F1"
FT                   /protein_id="ABX02924.1"
FT                   /translation="MYSVKTKSRFTQVSKWTAHITGRPRTFGLAVGVIFLWMISGPLFG
FT                   WSDTWQLVINTSTTIITFLMVFLIQNTQTRDSEAIQIKLDELIRATQGAHNALLDLEEL
FT                   EEDELDQIRATYQRLSERAREAIRHGLVDTDNPEPEAS"
FT   sig_peptide     complement(321002..321139)
FT                   /locus_tag="Haur_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.946 at
FT                   residue 46"
FT   gene            complement(321424..322119)
FT                   /locus_tag="Haur_0273"
FT   CDS_pept        complement(321424..322119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0273"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; KEGG: rfr:Rfer_1963 protein of unknown
FT                   function DUF125, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02925"
FT                   /db_xref="GOA:A9B7F2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F2"
FT                   /protein_id="ABX02925.1"
FT                   /translation="MVTSHREQHRTQHIGWLRASVLGANDGIVSTASLVVGMAASNASH
FT                   QSVVVAGIAGLVAGAMSMAAGEYVSVSSQADTERADIDRERMELAVDAHAERAELAAIY
FT                   GRRGLDASLAEQVAEQLMLKDALAAHARDELGISETMSARPIQAALASAAAFAVGAILP
FT                   LMTAVLAANSYLVVLVTGTSLIFLTLLGILAAYTGGSSIIVGAMRVAFWGALAMALTAG
FT                   VGAIFGTAV"
FT   gene            complement(322367..322894)
FT                   /locus_tag="Haur_0274"
FT   CDS_pept        complement(322367..322894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02926"
FT                   /db_xref="GOA:A9B7F3"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F3"
FT                   /protein_id="ABX02926.1"
FT                   /translation="MVIGVLFTCGGLVTTGAGIFINRFVAEQLRSQQITTPADASIPNA
FT                   PVTGIATALSMAALIQHHAADSSNGLSYAQMGRFAVASGDPSGTNTVDAALKDAKGQPV
FT                   ANQARTTQLTAAGLVTSLSLSAMALGASYGAMALGLGFFILGLIITGLGYALRGLITPE
FT                   VAARFGIQPVSV"
FT   gene            complement(323004..323483)
FT                   /locus_tag="Haur_0275"
FT   CDS_pept        complement(323004..323483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B1269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02927"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F4"
FT                   /protein_id="ABX02927.1"
FT                   /translation="MLCLLARIRIQGVTMIDPIPVPNGAPRLRDHPITRGIGNNQILHL
FT                   ADAVDHLVNEVHPAIHGHRQITLFRQAPVTLVLFVFDAGGELPDHVAQGIVSIQVLNGR
FT                   LSIQIAGNDHRLDAGQILFLNPAIAHSVRAEIASTMLLTVHHMESITMAQTTVES"
FT   gene            complement(324254..324688)
FT                   /locus_tag="Haur_0276"
FT   CDS_pept        complement(324254..324688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0276"
FT                   /product="XisH protein"
FT                   /note="PFAM: XisH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02928"
FT                   /db_xref="GOA:A9B7F5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014919"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F5"
FT                   /protein_id="ABX02928.1"
FT                   /translation="MLSHTTMSSILIPALERQGWLITHQPLRMLWYGIESQLDLAANSN
FT                   SHSSIAIAIYPPHDDSSVPPLTCFLGQALVTQAILGRLDPMCTLYCALDRALFTALLVA
FT                   PLRDLLRSAYQMRFIVVDATQEESIQWIPAQAPAQSLNWS"
FT   gene            complement(324767..325180)
FT                   /locus_tag="Haur_0277"
FT   CDS_pept        complement(324767..325180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0277"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: vvy:VV1158
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02929"
FT                   /db_xref="GOA:A9B7F6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F6"
FT                   /protein_id="ABX02929.1"
FT                   /translation="MVPQTIAVVNNDLALLDLLQELLLEAGYATTTYLTTDLTYQQLRD
FT                   SQPSLIILDVGLQASAPGWPLLKLLHFDPNTVQIPVLVTTVDHAFIQGKQAFLQAAGCD
FT                   VLELPASFTDLVAKVATLIGAPLARIIPTSDPP"
FT   gene            complement(325512..325901)
FT                   /locus_tag="Haur_0278"
FT   CDS_pept        complement(325512..325901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02930"
FT                   /db_xref="GOA:A9B7F7"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F7"
FT                   /protein_id="ABX02930.1"
FT                   /translation="MKAILGIITGILILLFAAIGFQNTTAISIHLFDWQTPALPLWMLL
FT                   LAALASGMLVVGLFAFPRQIETYYTNLRERGQATPVQRPLIPIDAAMPPPTTMPLAVEA
FT                   GPQHYNPQTGERLDPWIDDAPKRTV"
FT   sig_peptide     complement(325833..325901)
FT                   /locus_tag="Haur_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.316 at
FT                   residue 23"
FT   gene            326623..328218
FT                   /locus_tag="Haur_0279"
FT   CDS_pept        326623..328218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02931"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F8"
FT                   /protein_id="ABX02931.1"
FT                   /translation="MRIIHRSEQTIQTAHHYAERAAHHGDAVFDGVSIPPEISARNWAL
FT                   EGTVHSTKIVTNQLDSTRYFLGPQVCITHDDNRRTTWAAHVEHAQADQAHGQLILSQFI
FT                   GPNPAAAAASLSPAMRYVPQLERTIIAEGEIWRYHLTLNKFTGTIVTTWITRSAKGLQL
FT                   WLDGTLVNTESSEVDFPFFGLSQVAVGHVATAPPPFGLLSYKCRNTGRLFIRRYVDGQL
FT                   GPEVGLDVGEIRGGLSFGISGKQILARVDRITAGGLVPTLLRSADGGKSFDKPHAIDLG
FT                   GYDQDFKLIPGYTEPIVDKGGAFHVPIILSNGRESVALNYIPEHETIVEAIRVTGGNPL
FT                   GKLAVFPSTVGSKTSFGNGTSDGHGLIMILATEGRLFTSNSSAGGIYFPEAVLLNHEMP
FT                   LIAGFAASECYSSGLKPNIVSMDYIYLEANSIGQVASPTLHYETWDMPLPLPQATAKSK
FT                   GASVAITIQSDADVEPGKVVFNFDDPSIVITNSTITSLRTATLETNTPKLSGKKVSFDI
FT                   LTLFHRHYGEAMID"
FT   gene            328713..329921
FT                   /locus_tag="Haur_0280"
FT   CDS_pept        328713..329921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0280"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_2942
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02932"
FT                   /db_xref="GOA:A9B7F9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7F9"
FT                   /protein_id="ABX02932.1"
FT                   /translation="MKPNGMQILFIDHDGHGIPIIASIITAIQTVQYRLIAVSDLHHGL
FT                   SMLATRRIDAILVRLSLTDNTGMIIQTLSDHASTYPLILSSPNTDDHTLIPMLHGGVHA
FT                   TLFDDELTPALFQRTLDYGFARVAQLAAEDHVQTLTSTLAVALDTTHQIEHHLAIAIHE
FT                   LQTPISILLGYIDLFERRVATWGGIPLRERQMINTMRMQAIHVGRLVPTLLDSTLMTHE
FT                   LGPIQRRSLELSAVLRTVVGAMQGMRASHLLVLRVPDAAVWIEGDYGRLVQIFQNLLLN
FT                   ALHYSGMHSEITITLAADGQITIQDYGVGISADALVQIARPFFDTADPHGAARIGQGLG
FT                   LAIVQELIQQHEGSITIASTVDHGTTITIQFPWSVRPTRLPEHPASMPVNYPTITDIQG
FT                   STL"
FT   gene            329918..330190
FT                   /locus_tag="Haur_0281"
FT   CDS_pept        329918..330190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02933"
FT                   /db_xref="GOA:A9B7G0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G0"
FT                   /protein_id="ABX02933.1"
FT                   /translation="MKKRSVLLWLSLIGGLMLLGSASPQPQVTIGGLTIPVWQMLMAIV
FT                   LTMLSGLVLRFIAHQYHEYRTLYNHPPTHWNQWPDDPLPSKPSIR"
FT   sig_peptide     329918..329986
FT                   /locus_tag="Haur_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 23"
FT   gene            330219..330530
FT                   /locus_tag="Haur_0282"
FT   CDS_pept        330219..330530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0282"
FT                   /product="XisI protein"
FT                   /note="PFAM: XisI protein; KEGG: ter:Tery_0527 FdxN element
FT                   excision controlling factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02934"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G1"
FT                   /protein_id="ABX02934.1"
FT                   /translation="MVACSTTTIIETVLIATLCPDTTGTCAVQTVFDREQQHYMVVVAG
FT                   WHGQHRIHRCLVHIAYHDERVWIHCDHTIHGIPERLIAAGIPATRILQVFPLAGLRMP"
FT   gene            330571..331035
FT                   /locus_tag="Haur_0283"
FT   CDS_pept        330571..331035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02935"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G2"
FT                   /protein_id="ABX02935.1"
FT                   /translation="MDSHWFTPDHQHYFQVGIDSYPHPVPVTNALRCLLFGFSQQDHPL
FT                   VIHPLTFAEPNHFGTFTQRWMSPQMQGNAIAGWTGFMALRYLLGYFSQWVLLPPAIRYQ
FT                   AWHPTARTVTPPVQVIAAIRAWDVGWEHQLDNLLPRIETLRHPQYAALAG"
FT   gene            331065..333407
FT                   /locus_tag="Haur_0284"
FT   CDS_pept        331065..333407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0284"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sat:SYN_01902 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02936"
FT                   /db_xref="GOA:A9B7G3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G3"
FT                   /protein_id="ABX02936.1"
FT                   /translation="MPTPIRSILIIGNYAPRQCGIATYTTDLRMALLDAYPQSRIDVMA
FT                   MNDTPAGYDYPDSVVFTIDQDDPYAYYQAADFIRLSSYDLVCIQHEYGIFGGASGRNLL
FT                   LLIRAITIPIVTTLHTVLREPTADQHTILWELAQRSQRIIVMSSHAVDLMHTIYGIPLA
FT                   QIDCIPHGIPDLPFRDGYEDKQHANLIGKQVLLTFGLLSPNKGIEDVLHALPLLIKQHP
FT                   HVLYLIVGATHPTVRQTFGEAYREMLQALVEQLGIQAHVRFHDQFVSSSALAIYMGAAD
FT                   IYITPYHTQEQSVSGTLAYAIGAGKAIVSTPYWYATELLAHGGGMLVPFHDPALLAEQV
FT                   NTLLAEPQLRQTIRERAYQRGRTMLWSVVATHYMHSFMQARTHPLHPVLVLANQPIKSD
FT                   SPIIPPLCLDHLIAMTDDMGLIQHAILNIPNHHEGYATDDNARALIATMLLDPIQEPQA
FT                   QRLAMRYLAFLWYAFNPATQRFRNFMGANRQWLEATGSEDAHARSIWALGTVLEQSHDP
FT                   GLCGVAQRLLRFALPAVAQLTHPRPWALALLGFAAYRQRFPGDRTVMASQLHLAEQLLS
FT                   RFQAAHQPDWEWFDDHLTYDNAVLPHALIVSGQTLQRPDMVEAGLTALTWLCAIQRPEA
FT                   DHFKPIGSNGFFQRGQAPAHYDQQPIEAQATVLAACAAFESTGDSGWYDEAQHAFYWFL
FT                   GHNDAGVALYDPRTGGCADGLEIDRINQNQGAESTLAFLIGRLTMQTITPPIRRGTAEN
FT                   TSASVTRPPRIRADLIPPRDPNPSRPL"
FT   gene            333436..334392
FT                   /locus_tag="Haur_0285"
FT   CDS_pept        333436..334392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0285"
FT                   /product="glycosidase PH1107-related"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   sat:SYN_01903 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02937"
FT                   /db_xref="GOA:A9B7G4"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G4"
FT                   /protein_id="ABX02937.1"
FT                   /translation="MMMQPNRLDLFARHPANPILQASDWPYPINSVFNPGATVLADGTT
FT                   LLLCRVEDRRGHSHFCAARSANGLDHWQIDAHPTFAPDPQQYPEERWGIEDPRITYLEE
FT                   LAAYGVVYTSYATGGPGVSLATTTDFKTFTRYGVVMQPENKDAALFPVRINGLWAMIHR
FT                   PIGAQGSHIWMSLSPDLRHWGQHQCMLEARKGGWWDANKIGLSPPPIATEEGWLMIYHG
FT                   VRMTPGGCLYRLGVALFDTEHPERCLRRGEPWVLSPHTEYERHGDVPNVIFPCGVTVLP
FT                   DGDTLHVYYGAADSCVAVAIGSIRQILDWLTIYGVAT"
FT   gene            334675..335556
FT                   /locus_tag="Haur_0286"
FT   CDS_pept        334675..335556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0286"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: reh:H16_A0077 predicted PecM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02938"
FT                   /db_xref="GOA:A9B7G5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G5"
FT                   /protein_id="ABX02938.1"
FT                   /translation="MLLTAIAPILWGTTYVITTEWLPANRPLLVGVMRALPIGLIFLAL
FT                   GRQLPKGIWWWRSLVLGALNIGFFFPLLFIAAYRLPGGIAATLGALQPFIVAFWGWVVL
FT                   KERVTSRLLLMAGLGVLGVGMMLLNPQAQLDAWGMLAAFGGAMLYGVGITLNKHWGRPV
FT                   PLLTYTAWQLVVGGLMIVPIALLIEGLPPAFTTSNWLGFGLIGLVNTGVAYLFWFRGIE
FT                   RLKTSTMSFLILLSPVSATVLGWLVLDQRLSWLQMLGALVVLASIVLSQLPSRQPTPRL
FT                   QVQPAADSALTP"
FT   gene            complement(335656..336636)
FT                   /locus_tag="Haur_0287"
FT   CDS_pept        complement(335656..336636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02939"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G6"
FT                   /protein_id="ABX02939.1"
FT                   /translation="MSTNIDHHIGVEITFDQNPSRTHFAHYYYRAELYYGVDDKQAWCF
FT                   TMLLDEDRHVMPGETVQACLWFLSPQYQLGQLTVGTPFWLRSAQRLDGTGHVTQITNLE
FT                   QAVRAKSKYDLPVEVTFLAMPANNPSQVYSLFYGKHLNEYDLHNGYIKLAAGHTSIATK
FT                   PKHIPVPFEITAITLNQSEINNQPWFTEQHQWMITENYASNATFPTINNPILAKGQGIQ
FT                   LLEHKGRSFIANLTIAAKQLEQFQKATHMHYGFIYGRLFEGENYELNGTERLLILEEGQ
FT                   TVTIGQPVRGHLDLHGIKEHIKALPRGSKFVLRIADQTIAKGRVV"
FT   gene            337162..339660
FT                   /locus_tag="Haur_0288"
FT   CDS_pept        337162..339660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0288"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: rca:Rcas_0601 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02940"
FT                   /db_xref="GOA:A9B7G7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G7"
FT                   /protein_id="ABX02940.1"
FT                   /translation="MFFVLMVMQANQHIIELGKTLAAEEKAGCDDTATDHGISIFLREW
FT                   QAQHPQALHEPVVQGVLDALDGYSELSHAEREARLSVALDRLRNLFRKQPKAPAEPVGA
FT                   VPPIDTLLKTLQGIGPSTARSFAKLGVHTLEDLLYHVPHRYDDFSKRKQICDLVVGETD
FT                   TVIVTVDAIKSFNAKGRQGVEITVGDDTGVLKASWFRGTWMAKQFREGMRIVLSGKVSM
FT                   FREMKSMSNPQWEPFVEDDLVHTGRLVPVHPLTKGLQDRNARQVIKRVVDAVTPTLSDP
FT                   LPIELRERAGLLPLGVAISQIHFPDSWAMVQRARQRLGFDEFLYIQLGVLQRKRLYQGV
FT                   QGQPIAFNQAIHDAYLSSLPFALTNAQTRTFNEICRDLERPVPMTRLVQGDVGSGKTAV
FT                   AAAALVQAVAAGFQGAMMAPTEILAEQHYRGLKKLLANVKIPGRETNSNGDWRDELDQE
FT                   KRNRLAQIKQLLMLADEPEPEPGGIRVALLTGSLKARQRREALKLIADGEVDIIIGTHA
FT                   LIQANVDYQALGLAVVDEQHRFGVEQREALKRKGFNPHLLVMTATPIPRSLALTIYGDL
FT                   DVSVIDERPPGRQPIRTKWISSGERSKAYKHMRKEIAAGRQAFVICPLVEESEKLEDVK
FT                   SAIVEQEHLQHEIFPDLKVGLIHGRMTSSEKDTIMAQFRDREFDILVATAVVEVGIDIP
FT                   NATTIMIEGAERFGLAQLHQFRGRVGRGSHQSFCVLVSDKEDNDVTVARLSSMEESEDG
FT                   FRLAEIDLELRGPGEFFGIRQSGTPDLKVAQLTDTRLLHAARIEAERILKLDPELELPE
FT                   HAKVREKLQAFWAGMETQSN"
FT   gene            340088..342199
FT                   /locus_tag="Haur_0289"
FT   CDS_pept        340088..342199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0289"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain protein; protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain IV; KEGG: rrs:RoseRS_4540
FT                   translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02941"
FT                   /db_xref="GOA:A9B7G8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G8"
FT                   /protein_id="ABX02941.1"
FT                   /translation="MKEYGPDRIHTIGLFGHGGAGKTTLAEALLFASKALPRMGRVEDG
FT                   STVSDYDPDEVKRHASINLSVIPIEWNGNKFNFIDVPGYADFRGEAAAALRVIDGMVLV
FT                   LDAAGGVEVGAELLWQMAREANIPRVVFINKLDRENANFQRTVEQAKGLLSEAITPVHM
FT                   PIGSGANFKGIVSLRKRKAWLHHNGKDGAYEIAEIPAEIRQEALQMADGLIEKIAMTND
FT                   HLIEEYLEGGADALSAEEIRQGFQAAINAHTIMPLFIGSATTLSGIPQLLDGILDAIPS
FT                   AANRLTTAHDLRNDDDYFLEGKADEPLSALVFKTLVDQYVGRLSFFRVFSGEIHSNSVV
FT                   RNARTGREERIGQLFQMRGKEQTPVSSVSAGDLGAVAKLADTLSGDTLYNPENPLRLRS
FT                   VSYPEAAFTAKVTPHSKNDLDKLGNALHRIVEEDPTLHLGRDIQTGETLLAGLSETHLN
FT                   FVAERVKRKFDVHFDLAIPSVPYRERISSTATATYRHKKQTGGAGQFAEISLRLEPLPT
FT                   DPNRADPLEFVSEIVGGVVSRSFWPAIEKGIRESMALGVLSGHPVIDVKAAIYDGKEHP
FT                   VDSKEIAFKTAGKFAFREAARKANPVIIEPIYALKINVPDEYVGDILSDLNGNKRGRVQ
FT                   GMEQIGHSRTLITAHVPLAECQRYATDLRSITQGRGDFVMRLDHYDDVPHSVAQTIIAN
FT                   SKQQHDDDE"
FT   gene            complement(342409..342630)
FT                   /locus_tag="Haur_0290"
FT   CDS_pept        complement(342409..342630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0290"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: cac:CAC1274 30S
FT                   ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02942"
FT                   /db_xref="GOA:A9B7G9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7G9"
FT                   /protein_id="ABX02942.1"
FT                   /translation="MVRSALKTLVKKSAQSVNAKNEASKESLAAALKALDQAAAKGIIH
FT                   KNQAARRKSRLVRRFNIANGIGTRTTVQ"
FT   gene            342799..344640
FT                   /locus_tag="Haur_0291"
FT   CDS_pept        342799..344640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0291"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: rrs:RoseRS_3077 integral membrane
FT                   protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02943"
FT                   /db_xref="GOA:A9B7H0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H0"
FT                   /protein_id="ABX02943.1"
FT                   /translation="MSNESLSTTPAPAPSPLRKRSMSALLNSAIVMLGYLLSRVIGIVR
FT                   QTVLSSYFGTNIVSDIYTTAFQIPDLLYLVIIGGALGTAFIPIFIEAYTKETHERAWQV
FT                   ANLVINAALTVLSVVSLAILLLADPLLRWLNPTYTPEQLGLAIYLVRLFMLSPLLLGLG
FT                   GLAMATLNALDHFTLPALVPVIYNVAIIAGIVLIGPLLVRFGWVQHSISVVEHNGQPVS
FT                   IEGAAWGVVLGALLYLVCQLPVLYRSGFRYRVLFNWRDAALRRIGLLMGPRVFGQAAMQ
FT                   INTIAIFSFAKLFGDGRATALSNALTLMLLPHGIFALSLATVMFPQLSRLDAAGDHEGF
FT                   NQTTRNTLGTVLWAIIPAAAGLIMLATPIVQVLFQRGNFDSQSTLWVVQALMMYATALP
FT                   AFGAAEILIRGFYARQETTIPVVIGVVTVALNIGLCWLLTQFSTSHIGLAGAFSITNNL
FT                   ELLLLLVMWRRRNGNLDATGQLRRSLLITLVSSLAMVLVLQAPVLALLLVGLLMLNYAW
FT                   RRWGRQRWPQAGQAPIWLGLALATLAGLGLGWQLQLFDLATWLQIAPQAQSLWRLLGSL
FT                   VFNGLLAIAVYFGCSSVLGASEAAVWQRRILGRLKRR"
FT   gene            344753..345178
FT                   /locus_tag="Haur_0292"
FT   CDS_pept        344753..345178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02944"
FT                   /db_xref="GOA:A9B7H1"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H1"
FT                   /protein_id="ABX02944.1"
FT                   /translation="MANRRISTIVMAVLGVLMLVGLFLPYLKSTTTDFSISVFQTFGSD
FT                   LKGLVPEDSKTLYMIIAAAVAVGGLFALLSLTGKKVFGVFSIIVSFLIAAFHGLLTAGL
FT                   SGERDVVQGLGFWLLLGVSLALFITSIVFVARKPKLA"
FT   sig_peptide     344753..344839
FT                   /locus_tag="Haur_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.419 at
FT                   residue 29"
FT   gene            complement(345231..346766)
FT                   /locus_tag="Haur_0293"
FT   CDS_pept        complement(345231..346766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0293"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   cth:Cthe_0269 glycoside hydrolase, family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02945"
FT                   /db_xref="GOA:A9B7H2"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H2"
FT                   /protein_id="ABX02945.1"
FT                   /translation="MKQALHSRWLILVMLVGLGLSLPRQQSASANPQAFSFPYNQASGI
FT                   NYNVTDLTQAWNEWKSAQITSNNAGGGGRLRVLGGVSNSTTVSEGQGYGLLFASLFDDQ
FT                   ATFDGLWLFTRDYFTSRGLMHWHIGNPGQINGSGAATDGDEDIAMGLVNACIKVQQGVW
FT                   PASSNGLNYCTLASTMINNIYTYEVDHAGSNPPAGLPNNQGNELLPGDSWSTATEYTQG
FT                   IVNLSYFSPGYSTVFGKFTNKNTEWAAVNTRNYAITNLVQAKAGNCSKLVPNWNQYDGD
FT                   VQYVSWQPEESAWWSYDAARFAWRIAIDKAWYNTSNSRETMNEIGGFFSSVGIDNIQAR
FT                   YRLDGTSVDNYRGVFFVANAAAAIWAAPAPQAVNCGAATASLKTTPQQAYNAVLATKDT
FT                   PNSYYPNAWRLLSMLLLTGNFPNLYEMAQSGTGGTATPTITPTITRTPTATATRTATAT
FT                   PSNTPTRTSTGTPATITITPSRTPTATITPSRTPTVVPNLNFRMYLPFAKSNS"
FT   sig_peptide     complement(346680..346766)
FT                   /locus_tag="Haur_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.557 at
FT                   residue 29"
FT   gene            complement(346850..348679)
FT                   /locus_tag="Haur_0294"
FT   CDS_pept        complement(346850..348679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0294"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: cellulose-binding family II; glycoside
FT                   hydrolase family 8; KEGG: cth:Cthe_0269 glycoside
FT                   hydrolase, family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02946"
FT                   /db_xref="GOA:A9B7H3"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H3"
FT                   /protein_id="ABX02946.1"
FT                   /translation="MLKHRKMLLMVALLTLLTVPWWQSKAAQGNSVSPLLFPYNQASGI
FT                   NYNVTDLTQAWNEWKSNMITANNAGGGNRLRVMGGVDSSSTVSEGQGYGILFASLFDDQ
FT                   TTLDGLWLFTRDHLDPNGLMHWHIGNPGQLRGSYAATDGDEDIALGLVNACVKVRKGVW
FT                   PNSSNGLDYCSLATTMINNIYTYEVDHPGSSPVAGLPSNPGNELLPGDGWNLARDYPEG
FT                   IVNLSYFSPGYFTVFGKFTGKTSEWEAVNTRNYEITNLAQSRPGNCSKLVPNWNQYDGD
FT                   AQLVSWQPEEYAWWSYDAARFAWRVAVDKAWYNTASSRETMNEVGGFFSSVGIENVQAR
FT                   YRMNGTSVDNYRGVFFVANAAAAIWAAPAPQAINCGAATGTLKTSPQQAYNMVLTTKDS
FT                   PNSYYVNAWRLMSMLLLTGNFPNIYELANGVTPTNTPVPTSVPPTNTAVPTNVPPTNTT
FT                   VPPTSTPRPTNTPVTITPILTPIPTLTPIPTTVPTSVPPTNTPIAGACQITYSISNDWG
FT                   SGFTADVSIRNNGTAINNWNVRWNFAGNQQINNLWNGTVSQTGQAVSVNNVGWNGYIGS
FT                   GGTASFGFQASYNGSNPKPTSFSLNGTACSVAP"
FT   sig_peptide     complement(348599..348679)
FT                   /locus_tag="Haur_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.681 at
FT                   residue 27"
FT   gene            complement(348845..351409)
FT                   /locus_tag="Haur_0295"
FT   CDS_pept        complement(348845..351409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0295"
FT                   /product="glycoside hydrolase family 48"
FT                   /note="PFAM: glycoside hydrolase family 48;
FT                   cellulose-binding family II; KEGG: sco:SCO6546 secreted
FT                   cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02947"
FT                   /db_xref="GOA:A9B7H4"
FT                   /db_xref="InterPro:IPR000556"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023309"
FT                   /db_xref="InterPro:IPR027390"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H4"
FT                   /protein_id="ABX02947.1"
FT                   /translation="MSRHYYARGAMLLALLTMIGGLLTTQNAKPTAAAASCVVTYRIPN
FT                   DWGSGFLGDVNIQNNGAAISSWTVGWSFAGNQQITNLWSGIVTQTGNQVSVRNAGWNGT
FT                   ISSGGAVNFGFQGTYSGANAIPTVFTLNGVVCGETNPNPTATTPPTATTRPTNTVVVPT
FT                   NTPRATNTTVPPTNTAVPPTSTTRPTNTAVPPTATNGPTSTPRPTNTPTVVPPTSTPTQ
FT                   PGDDTYDQRFLEMYAELKNPANGYFSPEGVPYHSIETLIVEAPDYGHETTSEAYSYWLW
FT                   LEAMYGEATGNWQPLADAWRNMEMYIIPTSQDQPSSGSYNANSPATYAGEWELPSQYPS
FT                   QLQTNVSVGQDPIAAELRSAYGTSDVYGMHWLLDVDNWYGYGRRGDGTSKPSYINTFQR
FT                   GAQESVWETVPHPSWESFNDGGPFGFLNLFTGDASYARQWRYTNAPDADARAVQAIYWA
FT                   KVWADEQGGSPIVNGLVTKAAKMGDYLRYAFFDKYFKQIGCTSTSCPAGSGYSSAHYLL
FT                   SWYYAWGGSIGNGGGWAWRIGSSHNHFGYQNPMAAWILGSQPAFKPASTNGARDWNTSL
FT                   TRQIEFYTWLQSSEGAIAGGATNSWNGRYEAAPAGTSTFYNMAYDEKPVYHDPASNTWF
FT                   GFQAWSMERVAEYYYASGDVKAKNVLDKWVTWALANTTLTSNGSYEIPSTLAWSGQPAT
FT                   WNASNPAANTNLHVTVVDKTQDVGVAAAYAKTLMYYSAATKRYGTQHVASQTMAKELID
FT                   RMWSEYRDDKGVANPETRRDYNRFDDPVSVPNGWTGTMANGDPINNSSTFLSIRTKYED
FT                   DPAFPAVQAYLNGGPAPTFTYHRFWAQADIAMAYAEYDRLFQ"
FT   sig_peptide     complement(351323..351409)
FT                   /locus_tag="Haur_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.725 at
FT                   residue 29"
FT   gene            complement(351585..354125)
FT                   /locus_tag="Haur_0296"
FT   CDS_pept        complement(351585..354125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0296"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9;
FT                   cellulose-binding family II; type 3a cellulose-binding
FT                   domain protein; KEGG: tfu:Tfu_2176 cellulase, cellulose
FT                   1,4-beta-cellobiosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02948"
FT                   /db_xref="GOA:A9B7H5"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018221"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H5"
FT                   /protein_id="ABX02948.1"
FT                   /translation="MMSTPLERSSRRWRIIAGFVACLLIAGLIISPTTPTKAAEPLYRY
FT                   GEALQKSFFFYEAQQAGPKPSWNRVSWRGDSVLTDGADVGLNLSGGWFDAGDHVKFGFP
FT                   MAASATMLAWGAVEYRDAYAQSGQLDELLNNLRFVNNYFINAHPSPNVLYGQVGNGGKD
FT                   HAFWGPAEIIHLDDQAGPRPSYKIDATCGGSDLAGETAAAMAASSMVFRPTDPAYADTL
FT                   LSHARQLYTFADTVRGKYSDCITDATSFYNSWSGYNDELVWGAIWLYRATGEASYLSKA
FT                   EQYYANLSTEPQSTIKSYRWSIAWDDKSYGCYLLLAKLTGKQQYKDDTERWLDYWTVGY
FT                   NGQRVTYSPGGLAQLDTWGALRYSANTSFAAFVYSDYITDATKKARYHDFAVSQINYML
FT                   GSNPRNSSYVVGFGNNSPVNVHHRTAHGSWTDSLSNPVNQRHILYGALVGGPAKGSGDA
FT                   YTDSRNDYVANEVATDYNAGFTSALARMYSEFGGAPLASFPPIETPEDEFFVEAKVNAS
FT                   GPRFIEISGVLHNQSAWPARNSTKLSYRYFVDLSEVFAAGYGLSDVTVSTAYTQGSGVS
FT                   SLKQWAGTIYYVEIGFNGVNVYPGGQSESRKEVQFRLSLPTNTNAQQWDNTNDWSFNGV
FT                   GTSTDRVKTRRIPVYDNGVKVFGDEPGGSNVTPTATSLPTNTATPTVRPTNTATPTTGP
FT                   SATPTIRPTNTATPTVGPSATPTIRPTNTPTALPTNTPLPTNTPVAGACQVKYRVPNDW
FT                   GSGFLGDVTITNGGAAINSWNLTWSFAGSQQITNLWSGVVSQTGQNVSVSNAGWNGSLA
FT                   NGGSVNFGFQATNNGTNSIPASFSLNGAACTIVP"
FT   sig_peptide     complement(354009..354125)
FT                   /locus_tag="Haur_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 39"
FT   gene            354584..355606
FT                   /locus_tag="Haur_0297"
FT   CDS_pept        354584..355606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0297"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sru:SRU_0369
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02949"
FT                   /db_xref="GOA:A9B7H6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H6"
FT                   /protein_id="ABX02949.1"
FT                   /translation="MEQLTIRQIAQLANVSRSTVSRVINNHPSVRPEVRQRVLEVIREQ
FT                   DYVPQAAARSLASRRTNVVTLLIPRSSAIIFTDPFFPLIIQGITETCSERDYSVMLSMV
FT                   TGTQERDFYQRVLRSRMTDGLLMLSSDIDDPVLPLLINDQMPLVLIGEHPYMQPMYTVD
FT                   VANRAGAVLAVSHLLQLGHRRIGAITGLLQMKTAIDRRDGYKQALLQAGVAIEHSLMIE
FT                   GEFTQEGGYAAMRQLLSLEQRPSAVFVASDTMALGALRAIYEAGLHAPHDISLIGFDDV
FT                   PGAAYTTPALTTIHQPIQKLGSTAATMLLDHLEGRPPLQQHIRLSPSLVLRQSCGPRVA
FT                   "
FT   gene            355734..357194
FT                   /locus_tag="Haur_0298"
FT   CDS_pept        355734..357194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0298"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ttj:TTHB082 sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02950"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H7"
FT                   /protein_id="ABX02950.1"
FT                   /translation="MQRSRRPFITWLSLLTLISMILVACGGAETAPTATTAPAATATTA
FT                   AQVEPTAADAPTEVAATAEPATAEPAGGDVVTLKLWHMPNGAAPADAIQAEIDAFEKAN
FT                   PGINVEPEMLDWGAAFQRIQTSVQGGEGPCITQLGTTWNPTFAAMGGLRPFTEEEITAM
FT                   GGSDSFVAASWATSQLQGMEGTFSIPWFADVRALAYRKDLLEKAGLKPEEAFKDWASFK
FT                   TTLATIQEQNPDVAGIAFPGRNDWNVWQNSSMWIWNSGGDLLSSDLSEATFNSEAAVAG
FT                   VSEFANLYSSKLTVTNTLELNSAQVDASFGDGRTFSAITGPWLISNARTAADAGGWANR
FT                   TVADNLAYAEFPAGPGGSYTFVGGSNLAILKSCENADAAVKFVQFLAANESQLRYSQAI
FT                   GMLPATKTAQADASIASDALYSVFIAAAAKGKTSAPIAEWGQVESVLNEQLGSLWDDVA
FT                   TAGGPVSAEVVKTRLDQAAQTVNELLGN"
FT   sig_peptide     355734..355826
FT                   /locus_tag="Haur_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.739 at
FT                   residue 31"
FT   gene            357273..358250
FT                   /locus_tag="Haur_0299"
FT   CDS_pept        357273..358250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0299"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_1019
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02951"
FT                   /db_xref="GOA:A9B7H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H8"
FT                   /protein_id="ABX02951.1"
FT                   /translation="MALAPKKNKLSLWQRIRQNSLAYKFIAPTFVAMMIVHLIPIVQGL
FT                   YLSLLDVRLTTLTLYLKAPFVGLKYYIEVFNAIFGIGEAGASSRVTGLINAASNTLVYT
FT                   IWTNIGTLGLGLILAMLLNREFRWRGIARTLVLLPWVVPTFVTGTIFNFIWLEQGGLAN
FT                   KILLGLNIVDTPVTWLIGPNSLYALVIATVWRGLPFTTIMFLAAIQVIPTDLYEAASLD
FT                   GANGWQRFRHITLPLIKPIAGTQVLFGLINGFYGGYNIAVQMFGGGTGFAGEYADLLVP
FT                   AITRQTWERHLYGFGSAASVILMGMLLVFVGIWYRAFRDSLRAE"
FT   gene            358262..359155
FT                   /locus_tag="Haur_0300"
FT   CDS_pept        358262..359155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0300"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_1018
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02952"
FT                   /db_xref="GOA:A9B7H9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7H9"
FT                   /protein_id="ABX02952.1"
FT                   /translation="MGVSLSKKAESARPARATINYKAWLLDRGGDILLLVIIALMLLPI
FT                   IFLVVGSFKSREEFAVGSNFFPSDWRFENYSEMWTRVKFGTYFSNSLIICGITTLVVTI
FT                   LASMSGYALARFRFPGAGGLSMAILGTQLVPGTLFLIPLYMTFLWMKNNLGIPLIGTNF
FT                   GAIVLYVGFFLPISLWIQRSFFATIPIDLEEQAMVDGATRFQAFVYIVMPLAGPGVIST
FT                   AIFVFLTAWDELLFAWVLNVQTIPVGIRQFTGVAGSQNRYELLSAASVVIILPVAAMFF
FT                   LLQKRFIAGLTAGAVK"
FT   gene            359280..361604
FT                   /locus_tag="Haur_0301"
FT   CDS_pept        359280..361604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0301"
FT                   /product="protein of unknown function DUF608"
FT                   /note="PFAM: protein of unknown function DUF608; KEGG:
FT                   aba:Acid345_1688 protein of unknown function DUF608"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02953"
FT                   /db_xref="GOA:A9B7I0"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014551"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I0"
FT                   /protein_id="ABX02953.1"
FT                   /translation="MTEQRHHSSIPLAAWQRPLGLDYPNAAIAAHDHGPIIDDGVFHGL
FT                   PIGGMGSGAIGRNFRGDWSRWHLEVGKHVHRSVWPNQWSVFWQTASQQAAQVLCTTQPD
FT                   TDELSSWNWNYPVGAGNYHALFPRAWFDYQHPDWPLELVQEQFSPVLAGNLKESSFPVG
FT                   VFTWRVTNRGSETVRLGLMLTWEHTRAVEAAGLSLQRQHSAWNDGNTSGVTLTQTSDQA
FT                   LSSHNGTWALAVQAPESASVSQWTCWDVAQDAAALWQDFASDGQLADYPTSQKVAADQR
FT                   SATAIAVTLELAPGASAVIPFSLAWDFPIVEFADQSRWYKRYTRFWGTNGDQAQALAVA
FT                   SLTNADAWRTAIEAWQNPILADDQRPFWYKSALFNELYYLVDGGTLWVDRAVGGPEPAA
FT                   DDVGLFSYLECYDYPFYGTLDVSFYSSWSILALWPELERGEILAFSKTVNDADDTVVTI
FT                   VATQVPAIRKAAGALPHDLGAPKEQPLIKTNAYDFQDINNWKDLNLKYILRIYRDVSLW
FT                   NDQAMLEATWDTIPTALEYVHQFDSDGDGLLDHSGADQTYDTWAMSGAASYSASLLICA
FT                   LEAAIRLAQRMGDHAQADAWSEWLAAARQSFETKLWNGTYFRYHTADTDLREVIMADQL
FT                   VGQWYAGAIGLPAVAPREMIRSALQTVYRFNVMQYANGALGAVNGMHPDGTVDTSSNQA
FT                   SEVWSGTTYAIAAMMLQEGLDLEGWQTAWGAYNATYNELGLWFRTPEAWGIERTFRASM
FT                   YMRPQSIWAIEHALAVRAKNA"
FT   gene            complement(361701..362159)
FT                   /locus_tag="Haur_0302"
FT   CDS_pept        complement(361701..362159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02954"
FT                   /db_xref="GOA:A9B7I1"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I1"
FT                   /protein_id="ABX02954.1"
FT                   /translation="MSSAILWISIAVVMGLMLWSWSKRSERPSSMINFNQPPIKPTQTP
FT                   SFDSAKLDQAQIQLLLSQGKKLEAIKHVRLQTSLGLKEAKDYVEAIERGQSPLSPVVVE
FT                   PPVLQLPEDLLREAQIVAQQGNKIQAIKMVREATKLSLKEAKDLVESW"
FT   gene            362697..362885
FT                   /locus_tag="Haur_0303"
FT   CDS_pept        362697..362885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02955"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I2"
FT                   /protein_id="ABX02955.1"
FT                   /translation="MAAQLLEIHRQAIQQLSLIPAKGGCFEVEVNGQLLYSKLQTERHA
FT                   EAGEVEGLIAAYLDQQA"
FT   gene            362993..363946
FT                   /locus_tag="Haur_0304"
FT   CDS_pept        362993..363946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0304"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: cth:Cthe_2220 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02956"
FT                   /db_xref="GOA:A9B7I3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I3"
FT                   /protein_id="ABX02956.1"
FT                   /translation="MLVLITGSSGQIGTNLALRLLADGHEVFGVDQRVNTWTKAFEYVI
FT                   QDLGAPYRDFQGGIGGVPYPKPDVVVHLAANAKVHELVTYPHRALENVMTTYNVLEYCR
FT                   HQQVPIIFSSSREVYGDIHRYLTEEAQADFVYTESPYSASKISGEAFIYSYARCYNLPY
FT                   LVFRFSNVYGRYDNDIERMERVIPLFIRRMRDGQPVTVFGREKTLDFTYVDDCVDGIVR
FT                   GIERIVSGQVANQTFNLAYGEGNTLVRMAELIAEALQIEATINVQPSKLAGEVTYYVAN
FT                   IGRARQLLGYTPQVALADGLRRAVAWNIAWDEEQRR"
FT   gene            363943..366207
FT                   /locus_tag="Haur_0305"
FT   CDS_pept        363943..366207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0305"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   rca:Rcas_3423 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02957"
FT                   /db_xref="GOA:A9B7I4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I4"
FT                   /protein_id="ABX02957.1"
FT                   /translation="MTERSRQRGHQQLQTMRSKRIQARLLALSRVMNDIMNVDDPARLI
FT                   TAASAKLRQVLAVDAIAVWFYSPTSHRYLLSHFNNANHEDFSADDREALSALQVRSGEA
FT                   LAGRVVSEGHAISARNADEYRSMFGALGRRREALFNRWRALLPISFQVTGFTLGGNGRP
FT                   SGVIELFSSKPSINANSAAWLQPTLDQLGSLLQLVRQQADARSQRRRLAALDAVVTAIS
FT                   TSSDLPDLLNVALLVVIEVVSANGGAICLASPGGRSMTLAAQHQLPQREALLLGSSQAN
FT                   SVLEDVVYYGQPTLRPVISTSDLGEDIMGRAAMPLLAGGTIVGVLVLYGNYQTLSNNID
FT                   WPSLVSMGSQIGIAIANTRLYEESQRERQRLGTVIESIADGVAICNGVGELILANETAA
FT                   GLVEISILPTLATSSESGARYLDGTFVEADMLPFARALAGEVFRDYRLIVPGSQDQDVV
FT                   LSFSGAPLRRSVLIDSTETSFDGAVIVFRDITEQRRLEEAKDEFLAVAAHELRSPLAAI
FT                   KGYSDLLLRRELKQASEGRDLRGFITLSQQVNIMVQLVDNLLDVSRIDAERYTIQLDAV
FT                   DLGILLDSVVTHARQTANNHTLHFEQLNQSVVYGDSLKLRQVATNFLTNAIRYSPQQTN
FT                   IWVQVFSDEQFGYVQVDDQGPGIPQGQRERLFERYYRVPGIRRTGSSTEGLGLGLYLCR
FT                   EIITLHNGRIWVDSAPSGGARFCIAIPRFIPEKHETNTTQTTLDLDAFLFSPQPGRRND
FT                   E"
FT   gene            366200..366700
FT                   /locus_tag="Haur_0306"
FT   CDS_pept        366200..366700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0306"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: rca:Rcas_3910
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02958"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I5"
FT                   /protein_id="ABX02958.1"
FT                   /translation="MNSSVIAVLRRVDIFAGLNDLELSQIAQLCKVAKAKKGQIIFRED
FT                   SDGDDLYVVHDGAVEIQVQTRGSDGQHRLSTINTAYEGQAFGEIAMLGGGSRSATAVAS
FT                   MNPTTLLVINGPELSTLCDTNTAIGYRIMRNFINDMIYKLRSASLLLRGHIKWQDNQLS
FT                   QID"
FT   gene            367056..367967
FT                   /locus_tag="Haur_0307"
FT   CDS_pept        367056..367967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0307"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: dra:DR_2377
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02959"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I6"
FT                   /protein_id="ABX02959.1"
FT                   /translation="MATEKNVHQTERLLSVASGSALVAFGIMRRHLPVSLAAIAGGAPL
FT                   LWRGLTGHCPVYSALNINTAEPTTQAMWSKPTAPATPRIPIPTNHTNADQAGVDQAKAI
FT                   SVEQTITVDQPVAEVFRFWGNFENLPKFMHYLNSVKMFQNGTSHWEAKAPLGLSISWDA
FT                   EIADAKLNEYIAWRSLPNSTLPNQGRVEFNALSDEQTEVRVQLDYQPPAGTVGEAVAKL
FT                   FGNDPQKAIAEDLERFRKVIEDEEERTAVKANAVGEKPNANNPEYSDKLKVEAKTNKEE
FT                   SLENEDKAVDTSFPASDPPATW"
FT   gene            complement(368061..369203)
FT                   /locus_tag="Haur_0308"
FT   CDS_pept        complement(368061..369203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_5449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02960"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I7"
FT                   /protein_id="ABX02960.1"
FT                   /translation="MLPLQIVPVRNARQRQQFIHFPWKVYRGANPDPLWVPPLLIERER
FT                   FFNPKHGGFFAHGDVQLFLAQRGTEIVGTISAHINFLHNRTHNEHIGFFGFFEVLDDPE
FT                   AAATLLQTACAWVRDRGYKAIRGPMNFSINDECGLLIEGFELAPVMMMTYNPARYVEYI
FT                   EHQGFGKAIDLYAWIVDQRSYAEKGRGAKIERVAALAQAQTGLTFRKLNMRRFAEEVEA
FT                   GWHVYNQAWANNWGAIHMTLAEFRHLAYSFKPFLDPEVMIVAEDQGRMVGLLIAVPDIN
FT                   IPLRYSDGRLLPFGWLTMLRRKREIDQMRVLIMGVLPEYRRRGIDAVFYREVRNAGLKR
FT                   GYHTAEMSWILENNDVMNNTIAGLGGRRYKTYRIYEKKLS"
FT   gene            complement(369280..369630)
FT                   /locus_tag="Haur_0309"
FT   CDS_pept        complement(369280..369630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0309"
FT                   /product="protein of unknown function DUF419"
FT                   /note="PFAM: protein of unknown function DUF419; KEGG:
FT                   hch:HCH_06934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02961"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7I8"
FT                   /protein_id="ABX02961.1"
FT                   /translation="MSNHVDYAQARSYCLSLDDVIEDYPFGIEPLVFKIGDERGKMFAL
FT                   LVRSEPAQISLKCDPDRAEMLREQYPAITAGYHLNKRHWNTIVLDGSVPDEECLALIAH
FT                   SYDLVRPKRRKA"
FT   gene            complement(369614..370234)
FT                   /locus_tag="Haur_0310"
FT   CDS_pept        complement(369614..370234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0310"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: rca:Rcas_1729
FT                   aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02962"
FT                   /db_xref="GOA:A9B7I9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9B7I9"
FT                   /protein_id="ABX02962.1"
FT                   /translation="MFLIVGLGNPGEKYLNNRHNVGFQCVAEFARRHHLSFDGKRSDAR
FT                   IAEGLVNGQRVALARPQTFMNDSGKSVVGLVNWYKIDPASELLVVYDDLDLPFGTIKLR
FT                   NQGSSGGQRGMNSIIQLLGTQKFARLRFGIGRPPEGWEVINFVLGNWNAAERETLPKLY
FT                   DRAVEACELCLSDGVTKAMNAVNGEAPKKSKDQAKEPANEQPR"
FT   gene            370328..370864
FT                   /locus_tag="Haur_0311"
FT   CDS_pept        370328..370864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02963"
FT                   /db_xref="GOA:A9B7J0"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J0"
FT                   /protein_id="ABX02963.1"
FT                   /translation="MRILRFLFVALALLVLLPNRAFADNPNEQVLIDEVRGAYRVVATL
FT                   APNPPAVGEALLRVVITDATSGQPSPLNLVQLYAAPDSIGREELFTMLPENQDRNAGRY
FT                   TSDRLRFTISDQWTMRLVLGAPEGEMVFTTKVQVDSVFKEIGEAAVIAVPATLVGLAVV
FT                   FIGYKIWRKKRQAAN"
FT   sig_peptide     370328..370399
FT                   /locus_tag="Haur_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            370945..372111
FT                   /locus_tag="Haur_0312"
FT   CDS_pept        370945..372111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_0726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02964"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J1"
FT                   /protein_id="ABX02964.1"
FT                   /translation="MQLTPENYHEQLIALALTDDFVRLTMSGAARATDLRWQRVVVRPV
FT                   QLKQGRAWQAAYFDQRQNITKNYAIEQASSALGEIIAIPLSNITLETTSERIQIQRSKK
FT                   GKVIISRVRNQAAAPDLRHNHVKALPLPSDSPDAYLQKTGIMTNDGVIRASMSKKYTQI
FT                   NEFLRVFDELDLKPSPEQPLRILDAGCGSAYLTFAAYHYLVNIRGLAAVVIGVDSNEYL
FT                   IAKCRAQAEELGYTDMQFIAMPLADWQPEQQPDVVFSLHACDTATDDALALAIRSQAQA
FT                   ILSVPCCHKHLTHQIQAEVLNSMLRHGSIRQRTADLVTDSLRAQLLRINGYRSEIIEFV
FT                   DAEQTGKNLMIRAIRSKKPDSKAVAEYQALKQFWGVTPYLEQLLGSGN"
FT   gene            372512..374392
FT                   /locus_tag="Haur_0313"
FT   CDS_pept        372512..374392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0313"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: rca:Rcas_3734 chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02965"
FT                   /db_xref="GOA:A9B7J2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J2"
FT                   /protein_id="ABX02965.1"
FT                   /translation="MAKIVGIDLGTTNSVVAVMEGGDPAVIANVEGGRTTPSVVAFSKN
FT                   GERLVGQTAKRQATVNPENTIFSIKRFMGLEFDKATQERSTVPYEIVNGPRGDARVRVP
FT                   RTGKDYTPQEISAMTLQKLKNDAEQYLGEPVRQAVITVPAYFNDAQRQATKDAGQIAGL
FT                   EVLRIINEPTAAALAYGLDKKNDETILVFDLGGGTFDVSVLEVGDGVIQVKATNGDTHL
FT                   GGDDYDHRIVKWLIDEYKKDQGIDLTSDKQALQRLKEAAEKAKMELSTTMETEINLPFI
FT                   TADASGPKHLVTNLTRSKFEQLTADLTERLKGPFTQALKDAGLKATQIDEVVLVGGSTR
FT                   MPVVQELVRKLTGKDPHKGVNPDEVVAIGAAIQAGVLGGEVKDVLLLDVTPLSLGVETL
FT                   GGIMTKLIDRNTTIPTRKSEVFSTAADGQTAVDIHVLQGEREMAGDNMTLARFQLQGIT
FT                   PAPRGVPQIEVTFDIDANGIINVSAKDKATNKEQKITITASTNLSKDDVQKMVRDAESN
FT                   ASADQARRAKIELKNQADNIAYQAEKTLNDLGDKVDPSAKSQAEAQIADLRSKIAAEDD
FT                   AGIQSAMATLQQTLMSIGEAQYSDQAAAAGAPANAKAADDGVVDGEFTVE"
FT   gene            complement(374960..376168)
FT                   /locus_tag="Haur_0314"
FT   CDS_pept        complement(374960..376168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02966"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J3"
FT                   /protein_id="ABX02966.1"
FT                   /translation="MVARQIVKAVAAGLLVVGLSTPAFASGTLTNKFTDYNTVDVKDTV
FT                   NVMDYGMATAIGDFDDIAGVQTFVSAVRKDDGNLRVSAYYVNTTTNTKLGADIEDGGAM
FT                   NDVAIDRVGSSGLVVAAVEMNDRSLKFIAYDVTTGTNGRTIDRLNDHIPSIPDLSFVSD
FT                   VQIARVGSLNRGQFVTIVRRQDGTMRLDSWKVVRNNNNTVTFTWLDFVDGGLQIGDEIA
FT                   MIRNTTNLWQFATVHKNSNDLMNIRVWNVDQDASGSINFLSGVVYGTSIEGFDVAFSSQ
FT                   RLLTARYKSDGTTVIEMWNVDPFTNQISLDASGSLSTGSSNGVQIFDMGGGDLVLLREN
FT                   ILGSLFQNTLSTSGSVITLDPGGDQHMFTDGFSGVDGGDGRLFYAIADADVNKLTHQLW
FT                   LHQ"
FT   sig_peptide     complement(376091..376168)
FT                   /locus_tag="Haur_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(376385..377740)
FT                   /locus_tag="Haur_0315"
FT   CDS_pept        complement(376385..377740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7122 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02967"
FT                   /db_xref="GOA:A9B7J4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J4"
FT                   /protein_id="ABX02967.1"
FT                   /translation="MQRQTRQLWRSTLSLLGTVGLIASSFSITTSSISAQTSGSAQPCL
FT                   SGDPFQLAALKTKLSQVNPPSGVQRVNRTLTVEFITTGVLTDEAPTMPVLPTEVGDDEP
FT                   YEREPVPASTATFRVFNTLTLNEFRVVMQASTVGTIRDCYERNDLLNGKIPTDYTGDID
FT                   APPPPQRSKQTEVFTPFGWSNGDDNRELKTNHTQFPLRTISQFSRVSGNQDSNCTGTFV
FT                   GPRHLITAAHCINREATNVWFTTKVTPGRNGTGTGSAPYNSTVIMPNPQPPVESWYWTF
FT                   EEWRDPNQNNRTRWDIGMIVVPDRLGDTTSWMGVAPRTATYLKNTTSYNRGYPNCNGDG
FT                   ATRGNAPAGCQVARMYGDPGNCGARWFKNLDGDGWSRRYDVKCDASAGHSGSPVYHYEY
FT                   SAHHGKDIPVVSAVIITEECFTCSNLNSYVNTVRRVTPSVIDNYVALREIFN"
FT   sig_peptide     complement(377633..377740)
FT                   /locus_tag="Haur_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.727 at
FT                   residue 36"
FT   gene            complement(377823..378590)
FT                   /locus_tag="Haur_0316"
FT   CDS_pept        complement(377823..378590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0316"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rba:RB11859 PhnP protein homolog-putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02968"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J5"
FT                   /protein_id="ABX02968.1"
FT                   /translation="MQLTILGCGGSMGVPMLACDCVVCTSTEPRNQRTRTAALIQSPTT
FT                   TILIDPGPDLRLQGLRHNLQQLDAVLVTHPHQDHIGGIDDLRPFTLHTQRMLPLYANQF
FT                   TLDRIRYQYDYAFASGESASTRPSLGLNLLDGSALQIGDVPIIPLPIDHGDWQILGFRI
FT                   GDLTYMTDVSHIPEPTFEMLHGVKSLIIGALRHEPHPLHFTVEQALAAVARIQPEQAFF
FT                   VHMSHSLDYNTEHATLPKHVQLAYDGLVLPIGE"
FT   gene            378701..379465
FT                   /locus_tag="Haur_0317"
FT   CDS_pept        378701..379465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02969"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J6"
FT                   /protein_id="ABX02969.1"
FT                   /translation="MSAVVELSRAEIVTICAVVSAASIMGVAPAQNPAEHAQLLQLGEA
FT                   ALRQRQLAQSDQDGMLMIARDPLALVATCAYPQRSLIIHHVQHNGSVLQAFGHKHADSV
FT                   VFHEVLNSDMQRLQAFGSLAQLANYSLDWCGYAGSAELSVRWHIQSTVLAEARSLVEQS
FT                   EEQAALRALGNSGVSAEAAIRLIELLSQPHTTTIFNAVVYQGQQVLSREYSLLQAGQHT
FT                   LLMTQTNIEQDLYQLETTSRERLANLLIQSLA"
FT   gene            379482..380330
FT                   /locus_tag="Haur_0318"
FT   CDS_pept        379482..380330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0318"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   swo:Swol_0838 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02970"
FT                   /db_xref="GOA:A9B7J7"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J7"
FT                   /protein_id="ABX02970.1"
FT                   /translation="MNSQQSNQLIQGEMLDVIGSIAPQSINLLYLDPPFAAGRVFADSA
FT                   GAFDDRWQGGLTEYLAWLEQRLVAARRIVAEHGSLFLHLDRRAVHYAKVLLDQTWGFEC
FT                   FRNEIIWHYTGGGRARRSFSHKHDTILWYSKHPQHWTFNLQAMRQPYKASSGFAKAGIR
FT                   SAAGKRYLPHPDGTPVDDVWDIPMLNPMAAERLGYPTQKPERLLERIILAASNSGDLVA
FT                   DLCCGSGTTAAVAQRLGRCWIAADQSADALALVRGRLRQQAAEWQETLIQPQPASFAAK
FT                   R"
FT   gene            complement(380290..380922)
FT                   /locus_tag="Haur_0319"
FT   CDS_pept        complement(380290..380922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0319"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: dsy:DSY4293 hypothetical protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02971"
FT                   /db_xref="GOA:A9B7J8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J8"
FT                   /protein_id="ABX02971.1"
FT                   /translation="MDTTSFPEFWHSIPRDIAALMPNSPELPYDAHLILNSIARHSHEL
FT                   YQHSLRVGHMAWHMSHSLGVPTYERQQIWLAALLHDCGKTRMPRSLLFCPPPGSPHWEV
FT                   ALYQQHVNESLDVLHAYPTLHLLIPLVAEHHERIDGTGFPRGSKYPARSAQIVALANAL
FT                   DHLRAQPSSLSPNLQGLIDQAIDHHWDSAVAATALSAWQQTKLAEVG"
FT   gene            complement(380942..381331)
FT                   /locus_tag="Haur_0320"
FT   CDS_pept        complement(380942..381331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02972"
FT                   /db_xref="GOA:A9B7J9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7J9"
FT                   /protein_id="ABX02972.1"
FT                   /translation="MYNSSTISRRIALAFVTFGLIFVSFVYTALTSSQTPQFGTPAAAN
FT                   TAWQWGDIEGITVTQQLQTAPLNTAWQWGDIEGITVTQQLQTAPLNTAWQWGDIEGITM
FT                   THQLQTAPLNTAWQWGNIESSKGML"
FT   sig_peptide     complement(381245..381331)
FT                   /locus_tag="Haur_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.516 at
FT                   residue 29"
FT   gene            complement(381544..382752)
FT                   /locus_tag="Haur_0321"
FT   CDS_pept        complement(381544..382752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0321"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cac:CAC1447 MDR-type permease, probably tetracycline
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02973"
FT                   /db_xref="GOA:A9B7K0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K0"
FT                   /protein_id="ABX02973.1"
FT                   /translation="MQPQARFSYLVLSFGTRLLLSCIFTASMLYRIQVLQLDPLQLVLV
FT                   GTMLEAAAFALEIPTGVVADVYSRRLSVVLGVAFLGLGALSEVWLGSFVGSLLAQVVWA
FT                   LGYTLMSGATEAWITDELGVEVVEALFLKAAQLNSIASLLGIGLGVALATIGLVWPIVG
FT                   GGLALVGLAISIRWFMPETQFSPAPAAERQSWGRFGATLGHGWQAVRGQPVLLSIMVMS
FT                   AIAGAASEGYDRLWEAHLLNNIGLPTWLDLQPVSWFGAIAALGTLASLVAVIVIKRLAS
FT                   NTTERSIWLLRWQYGLLAAGLLGLALTQQFAIALFWIMLIRMLRQSIQPLYSAWLNRLI
FT                   ESRSRATIISINSQADAFGQILGGPIIGLIASRMGLPAAFVAASCCLWPMLVLLRQRQL
FT                   NRQ"
FT   gene            383077..384951
FT                   /locus_tag="Haur_0322"
FT   CDS_pept        383077..384951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0322"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: rrs:RoseRS_4301 heat shock
FT                   protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02974"
FT                   /db_xref="GOA:A9B7K1"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K1"
FT                   /protein_id="ABX02974.1"
FT                   /translation="MAEQHDVANEREQFQFQAEIQQVLHILIHSLYTHREIFVRELISN
FT                   ASDALNRVQFEMLTNQDVRDPELELAITLEADKDARIIRISDTGIGMTRDDMIKNLGTV
FT                   AQSGAKAFLQKLGEANPTNSSEIIGQFGVGFYSVFMAADEVRVTSLSYQPDATAWRWTS
FT                   RGEATYTLEAAERSERGTTIEIVLKEDAEEYAERWKLDQIVRQHSNFVAFPIYSAEGDE
FT                   KKVLNQRTALWRKQPREVTQEEYNDFYRQTTMDFNEPLSTIHISTDAPVDLHAILFLPA
FT                   KREQGMMRQIPDPGLKLYSRKVLIQERNEELLPKHLRFVQGVVDSEDLPLNVSRETVQS
FT                   SGTLRQIAKIVTNKITKEIETLAENDAEKFADFWREFGPYFKEGLVTDPGTRSQIEPLL
FT                   RFHSTSGEGLTKLSEYVERMKEGQEDIYYVIADNVETARRSPHLDYFNERGYEVLLMHE
FT                   TIDSFVISSLRDFQGKKLRSVDDADIAGDDVELEGSLSAATLGQLGDRIKELLGEQISE
FT                   VRGSKLLRSNPVRLAAPSDDFGRDMDRIRRMMGQEYSVPSRILELNPRHAIVHNLAALL
FT                   DEPDQAELFEVAVQQLYGTALLGEGLHPNPSELISGVHALIAAATKKQ"
FT   gene            385095..385631
FT                   /locus_tag="Haur_0323"
FT   CDS_pept        385095..385631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02975"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K2"
FT                   /protein_id="ABX02975.1"
FT                   /translation="MSDEFVAFPKIARLSRQVIVTEKIDGTNACIAIDEQGQIRAGSRS
FT                   QWLTVEHDNYGFAVWVAANHNALLELGVGTHHGEWFGHRIGKRQYGLNERRFALFNTSR
FT                   WNAENRPACCEVVPVLYDGVFDTAKIDAFLEDLRLNGSRMVAGFMQPEGVIIYHTAANI
FT                   FFKKTMPNDGAKGKT"
FT   gene            385895..387979
FT                   /locus_tag="Haur_0324"
FT   CDS_pept        385895..387979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0324"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: glycoside hydrolase family 26;
FT                   cellulose-binding family II; KEGG: cth:Cthe_2811 glycoside
FT                   hydrolase, family 26"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02976"
FT                   /db_xref="GOA:A9B7K3"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K3"
FT                   /protein_id="ABX02976.1"
FT                   /translation="MWSNLSRSRSLLTIALLGVLLGSLSLLPTHTTKAAITAYQAADPN
FT                   LAPYAQNVLDRFVQYKGQYWLGGQQEVHWDNSRKDEMSNAVFARTNPQRYPALRGWDFP
FT                   IGGALPNDGQWMIDAIISDWTNANVIPTISQHWTPLASQGTNHQDMFTVVDIDRMFVDG
FT                   TTERTNYLIWLDNIADDLQQLEDANVPVLWRPYHEAGGGWFWWDKDNGATNYRRLWDDM
FT                   FTYLVTTRGLHNLIWVWTPGVKGVSTAWYPAGQADILGSDVYNETSGNYVSWYEDLGRF
FT                   SQTKIKALSETDYMMDPALLSSAPFAYFMIWHTDMFYRNTDSRIQSTYAHWATLNRTNV
FT                   GQIWNGTLGIAPTATPGTPTPTPIPGIVVSDFEDGTLQGWTGTNLVSGPTVNNEWAANG
FT                   QRSIKAQVNLAATPADIRLAQALDLTGQSRIQIRLSAQNVGSGLSAKLYIKTGSAWNWK
FT                   DSGTVLIDSGISLLTIELAGVPDINQVRELGVEFNALTGNSGTATIYADYLTVGVVNSN
FT                   QPTPTTGPTATATRTPTQAPTATPTNIPTATRTPTQGPTATATTIPTVTPTNIPTATRT
FT                   PTQVPTATPTSTGGACKVDFKVTSQWGVGFIADVTVTNLQPSALNDWNVKFNFPSGQTI
FT                   SNLWNGTLSQTGSAVTVTNAGWNGYLAGNGGTANFGFQGVGSVPILPSNSFQLNGVTCQ
FT                   "
FT   sig_peptide     385895..385999
FT                   /locus_tag="Haur_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 35"
FT   gene            388096..390231
FT                   /locus_tag="Haur_0325"
FT   CDS_pept        388096..390231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0325"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: lic:LIC10333 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02977"
FT                   /db_xref="GOA:A9B7K4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K4"
FT                   /protein_id="ABX02977.1"
FT                   /translation="MIFILQSIALAISIFNAIICLWLGMTVALDGGRERGPRLAAAGLL
FT                   MAGVFFLIHAAIIGRGPPVVDVGLPFWWRVISVVSLLAPYAWYATMIWYTGVSGKSLRI
FT                   HKLLLFTMGIFIGILGLVLTAIYPLPQEARILALKIVPAWLVANLPFIVAGYLLALIMC
FT                   FSLPIHALLTGPGRRNNLPHQAWLRVRSWLIRTSLLGLLAGIVALIGAVIVFSQGAVGR
FT                   TPEVAWLADRAIELFFQLDVMVLIVVAAALGAAGQAMGAYAAFTDRPLPQWNRIDQWRW
FT                   LVAIAGGFALMVGVSSALQVASIYIVLFATTLASLAYGLLSWRYRVEHEAFMERLRPFV
FT                   GSLHFQDRLLDGGASLSASVEGLVEAVSRDVLRAERACLLLRDAVPGLPNVISYHWGQT
FT                   PIPLLEQLPISNERRTSGIRLEAQSGAEWAVPLWDGRGLAGALVLGSPQAGAVYSEELM
FT                   EVAAACCARLTDALAGERAARMLGDVLRQRIAEVKVLGSQGRRTLHDDVLPQIHAALIH
FT                   LSAVSANDPMAQQTIQALSEAHTKLSALIRSLPPATPHRLAQGGLAQTLHDMVLVDFGN
FT                   AFDQVSYTVAPAAEARLADTPQFIGEVISYALQETLRNAARHARGNDPRRTLQMRVQID
FT                   WQHGLVVDICDDGVGMQPHQSSSSGSGSGLRLHRGLLMVIGGSLNIATPGQGGTHIHIQ
FT                   VPEELWNLPVLEPEEIA"
FT   gene            390384..391463
FT                   /locus_tag="Haur_0326"
FT   CDS_pept        390384..391463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0326"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   rca:Rcas_1760 protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02978"
FT                   /db_xref="GOA:A9B7K5"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K5"
FT                   /protein_id="ABX02978.1"
FT                   /translation="MGLFGKRADAPTQEAVLAALATVQEPELGGNLVARKMIKELNIDG
FT                   GRVVVLIDLTTPACPFKEQLANDVRAALAQVPGVSEIEVDFTATVRSYNGIPDKARVPG
FT                   VSHILAVASGKGGVGKSTVAVNLAVALAQEGANVGLLDADIYGPSAPLMTGARGKPGIT
FT                   QNQKIAPLEAHGIKIISVGYFVDDSQPLVWRGPMISSMLRQFLFEVDWGQLDYLIVDLP
FT                   PGTGDIQLTLAQSIPLSGSVVVTTPQDVALADAIKGVEMFRKLNVPILGIVENMSYFIA
FT                   PDTGKRYDIFGHGGARTASSKLGVPFLGEIPLGMPIREGGDTGQPAVTQSAKDAYADSF
FT                   RDVARTLAGRISIETMVAA"
FT   gene            391538..392572
FT                   /locus_tag="Haur_0327"
FT   CDS_pept        391538..392572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0327"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: rrs:RoseRS_2110 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02979"
FT                   /db_xref="GOA:A9B7K6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K6"
FT                   /protein_id="ABX02979.1"
FT                   /translation="MMPIELLEKPQTLQTRSNAPAHDAHGRRINYLRISLTDRCNFRCF
FT                   YCMPEWGMQFAPKPELLTNAELIRLVRIMAQTGFEKIRLTGGEPTLRRDLVGLVEAIAN
FT                   TPGISEVSMTTNALLLAPIAQQLADAGLKRVNISIDSLNPESFRKITRGGDLTRVWAGI
FT                   EAAEQAGLTPLKLNCVVVRGVNDHEVLDLARLTIDKPWQMRFIEVMPLVGVAEVADNGV
FT                   VPSNQLIAQIEAEFGLDFLGWYGADPARTYQIPGAQGKLGFISSISDPFCATCNRMRLT
FT                   ADGKLHLCLLRDNELDLRAALRGSGSDEELEALIRHAVWIKPWGHGLPDGVKPTVRGMS
FT                   ELGG"
FT   gene            392801..394084
FT                   /locus_tag="Haur_0328"
FT   CDS_pept        392801..394084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mul:MUL_3196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02980"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K7"
FT                   /protein_id="ABX02980.1"
FT                   /translation="MARNIMLNHSIRLYGHFIQQQLPPSNYKEFSRWGIDEQNIYRSEY
FT                   LQMSSLTQMCTMFTYLYHSAIADRQKWNILCESFGTMLIYQIYEVISDNISMGLGLAIN
FT                   PDYQQKNQLIRYFNTAMVESLDNGIIMLDHQRIKALSKNISLIEQHISLTRNQDLFDKY
FT                   CAHKNIRLDTIEEPEIWVALYANIASCLDFINQIKQPSARTLIKNSVISRYTAINRLNN
FT                   AEYTSINQLIQLQIDTMLVIPTLEYCINLWSEVYLDDQALRDDIAENPYLRQYITTATL
FT                   LVRLLNDVGSILLQLSHQQIAQYFSQLLLESPPLKHEAWYDWFNRVASHPMFFRLHKDV
FT                   VFNEVNILLYAIEPTMDPSTVIDQMIHNTQHAAQLYQATMALFEQQFGLLSQTSHYRIP
FT                   LDIASRIVTFHQALYANDYTQPEGEYAV"
FT   gene            394112..394570
FT                   /locus_tag="Haur_0329"
FT   CDS_pept        394112..394570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02981"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K8"
FT                   /protein_id="ABX02981.1"
FT                   /translation="MPNPLCISANELVCTDQSTTFEYVCHFENNREWWLPVTHTQHLSG
FT                   EGVGAIYEEHAKVAGIPMKMQLKVYHYNPPQQIKFTITSALMLSDMDYRFLVESAGTRI
FT                   IISTAINFKWFLRPFAPLMRSALIKEASQHLGVLKSVLAQKFSQASNK"
FT   gene            394682..395122
FT                   /locus_tag="Haur_0330"
FT   CDS_pept        394682..395122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0330"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: kra:Krad_0154 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02982"
FT                   /db_xref="GOA:A9B7K9"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7K9"
FT                   /protein_id="ABX02982.1"
FT                   /translation="MARTDQSNESEVLAGSSRVLRFAYCVLAISAGARALFQVATKFNQ
FT                   APLAYGLTTVAALIYWVAFLGFGRRSPQAWRITLGVCAIELLGVITVGILTLIERDWFP
FT                   KDTVWSDFGIGYGFTPLLLPIAGLWLLLRQETRQAYGVANKL"
FT   gene            complement(395098..395907)
FT                   /locus_tag="Haur_0331"
FT   CDS_pept        complement(395098..395907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02983"
FT                   /db_xref="GOA:A9B7L0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L0"
FT                   /protein_id="ABX02983.1"
FT                   /translation="MSDSILAQAAPPADQRIWYGAEPLQFADLRVPPGIGPFPVVVVVH
FT                   GGFWRARYDLEHIGHVCAALTALGYATWNIEYRRVGNAGGWPNTFLDVAQAADFVPNLA
FT                   QHYPIDPQQVISLGHSAGGHLALWLAARPKLAATSPLWQAQPLGLKGVVSLAGVADLAM
FT                   ADQRRLSQQAVQELLGGSPETYPERYHDASPAALLPLQVPQIVLHGTDDGPVPFAISQS
FT                   YVEQALAAGDEARLVPLPNAHHFELIDPASREWPAVVAAVQSLLATP"
FT   gene            396063..397805
FT                   /locus_tag="Haur_0332"
FT   CDS_pept        396063..397805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3677 FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02984"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L1"
FT                   /protein_id="ABX02984.1"
FT                   /translation="MVLRRMMFVLLVIFSLSTVSATSLETPSAEPLDAASPASPAATNA
FT                   YTMRAGFPATKPNGSYFSSPTVVDLFKDGSPEILSADATGCIWGYNIYGQLLPGFPWMT
FT                   GGACANTPRINGSLVVADINEDGLLEIVVGTRGKGTSVGQRGKVIVYQRNGAILSGWPK
FT                   EMEWAYITNGNFPEVVHVAVDDIIGDSKLEVIATTTNEAGSNTDYAPNVHAWYYTGNVV
FT                   TGYPKSSDKGSGIWGHPALADLDNNGKSEIFVGRDELYFYRYKNDGTQYAGWPIQTYTH
FT                   VNQTTWNVHDYIEFTRSGPAIADLDNDGSYEVIAAGKVRTPDGDPHNNYDPQSASAVFV
FT                   TEPDGTRRPGWTDAKRAGAPLDVNFTPNNPIVVADLDGNGEKEFVVTFDDGTIRAYREN
FT                   GTQIWSYFYAEEPVQGAPTRKVFGSEVVIADVTGDRKLDIVFGTYSFDRLYAGIVGLYA
FT                   LDARNGALHSGFPLSLPNEGTASDNSAGSQKGIQAAPTISDIDNNCYVEILAHSRAGNI
FT                   YVWETLGRNLPELMPWPMSRQNLQRTAWVQNPPEPRQHVFAPEQIQGGDFNVYLPMTRM
FT                   GCDF"
FT   sig_peptide     396063..396134
FT                   /locus_tag="Haur_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.520 at
FT                   residue 24"
FT   gene            complement(397853..398560)
FT                   /locus_tag="Haur_0333"
FT   CDS_pept        complement(397853..398560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02985"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L2"
FT                   /protein_id="ABX02985.1"
FT                   /translation="MRLISYFLFICGLVACGGATATPIPATQVVAQVSTATPEPTLVQP
FT                   TLTPTIPPTFTPLPRVTPTVADLGNIPGNSTAFIEIKGLKTYTNPTQAFSIDIPDDWQM
FT                   RDSVDAGNNLLFWVDPAEQAFIQLLVVDDSQNLIGDQAEFLNDFISQIVGQSSEFNIDQ
FT                   PVLQADGNTYVSYSFIDQQSLLAMSGDGYVRRDGNYLSIIQILVPLEQFEALQPDLVRI
FT                   VQSYKIDPNLPLQ"
FT   sig_peptide     complement(398495..398560)
FT                   /locus_tag="Haur_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.609 at
FT                   residue 22"
FT   gene            complement(398622..399461)
FT                   /locus_tag="Haur_0334"
FT   CDS_pept        complement(398622..399461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0334"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: aha:AHA_1285 alpha-beta
FT                   superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02986"
FT                   /db_xref="GOA:A9B7L3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L3"
FT                   /protein_id="ABX02986.1"
FT                   /translation="MQRTIGLCLGGGGGKGSAHIGVLHELERVGIQANMVAGTSIGAII
FT                   GAVVAAGYNATTIEQAFRATPLRRILSLDPASWGLIGSEKLAGVLSELLGDQLIEDLPI
FT                   PYAAVAVDLVTGHEVVLQRGSLVEAALASAAVPGVFPPRRIEKYILADGGIRNNLPIDI
FT                   TRQLGAERVIAVNLIGEFDQFEVNNAAQSSLFSWRRWVPLTQLALAERAIGIMVHQITL
FT                   QRLRETPPDLLFSPDVNRMSMADLLHLDDGIQAGIACVADYYEELQQWALWQRGEFA"
FT   gene            complement(399854..401284)
FT                   /locus_tag="Haur_0335"
FT   CDS_pept        complement(399854..401284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0335"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: rrs:RoseRS_2631 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02987"
FT                   /db_xref="GOA:A9B7L4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L4"
FT                   /protein_id="ABX02987.1"
FT                   /translation="MNQTLVNRYQILATLGQGGMATVYRARDLLLKRDVALKLLRPEFA
FT                   NNPSLSQQFSAEAQTAAQLSHAHIARIFDVGYDPSSGPFFVQELIEGQSLDQLLPVAAP
FT                   QALTWTREIALALAAIHQQGYVHCDVKPQNIRINADGHAILLDFGIVQAIGTINAEQVY
FT                   GTPQYIAPERAEGGATTEASDIYALGIMLYELLTGRVPLDGDSAWAIVQRHLNEGVPAL
FT                   RQALPGTATAIENLIKRATERVPSQRFASAQAFAGEIESIQQGANSATIAMPVRQRSTV
FT                   SIHNMETTAVRVPPKTAALVQAKPQPTPTKALLANPKPVAKKQIGLTLAALVFVVLVAV
FT                   AFAKLSGDTQQPGASGNATTVAQPSATLVPIAEATATIVAEAISTQAPEPTIASQPLPS
FT                   MPNFVGLKRGEAEQQARQLKLKINFIEEANEQAKDRILSQEPAAGSPIAENSQITLVIA
FT                   VKETKKPKGPGKGNDDDD"
FT   gene            complement(401564..402271)
FT                   /locus_tag="Haur_0336"
FT   CDS_pept        complement(401564..402271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0336"
FT                   /product="peptidase membrane zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: peptidase membrane zinc metallopeptidase
FT                   putative; KEGG: rca:Rcas_1508 peptidase membrane zinc
FT                   metallopeptidase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02988"
FT                   /db_xref="GOA:A9B7L5"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L5"
FT                   /protein_id="ABX02988.1"
FT                   /translation="MIFDPLYFVFAIPGMLFAFWAQWYVKSTFSKYANVANMHNMNGFA
FT                   VAQRLMNAEGLNYVRVNQVAGQLTDFYNPADKSINISQSSVNPSVAAMAVVAHELGHAL
FT                   QDREGYAMLRLRSSIVGIANIGSNIGTWLVMLGLMFGAASRSGGIGFTMALIGLVLFAG
FT                   AVLFTLVTLPVEFNASSRAKKMLIANGLVSPQDQAAVSKVLNAAAWTYVASAAQSILTF
FT                   AYFAFRVFGGRRD"
FT   gene            402597..404483
FT                   /locus_tag="Haur_0337"
FT   CDS_pept        402597..404483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0337"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   deh:cbdb_A1612 ABC-transporter, ATPase and permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02989"
FT                   /db_xref="GOA:A9B7L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L6"
FT                   /protein_id="ABX02989.1"
FT                   /translation="MNGGGWRGFVRANEDEQPTISRMLLQRVWGYARPYRSGIIVVLIT
FT                   IFIGTLLDRITPLLVRHLIDVAIPERNLGRLNLVAVGLVAIPLIGGLLDILQRRHSSLV
FT                   GEGIIFDLRRALYSHMQRMSLRFFTSTKSGELVSRLNNDVVGSQRAVTGTLITLITNVI
FT                   TVSITLFIMLTIEWRLTLLALLVLPLFMLPARRVGRIVRNLTRSQMQANGEMNGLMGET
FT                   LNVSGALLVKIFGRRNDEVAKFSQHAGEVRDLGIRTALVMRSFFVMVGLVSAVGVTSVY
FT                   WFGGYLAITSDNFSTGDIIALALYLPGLYGAISTLVNTRVELASSLVSFERVFEILDLP
FT                   LEIVDAEQPQILQTIRGEVQFEHVWFRYQADEINSLSSRDGQETTVISPITTREWALSD
FT                   IDFTAKPGQLVALVGPSGAGKTSLTYLLPRLYDPSRGRVLIDGIDVRELELDSLGQAIG
FT                   MVTQETFLFHESLRANLRYAKPDATDAELEAACRAANIHDLIASLPNGYDTVVGERGYR
FT                   FSGGEKQRIAIARVILKNPRILVLDEATSALDSRSEALIQAALQPLLKDRTSIVIAHRL
FT                   STILAADLILVVDQGRVLERGTHSELLAQAGLYAQLYQTQFKEREQALEQRA"
FT   gene            404785..405819
FT                   /locus_tag="Haur_0338"
FT   CDS_pept        404785..405819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0338"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   afw:Anae109_2774 alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02990"
FT                   /db_xref="GOA:A9B7L7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L7"
FT                   /protein_id="ABX02990.1"
FT                   /translation="MMKAGFFRHHGGLEVLEYGDLAEPVAGPDEVLVRVRAAALNHLDL
FT                   FVREGLPGLNLPMPHIGGCDIAGEIAAIGEGVTGWREGQRVVVNPNIWCGACEYCIAGE
FT                   ETLCDRYGVIGEHQTGGLAQYIAVPARNLYAIPADYAFEQAAAVPLVWMTAWRALIGQA
FT                   QLRAGQSVLILGAGGGVASAAIQIARYAGATVYAASRSPEKLARAQELGADYVVRSDGD
FT                   WGRELWKQTNKRGVDVVLENVGAATWESSLRSVAKGGTVVTYGATTGPIVNIDIRKLFW
FT                   RQFNLIGSTMANNREFNTIMRLVFWERRFQPLIDKVFPLSEIQAAQRYLESAEQFGKVV
FT                   ITIP"
FT   gene            405877..406881
FT                   /locus_tag="Haur_0339"
FT   CDS_pept        405877..406881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02991"
FT                   /db_xref="InterPro:IPR032554"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L8"
FT                   /protein_id="ABX02991.1"
FT                   /translation="MPITIEHVRVLEGPNIYYPQAGVAASLQVSHDLRDELGRQLKTWA
FT                   QAVGLIIGYLRMKIEPIDDQWLLSLSFTCNHPQLGAAILQHAVEDILAGERQDEDWNHD
FT                   DALFDLRRQRMRIDPVLPLLQLRAEAQGRVLPVIAVGDGMLQIGTGSGGWQFDPAQLSL
FT                   GFAINPPWEQIRSVPLIAIGGVGAEIAAAQIAQGLTAAGWQQVMHIVKGDFASVRQAFL
FT                   QPKAEIFVIALDHSDAVERGLAFNRCTMGVVLGISDLPETQALAAGLPALTADELGNTI
FT                   LLADDQRTAGLARRTAAPVVQLQRTHEPASIQQPLLALVVNQLQQLLDAGAFD"
FT   gene            406921..407274
FT                   /locus_tag="Haur_0340"
FT   CDS_pept        406921..407274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0340"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: rxy:Rxyl_0191 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02992"
FT                   /db_xref="GOA:A9B7L9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7L9"
FT                   /protein_id="ABX02992.1"
FT                   /translation="MPKITVGSQAAFEVASGTRLVNALEDHGVDILHRCGGNARCTTCR
FT                   VEFQTGEPQAITKAESFKLAEAKLTGVRLACQILCEHDMQLQPLQTLSASGLPDPGPRP
FT                   SDELTPAPEWLNR"
FT   gene            407333..408223
FT                   /locus_tag="Haur_0341"
FT   CDS_pept        407333..408223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0341"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sus:Acid_5923
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02993"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M0"
FT                   /protein_id="ABX02993.1"
FT                   /translation="MNFPLLREFGSTGLQVSALGFGAGHIGGNELTEAEAAKLLHGLLD
FT                   LGINLIDTARGYGLSEERIGRHLQQRRHEFVLSTKIGYGIEGYDDWTSPIITAGIDAAL
FT                   QRMHTDYLDIVHFHSCPVETLRAGEVIEALERAVQAGKVRVAAYSGDNAPLAWAVQSGH
FT                   FGAIECSVNLADQRVISQVLPQTQQRQIGVIAKRPVANVAWRFAQRPVGDYAEVYWERL
FT                   QAMQLDFDPERLLDIALRFTAYTPGVHSCIVGSRSLEHMQHNLALLQQGPLEPQLYAYL
FT                   SSQFQTNDQGWVGQI"
FT   gene            408456..409067
FT                   /locus_tag="Haur_0342"
FT   CDS_pept        408456..409067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0342"
FT                   /product="Deoxynucleoside kinase-like"
FT                   /note="KEGG: bld:BLi00023 Dck"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02994"
FT                   /db_xref="GOA:A9B7M1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M1"
FT                   /protein_id="ABX02994.1"
FT                   /translation="MGKLITIVGNAGIGKTTLTKLLCRDQRFFAALESHVERPFQQLFA
FT                   QNLQRYALANQFDYLLLRAEQERFIRAQSGIGVQDGGLDEDFWVFTQHFQHQGYLSAAE
FT                   FELCQRLYTELRAGLGQPDLIIKLDAPLDVIIQRYEQRNRPLEIAQRDDLAQLGTLLDR
FT                   WTATITTPLLSLDWSSSALPTIEQQQQLIETILKQLRIVH"
FT   gene            409107..411299
FT                   /locus_tag="Haur_0343"
FT   CDS_pept        409107..411299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0343"
FT                   /product="Proprotein convertase P"
FT                   /note="PFAM: Proprotein convertase P; peptidase domain
FT                   protein; KEGG: cme:CMI070C similar to syntaxin binding
FT                   protein Pfam: Toxin_5 EGF_2 Thia_YuaJ Voltage_CLC DAP10
FT                   Sec1 Herpes_BLRF2 PROSITE: EGF_1 EGF_2 ARG_RICH PRO_RICH
FT                   SER_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02995"
FT                   /db_xref="GOA:A9B7M2"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M2"
FT                   /protein_id="ABX02995.1"
FT                   /translation="MRLRIGLIITLLLMITVGKTLQNPRDVAQALSQTPDQTTIPQGFS
FT                   RIQEQEFNDLPLNANLLVGSSLVVRGSIQQTDVDYFALDLTAGQRLAMATITSASVASS
FT                   DTTIHLYAFDGVNSDLIETDLSDGILSNSSSVISSQPITLTGTYLIKVEGGTATTVIQP
FT                   YDLYVRVLSETASEQEPNDEVAQTIDAQAAISGVVSTTNDLDRYQFNVNPGDTIFATVD
FT                   FDPERDGITWNGFLDIGMINNTYLRANDSNSVSPNAEANVITVQQAGTYEIRIGSLLEI
FT                   GVDASYLAQVTIIPAAIQANCQTVMSSGAPQNIGPQAGIIQSTLTVTQAANIADIDVLL
FT                   NLEHSFMPDLDVTLTAPDGNVINLFTDIGNVQQPTVNLVIDQQAALPLGTYNVLSGTHF
FT                   GPKWNSSLDWLAGQQAQGQWILTIYDDTDQNAGVLNGWGLRICGMPTPSDCPVGMSRSV
FT                   LYSSQFEADNGGLTPGPFDQEWVWGNRNSPPIVGAYSGENSWNTNLTGNYPNSTRMQLL
FT                   SPQIDLTNVTGPIYASWYQRYQLDNSVNDFYQVTAHKPQVEQILFRHQSAAMQINLGNP
FT                   LVTLDQSTGWGLQRHDLSDFAGTSLYLTWDFGSDEVASFAGIALDDVEITGCIDPAQIT
FT                   PTNTPTPSNTPTLTSTPSNTPTPSNTPTATATPTQTLTPTETPTPSNTPTATATPTQTE
FT                   TPTATETPSITPTSTPSVTADPSLIPVYLPLVSKDN"
FT   sig_peptide     409107..409175
FT                   /locus_tag="Haur_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.641) with cleavage site probability 0.444 at
FT                   residue 23"
FT   gene            411441..413591
FT                   /locus_tag="Haur_0344"
FT   CDS_pept        411441..413591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0344"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: Proprotein convertase P; peptidase domain
FT                   protein; KEGG: rci:RCIX267 putative alkaline serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02996"
FT                   /db_xref="GOA:A9B7M3"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M3"
FT                   /protein_id="ABX02996.1"
FT                   /translation="MRLRIGFIGLMIALLGLTGSLRAFKPVQAAPSNPTTAQIAQANVP
FT                   QGAVRVKEQESNNTTATANAIMSSSTLIRGNIWNGDVDFYSIELAAGDRLTAATMSAAS
FT                   ASGNNDTVLTFFAPDGTTVIETDDNDGSLGGNASVISSAPVTQTATYYLRLSSTSTNQV
FT                   RYYDFYVRVLSEAATAETEPNDLLTTAQVLPTSGTISGVLSATTDLDYYQLNLNAGDTI
FT                   FTSLDLNPERDGIVWNGRLGIGAFNGFTLVVDDTSVVSPNAEAHFMTVKTSGTYYVLAS
FT                   TTAASIPAEATYLLGVTVFPAEQQANCTTYTSADVAKTIPTTTSFITSTLTVPDNFIIA
FT                   DLDVSIELTHTNMPDLDVQLQGPDGNVGGLFTDISNNTQTTMNIDLDDEAAIPIGLFAI
FT                   VSGIRYIPELNYRLDWFDGGRSAGTWTLLIHDDTAANGGTLQNWSITLCAAPPASCPDG
FT                   MSMSTITSTDFEANDGGFTHSGTADSWEYGAPSAAPLIGSYSGANSWKTNLDGTYSVSS
FT                   IANLFSPSISIPNVTGPVYIQWQQRYQMESANFDHYTASVGTGVVTKTLYEFDAATMTN
FT                   AVGNPSVTFQESTVWSRQLYDISEFKGQSIQALYHLDTDSSVQLGGIAIDDFQIMACDG
FT                   VAATATPTEAPTATSTPTNTPTNTPTNTPTNTPTNTPIITITPSNTPTATVTPSNTPTV
FT                   TPSVTAGPTMIPVYMPLVGKDQ"
FT   sig_peptide     411441..411512
FT                   /locus_tag="Haur_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.642 at
FT                   residue 24"
FT   gene            413746..415827
FT                   /locus_tag="Haur_0345"
FT   CDS_pept        413746..415827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0345"
FT                   /product="Proprotein convertase P"
FT                   /note="PFAM: Proprotein convertase P; KEGG: sth:STH718
FT                   bacillopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02997"
FT                   /db_xref="GOA:A9B7M4"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M4"
FT                   /protein_id="ABX02997.1"
FT                   /translation="MRLRIGFIGLMIALLGLTGGLRSLTSVQAVPNAPQNLAAHQLNTP
FT                   QGFARISEQESNDTPAMAQPIIGDSAVIRGYITANDSDFLAIPLTSVQRVVAATMTSAS
FT                   ATNIVDSILTLYQPDGTTVLELDNDDGIFGVSSSVISSAIITTTATYYLKVTANNTTNK
FT                   IYYYDLYVRILTSEPIVEQEPNEPAQMLPAAGIVSGIISQTGDIDRFQLALNPGDTLFT
FT                   TLDIDPERDGISWNGRVTIGPFGPNIITINDGNAVSPNAESAQLTVKEAGNYIISVDNL
FT                   SAINNSTYILQVLIIPAEEQANCQTYMSTDVNKTIPPDPGMITSGLNIPDNLLIGDLDL
FT                   IIQLDHTFIPDLDAQLTTPDGNILGLFSDIGITTSAPASMNLIIDDEAALPSFQALSVN
FT                   GLINLPEAAYRMSWFDGQRTQGNWTLTLYDDATGDGGTLLNWGLQVCAALPPADCPDGT
FT                   VSSTIYSTDFEANDGGFTHSGTTDPWQYGQPNSAPIVGSYSGSNSWKTNLTGNYPALMN
FT                   ANLTSPAIDLSGVVGPIQVQWQQRYQIESAAFDNYAAQIVGSSNQVLFQHRDGVMRESV
FT                   GNPLVTVQASTGWSRQLHDISSFVGQSIQLQFHMDTDSSVELAGVAIDDVLVTGCVVLP
FT                   TATPTETPTNTPTNTPTETPTNTPTVTVTPSNTPIVTPSVTAGPTTIPVYLPLVSKGE"
FT   sig_peptide     413746..413835
FT                   /locus_tag="Haur_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.808 at
FT                   residue 30"
FT   gene            415983..418110
FT                   /pseudo
FT                   /locus_tag="Haur_0346"
FT   gene            418341..419447
FT                   /locus_tag="Haur_0347"
FT   CDS_pept        418341..419447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0347"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: rca:Rcas_2149 2-alkenal
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02998"
FT                   /db_xref="GOA:A9B7M5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M5"
FT                   /protein_id="ABX02998.1"
FT                   /translation="MSNPKRTVGIGGLIIAALALSGVGGGLVGGVAGYRLAQVDQTATA
FT                   VAVTPTSATQQTTDNLTAQPVVASTNDAVVQTVAKASPAVVKIISTVVGGQASGSGAII
FT                   NEDGYIITNNHVVEGQSRLQVIYSDGTSHNAELIGTDAFSDIAVIRVLDAVPATISLGD
FT                   SDSLQPGETVVAIGSPLGKFQNSVTVGVVSALDRTIDSMEGLIQTDAAINHGNSGGPLI
FT                   NLKGEIVGINTLVVRGDIGSIDEAQGLGFAVPSNIVREVSDALIANGQVIRPYIGIRYE
FT                   LLSPETAELGIANDKGAFVTNVDEGTPARRAGISRGDIILAVNGEEITQRHSLQRLLLQ
FT                   YKPGDTVTVTIERNDQQQEVQITLAERP"
FT   sig_peptide     418341..418454
FT                   /locus_tag="Haur_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.465 at
FT                   residue 38"
FT   gene            419578..419964
FT                   /locus_tag="Haur_0348"
FT   CDS_pept        419578..419964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABX02999"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M6"
FT                   /protein_id="ABX02999.1"
FT                   /translation="MRRWFLALCLLVVLAGCSGSSIATQVSDTVQQLSETSVQDLVDRL
FT                   SGIEEAVRNNDWEQTRALFSTVENGWNALRVPVEAAFPEIASNIQAQIDQLSQALSVEL
FT                   PSSEDVRAGLSNLRDQLVALLQAL"
FT   sig_peptide     419578..419649
FT                   /locus_tag="Haur_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 24"
FT   gene            420026..420679
FT                   /locus_tag="Haur_0349"
FT   CDS_pept        420026..420679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0349"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cya:CYA_2571 quaternary
FT                   amine ABC transporter (QAT) family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03000"
FT                   /db_xref="GOA:A9B7M7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M7"
FT                   /protein_id="ABX03000.1"
FT                   /translation="MGEFQQALEYALEPRNLARLSAALNRHGQLVASAMAIALLLGLPF
FT                   GWWSSRSRLISAIAINTTNGLRVIPSLAILFLFVAIPGFGLSIRSAIIALTILALPPIL
FT                   INTNTAFRTLNPAVREAAKAMGMPAWLQLWRVELPLAAPVILSGIRIALVEVIASATLA
FT                   AFIGAGGLGSFITLGFSMSRVDILLVGAIPVALLAILAEIVMAGLLRWVQPPQF"
FT   gene            420701..421642
FT                   /locus_tag="Haur_0350"
FT   CDS_pept        420701..421642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0350"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: cyb:CYB_0579 quaternary
FT                   amine uptake ABC transporter (QAT) family, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03001"
FT                   /db_xref="GOA:A9B7M8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M8"
FT                   /protein_id="ABX03001.1"
FT                   /translation="MRRFIQLTVLLTLLMTILAACGDDAASSTTAPSSDPNPAPSSNQV
FT                   IRIASKNFTEQFIVGEMYALLLEQAGYKVERKIGLGATDVAQAAMEKGEIDIYPEYTGT
FT                   GLLTVLKLPTQTDPKAVYETVKKGYAEKYQIAWLDPAPMNNTQALAMTKEGAQKFGIIT
FT                   ISDMAAKAGELRMIGPPEFQEREDGLPGIQAKYGNFELKEYVPVDPGLKYKGLVEGNAD
FT                   VVVAFGTDGEIANYGLVVLKDDRNMFPPYQIAPLVRQSVLDANPKLAELLNALAPKLDD
FT                   ATMQQLNFEVSGNNRKYEDVAKEFLTTQGLLK"
FT   sig_peptide     420701..420769
FT                   /locus_tag="Haur_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.708 at
FT                   residue 23"
FT   gene            421892..422866
FT                   /locus_tag="Haur_0351"
FT   CDS_pept        421892..422866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cya:CYA_2231 quaternary amine uptake ABC transporter
FT                   (QAT) family, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03002"
FT                   /db_xref="GOA:A9B7M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7M9"
FT                   /protein_id="ABX03002.1"
FT                   /translation="MSTIEFRNVRKIYPKAATAALADISLTINRGEFVILLGPSGCGKT
FT                   TLMKMINRLIEPSSGTILLDGVDIQSINATKLRQQIGYVIQQVGLFPHMTVAENIAVVP
FT                   KLLGWPKAKIQSRIDELLQLIQLDPAQFRQRYPAQISGGQAQRVGLARALAADPGVMLM
FT                   DEPFGAIDAITRTALQDEMLRIQQQLQKTIVFVTHDVEEALRLADKIAILHEGTIVQYD
FT                   TPLNLLRNPANHYVAELLGADDLVRRLSLIQVRHVLQPLPASYDSSLASIESSRNLRDG
FT                   LNQLLASSDEQLLVVEHNQPIGMLSLAAIHAYLHPEVIHERHR"
FT   gene            422850..423488
FT                   /locus_tag="Haur_0352"
FT   CDS_pept        422850..423488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0352"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cya:CYA_2232 quaternary
FT                   amine uptake ABC transporter (QAT) family, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03003"
FT                   /db_xref="GOA:A9B7N0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7N0"
FT                   /protein_id="ABX03003.1"
FT                   /translation="MNDIVDGLRYLLTERAEVWQLLGQHVTISLIALLIASLIALPLGV
FT                   LVVRVGWLAGGVMAVLSVLYTIPSLAMLIMLIAVFGLSKTTVIVTLVIYAQVILVRNIV
FT                   VGLKSIDRSVLEAARGLGMNAWQIWWQVELPLALPIMLAGLRIAAMMCIAISSIAAMIG
FT                   VGGLGQLLFQGITFDRADMIWAGTISIASLALVCYGLLALVEQRFSPKI"
FT   gene            complement(423595..424140)
FT                   /locus_tag="Haur_0353"
FT   CDS_pept        complement(423595..424140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_2326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03004"
FT                   /db_xref="GOA:A9B7N1"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7N1"
FT                   /protein_id="ABX03004.1"
FT                   /translation="MTQPFYKICPTCNTQTHPDVMFCTNCGGSLQGSPVHGAQTVAYQQ
FT                   NSTPAQPGYQQYSQPVQPPPMYQANYQQPIAPYQQPNQYQYQVPQGYAYTEKNKVVAAL
FT                   LAFFLGPLGIHGFYLGNSQMGLILLLSNVVFLPLSCFGIGLLGYALTGIICLVQTVLYL
FT                   VASDAEFYQKYVVQKSWF"
FT   gene            424368..424814
FT                   /locus_tag="Haur_0354"
FT   CDS_pept        424368..424814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ter:Tery_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03005"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7N2"
FT                   /protein_id="ABX03005.1"
FT                   /translation="MTIYFYAVSAEFGCFSNFSAHGFKLDGHYWPTSEHYFQAQKFTGT
FT                   DYATTIRLAKSPAIAARLGRSRKQPLRRDWEAIKDAVMRRALLAKFRSHAEIRAILLAT
FT                   DDQPLVENAPNDYYWGCGIDGSGKNMLGQLLVEIRQTLRDEDVA"
FT   gene            425124..425462
FT                   /locus_tag="Haur_0355"
FT   CDS_pept        425124..425462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03006"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7N3"
FT                   /protein_id="ABX03006.1"
FT                   /translation="MLNPADQLLLKSLCNDLVAVEAQISELETQRESLRARISELVEQM
FT                   GGKIQLRGFGTLQISNPSVIVSYDRKGIEQLVQQLAEAGNFALVDAIQTSRKESMRSGG
FT                   LRIMREKA"
FT   gene            425466..426575
FT                   /locus_tag="Haur_0356"
FT   CDS_pept        425466..426575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03007"
FT                   /db_xref="GOA:A9B7N4"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9B7N4"
FT                   /protein_id="ABX03007.1"
FT                   /translation="MRLTRRLLLKSVLISVICGVALLQLYRQRVPPAFNLPAAASVRTQ
FT                   HPIVGVHTRLMGLDEPTIRRTLQQVREMGATTIIDLFPWAVIQPRSANSYEWTGSDMLI
FT                   AHAQRQGLTVIARLDFVPAWARPANTSDRYLDPDHYAAYADFVVAFAQRYVPQGVQVLQ
FT                   IWNEPNLRFEWGDRAPDPVAYANLLKVVYPRVKAVAPEALITLAGLAPGGPTGLIDPQT
FT                   LSVNDLTFLKLCLAEKPPFDAVSVHAYGSINPAEQAPDLTITNFRRTELIYDLVLAAGY
FT                   EVPFYITEGGWNDHARWPNAVSPPIRVQNTLAAYAWAEQHWPWMHTVGFWQFSLPNLTY
FT                   TYADNYTFVAPDGTPKAIYYAVQAFTQQP"
FT   gene            426820..427527
FT                   /locus_tag="Haur_0357"
FT   CDS_pept        426820..427527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0357"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; fatty acid
FT                   responsive transcription factor FadR domain protein; KEGG:
FT                   ilo:IL1821 negative regulator for fad regulon"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03008"
FT                   /db_xref="GOA:A9AU89"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU89"
FT                   /protein_id="ABX03008.1"
FT                   /translation="MSELQRPASYCEQQLIKRIIGGSYAAGSSLPSERELAVQLGVTRP
FT                   TLREAIQRLARDGWLVVQQGKPTMVCNIWHDGGLGVLRSLVQYSTELPAQIVPQLLAVR
FT                   LDLAPSYTAMAIEHHAEAIAALLQTALPLADNAAAYAQFDWQLQHQLTIASTNPIYTLI
FT                   LNGFRGFYQMMALDYFELAQAREHSAAFYRTLLQAAQTRDADLARQASQFAMQQSIEVW
FT                   QLLAANINNTQRG"
FT   gene            427529..429130
FT                   /locus_tag="Haur_0358"
FT   CDS_pept        427529..429130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0358"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pmy:Pmen_1558 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03009"
FT                   /db_xref="GOA:A9AU90"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU90"
FT                   /protein_id="ABX03009.1"
FT                   /translation="MRRWNGWGDESKEYPVKAGILGLLKQLIGAGTAPSDVRLAEIVAQ
FT                   VPASRLPHHELISTDPELRIRHARGQSFADLVATRSGELGQIPDGVAFPQSSQAVRELI
FT                   DWASDNNVSLIPYGGGTSVAGHINPVAGERPILTVSLAKLNRLMEINPTARLARFGAGI
FT                   KGPDLEAQLRALGFTLGHFPQSFELSTLGGWIATRSSGQQSLGFGRIEQLWAGGRVETP
FT                   RGSLELAPFPASAAGPDLREMLLGSEGRYGIITEVTVRIRPIPELDVVHAIFFANWEQA
FT                   QTAARTIAQANLPLGMLRLSTPTETMTNLALAGHERVIGLLEGFLKLRGVGSEKCLLLV
FT                   GFIGSQAQVKLSRQAVLSLMRRHGGVHIGQSFGKAWQAGRFRAPYLRNRLWELGYGVDT
FT                   VETATTWENVTPLLNRLEHSLRHGLAAEHEQVHVFTHLSHFYPTGSSIYTTYAFRLGND
FT                   AQATLARWHALKTAASQAIVAAGGTISHQHGVGLDHRPYLEAEKGRLGIGALQQLGQHF
FT                   DPQGLLNPAKLYEDGQ"
FT   gene            429127..430707
FT                   /locus_tag="Haur_0359"
FT   CDS_pept        429127..430707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0359"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   hch:HCH_04624 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03010"
FT                   /db_xref="GOA:A9AU91"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU91"
FT                   /protein_id="ABX03010.1"
FT                   /translation="MNPQLQWNAAWRETTWQVLDQAWDVIIIGGGITGAGLVREATRSG
FT                   LKALLLEARDFAWGTSSRSSKLVHGGLRYLAQGQVRVTYDSVVEREQLLNEAPGLVAPL
FT                   GFLIGLPQGKPIKRWVYQAGLLAYDALARRREQHYLSMANLRLQAPYLADANLAAGLRY
FT                   SDAQTDDARLVLRILREATAAGASVLNYAAVEQLVRANEQVVGVVVRDQLSQRQQTLTA
FT                   KAIVNATGAWVDQLRQQIQAPAKMRPLRGSHLVFSQAQLPLAQAINLEHPRDQRPVFFV
FT                   PWEGVSIVGTTDLDHEQDLWQEPSISPAEVAYLLEAAQAAFPSLDLSLSDVISTWSGVR
FT                   PVVDTGASDPSKESRDYVLWQEQGLLTVTGGKLTTFRLIALEALKLLRQRLPQIKRWPN
FT                   APRLNPAPSSLAGTLAPRIKQRLLGRYAAEAPLMLQELPNHEFCSIADLPSLWAEIRWA
FT                   ARYEAVTNLGDLLLRRSRLGLLLPHGAAEYQAQIQAICTEELGWDAQHWQTEWQQYQQL
FT                   IAQHYSLPA"
FT   gene            complement(430875..431816)
FT                   /locus_tag="Haur_0360"
FT   CDS_pept        complement(430875..431816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0360"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: rca:Rcas_1054 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03011"
FT                   /db_xref="GOA:A9AU92"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU92"
FT                   /protein_id="ABX03011.1"
FT                   /translation="MPMTQEHQTAWERQHRAANYAEISTRIAHILPSDGMIEPLPGVHV
FT                   YRVSGPTEPIHGVTVPAFCVIVQGRKMVLLAADQYHYDPAHYLLTTAALPVVGQITEAT
FT                   PEAPYLSLRFALSPALISSVMAEVGVTPVASQASVRALAVSSLDGEFMDVVVRLVRLFN
FT                   SSRDAQVLGPLIMRELVYRLLMSEQGMRLRQIAIIGGAEHRIMGALAQIQRDFHQPLRI
FT                   PDLAQAVGMSVSGFHSHFKAVTAMSPGQYQQQLRLQEARRLLLSEDLDAASVGARVGYD
FT                   DAAYFTRAYKRLFGAPPIRDATRMRAVVMAGG"
FT   gene            432016..432876
FT                   /locus_tag="Haur_0361"
FT   CDS_pept        432016..432876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0361"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rca:Rcas_1051
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03012"
FT                   /db_xref="GOA:A9AU93"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU93"
FT                   /protein_id="ABX03012.1"
FT                   /translation="MTIIPTVSLNAGIAMPILGFGVFQITDAAECERAVSDAIQTGYRL
FT                   IDTAAVYGNEAAVGAAIARSGVAREDLFVTTKLWIQDTGYEQTKAAFERSLQRLGLDYL
FT                   DLYLIHQPYGDIYGAWRAMEELYQAGRIRAIGVSNFHPDRVMDLIVHNQVPPAVNQIET
FT                   HPFQQQIDTQQFLQQQGVQIESWGPFAEGKHAIFQNELLAGIAATHQKTVAQVILRWLT
FT                   QRGVVAIPKSVRKERMEENFNVFDITLSPEEMAAISTLDTKTSSFFDHRDPAVVKMLGE
FT                   ANRPT"
FT   gene            433120..434373
FT                   /locus_tag="Haur_0362"
FT   CDS_pept        433120..434373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0362"
FT                   /product="Sterol 3-beta-glucosyltransferase"
FT                   /EC_number="2.4.1.173"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   afw:Anae109_0485 glycosyl transferase family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03013"
FT                   /db_xref="GOA:A9AU94"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU94"
FT                   /protein_id="ABX03013.1"
FT                   /translation="MDISIISYGSRGDVQPFVAIARALRHVGHQVQLIGPANFAALSHD
FT                   AGVPFVSVGVDIQAYLRERIASLSGSRNVIGLLKSLRNELNELIEGIAQETLQACQGTD
FT                   LILGTGPQTASFAERLGVPFIEAVLQPLTPTRAYPSPIAPAWLQLGGFANYLTHLGFEQ
FT                   IFWQIFRPTVNRVRSHVLGLPSYGFTSPFGKIREQVPLRLHAYSDYVMPRPNDWAKQHQ
FT                   VTGFWFLPAPADWSPPAELCAFLAAGPAPIYIGFGSMMGGDPQQLTSIVKEALARSGQR
FT                   GILAGGWGALAETSAPSDHLCFVESVPHQWLFPQTAAIVHHGGAGTTGAALRSGRPSIV
FT                   VPFAFDQTFWGRRVAELGVGTAPIARSQITVDRLTAAINQVTTQTAIREQAAQLGSQIQ
FT                   QEYGTAQAIDHIHRVFRH"
FT   gene            complement(434482..435315)
FT                   /locus_tag="Haur_0363"
FT   CDS_pept        complement(434482..435315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0363"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: rrs:RoseRS_3519 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03014"
FT                   /db_xref="GOA:A9AU95"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU95"
FT                   /protein_id="ABX03014.1"
FT                   /translation="MAIIVTDSTADIPAGLAAENDIHVIPLTVNFDAESFADGVEITHD
FT                   QFYARLVESNNLPTTSQPSVGAFEQLYRAIGNDEPIISIHIAGKLSGTIRSAQQAAELL
FT                   PDFDIRVIDVQSTTMSQGWAALLAARAAKEGKSADEIVALVHSIVERTRLLAALDTLRY
FT                   LEKGGRIGKTRALLGTLLNVKPIIDVRDGEVKPFEQVRSKKKAVARLIEEARSMAPFEE
FT                   LAVLYSRNEAEAREFAQSLNEIFPADRIVLAEIGAVVGTHIGPGALGFTGVRKNK"
FT   gene            complement(435499..436347)
FT                   /locus_tag="Haur_0364"
FT   CDS_pept        complement(435499..436347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0364"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: rca:Rcas_0603 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03015"
FT                   /db_xref="GOA:A9AU96"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU96"
FT                   /protein_id="ABX03015.1"
FT                   /translation="MARVKIITDSTADIPPALAQELNITVIPIYVHFGDQTLRAGIDIS
FT                   NEQFYRRMAEGGPYPYTTAPAPGVFEQYYRQFSREYDGVFSIHLSNRFGGVVKSATIAR
FT                   DKLPASLTRVEVIDSTSTSLGLGMVAIAAARAALDGASIDEVHRVVMQTIQLTHVVFFV
FT                   DSIDYLERSGRLSQASAMLGSMQRIKPLLILDDGEIVPYDRTRTRAKAIEGLFTFIEDF
FT                   PKVEQVAIMHSTTPDDVEKLLEKIDPIYPRDQVMIVEYGPALGAHLGPNAMGVVVYEGM
FT                   E"
FT   gene            complement(436392..438029)
FT                   /locus_tag="Haur_0365"
FT   CDS_pept        complement(436392..438029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0365"
FT                   /product="Dak phosphatase"
FT                   /note="PFAM: Dak phosphatase; KEGG: det:DET1263 DAK2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03016"
FT                   /db_xref="GOA:A9AU97"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU97"
FT                   /protein_id="ABX03016.1"
FT                   /translation="MDSAPKNQIDGTRLLAVFRAAAAWFSQNVATVNALNVFPVPDGDT
FT                   GTNMNLTLTAALKDVQNDASVAVVAERVYRGALMGARGNSGVILSQILRGLSQGMVGQQ
FT                   VCTPEILVTALEQAATTAYKAVIKPVEGTMLTVIRETSEAARAGFQPEMNWHEVLDLIV
FT                   KGARVSVDNTPNLMKMLRDAGVVDAGGEGLYLLFEGARAFARGEQLEQRVAPVDQLAMA
FT                   FDDIHSDDDFGYCTNFMIQGENIPYEDVRNTIAEMGTSVVAVGDERLVKVHLHTLRPGD
FT                   ALNYAVQWGSLGAIEITNMDKQRSDLHAAQAQQASQPARVKLDEPVSDVGVVAVAPGQG
FT                   FRVLFESLNVGEVVTGGQTMNPSIQDLVTAIDKLPQPEVIVLPNNSNVILAAQQAQQVT
FT                   NKVVHVIPTKTVPQGMAAMFAFNYAVGASDNVQAMSRAIKDITTAEITTAVRDATVNDV
FT                   EVRDGQTIGLLNGALVESGDQPDEVIDRILARMDLDDHEIVTIYYGEQCSAEQAEALAH
FT                   KINATYPALDVEVQNGGQPFYDYILSAE"
FT   gene            complement(438001..438477)
FT                   /locus_tag="Haur_0366"
FT   CDS_pept        complement(438001..438477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0366"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   amt:Amet_2772 protein of unknown function DUF322"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03017"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU98"
FT                   /protein_id="ABX03017.1"
FT                   /translation="MNEKTSLANVRQNDAGRIEVHSRAIATVVAGAVVRCYGVVGMAPR
FT                   NLRDSVAHVLRPEDQYKGIDVQVSTEAITVDLFVIIEYGTRIATVARNIMESVQYAVVH
FT                   ALGEANITVNVHVQGLRIEQADKEPKDATEGQPSRWRRFGVMGGLRGQRTEESN"
FT   gene            439342..440517
FT                   /locus_tag="Haur_0367"
FT   CDS_pept        439342..440517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0367"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; sigma-70 region 1.2;
FT                   KEGG: rrs:RoseRS_3157 RNA polymerase, sigma 70 subunit,
FT                   RpoD family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03018"
FT                   /db_xref="GOA:A9AU99"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9AU99"
FT                   /protein_id="ABX03018.1"
FT                   /translation="MFTRRNVVDCIENPAGSIDSFRAPPAAKAIVGVAQRAWTMTKYET
FT                   MNVAKNQPELEDAPEGWELEPGFNDEDVELAIVNLRRKKTLYSEAVEDSVQMYLREIGE
FT                   VELLTAEEEITLAKQIETGRKAEHQLQTEQYATWDERTALERRVDFGNEGRRKLTQANL
FT                   RLVVSVAKKYIGNHMSFMDLIQEGNIGLMRAVEKFDYRKGNRFSTYATWWIRQAVTRAI
FT                   AEQSRTIRLPVHLSESIAQMRRVAYQLEQALQREATPDELADALGVSLRKVKRMLNASV
FT                   QPVSLEQPIGKEGQGRVGEFLADDTDEAPLEQATRMMLQDELADALSQLPDRERQILLL
FT                   RYGLADGKRRTLEEVGAEFGITRERTRQIEAEAMRHLRQPNVGQHLRAYLD"
FT   gene            complement(440952..441866)
FT                   /locus_tag="Haur_0368"
FT   CDS_pept        complement(440952..441866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0368"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mma:MM_3320 oligopeptide
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03019"
FT                   /db_xref="GOA:A9AUA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA0"
FT                   /protein_id="ABX03019.1"
FT                   /translation="MLSLTGALTSAWQRLTHGSAKTPIIEQPEQRAKPQLSRSGKFAAG
FT                   GLLFMLIAVIVGPWLWQVDPLAQNIGQRLAPPSLSHPLGSDQFGRDVLARMLIGGRWSL
FT                   FGAGFVCIGTSCLGLVLGACCAVGPRWLDYLLSRITETFQAIPPVLLALALSAILSRSF
FT                   SNLLLALILTNWTWYARMYRALILKELAMPYIEGAQAIGVKPLAILLRHVLPNLFGSMV
FT                   VIATTNFGSVILNLSALSFIGFGLNPPTPEWGNLINESRAFFQREPRLMIIPGLCIATT
FT                   VLWLNLLGNALRDRLDHYQGIRD"
FT   gene            complement(441790..442740)
FT                   /locus_tag="Haur_0369"
FT   CDS_pept        complement(441790..442740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0369"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sth:STH2653 oligopeptide
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03020"
FT                   /db_xref="GOA:A9AUA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA1"
FT                   /protein_id="ABX03020.1"
FT                   /translation="MSTLLRQSAGRLLSGLMVLWMVSMLAFLIIHMAPGDPARMLLSAS
FT                   GLDAPPAEAVAAKRRELGLDRPLLSQYVSWLGAVVQGDFGVSYRSGKPVWSMYRERLPA
FT                   TLLMAGLVLTVSLSIAIPLGLISAIKRHSLLDHAAQFLAVIGAAIPGFWIALVLILVFA
FT                   AKLRWLPALGSATFKGMLLPAIVLALPNIALTSRLVRATTLDVLNQQYIVTARAKGRSE
FT                   YGLLFGHALPNIAASLITPISLELAFLLTGTVIIETVFAYPGVGRMAVEAALVGDMPVL
FT                   GLSVLIAGGIYVIANWCADLGMAALDPRLRQNANN"
FT   gene            complement(442737..444230)
FT                   /locus_tag="Haur_0370"
FT   CDS_pept        complement(442737..444230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0370"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: mba:Mbar_A3677 oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03021"
FT                   /db_xref="GOA:A9AUA2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA2"
FT                   /protein_id="ABX03021.1"
FT                   /translation="MIQMLVACGTASETPQATTSTSDPNGELRIGTGINLPTSLDVAQG
FT                   SNGYNMLTYGAGETLMRFTPSNQLEPWLAENVTALDPTTWQIKLRQGIRFHDGSELKAS
FT                   DVLNSFNSSWQNLSGAKNFIPADTNVNVVDDYTLTLTTSQAEGSIPYSLANWNFVIHKP
FT                   AVNGISILTGMYQPISLEKDQELVLERFANYWDGQAGLQKISVKKIPDANARALALQSG
FT                   DLDLLTNVSPDIARGLPADIEIQSVAGTRMHYVMLDSAHPPFDDRLVRQAMALAIERQA
FT                   LLQATLDGQGAVATNLYPATVGIELVEAQIFDPAQAASLLDQAGWVVGSDGMRSKDGQP
FT                   LAFTLHSYPGRAELTLMAIAIQAQLQTLGIKVEVNEVADIGEVLEKGNFQASMYSIGTS
FT                   GDPQYTVGITLVEDAAYNYAGYKNPAIESAFAELRAEQDPIKRIAIAKRIQTEVKNDPT
FT                   NLYLASPPLISAYRKGSISGYVPNPNDVYLITKELKLNQ"
FT   gene            complement(444342..445100)
FT                   /locus_tag="Haur_0371"
FT   CDS_pept        complement(444342..445100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0371"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bra:BRADO3705 putative
FT                   3-oxoacyl-[acyl-carrier-protein] reductase, related to
FT                   short chain alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03022"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA3"
FT                   /protein_id="ABX03022.1"
FT                   /translation="MVGLITGAGTGIGQAMALALAKRGATIILVGRRREPLLQTASLVT
FT                   QLGGQAWPIVCDLSDHEAVAALAAQITQRYVQLDLLIHNAAVLAGGAFDQLPESAILAT
FT                   LNANLLHPIWLTRQLLPKTVLIVGSTVSRVAMPGASLYSLSKAALEAWGLALTAETTIK
FT                   IVRVYPPATKTAMTTAMAQQTGQRFPLAEANKVGEQIIQRYLAGETEIVLSASDRWLFR
FT                   LQRYAPKRLQALLKRYHQQLIKLWGGSTII"
FT   gene            complement(445114..446100)
FT                   /locus_tag="Haur_0372"
FT   CDS_pept        complement(445114..446100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0372"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; KEGG:
FT                   bat:BAS3018 3-oxoacyl-(acyl-carrier-protein) synthase III,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03023"
FT                   /db_xref="GOA:A9AUA4"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA4"
FT                   /protein_id="ABX03023.1"
FT                   /translation="MQFPLRIAGIGAYLPATIVTTSELAERFGVDPGLIERITGIRERR
FT                   YAGAETALTMATQAAQQALANANYALDSIDLIVVASAGMHQAIPCTAALLQNALQAPVG
FT                   RSACFDLNATCMSFMLALQLLAPLINSGVYQRVLLVSSERASVSLNPHEWESTALFGDA
FT                   AAAVVLERGDGSSSLQHSQFATWSNGSDLIQVRGGGTAQHPNAADTTPDMNWFMMQGPL
FT                   AFRFVLREMQQFVERFLAELGWQNSEIDAVIPHQANRHAIEQVQARLGFQPDQVISNLA
FT                   TRGNCVSVSVPLALAEAVAAGRIQRGNRLVLLGSGAGITLGAVALIY"
FT   gene            complement(446120..447373)
FT                   /locus_tag="Haur_0373"
FT   CDS_pept        complement(446120..447373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0373"
FT                   /product="Sterol 3-beta-glucosyltransferase"
FT                   /EC_number="2.4.1.173"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   gvi:gll2420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03024"
FT                   /db_xref="GOA:A9AUA5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA5"
FT                   /protein_id="ABX03024.1"
FT                   /translation="MNYCILALGSRGDVQPFIALALGLQTEGHQVVIAAAHDYRSLVES
FT                   YGCRFAPLVGSISALLNPEQMAAGLAAGRSAIIKQFLQQTPPIIRQLIADALAACQTAD
FT                   CLIVSSLGMWPALHLAEHLHIPVVLVHLHPYAASSQTAHHFAPQLAWASYRRMSYRVAE
FT                   QLQWQVLRMAFNQARQQILQRPSLSIGQLWQRSRNFQPPTLYAYSALVAPPPATWFDDG
FT                   AITGYWSLPPAADWQAPTALQQFLAAGPAPITISFGSMLHGQKRGNQLSQLLITASQKA
FT                   KVRMIINQGWGDLAQGKLPANCLAINGLAYAWLFERVAAVVHHGGAGVTATALGAGKPA
FT                   LVTPFLGDQYFWGQRVYDLKAGPAPVPANQLQVAQLATLLCSLIERDDYQAAAQQLATQ
FT                   LAQEQGVTKAIAWLKQRF"
FT   gene            complement(447370..448671)
FT                   /locus_tag="Haur_0374"
FT   CDS_pept        complement(447370..448671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0374"
FT                   /product="putative adenylate-forming enzyme"
FT                   /note="TIGRFAM: putative adenylate-forming enzyme; KEGG:
FT                   btk:BT9727_2999 coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03025"
FT                   /db_xref="InterPro:IPR012685"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA6"
FT                   /protein_id="ABX03025.1"
FT                   /translation="MSISDVLTMGYHFGQARWRWQRLNAERLPAFQATKARQLIAWVAQ
FT                   HSAFYRQHWQGHDLNDWRNLPAVDKGLMMANFREFNTLQVPTAAAFDLAQQAEQQRDFV
FT                   PRLGNLTVGLSSGTSGHRGLFLVSAAEQLLWAGTILGRTLHQIKPTKIAFFLRANSNLY
FT                   QQLGGRLIQFRYFDLTQALAGHIQVLNDYRPTIIVAPPALLLQLLAAAQNGQLTHRPER
FT                   IISVADALASDEQQQLSNYFGIPIEQIYQATEGLLGISCAHGNLHLQEDIVAVDFEDLG
FT                   QGRVTPYITDLWRRTQPIIRYRLNDVLRLSAQPCRCGSAFAVIEQIEGRRDDLCYFTCH
FT                   GQRQAIFPDSLRRAILLAHSAIQEYQITQTHDDQLTITLMLATAADTATVGAAVEQQIK
FT                   LHLADYGCTNCQLSIGFAPIEYGLVNKRRRVIRQ"
FT   gene            complement(448668..449483)
FT                   /locus_tag="Haur_0375"
FT   CDS_pept        complement(448668..449483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0375"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   lpn:lpg1629 Zn-dependent hydrolase GumP"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03026"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA7"
FT                   /protein_id="ABX03026.1"
FT                   /translation="MQVRLLDTGICRVPEFHVLRDGSRRMLDCHALVALIEHPKHGWGL
FT                   FDVGYSQAMISATQQLPWSLYRQATPLQLSPELEVVNQLPQYGLSAADIGWIVLSHAHA
FT                   DHVAALADFPQAQIYMSATAFELVSQVQGINALRRGIIPHLFPQGWHQRLHLIHEFRDQ
FT                   PLFALGNTHDLFGDGLLRLVELPGHARGQIGMYIANSRPILLAADGAWHSRAIRGQVLP
FT                   HPIIYFMIDDAKAMATTLARLSAFAQAYPEVLIVPCHCPEIYANEVATA"
FT   gene            complement(449487..450467)
FT                   /locus_tag="Haur_0376"
FT   CDS_pept        complement(449487..450467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0376"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: gur:Gura_2007 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03027"
FT                   /db_xref="GOA:A9AUA8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA8"
FT                   /protein_id="ABX03027.1"
FT                   /translation="MQILVTGATGFLGAHTALALQKAGHTVLGLGRRWEHVPQLLAAGI
FT                   QPIKADLRDRATLIAACASCDVVVHSAALSAPWGSRSDFQTINVDGTANVLAGCAAQKV
FT                   GRLVFISSPSVLSNGRDQFDLLDTMPYPARPISLYSASKQQAEQLVLKHSTPSVILRPK
FT                   AIFGEGDQALLPRIIAAARAGRLRQFGNGQNLVDLTYVANVVHAIELALTAPAALGKCY
FT                   TITNGEHPQLWAVIRRVLAELGLPSQLRPMPLSLALAVARIMESISLLTRREPLLTRYS
FT                   VLALARSQTHSLVAAQHDLGYQPLISLETGIQRTIAALKQPTKGV"
FT   sig_peptide     complement(450408..450467)
FT                   /locus_tag="Haur_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.963 at
FT                   residue 20"
FT   gene            complement(450474..451094)
FT                   /locus_tag="Haur_0377"
FT   CDS_pept        complement(450474..451094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0377"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: rca:Rcas_4070 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03028"
FT                   /db_xref="GOA:A9AUA9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUA9"
FT                   /protein_id="ABX03028.1"
FT                   /translation="MGLHVSSHPLVLHKLALLRRVESEPKKFRELVREISQFLVYEATA
FT                   DMPLAPYTIQTPLSTMQGHAIGARIGLIPILRAGLGMVEPVIDLLPTAHVWHLGLYRDH
FT                   NTLEPVTYYNKLPAQPDIDVCLILDPMLATGGSAVAAVDILKAWGAAKIKFLGLIAAPE
FT                   GVERLQTAHPDVEIHLAALDERLNEQGYIVPGLGDAGDRQFGT"
FT   gene            451456..452154
FT                   /locus_tag="Haur_0378"
FT   CDS_pept        451456..452154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03029"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB0"
FT                   /protein_id="ABX03029.1"
FT                   /translation="MALEGNFADMPLIDLMHVFHHGRKTGRLLIANAPFKAMLWFFDGA
FT                   IINAGVVTQNAHERVACGEQAVFDMLAWDDAQFVFLPPNPQETVSVQIQHSIDWLIIEG
FT                   LRRRDQPQRLAGTTKLQPTSRLRLVPMLRQASDITLTIEDWRILSQLVQELSVAELVEA
FT                   TGWNYDQTLKVLHRLIALNLVEVCSEIVVSQRSLSPVLMAPNHEHMVENRVRGLVQAIK
FT                   ARLRRTSASA"
FT   gene            452163..452738
FT                   /locus_tag="Haur_0379"
FT   CDS_pept        452163..452738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0379"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: protein of
FT                   unknown function ATP binding; Miro domain protein; KEGG:
FT                   rrs:RoseRS_3915 protein of unknown function, ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03030"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB1"
FT                   /protein_id="ABX03030.1"
FT                   /translation="MVNYKIVITGAYAAGKSQFIRTVSEIDVVDTDVPVTHAEEKELKH
FT                   HTTVGLDFGTLSIDAEQRLLLFGTPGQERFDFMWEILAEGCLGYIVLVDSCRPAHFNET
FT                   IVVLERFAEMTPVPFVVAATKQDLPGALPPMYIRRRLGLPTDIPILACVATDYPSVSDV
FT                   ISTLLDRIDVLAQDSSSSSENNKEHSHG"
FT   gene            452731..453108
FT                   /locus_tag="Haur_0380"
FT   CDS_pept        452731..453108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0380"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   rrs:RoseRS_3912 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03031"
FT                   /db_xref="GOA:A9AUB2"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB2"
FT                   /protein_id="ABX03031.1"
FT                   /translation="MASRSEQINTILGQLVTNNGNDINGAALISSDGILIGSRMSADVN
FT                   ADRMGAIAATMMGVTTRVVNDLKIGKANEAIVNAESGYLLVMPVAAQMILAIILRQHAN
FT                   LGMIRIEARETGRAIAELMTA"
FT   gene            453125..453670
FT                   /locus_tag="Haur_0381"
FT   CDS_pept        453125..453670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03032"
FT                   /db_xref="GOA:A9AUB3"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB3"
FT                   /protein_id="ABX03032.1"
FT                   /translation="MADRQSWSVKGTAILTELVKMMDVSAAESQLLGSLHDGAKAQTTA
FT                   FTDAFYKRLLGHAATAEYLDGVSVERLTGMLGMWFSDLFRGNYDEAYAQQRLKIGEIHV
FT                   RIGLPVRYPLAMLDVIMPFGEQVAATSSDPAKAITAFRKVLALDVALFNQAYEDNQLSH
FT                   LADLVGGERLARLLLAGQ"
FT   gene            complement(453688..454326)
FT                   /locus_tag="Haur_0382"
FT   CDS_pept        complement(453688..454326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03033"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB4"
FT                   /protein_id="ABX03033.1"
FT                   /translation="MPEANTPVLVAVLNNHADWQRIQHEHWYRVPLAHAPRRMAAGMLA
FT                   WYQTKAFGDEGGQIRWYAPIEHVSQATRSQLIPEQPEHPRAHERYWRLEVGALQALPQP
FT                   IMAQRFRRITFISTNWQQLIHAKQINDLWLGDSLLEQLSQQLISEGMNVVRRRLHDGNT
FT                   PPQGTFVLIPLLNQIEVSIGEQRLRLDHDDLIWDFAGCLTNIRALQQRN"
FT   gene            complement(454330..455211)
FT                   /locus_tag="Haur_0383"
FT   CDS_pept        complement(454330..455211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0383"
FT                   /product="UV damage repair endonuclease-like protein"
FT                   /note="KEGG: rrs:RoseRS_1694 UV damage repair
FT                   endonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03034"
FT                   /db_xref="GOA:A9AUB5"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB5"
FT                   /protein_id="ABX03034.1"
FT                   /translation="MRYLGLSGRILKRPDLQAPNQQQLSQWVLYLYDVLRYLEQQQIHC
FT                   YRLPAWPYELLNTWPEAAEQFQLIGNYAQQAQIRLTYHAPSNVLLNSHDPLIRQYALTY
FT                   LTSAAAYLINLGCDDPVIVVHIGAQYGDRASALAQSVTSLQQLEPAVINVLALEADGRV
FT                   WSLLDALHIHAQTSIPVIFDWLHHQLYNPAQLNDTEALNYALATWPVQRKPKVHFSSPR
FT                   TEIRLGQRQQLLLPTWHEHSDLANPFELISLLRLPYQREYDLMLEVKAGDLAIERARND
FT                   LQRFAPEISDVE"
FT   gene            455418..456086
FT                   /locus_tag="Haur_0384"
FT   CDS_pept        455418..456086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0384"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: plu:plu2182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03035"
FT                   /db_xref="GOA:A9AUB6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB6"
FT                   /protein_id="ABX03035.1"
FT                   /translation="MVTTTQRFQLLAFDLDGTLVDSAQGIVDTVNQVLAEHGFATAAYS
FT                   QMAPWIGLPLQVFWERLTDFQPENYGILTERYRTIYREIAIPSSRLFAGVAETIDQLKS
FT                   AGYRLTIASSKITPVSSAVLQQVGLFGYFDLLMGNDSVSQPKPHAEMLAKTLAHFGLNA
FT                   TQALMIGDTIHDITLGHNAQVASLAVTTGTHDLATLTAAQPLAILNQLHELPAWLAQPA
FT                   "
FT   gene            456125..456346
FT                   /locus_tag="Haur_0385"
FT   CDS_pept        456125..456346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03036"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB7"
FT                   /protein_id="ABX03036.1"
FT                   /translation="MPQYKNRMYRKEWLSERRKLARALEGLEQNWDLEAEGIVLPTDDD
FT                   GATLTVEQLRERIADLDGKLERYPNPQK"
FT   gene            456723..457100
FT                   /locus_tag="Haur_0386"
FT   CDS_pept        456723..457100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0386"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: chy:CHY_2375 aspartate 1-decarboxylase
FT                   precursor; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03037"
FT                   /db_xref="GOA:A9AUB8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AUB8"
FT                   /protein_id="ABX03037.1"
FT                   /translation="MIRTLVHAKIHRATVTGADLNYVGSITIDEDLLEAAGIWPFERVQ
FT                   VVDVNNGARLETYAIVGERGSGTIQLNGAAAHLVNVGDLVIIMAYAQVDAKPEEWEPTV
FT                   VFVNEQNAITEVKALLPVGGR"
FT   gene            457158..458393
FT                   /locus_tag="Haur_0387"
FT   CDS_pept        457158..458393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0387"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein domain I
FT                   and II; MoeA domain protein domain IV; KEGG: ace:Acel_0167
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03038"
FT                   /db_xref="GOA:A9AUB9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUB9"
FT                   /protein_id="ABX03038.1"
FT                   /translation="MTLLAVADAQAAILERMTTLASESIDLNEALGRVLAAPMYADRDA
FT                   PPFANSAMDGYAVLVTDLNNASADNSVALQIIERVAAGAVPQHQLRAGSAIRIMTGAQV
FT                   PANAEAVVPFEETDEGQANAQTEVVRMFQPTQHGNNIRPAGEDMQAGSLVLAAGQMLNA
FT                   GSIGVLATIGAAQVPVFRQPRVAIIATGDELVDVGVEPKAGQIRNSNGYANAAQVREAG
FT                   AIPIMLPIVPDNADALRATLAQAVAQVDVLLTSGGVSVGDYDLVKQILNEVGKLEFWRV
FT                   RMRPGKPLAFGSINGKPIFGLPGNPVSAMVCFELFVRPALRKIGGYQQLLRPSVWAKLL
FT                   DADLESNERRQYLRVIVKSSATGLTAELTGAQGSGLVSSMASANGLLIVPEAGHGINRG
FT                   AMAEVVLFGELH"
FT   gene            458411..459631
FT                   /locus_tag="Haur_0388"
FT   CDS_pept        458411..459631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0388"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   tfu:Tfu_2817 phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03039"
FT                   /db_xref="GOA:A9AUC0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC0"
FT                   /protein_id="ABX03039.1"
FT                   /translation="MPFESFQDLITMLVVILVLQVSLALLLIGVRKWRPTRYQRYPRIS
FT                   LPPTSDERHQFQLYMSGEELFPAMLQAIESAQRLILLETFIFKGDDLGHKFREALLRKA
FT                   RSGVAVYVIIDGFANLVVPRKFKNFPPEIQLLSYPAFPRLSQIFDIGSYARDHRKLLVV
FT                   DNEVAFIGGYNLGELYRTEWRDTHVQVRGPIVSNLAEMFASQWNRYRRRLTRLHIDLEL
FT                   EWQSTVRVQRNDAGRLVFPIRSMYLDAIERAERFVYISNAYFIPDRAILEALVLTARRG
FT                   VDVRILVPAESNHVLADWLARHYFEFCLRHGIKIFLYENAMIHAKTATIDGIWSTVGTA
FT                   NLDRLSLAGNHEINLEIYNAAFAERMQEIFACDMANARELTLAEWIKRPWYTKAAELVL
FT                   SPLWPIL"
FT   gene            459645..460040
FT                   /locus_tag="Haur_0389"
FT   CDS_pept        459645..460040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03040"
FT                   /db_xref="GOA:A9AUC1"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC1"
FT                   /protein_id="ABX03040.1"
FT                   /translation="MLKRNESLAFGRPFLITVIAIGYVLTAMLEVAVALYGRVPAFLEQ
FT                   FILSDDPLLLIVTACFQVMMGLALFQGWRVMWWVVIGSAYLSIGSYILDGMLGERWAWG
FT                   GMLWNVVVLAYMNSRDVQAFFGREVYY"
FT   gene            complement(460034..461065)
FT                   /locus_tag="Haur_0390"
FT   CDS_pept        complement(460034..461065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0390"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="SMART: AAA ATPase; KEGG: rca:Rcas_4086 magnesium
FT                   chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03041"
FT                   /db_xref="GOA:A9AUC2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC2"
FT                   /protein_id="ABX03041.1"
FT                   /translation="MNELLPYPLLGIVGQRELKTALTLALVNPAVGGVLLSGPYGVGKT
FT                   TAVRGLLDIMPLVKRSRCENNCPPDDESDLCPTCLDFLARGESRLKDDLMRLIELPLNA
FT                   RLEDVVGGLNERVAIEQQRVVLEEGVLARANHNLLYVDEINLLDHAVVDAILDAAAQGQ
FT                   TFVRRGAMVKLYQSRLILIGSMNPEEGRLRPQILDRLGLRVWVGPLPNARERLEIYRRA
FT                   IAFRQDRTAFRMAYAQATTQLRLDVLKARELLPKVHLTKTAERYAMQVITQLAIPSHRA
FT                   EIVLLEAARARAAADDRVRATPNDIKAVAPMALRWRQSPHLSDFLQQHETDEHLIAQAL
FT                   QTQ"
FT   gene            complement(461074..461361)
FT                   /locus_tag="Haur_0391"
FT   CDS_pept        complement(461074..461361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0391"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   gtn:GTNG_1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03042"
FT                   /db_xref="GOA:A9AUC3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC3"
FT                   /protein_id="ABX03042.1"
FT                   /translation="MIDEQTEALVRRLKSIEGHVRGVQRMLEEDAYCIDVLRQTLAIRR
FT                   ALEKVDALVLERHLSTCVTNAIRSPNEGEREQAITEILEIFAATRSVSEK"
FT   gene            complement(461374..462195)
FT                   /locus_tag="Haur_0392"
FT   CDS_pept        complement(461374..462195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0392"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; PGAP1 family
FT                   protein; KEGG: rrs:RoseRS_0879 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03043"
FT                   /db_xref="GOA:A9AUC4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC4"
FT                   /protein_id="ABX03043.1"
FT                   /translation="MSVIVIDDQVVHYETFGRGRPVLFLHGWLGSWRYWMPTMEFVSKD
FT                   FRTYSFDFWGFGDSDKTSTAKSISITNFSDQVIRFLDAMGIDKVPLVGHSMGGMVALKT
FT                   AIRHPNRISRVAAIGAPIVGTSLSGLLKLTDNQYVSRAMARVPVVTKFLFRWFLGNVND
FT                   TAYGEILDDSVKPTEESLRRAVGSMMRTDLRPELEQLTIPTLIIHGARDDIVNPNQADI
FT                   FLQRDMANTQVFVMPESRHFPFLDEPAQFNKVLHAFLKRPVNEARAAAEAA"
FT   gene            462439..463041
FT                   /locus_tag="Haur_0393"
FT   CDS_pept        462439..463041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0393"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: swi:Swit_3244 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03044"
FT                   /db_xref="GOA:A9AUC5"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC5"
FT                   /protein_id="ABX03044.1"
FT                   /translation="MSDFRAQIQHYIREQALPIDKYSHQPRLYQLISMIGQGLSYDDDV
FT                   VYAAAWLHDLGVFIGHRPTDPDALAAWDNVAYALEKVPALLQQWQFPPEKIEVVLTAIS
FT                   QHSPQQTPTSIEATLLRDADMLEQLGAVAILRIVSKVGRDTRYPTFGQALATLEHNLEH
FT                   LPSQLRLANSQQLAQARIAVLGQFITAAQAESQGQPW"
FT   gene            complement(463043..463924)
FT                   /locus_tag="Haur_0394"
FT   CDS_pept        complement(463043..463924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0394"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rca:Rcas_0730 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03045"
FT                   /db_xref="GOA:A9AUC6"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC6"
FT                   /protein_id="ABX03045.1"
FT                   /translation="MTPISEQQQELLSAALDGQLSAAEQAQLDQQLEHDHGLAVEFAEL
FT                   RSMQALLQELPPVRPPRSFTLDPAIHAPKRSFWLGGWIRWVGVVGAFALMLTVGLQLTN
FT                   QSGQSMTMAPVADMANPEAANGVSDRMAIENNNTSAEAPPMGSGSGSGPADPSQPTTAE
FT                   DTMAVLDQTPEPMVGGAAPAMIEGYPTPMAYSSIPISDTAGMARMSAEQATALAGSPLN
FT                   NPLIDQNNPSSPGTLDLEQPVLKEQTPTAQPVPIAMAESEPSLLLWFSIALVLGVGLAS
FT                   AMVYWLKSFKQP"
FT   gene            complement(463955..464542)
FT                   /locus_tag="Haur_0395"
FT   CDS_pept        complement(463955..464542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0395"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: rca:Rcas_0731 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03046"
FT                   /db_xref="GOA:A9AUC7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC7"
FT                   /protein_id="ABX03046.1"
FT                   /translation="MTDAERQWVSAAKDGDVEAFNQLVRMYEGRVYGLAYRMLGDSDSA
FT                   ADVAQDTFISAFKAIKRFREGSFAAWLLRIATNACYDVLRAQKRRRTTSMDQLLAGDDD
FT                   SPGEQFEDQSLPLDQHMINRELQAAIQAGLATLPEDQRAVLIMCDIQGFAYEEIAAATD
FT                   TQLGTVKSRLSRARAKLRDYLKSRELLPTAER"
FT   gene            complement(464627..465529)
FT                   /locus_tag="Haur_0396"
FT   CDS_pept        complement(464627..465529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0396"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rca:Rcas_0880 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03047"
FT                   /db_xref="GOA:A9AUC8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC8"
FT                   /protein_id="ABX03047.1"
FT                   /translation="MLDLQKLRMFVAAAQSRNFTRAAEQLDLTQPTVSQQIQTLERELG
FT                   VSLFERLSRGIELTAAGRALLPHAEQMIALERIAEQAVRAAAGQSERTLLLGVGNTLAT
FT                   YALPDLLQRFNWEHPAFVVHIGTGNTEQLLAQVISGEFELALVGSPIVHTQLIIMPFLT
FT                   TELVVIVSPDDPWARLKQINIEALHGRRMLLREEGSALQASVSELLNAQQIRPKQPIVL
FT                   GNLEAIKRSVEVGLGIALVPAMAVRREVAAGRLRQIHLANVPTRRVYNVVHHRDRHITN
FT                   AAQLFLDLLRKPLGPDTNE"
FT   gene            complement(465641..467380)
FT                   /locus_tag="Haur_0397"
FT   CDS_pept        complement(465641..467380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0397"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   mbu:Mbur_1492 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03048"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUC9"
FT                   /protein_id="ABX03048.1"
FT                   /translation="MSALTYPSLPSPFEMIGPCGKQSTHRRFFMAKKAGIPYLIWWESR
FT                   IPEALRKQQMVVQIANQAGSEVAILDVQALSLQQLLDTAGSLPAPVAAQYALGLIETAE
FT                   FNHRQRTALTTSNLYGPSLLDLGSQGTIVPKIDPRAGQQAGPVPAQLLPINEPASPQTD
FT                   SYYIGALIAWMISGQFAPQGNPLAMLPAIDGNLRSILQRATVANPSQRPSAQALGQQIQ
FT                   DWLSGKVTPVAKKKPSQWAWLAGAITTAAIMWLVIYGLSRQDKVTDTEFGQAQIEQGTG
FT                   DFQPGTSSNGLAMLGDIDGVEVNRIDDTRHPEIDMYLSIMRPTGVVTDVPRQNVKVFEN
FT                   NNQIEGFSWVNLSRVQDPLNIMLVIDTSGSMGPSKEGLTDGGLDAAKIAALDFIDHLPS
FT                   NANVGLIHFGTLVTVDHSLTNDIGAVRQSISELKPEGQTAIYDALAISYTQLRRAKGQT
FT                   FIVLISDGADTASKGDNYDSIVAKATKANIPTYIIGLTSPEFDGQLLEDLQRDTKAMIY
FT                   QTPSKEQLGGFYTEVAQEVSGQYRASFNIPDTYKTGDEIMLKVEVNAGDGLLVTKERKY
FT                   IHP"
FT   gene            467496..468890
FT                   /locus_tag="Haur_0398"
FT   CDS_pept        467496..468890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0398"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rca:Rcas_3032 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03049"
FT                   /db_xref="GOA:A9AUD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD0"
FT                   /protein_id="ABX03049.1"
FT                   /translation="MKKFKRPKIVTLAVRLTITMVAVSVVPLALIALIILLGVRISEAD
FT                   RRSLELNNQLELYVAFAEQLIASDGDLQSASNILLSRPVGSGDGAIRVFGSAGQIFGAN
FT                   GSNSAFPSRAAASQFVTSIPTVFVAETRGRRYVAGQVRWQQKVVGVIEVSQSVEDEDRL
FT                   LRVLIRFVFISIGLAFAAAFLGSSLVARWLARMIGQLRETAEQVADGDLTERALERGPA
FT                   EFVQLARSINTMTDQLAERLSRIEQQSEAQRRFYRDVSHELRTPMMALGGYLENIEDAE
FT                   NADEQAQSIRAMQAEIARLARLADELLRSDAQPSLTLGPKQTLDLGAMIHELVQNLSGR
FT                   AQRSGVELLAQVPPRPIVVEADHDRLKQALLNLFDNALRATPPSGQISMRVSLTAEQVV
FT                   IDVQDTGEGIPPALREAIWERGVRGAEGGSGLGLAIVRTILRAHGGEAALIPSEQGAHI
FT                   QLRLPI"
FT   sig_peptide     467496..467570
FT                   /locus_tag="Haur_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.350 at
FT                   residue 25"
FT   gene            469162..470013
FT                   /locus_tag="Haur_0399"
FT   CDS_pept        469162..470013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0442 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03050"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD1"
FT                   /protein_id="ABX03050.1"
FT                   /translation="MRQFEYEQLISAADCQYCYQAMLERYPLQRVTINGHTWEFCDTGG
FT                   DLPALLILPGGLARADLAFRWLSRCHQRFRVISLTYPNTILKLADLAKNLLALFGHLQI
FT                   EAAWIVAGSYSGLIAQAVLHYCPQLALGLLLSDTGVPRRTRWIWLTLLQPLVAILPLGL
FT                   VRRLFWQGTQQFLQPMADSLRPFWAERLHHNIQQLQRYDYLCLLNWWRELDWHLGAARW
FT                   HGKLAIIVAEHDGLFGQRDQQLLRQYYPAASYQLMAHAQHCASLAQIDHYIDWALAWIE
FT                   VA"
FT   gene            470013..471179
FT                   /locus_tag="Haur_0400"
FT   CDS_pept        470013..471179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0400"
FT                   /product="Glycosyltransferase probably involved in cell
FT                   wall biogenesis-like"
FT                   /note="KEGG: ypi:YpsIP31758_2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03051"
FT                   /db_xref="GOA:A9AUD2"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD2"
FT                   /protein_id="ABX03051.1"
FT                   /translation="MRWLAWWYLLDRCWRWLVIRRFFAKHQPPAPKHWPSIDLIQPLTH
FT                   GVFDLAKTLQQRLDLRYAGQLQHYWVIDQADNQTLAVCSALQKKHPEQHITIIQVAPDW
FT                   GQRASKLVKLQAVLAQANSEIVWFVDDDVSLPLDGLSQGLPYLFQPQVGAIFGLACYVN
FT                   WHNFPSALMSNFVNANALPSYIGLAALTEPYTITGHQFALQRSVFEQIGGLSGMYGRID
FT                   DDHELARRVQAHGLRNLQMPLIYQVDNYFVNLPAYFQQMQRWFTIPRVLMLPHLSQYDQ
FT                   FVTILSSLAQPIPTILALASMRQPKLRPWLVACLLAQLSLQGWQIRRYCQTKVPWWAWP
FT                   LSIIGTLIDPLLMLWGLLGDDTIVWRGERIRLRHSASAQWLGKEQDHD"
FT   gene            471172..472380
FT                   /locus_tag="Haur_0401"
FT   CDS_pept        471172..472380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0401"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="KEGG: ypm:YP_1831 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03052"
FT                   /db_xref="GOA:A9AUD3"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD3"
FT                   /protein_id="ABX03052.1"
FT                   /translation="MIKRIWIVLCGLMLGQRCWKWWQVWRFFGKPTPTAQHEPATTLVS
FT                   LLQPILSGDPHLAICLRANLNAPSSYKREWLWLIDDDDRIAQQLCYGLQAEYAEQTIRI
FT                   ISLPAPAERVNPKTFKLIAGLQQAQGQIICVLDDDTSLPAYGLEQCLPWLDQAGVGLAF
FT                   GLPYYRSFDNTWSSLVALFVNSNSLLTYVPYSQVSEPFTINGMFYAMRRDVLEQLHGFV
FT                   GLEHILADDFAVAQRVQQAGLRLQQTSMRHAIRTTVTNAQRYRSLIQRWFIFPRESLLR
FT                   HLNRRERSLLFCLAIVPTLFPLVLAIVSVLRPSQRQRWFAATYTLLGLISFIQIDQAYL
FT                   EQATPRRYWLFVPFLELLIPVQLIQALLAPQRIVWRGHVMDVEKGGAFRFVQRRDDGSA
FT                   NGF"
FT   gene            complement(472505..473893)
FT                   /locus_tag="Haur_0402"
FT   CDS_pept        complement(472505..473893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0402"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: cfa:479783 major vault
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03053"
FT                   /db_xref="InterPro:IPR021870"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="InterPro:IPR039059"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD4"
FT                   /protein_id="ABX03053.1"
FT                   /translation="MIIPWIYYIQADEQLLVESLSRRWTVNGPRRYTARPFERITRRSG
FT                   LVLGPTEYVYVTDSLTGQERLERGPQLFFPTAYEEIGTTQQALPLKKNQYVRILDRSTG
FT                   QLRVERGEQSIYLQPNESQIGNIEAGYNIDEHHAVLVRSTTDGQLNLITTPQVFIPTAE
FT                   QEVIEHRQRILLENHEVVVIKDRDGRYQFRRGSQRDRSFFLEPYTDLVTFRWSSGLHKD
FT                   KRNLVITHLDIRPKFMWYAFEARTQDNVEIMIDITFFWQLADVEAMIVSTDDAPGDICA
FT                   HARSAIIQAVSQTSLERFLANFNSIVRDAVIVPEDGFYAERGVKLHSVEVRSITCKDAN
FT                   TQRVLQEIIQETTNRLNRLQKQESENEIKVKQLEGEIVAQETRSRLLELQRRIAQAEAE
FT                   TQGLAEAERVHAFIQGLGAELPISEKLAIFNILRRQEAIASLSQGKAQLYLTPADINLS
FT                   LEHH"
FT   gene            complement(474076..474663)
FT                   /locus_tag="Haur_0403"
FT   CDS_pept        complement(474076..474663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcl:ABC0634
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03054"
FT                   /db_xref="GOA:A9AUD5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD5"
FT                   /protein_id="ABX03054.1"
FT                   /translation="MLGNVVKVDPRTKRTRKLILDALIQLLRTHTFEEVTVNEIAEAAT
FT                   INRATFYAHFSDKYALVDELIRDGFMLYLDRRMQHYPDTPTRYMQALLWAIADHWAMIH
FT                   GQCNQYHRFFDSLAENQIKRMLEQHIQTWLDHYGPLRNVPAMQRQLLATMLSWSVYALV
FT                   ARWLYSDRCQNLEHFINDSVPLLVGSIEALKG"
FT   gene            474807..475691
FT                   /locus_tag="Haur_0404"
FT   CDS_pept        474807..475691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0404"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
FT                   protein; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; KEGG: sme:SMc01405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03055"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD6"
FT                   /protein_id="ABX03055.1"
FT                   /translation="MANTQGLVAITGAAGQLGRLVLQQVLEKVAANQVVAITRDPAKLA
FT                   DVAAQGVKVVAGDFSDPAGLTAALAGVERVLMISIDVVGGERVRLQTDAVKAIAAAGVK
FT                   HLVYTSAINPAEAPMEFIREHAATEQAIVASGLSYSFLRNNFYFETITDKIKGALAGGV
FT                   IAAAAGDAAAGLVARADCAAAAAAALVSDNTASEVYNITGPVSLTHKAIAETVAEFAGR
FT                   EVAYYPIDAASAQQQLEQFGLPAQIAGFVVAIDHDLIGSGALDLVTNDVERLTGKPAQS
FT                   LAEYLNANRELFS"
FT   gene            complement(475800..476690)
FT                   /locus_tag="Haur_0405"
FT   CDS_pept        complement(475800..476690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0405"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rca:Rcas_0312
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03056"
FT                   /db_xref="GOA:A9AUD7"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD7"
FT                   /protein_id="ABX03056.1"
FT                   /translation="MSDYVNSEVLVSTDWVAEHLNDPNVRLVESDEDILLYEMGHIANA
FT                   VKINWQDDLNDVRIRDYIDGDDFAALLSRFGISNDTTIVFYGDKNNWWACYAYWVFQLL
FT                   GHEKLKIMNGGRKKWIDEGRELTRVVPSFEPTNYVVGQPKPEIRAFRDDVLAHIGRPNP
FT                   RQTAIELPAGHSLVDVRSPDEYTGKKLHMPEYPQEGAVRGGHIPGAVNVPWAKAVNDDG
FT                   TFKSADEIRQLYGEVGVTPESDTVVYCRIGERSSLTWFVLHELLGYKNVRNYDGSWTEW
FT                   GNVVGLPIHNPTTSK"
FT   gene            complement(476718..477029)
FT                   /locus_tag="Haur_0406"
FT   CDS_pept        complement(476718..477029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0406"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   rca:Rcas_0311 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03057"
FT                   /db_xref="GOA:A9AUD8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD8"
FT                   /protein_id="ABX03057.1"
FT                   /translation="MSFHVVATLHDLADTPAIQIDFAGEQVGIFRCGTQYFATSNICTH
FT                   AYAELHEGELDVDDCTIECPLHGARFDLASGRPRSLPATEPLKVYSLKIEGDQILLEA"
FT   gene            complement(477128..478546)
FT                   /locus_tag="Haur_0407"
FT   CDS_pept        complement(477128..478546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0407"
FT                   /product="FeS assembly protein SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: rrs:RoseRS_0712 FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03058"
FT                   /db_xref="GOA:A9AUD9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUD9"
FT                   /protein_id="ABX03058.1"
FT                   /translation="MSNPAQNEIEFDYSKYGFRDEENYTFKSSKGLNADIVRTISEMKG
FT                   EPEWMLQRRLKALEIFHKKPLPVSGVWANPRLAELDFQDIHYYVRPGERAENNWDDVPE
FT                   SIKNTFEKLGIPEAERKFLAGVGAQYESEVVYHSLREEWEKLGVIFLDTDTGLKEYPEL
FT                   FKEYFGTIIPSADNKFAALNTAVWSGGSFVYVPKGVKVDIPLQAYFRINAENMGQFERT
FT                   LIIVDEGAEVHYIEGCTAPVYSTNSLHSAVVEIIIKKGGKCRYTTIQNWANNIFNLVTK
FT                   RAVAYEDASMEWVDGNIGSKLTMKYPAVYMMGRGAKGEVLSVAYAGEGQHQDAGAKMVH
FT                   GAPDTTSRITNKSVSKNGGRTTYRGLAKVMRGAHNAKINVVCDALILDNRSASDTIPYI
FT                   EIEEDSATVAHEATVGKIGEEQLFYLMSRGLDEAEALSMIVLGFMEPFTRELPMEYAVE
FT                   LNRLIQMEMEGSVG"
FT   gene            complement(478797..479192)
FT                   /locus_tag="Haur_0408"
FT   CDS_pept        complement(478797..479192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0408"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   rrs:RoseRS_0711 SUF system FeS assembly protein, NifU
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03059"
FT                   /db_xref="GOA:A9AUE0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE0"
FT                   /protein_id="ABX03059.1"
FT                   /translation="MDDLYRENILDHYRHPRNYGEIEQATIVQHEHNPLCGDQLSIYLL
FT                   VENERIVDVKFKGKGCAISQASASMLSEELAGKSVDEAKAFDKQTILDLLGIPIGPVRL
FT                   KCALLSLKTLKAGLYGVNLVDDDEDSL"
FT   gene            complement(479199..480437)
FT                   /locus_tag="Haur_0409"
FT   CDS_pept        complement(479199..480437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0409"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; KEGG: rca:Rcas_0306 cysteine
FT                   desulfurase, SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03060"
FT                   /db_xref="GOA:A9AUE1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE1"
FT                   /protein_id="ABX03060.1"
FT                   /translation="MSVQTTLDIQAIREQFPLLDQSINGHRLAYLDSTATAQKPLAVLD
FT                   AMDRYYRTINANVHRGVYQISEAATEAYEGTRRTIGRFIGAKSTKEIIFTRNATEAINL
FT                   VAQSWGRANLQAGDRILLTVSEHHSNLVPWQLLAAQTGVELDFIELDDQGRLDLSHLDQ
FT                   LLTERTKLVAMTHMSNVLGTINPVERVIAAAKQVGALVLLDGAQSVPHIPVNVQALGCD
FT                   FLAFSGHKMCGPTGIGVLWARRELLEAMPPFMGGGDMIKRVGLRESSWNDLPWKFEAGT
FT                   PAIAEAIGLGAAIDFLNELGMQAIHERERQLTHYAWDKLSAIDGLTIFGPPAAERGGLL
FT                   SFTLAGVHAHDVAAILDTQGIAVRAGHHCTHPLHDIFGVPATVRASFYLYTLEEEIDRL
FT                   AEALVLARDTFQL"
FT   gene            complement(480648..480767)
FT                   /locus_tag="Haur_0410"
FT   CDS_pept        complement(480648..480767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03061"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE2"
FT                   /protein_id="ABX03061.1"
FT                   /translation="MTTLEEAQLINYLKATQFRVGLLINFGSLGKLEWKRLVR"
FT   gene            complement(480782..481024)
FT                   /locus_tag="Haur_0411"
FT   CDS_pept        complement(480782..481024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03062"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE3"
FT                   /protein_id="ABX03062.1"
FT                   /translation="MATILLADEVFAVVGAAIEVHRELGSGFLEAVYQEALALELAQRQ
FT                   IQFAAQTPLAIRYKQQLLQKPILLILFVTTKLLLS"
FT   gene            complement(481141..482331)
FT                   /locus_tag="Haur_0412"
FT   CDS_pept        complement(481141..482331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0412"
FT                   /product="FeS assembly protein SufD"
FT                   /note="TIGRFAM: FeS assembly protein SufD; PFAM: SufBD
FT                   protein; KEGG: rrs:RoseRS_0709 FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03063"
FT                   /db_xref="GOA:A9AUE4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE4"
FT                   /protein_id="ABX03063.1"
FT                   /translation="MPANLQSTFDLAQFEALLASRNEPSWLTSRRREAWEAFETAEQPD
FT                   WRRTNLKGFNIADYTLAEAEVSVDFAGAEGVTILPLAEAIQSHAELVQRVLGSAVQTSR
FT                   DPFSALNNALVNGGIFIHVAKDVAVEELVRIRYHLSNAGTVVAPRTLIVTERHSSINVI
FT                   EEISSADFAGSAVVLTGAEIEVGDGGQVGFSSVQTLNSNVYLLGSQQIRINRDAQAEWL
FT                   NVVVGSAVQHVTLEANLSGNGSSVNWNGLLYGNGKQNLLVAPKLNHIGLNTEGQINFKT
FT                   VVDDEAYAVFDGMVKIPATGQGTNSDLRENALHLSKNSRSDSIPGLEIDANEVKAGHGS
FT                   TSGQIDEEQLFYLQSRGLPFAEAKRTIVLGFVGEIIDMIPDEAVRERVETIVAEKV"
FT   gene            complement(482321..483112)
FT                   /locus_tag="Haur_0413"
FT   CDS_pept        complement(482321..483112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0413"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: rrs:RoseRS_0708 FeS assembly
FT                   ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03064"
FT                   /db_xref="GOA:A9AUE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE5"
FT                   /protein_id="ABX03064.1"
FT                   /translation="MSANNLVIRNLHVAVDGKEILKGINLTIEEGKIHAIMGPNGSGKS
FT                   TLAYTLAGHPRYEVTEGEVWYKGQDVLDLEPNDRSKLGLFLAFQYPVAVAGVTVANFLR
FT                   AALNAHRAQEGVDPKSTAIPMAEYRKVIKARMDMLEMAPDFARRYLNEGFSGGEKKRLE
FT                   ILQMAMLQPAMAIMDETDSGLDIDALKIVAEGVNKVKAEKPELGVLVITHYQRLLNYIK
FT                   PDYVHVLMNGQIVREGGPDMALELEEKGYDFIREEVFGNAS"
FT   gene            complement(483186..483848)
FT                   /locus_tag="Haur_0414"
FT   CDS_pept        complement(483186..483848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0414"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: regulatory protein DeoR; KEGG: rca:Rcas_0303
FT                   transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03065"
FT                   /db_xref="GOA:A9AUE6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE6"
FT                   /protein_id="ABX03065.1"
FT                   /translation="MTVFGIREGTPAGDIVSYIQRKGSATVKELEDALAVSTTAVREQL
FT                   THLTNQGLIAPTKIRQGPGRPSYRYTLTAKAQSLFPKGYDVLLNVLLEEILATEGPEGM
FT                   AQLLSRVGTRLATLYTGDHPANVALRERLMQFVYTMNRKGMSINVAESPGGGWVVSEYA
FT                   CPYFEVAQTHDSLCSMERQMMETALGHEVEIQRRMVEGHNGCHFVIKADEIGIEKHN"
FT   gene            complement(484076..484471)
FT                   /locus_tag="Haur_0415"
FT   CDS_pept        complement(484076..484471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03066"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE7"
FT                   /protein_id="ABX03066.1"
FT                   /translation="MHPITGIEAVLQWFAERYSSSEAEQIRSAVNANTRLLKAWRTNPA
FT                   NARPLASDKHLWCLLGAMYGNAILAQAQAVYRQATAHYQRWLNRRRNLQTVEVRLQGDL
FT                   ARFGEQHPRTQRTLAQLQRLHQELLAA"
FT   gene            484608..486020
FT                   /locus_tag="Haur_0416"
FT   CDS_pept        484608..486020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03067"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE8"
FT                   /protein_id="ABX03067.1"
FT                   /translation="MVWLRVALVGLLVAIVLGSIPQAQAADQGSTEHIFGEGEGDPAGA
FT                   FQVLRLHPIPTSMNFGDAVRGVASGDSWLVGVGQKTFFSLDAGNHWQQLDPLTLFPAAA
FT                   GGLCCQQAFAYDYGRDLFIWLLQYAPDAQRGLVRIGYTDSAGLAEQAWEWYDVPAAQGF
FT                   TWVDPQLELSANQIWLAMERQAVGGAIDSTWVSQIQTDTLEDDLPFIRSYSSSTERAWH
FT                   LVRGAKDMMYFATHINQTSLRVYAWDENQPIPTSSDLNVAEWTAGARICPTPDQRNWCS
FT                   DDDGRIRAGWVAKGTVGFMWNAVSSNTITFPYIDAVRMYERDLSLLPFSLARPFIFNAQ
FT                   NGFSLPSVAVNGRDDVAVSFYHSSTKQYPTLSSSIFDDFTAPPPGWAYYNVQGSSTTPS
FT                   QQHWVGQLDTQVFSPTNLGWSVTGARLNGCDEARCLQPFIAIFSRERDRPAIERWLSPV
FT                   RYELFTPFVQMN"
FT   sig_peptide     484608..484685
FT                   /locus_tag="Haur_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(486061..486136)
FT                   /locus_tag="Haur_R0004"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(486061..486136)
FT                   /locus_tag="Haur_R0004"
FT                   /product="tRNA-Phe"
FT   gene            complement(486139..486214)
FT                   /locus_tag="Haur_R0005"
FT                   /note="tRNA-Val4"
FT   tRNA            complement(486139..486214)
FT                   /locus_tag="Haur_R0005"
FT                   /product="tRNA-Val"
FT   gene            complement(486235..486321)
FT                   /locus_tag="Haur_R0006"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(486235..486321)
FT                   /locus_tag="Haur_R0006"
FT                   /product="tRNA-Leu"
FT   gene            complement(486467..486892)
FT                   /locus_tag="Haur_0417"
FT   CDS_pept        complement(486467..486892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0417"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aha:AHA_0772 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03068"
FT                   /db_xref="GOA:A9AUE9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUE9"
FT                   /protein_id="ABX03068.1"
FT                   /translation="MEWQKGDYTISTDSARLDHTAIIAALHETYWAAQRQPTTIVRSLT
FT                   HSFCFGVYYNQQQIGLARVVTDYAVFAYLADVYILAEHRGHGLGKWLVQTVLAHPDLQG
FT                   LRRWLLATRNAHGLYAQVGFIPIVSAEPWMEIFNNQA"
FT   gene            complement(486955..488607)
FT                   /locus_tag="Haur_0418"
FT   CDS_pept        complement(486955..488607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03069"
FT                   /db_xref="GOA:A9AUF0"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF0"
FT                   /protein_id="ABX03069.1"
FT                   /translation="MAQAVLPCRTMEMQNLPPSGPPTQRARLLTALRSSRAMQKIRQYQ
FT                   TVLLAGTFFVLAAIFGLNSQSTIESPSGAASPTSLAQATLAPADGSITPTVATSTEVAN
FT                   LRPTPTDVAGVVGPPAPNRATPTNEGAYPPPVGQGPTSTVDPFPTLPVGGTTIPPFPTS
FT                   STGNRGTAAPTQSSGGYPTPSSNSATPAPTNIPVATDELPFPTEEGEDPKPTEDPFEET
FT                   PSATEEPFETPTTTPTEGPTATPTNTPTPTPLPYDLIRGNTRWTLAQSPVRIRRDTIIA
FT                   KGASLTIDDGVEVLLDANTSLVVDGTLTANAARFRKSGNSFWKSIVVNNGGQANLNWVD
FT                   MRGGGSEGVLISALGGNTVIQDSVFEENKGRIYISGGNFDMQRSRVVGFAPISAEVRGG
FT                   KSLRLFSNVINNTATDGATGVSLSATADDVEIVLEKNSFRGSSGTNVRAQFNQSLNAVF
FT                   QCNSFSGGAYGLQIKSTDPTLDGSRILISGNSFQSHKNYGLTGDVGFDARNNWWGDASG
FT                   PYHPEQNGAGTGDAVGVNLTFSPWLNAKPSCAP"
FT   gene            488839..491997
FT                   /locus_tag="Haur_0419"
FT   CDS_pept        488839..491997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0419"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   rrs:RoseRS_2828 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03070"
FT                   /db_xref="GOA:A9AUF1"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF1"
FT                   /protein_id="ABX03070.1"
FT                   /translation="MQFKGLRLLTALTMLFTLIGTSLSATYTTPTSAVSTSLVISQFQT
FT                   AGGTADDEFIEIHNISANPVDLNGHRVVYRAAAGVTDVSIASWTSSVVIPAGGFYLLGR
FT                   ANSYDGTVTADTTFGSGISGTGGGFAIRNGDLNTGTIIDSVGFGSATNAFVEGTVVAAP
FT                   SANNSAQRNNSSCTDTDNNAADFSLLTPSAPRNSSSPVATCGGLPTDNPPTVASTVPAN
FT                   NANNVALNANVTLTFSEPVTTTGTWYTISCTSGARTASVTGGPTSYVLDPSSDFAASDA
FT                   CTVTVVASQVTDRDGSVDAMAQDYSFNFNVSSGVACSGGTVTPIGQVQGTGETSPANGT
FT                   VVTVQGTVVADFEGAQPALRGFYLQDAGDSNAATSDGIFVFNGGADQVALGQVVRVTGT
FT                   AGENQGQTQLSGSLTVELCGTTNTVTPTQVTLPFASTTDAERFEGMLVQFNQKLVVSEH
FT                   YLLARFGQVTLSLNERLAQPTNVVSPGAPALALQAQNNLHKIILDDPFNNQNADPILFG
FT                   RGGTGLSAANTLRASDSITGLQGVMTYTWGGNSASPNSYRVRVTQSPNFVAENQRPTSL
FT                   ELDGSLRVAGINVLNYFNTFGNGNCTGGVGGAATDCRGAENTTEFQRQKDKTIAAIIMT
FT                   QADVIGLMEIENDGFGSNSAIQDLVNGLNAATAPGTYALVDVDTRTGQTNPLGTDAIKV
FT                   ALLYKPGKVSLAGTTAVLNTGAFGDFTTSSGTTGRNRPALTQSFTETSSGETFTVVVNH
FT                   LKSKGSACTDNVSPVPSDPDLGDGQGNCNLTRKTAAQELVAWLNTDPTNVDDSDYLIIG
FT                   DLNSYAMEDPITAIRNAGYVNIPKTLLGDEAYSYIFDGQTGSLDHALASTSLFSQVADV
FT                   QELHINADEPIALDYNTNFKSAGQIVSLYNNDAYRASDHDPIVVGLALGAAPTANFSTS
FT                   TKTVSSTSVEQGEVFTYTLTIRNTGAAEGSFSLSDLINSNLEIVGVTGGLTVNDQTASV
FT                   NSSLAPSSNKTYTIAVRSVGNFVGSVGNTAVLNSNINLTADSVTVNATTTPSFTVYMPL
FT                   VTKN"
FT   sig_peptide     488839..488913
FT                   /locus_tag="Haur_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 25"
FT   gene            492136..492600
FT                   /locus_tag="Haur_0420"
FT   CDS_pept        492136..492600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03071"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF2"
FT                   /protein_id="ABX03071.1"
FT                   /translation="MQYADRSESISEYLKRCPFHNTITITNRLTSDGDRIITILNNHTI
FT                   AIEIYLAKSNYCLINAGLGFNVDDIYWPNFPAISVLEYLVNGHLVEKQRMLGSTCVGVS
FT                   SYVAINTDIIYSNRTFCLLGELLHVFTKATRFVQYPKLVDSKSVIDQPLP"
FT   gene            492687..493778
FT                   /locus_tag="Haur_0421"
FT   CDS_pept        492687..493778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0421"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: NHL repeat containing protein; glucose
FT                   sorbosone dehydrogenase; KEGG: pca:Pcar_0624 L-sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03072"
FT                   /db_xref="GOA:A9AUF3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF3"
FT                   /protein_id="ABX03072.1"
FT                   /translation="MLAFWHTYQRVKHGSWSLVLGLALVACSIPVNYSSDNPPTSPPAE
FT                   LQIAAGFTITPIITGLDQPTGLAFDPQGRLYIAQRSGTVLISDGTNPPREYATDFNKPL
FT                   SLHWYEQALYVVEQGQIQRLSDGNSDGIVDQQTVLLSDLPDQIEAATLVSDAQGWLYLG
FT                   VGTRADHTATAGIQEGYIRRFRADGSESSVYATGLRMPFGLAFDPQQQLYATDNGREGL
FT                   GDDLPPDEVNRITAGADYGWPRCWGQRQPDADGGGDAANCSTTNEPVALLPAHSGVTGI
FT                   VFYQGTAFPARYHGDAFIGLSGSWYSQELRGHSIVRMDAETQQIESFASGFGRPVGLAI
FT                   SPQGQLLVADYDRGTIVMIAAPP"
FT   sig_peptide     492687..492794
FT                   /locus_tag="Haur_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.411 at
FT                   residue 36"
FT   gene            493893..494285
FT                   /locus_tag="Haur_0422"
FT   CDS_pept        493893..494285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03073"
FT                   /db_xref="GOA:A9AUF4"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF4"
FT                   /protein_id="ABX03073.1"
FT                   /translation="MVATIWAKAMGLMFYDWFADRSAWLDGIRLTIGNLLVIWLSYVVF
FT                   RSPDAIYTSFIGIILLDYLTMSWIIKQRAAKAINRDPIGQLQVIDHTPKMYESPTKIAV
FT                   MINLFAIAAAILSSLLLFFVSVFVLS"
FT   gene            494305..494784
FT                   /locus_tag="Haur_0423"
FT   CDS_pept        494305..494784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03074"
FT                   /db_xref="GOA:A9AUF5"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF5"
FT                   /protein_id="ABX03074.1"
FT                   /translation="MQQLVLACGYNPFGYVIFFFIMVIPFSLTLGIKWFFLAQTLRASH
FT                   RSLFLHSLGLTFIVGLVIGFVFISAYILPTSLFVIEIGGFYSYQFFIWAIVCIVDTFLI
FT                   ERWLLKPKAQAISLTDDQQLQVEAAAIKYQPSWVAALLSNTLIAIVVALFFQMID"
FT   gene            494802..495290
FT                   /locus_tag="Haur_0424"
FT   CDS_pept        494802..495290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03075"
FT                   /db_xref="GOA:A9AUF6"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF6"
FT                   /protein_id="ABX03075.1"
FT                   /translation="MQQILIACGSNQLGQIFALVGVLVLFFINLGIKWFFLAKTRRSAR
FT                   RSLFIDSFGLMFMTGVVTVFVFISAYILPTFLFVIEIGFFYSYQIFIWAIVCIVDTFLI
FT                   ERWLLKPKAQAISLNDDQQLQVEAVPMSYQPAWAVALQSNTLIVILVALFFQMIDSMN"
FT   gene            495304..495795
FT                   /locus_tag="Haur_0425"
FT   CDS_pept        495304..495795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03076"
FT                   /db_xref="GOA:A9AUF7"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF7"
FT                   /protein_id="ABX03076.1"
FT                   /translation="MQQIVIACGINPIGALIELVFWIIGIIMAIWFMVVFKAWAFPRSQ
FT                   WFNRRAPMLKSFIMLMTGATVVILVMTGIYFLAPAIFNYRWGFVRQYHVILLLAICVHD
FT                   ALAMNYWLNQSYAQTLSLDPNQQMQVDPACSHWYQPWVIAFSTNLLLFLCLMPVFRLTN
FT                   "
FT   gene            495956..498265
FT                   /locus_tag="Haur_0426"
FT   CDS_pept        495956..498265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03077"
FT                   /db_xref="GOA:A9AUF8"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF8"
FT                   /protein_id="ABX03077.1"
FT                   /translation="MRWIRWCWLLLLIALPISAASSQEQSNNGLVWQVEPVFGTVYRAG
FT                   EWMALRVKVSNTGVDRMVEIHIGNYNVELDVPGGSQKETLVYGQFDQAFRVPMAMYLNG
FT                   EKRETATLQLRSTDRPMVATLLEQPLPQLTKVVLVATDSQQLPNVQIGLDMLSGIVLNQ
FT                   RSWGELTPEQQQAIKQWVNNGGVLVAEPNLLEDLPAELQPAQATGQQTIATTTLSQVFG
FT                   QPFNVPNLDVALLQPNQQAATSLKQEQTPLLVKRSVGRGFVIASAFNFDQAEITAWRGY
FT                   ENLLASLFPQQQDLGWMGAGSSESMLRDSAAPALLNNLPALDLPPLQTLLILLGIYIVL
FT                   AGPVTYLVLRRLDRMALAWLTIPTLTLIFAVLAYGIGSKQRGTDILVHDVALIYPDEQA
FT                   NATVLGYAGIFSPVREDYQVTINHGAYPRPLLVNPNLGTNGGINATRALYSHQPGDVRN
FT                   LTINQWSMEMFAYERDISDAPHVQIEISLQGKKIIGKVKNTSTYTLSDAAFIMLGNAQK
FT                   FGTIEPGAEKSIELQINNNPSMSGASYLLFQKELDEGYQTEFGPPRELLAKTQALDIAL
FT                   PTTYGSIDRNAVFVAFVDFNQAVIDLPEKRFAATQRSLLIQYPQLRYSQNAVELTNNWF
FT                   SYILEDDPNMGMGSTCTTSARGAGTNISQKTGIIQLSLPTTFSSIEAQSLRLLPTIDGG
FT                   MVAPNKLTYELYNWATSQWDVVEFKNGAIDLTTSPSTYLQQGNLRTRYTLDPTVDTTAG
FT                   LWGCFSVGPVLSGVVK"
FT   sig_peptide     495956..496024
FT                   /locus_tag="Haur_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.836 at
FT                   residue 23"
FT   gene            498262..499215
FT                   /locus_tag="Haur_0427"
FT   CDS_pept        498262..499215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0427"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_1723 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03078"
FT                   /db_xref="GOA:A9AUF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUF9"
FT                   /protein_id="ABX03078.1"
FT                   /translation="MSELAIQTVDLLRRYGKYTAVNKLNLKITLGSIFGFLGPNGAGKT
FT                   TTLRMLAGLLEPSSGQVFLHGQLIQKTSTAAAIVGYMPDFFGVYDDLRVWEYLDFYARC
FT                   HGIEPAKRKSTVDGLLDLVDLSEKRNAFVQHLSRGMQQRLCLAHALVHDPKILLLDEPA
FT                   SGLDPQARVELRELLRTLRDMGKTIILSSHILNELEDICTDFGIMARGELLAQGSLETL
FT                   RQRSRPALQIKVLDDLDRAMRLIAAQSGVLRVLEPAEATPMLIEVEFDGDEQQASQLLL
FT                   NLARAELPIADFHREDDSLERLFLQLVNNHGLEERV"
FT   gene            499212..500303
FT                   /locus_tag="Haur_0428"
FT   CDS_pept        499212..500303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03079"
FT                   /db_xref="GOA:A9AUG0"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG0"
FT                   /protein_id="ABX03079.1"
FT                   /translation="MSNRAVSRRWSLQPNPIVVKELRSRMRGGRAFILLTGFLLGLGLV
FT                   GYALFLRATSGQAAGMPIFSAQIGQTLFAGLAFMLLFLVILIAPAVTVGAISSERERLT
FT                   YEMLIATNLPSHRLLWGKLISALSYIALLLLAAIPLGSIVFLFGGITLRHVLQAAAIIV
FT                   LSAITSAMLGIWASAMTGKTGRAAVVSYVIIGLVLGGFLAGAEIWTNRSTEPVPTGLLA
FT                   PNPISALASSIGTLSGPSNGGMITTMRAFEAVPMAAGGGWWPGMNSFSGGLNFPGWQTF
FT                   SIGIYPATDQFGPDGMPIIAEPRSVWRTTLIILIMTCLVFFWMALHAVKPRRRWWPTWG
FT                   DLAMLSVTSLSLLGLGYWIGWWF"
FT   gene            complement(500418..502247)
FT                   /locus_tag="Haur_0429"
FT   CDS_pept        complement(500418..502247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0429"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   rrs:RoseRS_2496 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03080"
FT                   /db_xref="GOA:A9AUG1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG1"
FT                   /protein_id="ABX03080.1"
FT                   /translation="MNAPAYVRNQELKRWVEEMVALCKPDDVYWCDGSDEEYALMCGRL
FT                   VESGTFVPLNPELRPNSYLARSNPSDVARVEDRTFICSLSKGDAGPTNNWMHPKEMKEK
FT                   LNGLFDGSMRGRTMYVVPFSMGPLGSPIAHIGVELTDSPYVVVNMKIMTRMSSDVYAVL
FT                   GETGHFIPCLHSVGAPLQPGQADVSWPCNEKEKYIVHFPEERSIWSYGSGYGGNALLGK
FT                   KCFALRIASNMARDEGWLAEHMLVLGVESPVGEKTYVAAAFPSACGKTNFAMLIPPTAM
FT                   DGWKVTTVGDDIAWIKPGKDGKLYAINPESGYFGVAPGTSEDTNPNAMAALSKNTIFTN
FT                   VALTPEGDIWWEGMTKTPPAKAIDWTGQEWTPDCGRKAAHANARFTAPASQCPSIDPAW
FT                   EDPQGVPIEAFIFGGRRSTLMPLVYQAFNWTYGVYQAATMGSETTAAAMSAVGEVRRDP
FT                   MAMLPFVGYHMADYFNHWLQFGRTIPNPPRIFSVNWFRKDKNGKFLWPGFGENMRVLKW
FT                   VVERAHGHAVAIESPIGWMPRYQDLDWSGLNFSEDQFHELMSVDRDDWNKEILSHEELF
FT                   IKLYDRLPKEFLSIRELILSSLWRSPEHWEAFE"
FT   gene            502725..505151
FT                   /locus_tag="Haur_0430"
FT   CDS_pept        502725..505151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03081"
FT                   /db_xref="GOA:A9AUG2"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG2"
FT                   /protein_id="ABX03081.1"
FT                   /translation="MEERSQRAKIGGSGRRWQVFPVLGGVGLLVTMLLVTQTPEPPAPL
FT                   PTATVVAEAVVTPSISTQPTPQNPISSLPAVDLAGQQLLFIDPNNQIKLWDGVGLVQSR
FT                   GTVERLYGSSGWGLTVDQHRDVLFIRGFDWLEARSLRDNRRLWQLPITAYANNTETTIL
FT                   DVVSDPFNQLVWLVEKQRTTDAFQPATVRVRGLDSRSGLELRRYQTPLVNDPPHVLPIV
FT                   NGPWLLADGQLLPFDPASEAFGKPLMSRLEFVQVAPDGKQALVFGANSLIEIDLLTQQT
FT                   LKQTELATAPKINSIEHIIASPNFNYVLIIGTVFEETDFSQHIFVYDRDGIQVGSWQRK
FT                   LLAERTHIVDTDVSNHIRFLDDQRLVLLHRTGMLEIINLATDSMQLISLREKPDLFERL
FT                   EHLAGFELMPKLELLPLVENPELEYLEAPGFASAPLTPTTAPKPFGLTSIDGQITQLWD
FT                   DGSSKTINQLVRTLIPYLIRRNNAPPLFIDLIDTDLVLIDPVNQTTHSIALEPIEAKSL
FT                   DDLEGISASNSASIVICYSYHLDSSADSRVNRCRELNLQTGQTSLFAELPAATDLIPIY
FT                   WDGRQLTIVGKTYREAKRSFDYLVWQTLADDRSQGQMLLQPLDVQQLWYMVGSPTVIYQ
FT                   NMLGNIVSYQLLDQNPALLIQRSADHDIDVDLAPNGQRVVLIEREYPLNHGTLTMFDTA
FT                   TGAELWRDDTTRDHVGLWSGDSQFYLTRTYQAVNSSLNTYTHQGKQGHSLLVAQGIGEF
FT                   VPDWLGQQVVLRIYDELFLLERVNEHWLPLSKFPNFQTVFSSRSWPKIVYVYPQP"
FT   gene            505172..505561
FT                   /locus_tag="Haur_0431"
FT   CDS_pept        505172..505561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03082"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG3"
FT                   /protein_id="ABX03082.1"
FT                   /translation="MMQKVYRRLGLLLCLGVLSTCQAQQPTPTVITQASPTMPPAVAQA
FT                   SPTQPSATPTPLPLRVPTNERVLVQLKKPEFGLDINYFWIEPSGELTAVGAEYPYKFIS
FT                   IFAEQQLAITHLAHFIQLFDLTTNQ"
FT   sig_peptide     505172..505243
FT                   /locus_tag="Haur_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            505621..505878
FT                   /locus_tag="Haur_0432"
FT   CDS_pept        505621..505878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03083"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG4"
FT                   /protein_id="ABX03083.1"
FT                   /translation="MFAKGRVSYSTLWSDQQVDLLENMDVVVNRPYLPALVLYMRYNPD
FT                   PQPHELWLYDPQMQTHTQIEYTNPDYVFNGMSQALIDPNL"
FT   gene            505882..506718
FT                   /locus_tag="Haur_0433"
FT   CDS_pept        505882..506718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03084"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG5"
FT                   /protein_id="ABX03084.1"
FT                   /translation="MLIIRVPHESPRLLRLDLVTNQLSAFETTFQPNDYRRIEPLAWHG
FT                   QTLYVLFHDQPNGSATLQPVLAKLTLNQQAKIEILAELADWPDYWVSANQQALVYRQSQ
FT                   TATEQTLVWWNLTDQTSRTLTLPLVSHAALALAPDGSALAMVTLDPTQQVAELRRYDYA
FT                   SQTWQTLDQQASGQIVTTNPVVGWSADSQHLWWQRSLPQPLLAKEYRVYTATGALQSTD
FT                   ELPLHHQAVVSADAETLVLVGVAGTMLQERQHGRITAQFPLPVDLLEQKVLAGVNR"
FT   gene            506962..507972
FT                   /locus_tag="Haur_0434"
FT   CDS_pept        506962..507972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0434"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sth:STH2664 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03085"
FT                   /db_xref="GOA:A9AUG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG6"
FT                   /protein_id="ABX03085.1"
FT                   /translation="MSVIDVRNLGKTYRTIEKEGGVKGAIKALFRPQYREKVAVHDLNF
FT                   QIDAGEIVGYIGVNGAGKSTTIKMLTGILYPTTGAVTVLGHDPQRERVANARNIGVVFG
FT                   QRSQLWWDLALIESLNLVANIYEVEPSRYKQLLSHFSEVLELDEILKTPIRSMSLGQKM
FT                   RAELAAAFIHEPKIVYLDEPTIGLDVMVKQRIREFIKDYNQTHNTTVMLTTHDLGDIEQ
FT                   LCSRVIIIDAGSKVYDGPLHAIKQQFGKYRTITFETNQPITNVQLPPACEQLSLSEYSL
FT                   ELKFDRSQLSASQVATALMQQIDVADFTLNEPDLESIIKHLYQNPTAYNEVAVNE"
FT   gene            507965..508777
FT                   /locus_tag="Haur_0435"
FT   CDS_pept        507965..508777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0435"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   cpr:CPR_0171 ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03086"
FT                   /db_xref="GOA:A9AUG7"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG7"
FT                   /protein_id="ABX03086.1"
FT                   /translation="MNKLAYRLRIYRSVVGMNIKEMLAYNLWFWSQLGAHLFLTIVYVS
FT                   FWKALYSERETIAGLTMQQTLTYIILARMIAPLVQWGYTQEFGYWIREGTISSELLRPV
FT                   DFQERIFIGHLTRTFVALAQQLLVTGSFAVLVFDIRLPTDPLIWLSFLISLLLGCSILF
FT                   CFDWIFGCVAFYSTEVWGLQVVRGSILMLFSGVLLPLTMLPSGLQTLAQWMPFAQSVSI
FT                   PVSLLSGITPLDQLGSIWLQQLAWLAVMLMLSRLMFNFSVRKITVQGG"
FT   gene            508780..509568
FT                   /locus_tag="Haur_0436"
FT   CDS_pept        508780..509568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0436"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   cpr:CPR_0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03087"
FT                   /db_xref="GOA:A9AUG8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG8"
FT                   /protein_id="ABX03087.1"
FT                   /translation="MLRYSKIYWYFVVQRFKILMEYRLNFFIGSISTVLFQGASIIAMW
FT                   AVLRQVPSIQGWTLEQILLIYGLLTLSKGINHLFADNLWVIGRDYIRPGQFDRFLVRPI
FT                   NPLFHLLADRICHDAIGDFIVGFGLVGYAMVKLQLPITLASISFIILMVISGGIIFIAL
FT                   NLITAATAFWIMDSIPVTNLVFSTNEFAQYPLTFYHRSVGILLTWLLPYGFASYYPASY
FT                   LLGHSIGWMAWLAPLIALVSITIAYRFWVFGLKHYGSTGS"
FT   gene            complement(509661..512714)
FT                   /locus_tag="Haur_0437"
FT   CDS_pept        complement(509661..512714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0437"
FT                   /product="peptidase M4 thermolysin"
FT                   /note="PFAM: peptidase M4 thermolysin; Propeptide PepSY amd
FT                   peptidase M4; Propeptide peptidase M4 and M36; Peptidase M4
FT                   thermolysin; KEGG: btl:BALH_0539 bacillolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03088"
FT                   /db_xref="GOA:A9AUG9"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUG9"
FT                   /protein_id="ABX03088.1"
FT                   /translation="MRSMRMLRLLAVLIVVSMLPLSRSNAQTPTTNSPINRLLSQGANV
FT                   ARHSQTGYVRWIGAAAGTTLDQPVGLNRADTLNIANAYLAEYGNLFGLAQASDATVAKT
FT                   STTQDGRQVVRYKQRYQGVPVIAGELQVQVNQAGELLSINGEVLPNLNLNTNPKIDQAK
FT                   AINTAQTYVATKYDVNLAALNVSKSELAIYNPALLGGTGLQKSSLVWFVTVESTSSNPI
FT                   REYVFVNAQSGEISLAFNQIGFAKNRFVCNDNNVVDNDDNPNNNCDQPSEYVRTEGSAA
FT                   SNDADIDAAYDYSGDTYDFFNLFFGRNSIDNNGMNLISLVKHCPPGAGCPYGNAFWNGR
FT                   QMTYGQGFAAADDVVAHELSHGVTEYTSNLFYYFQSGAINEAMSDIFGEFMDQTNGSAD
FT                   DDETTRWIMGEDLGGIRNMQDPTQGDQPDRMLSELYVLDPNLLDSGGVHSNSGVANKAA
FT                   YLLSDGDTFNGQTIASIGITKTAHLFYETQISSLTSGSDYADLASALRQACTSLTGSHG
FT                   ITAADCVEVNKTILATEMDLQPTNAPAPDIAACSPGQTQTTVFNEDFEALPNNRWSASA
FT                   LSGSTETWTTNPAPLVGTYATSGSGSATNYNGVYGWNQAVEESAFTQNASVTVPANGFA
FT                   YFRHAYDFYAPIDAGVVEYSTNNGSTWQSAAGLFSFNGPTNIAEDGAFGGEQAYVGNSN
FT                   GYNASRLNLASLAGQSIRFRFKVALGDTPTPNRSVTWSIDDFEIYTCNGPAAPAAPSLF
FT                   LSSDVLVQQGKQTSATIGTASDDLDLAGALTVSTAGAPTGMNVSISNQAGILKANVNCA
FT                   CSSAVGTYPITVTVRDSGNLTASQVFNIEVEPAGQSLINGGFELGTNWQAFSNSFSDVS
FT                   PPLCSLPGCAGAPRTGTSWLRFGARSGTTETAFAQQTFTTTAGDATLEFYLSIYAHNGR
FT                   GIQDYVKLSLDGEEIFRVSDANTEYDNGYAKVTIPLTDLSAGEHVLRFDSVNNSTANIV
FT                   RFSIDDISFVTETNQCRGSNLYLPMITK"
FT   sig_peptide     complement(512634..512714)
FT                   /locus_tag="Haur_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            513139..514203
FT                   /locus_tag="Haur_0438"
FT   CDS_pept        513139..514203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0438"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; Helix-turn-helix type 11 domain protein; KEGG:
FT                   rrs:RoseRS_3462 heat-inducible transcription repressor
FT                   HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03089"
FT                   /db_xref="GOA:A9AUH0"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AUH0"
FT                   /protein_id="ABX03089.1"
FT                   /translation="MHLELNERRRRVLKAVIQQYIDTATPVASQDLARSLGVSSATVRN
FT                   EMAALEDAGLLTHLHTSAGRLPTDAGYRFFVENLMDRAALSTQEQRMIQHQFYQIRSEL
FT                   NQWIHLAAAVLARTAQTAAVVTPPRAYESRFKHIELISINDALVLLVLVLHEGSVKQQT
FT                   LPADPNTTQEQLSRIAGRINELCHEASAKAIANIAHNQSTNQPPLSSFEVLVIESVARA
FT                   MQQFEEHVNELIHHDGLLEMLHQPEFGQVTRVREVLSILEGGTMLESLIPQALASDGVQ
FT                   VIIGGEHSRDELRDYSVILSRYGVNGDVAGVVGVLGPRRMAYPRSISSVRYIAGVMSDL
FT                   MGDLYGERKIEPSE"
FT   gene            514262..514777
FT                   /locus_tag="Haur_0439"
FT   CDS_pept        514262..514777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0439"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rca:Rcas_4391 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03090"
FT                   /db_xref="GOA:A9AUH1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH1"
FT                   /protein_id="ABX03090.1"
FT                   /translation="MTEEVQAQSTDDTNPQGDAESLNERIATLEREVEEHKTNWMRAIA
FT                   DFKNYKRRTESEREELIRNASAGLMLKLLPVLDDLLLAMGQIPAEIENNQWIGGVKQVQ
FT                   RKFETVLEGAGLQPIPAVDEEFDPNIHEAIMFEEGDEAQSNKVVAELRRGYKLGERVLR
FT                   PTVVKVGK"
FT   gene            514873..516729
FT                   /locus_tag="Haur_0440"
FT   CDS_pept        514873..516729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0440"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: rrs:RoseRS_3460 chaperone protein DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03091"
FT                   /db_xref="GOA:A9AUH2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH2"
FT                   /protein_id="ABX03091.1"
FT                   /translation="MGKVIGIDLGTTNSVVAVMEGGEAVVIPNAEGARTTPSIVALSKN
FT                   GERTVGLVAKRQSVTNPENTIYSVKRFIGRKLDHPSVQRDKDLIPYRMTSAPNGDARVL
FT                   MGGRDYSPQEVSAMILQKLKADAEAYLGEPVSQAVITVPAYFDDSQRQATKDAGKIAGL
FT                   EVLRIINEPTASALAYGLERNSNELIVVYDLGGGTFDVSILELGEGVFEVRATNGDTHL
FT                   GGDDFDQKIIDWLASEFQRENNIDLRSDRMALQRLKEASEKAKQELSSVLQTDISLPFI
FT                   SADASGPKHLNTTLTRAKLEQLTADLVERTLKPIKLALQDAGLKPGEVDEVILVGGQTR
FT                   MPAVQAAVKKFFGKEPHKGVNPDEVVAIGAAIQAGVLAGDVTDVLLLDVTPLTLGIETY
FT                   GGVMTPLIDRNTTIPTKRSQIFSTASDNQNSVEIHVLQGERAEARHNKSLARFTLDGIP
FT                   AAPRGVPQIEVIFDIDANGIVNVSATDKATNKEQKITITPSSGLNDDEISAMIRDAEDH
FT                   ADSDARRRDQIATRNKADGVIYAADRMLREADDNVDYTARNTVEDRIAALRAVLDGDDM
FT                   EAINNRTAELSVAMQRLKPAPDFGIEPETPSQDHGSADEVEL"
FT   gene            516875..518011
FT                   /locus_tag="Haur_0441"
FT   CDS_pept        516875..518011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0441"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: rca:Rcas_4393
FT                   chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03092"
FT                   /db_xref="GOA:A9AUH3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH3"
FT                   /protein_id="ABX03092.1"
FT                   /translation="MATEAKRDYYEVLGVGKSASPDEIKKAYRKLAMQYHPDRNPGNVE
FT                   AENKFKEATEAYEVLSNDQKRRMYDQFGHAGSSGQGFDPFAGFGGAGGDPFSTIFDAFF
FT                   GQGARGGSRGGTRQGADLRADLVISFEEAIFGTEKELDYRRLESCGPCGGNGAEPGTEP
FT                   TRCPKCQGSGEMRVRTFLNMVTVTTCDQCNGRGVIIPIPCKTCRGEGRVRETVKRKLTV
FT                   PAGVDDGMRIRIGGAGDSGPSGGSAGDLYVNLRVQPHDFFVREDNNILLQLPINLVQAA
FT                   LGAQLNVPTVDGDEPLNVPAGTQDGTVFTLRGKGVPYIDSSGRNLGRRGDQMVVVKVRV
FT                   PTKLNDEQRELFQKLGETMGMDHFEQKERGFWSKIFGS"
FT   gene            518317..518709
FT                   /locus_tag="Haur_0442"
FT   CDS_pept        518317..518709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03093"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH4"
FT                   /protein_id="ABX03093.1"
FT                   /translation="MNCRDCGNEFVFTAGEQEFYSQKGFDNEPTRCSNCRQARKQNRGG
FT                   GGYESSSRGGGGGGYSRNSYGSDRGGYSSDRGGYSSDRGQREMHTTTCSSCGGPAQVPF
FT                   VPRGDKPVYCRDCFQSQQSSSRSNRW"
FT   gene            519140..520015
FT                   /locus_tag="Haur_0443"
FT   CDS_pept        519140..520015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0443"
FT                   /product="Ectoine/hydroxyEctoine ABC transporter
FT                   solute-binding protein"
FT                   /note="TIGRFAM: Ectoine/hydroxyEctoine ABC transporter
FT                   solute-binding protein; PFAM: extracellular solute-binding
FT                   protein family 3; KEGG: bbr:BB2160 putative extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03094"
FT                   /db_xref="GOA:A9AUH5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH5"
FT                   /protein_id="ABX03094.1"
FT                   /translation="MRRVWWGVAGLALIGMITVLIWWLAKPLETTLERAQRTGMIRIGY
FT                   APEAPFSYRDATGTVVGEEAVVITWVMQRLGVSQLEWVQTEWADLIPGLQAGRFDLIAS
FT                   GMFITCERAELLAFSQPTFALSPAMLVAKTNPLGIQSFADFQRPDRRLAVMRGAREAEI
FT                   AQALGIAPEQLLFVPDVQTGLAAVLAGRADALALTDISIDLLVLQAPDQVERAMPFVPP
FT                   IIDGNLSIGYGAFAMRHKDAHLRTAIDQQLIGFIGSDEHYGLIAPFGFSREQLPNRSTA
FT                   SLLQGCENGS"
FT   gene            520012..522153
FT                   /locus_tag="Haur_0444"
FT   CDS_pept        520012..522153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0444"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: sfu:Sfum_3112 putative PAS/PAC sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03095"
FT                   /db_xref="GOA:A9AUH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH6"
FT                   /protein_id="ABX03095.1"
FT                   /translation="MKRFAWLRRKELRPLIALLSVALVSIALLQWNYYQMRSMIQSQIT
FT                   AFNGMTQARLNMKRGYLIAEQVLNGNQTLLPQDAIAYLDQAILAVDDWQQGKNPVVVFD
FT                   QLLPPDPPTQQALTDYRQHLVSFRALLLQHLNRPQEQAQTTIDRRIAFSELESEAEQLE
FT                   NRLYLDLELSIKRQAERYSLMLVGWLIFLVIIAGVVYRLLGLQRLAVAQLAASEKQFRA
FT                   QYRGIPIPTYTWRCIDDDFILEGFNDAAMIITQGAITKFVNQSARIVYRNEPEILHHFE
FT                   RCQREKITLHQEIRYEFKLINQVKDLYVSYVFIEPDFIMVHTEDRTDRNQLQMQLIRAQ
FT                   KMESIGRLAGGVAHDFNNLLTAISGYTTLAIDSAQQGFPVVEELTEIQHATDRAAMLTS
FT                   QLLTFARKQQIQPKIVNINDLIMSMEKLIRRVLPESIQWRTVLNVNIDLVLADIGQIEQ
FT                   VLLNLVVNARDAMPQGGNLLVETNNVAVDANYARTHIDVPIGNYVLFAVSDTGIGMTQE
FT                   VQSRAFEPFFTTKSDHEGTGLGLATCYGIIKQHGGHIGLYSEVNHGTTIKIYLPRSEQA
FT                   QLDDAPSLIQNLPRGTETILVSEDEPQVRAVLVRMLQGLGYSVLEALHGSEALALLQAQ
FT                   ALGTIQLLITDMVMPQMGGFELSQRVAELDPQLKILFISGYSEHSLAQHQQLAQQPLLL
FT                   SKPFSLATLAQTVRKVLDD"
FT   sig_peptide     520012..520101
FT                   /locus_tag="Haur_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.734 at
FT                   residue 30"
FT   gene            522543..523175
FT                   /locus_tag="Haur_0445"
FT   CDS_pept        522543..523175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0445"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ccr:CC_1643 hydrolase, haloacid
FT                   dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03096"
FT                   /db_xref="GOA:A9AUH7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH7"
FT                   /protein_id="ABX03096.1"
FT                   /translation="MKKYKLVLFDFDGTLADSIPWLVKAINGVAEKYKFRQLTPKEFTE
FT                   LRGQNPREVMKYMQVAWWKVPLIARHMRQLAAQNIRHIQLFDGMELILAQLDAADVRLG
FT                   VVSSNSEENVRHVLGDALANVVEFYECSVPIFRKRARFERIVRKANLEREKILCVGDEI
FT                   RDAEAAKQAQLAFGAVGWGMSRIQDFAPYAPREVFFQVSDIATRLID"
FT   gene            523274..524125
FT                   /locus_tag="Haur_0446"
FT   CDS_pept        523274..524125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0446"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: aba:Acid345_2253
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03097"
FT                   /db_xref="GOA:A9AUH8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH8"
FT                   /protein_id="ABX03097.1"
FT                   /translation="MSLGSLTFRLGGDLEIRRLGFGAMRITGDGIWGEPSDREQSKAVL
FT                   RRAVELGVNFIDTADSYGPDVSECLIGEALHPYSADMVIATKGGLLRGGPNIWYSNGRP
FT                   EHLRISLEKSLRQLKLERIDLYQLHRIDAQVPLEESLGALSDLRNEGKIRHIGLSEVNN
FT                   EQLAQAQKVVPIVSVQNRYSIGDHEWESMVDACEAQNIAFIPWFPLAAGRLTAPGGTLD
FT                   QIAKKYEASVGQIALAWLLKRSPVILPIPGTSKVKHLEENMGAEKIALSDEDFQTLREL
FT                   QA"
FT   gene            524641..525330
FT                   /locus_tag="Haur_0447"
FT   CDS_pept        524641..525330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0447"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: syf:Synpcc7942_1012 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03098"
FT                   /db_xref="GOA:A9AUH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUH9"
FT                   /protein_id="ABX03098.1"
FT                   /translation="MSRILIVDDDPAILSGVSTLLEQAGYEIAQAASLAQARSHLQAFN
FT                   PPSLVILDLMLPDGDGFELCRQIRQGGQYLPILMLSARDELQDRVEGLTVGADDYLTKP
FT                   FAPAELVARVRAILRLAQHQRETIGSFECGKLRFDCELQRAWWDEQLLELTPKESGVLL
FT                   QLMRQPSHVWGRLALLQTVWGTNFLGDSRIVDVCVQRLRAKINQLDANADPIQTVRGFG
FT                   YRLKCEP"
FT   gene            525327..526139
FT                   /locus_tag="Haur_0448"
FT   CDS_pept        525327..526139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0448"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rsh:Rsph17029_1559
FT                   PAS/PAC sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03099"
FT                   /db_xref="GOA:A9AUI0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUI0"
FT                   /protein_id="ABX03099.1"
FT                   /translation="MIVLPLKSLLFGILLLLWLVASFAWWLGQRGKRPIIQHSADPLLR
FT                   QQIAQHRAFIGTLSHELRTPLTALLAHTAIVHNQQSEPAVREHSLLTLEREAQRMARLV
FT                   RDLLELHRLELSDELPLVPVNVALLAEEAIASVWVMADEAQIELQFEADPTHQRVLAHP
FT                   DRLKQVWLNLLMNCLRYCRAGDLVIVRVLASEQGLRCSIEDSGPGIAATDLPHVTEPLY
FT                   RGVLDNEGSGLGLSLVKQILARHHSTLQIESSTNPPTGTHIWWILPYD"
FT   sig_peptide     525327..525401
FT                   /locus_tag="Haur_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            526132..527535
FT                   /locus_tag="Haur_0449"
FT   CDS_pept        526132..527535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03100"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUI1"
FT                   /protein_id="ABX03100.1"
FT                   /translation="MTKLRWLSLLILGSIIYWLLPIDGNLVLQTNQQAGWPQIWFERDT
FT                   QDQQWIYVRDNQPWVYVALTLDGTSLQRDQQFAAGSEPWTWRWSSTSNTLTQADIRFYH
FT                   DCDRGCQERGSLMIGQPEPTATPRQSSLLGAMFANPDRDWHGRAAWSVDLVYALRADES
FT                   QWSVDALASRVAAAHKAGLRVIIRVAYDQGQSLPPNNDETALAIFLRFCQRLAHDQRLQ
FT                   AVYGYSIGNGYNSLGENSLSQEPLTPAWVARILVGYGVATERHDNVIETMRGLNPQLKL
FT                   LVGPVRPWSNEADGAWADPLNQPWLNYFNSLLVLLDQTIRSKHQQQINVAPDGFALSTA
FT                   GWPERSADPAQEPLNDLYLSQSGKAQRGFRVYRDWLTIINRYPSTANRPVYITATNTFH
FT                   PEQARTPLENYPKGWLSNALAEVSSNPQVQALCWFVDQPFGQQWYEWSLSEPQGKLHEA
FT                   AQEFDQLLR"
FT   gene            complement(527532..527993)
FT                   /locus_tag="Haur_0450"
FT   CDS_pept        complement(527532..527993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0450"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rle:RL2387
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03101"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUI2"
FT                   /protein_id="ABX03101.1"
FT                   /translation="MAKYTVTIEWERQAATFSDGKYSRAHRWIFDGGQVVKGSSSPHVV
FT                   PLPYSDEQAVDPEEAFIAALSSCHMLWFLSIVAEAGLVVEHYQDQASGKMGKNSTGKIA
FT                   MTKVTLRPNIIWAEPAPSSEQIEQFHHQAHEQCFIANSVLTQISIEPQP"
FT   gene            528277..529215
FT                   /locus_tag="Haur_0451"
FT   CDS_pept        528277..529215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0451"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; GAF domain protein; KEGG: bbt:BBta_1753
FT                   putative sensor histidine kinase (HWE family) with a GAF
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03102"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A9AUI3"
FT                   /protein_id="ABX03102.1"
FT                   /translation="MSLGSGSQLNNAERTETLQELGLLDVSFDPAFDRLTRLASKVLQA
FT                   PVSLLSLVEHHRQYFKSHIGLAEPWAERRETPLTHSFCQHVVSNGQELIVTDAREHPLV
FT                   HDNLAIPDLGVISYAGMPIRSGGHVLGSFCVIDGKPRVWTADELDILHEFAELLMTELK
FT                   LRQEIRIHQQDIRERERLQNELIGLQQALLDELSTPLIPLNDQVLVVPLIGALDQQRAQ
FT                   RMTEALLTGVGKYRADFVILDITGVPVLDTYVASLLVQTSQAIQLLGARMVLTGLRPEI
FT                   AQTIVSVGLDLRSVVTYSTLQQGIEYTFRRK"
FT   gene            complement(529264..530844)
FT                   /locus_tag="Haur_0452"
FT   CDS_pept        complement(529264..530844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0452"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: rrs:RoseRS_0132
FT                   integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03103"
FT                   /db_xref="GOA:A9AV25"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV25"
FT                   /protein_id="ABX03103.1"
FT                   /translation="MNTKLETKTQTTAGRSIALAALLLMVGNFASRILGLVRDKVINHN
FT                   FGVGAETSLYSLLSAVPTQLYDFLVGGLVSAALVPVLTDYIDQHDDGDLWQIINTILTM
FT                   LALVLGLLGGLVWIFAEPINQVLAAKIVASPTMLSLGVSMLHSMVIAVVFMCLSGVLTG
FT                   LLQAQRRFSLPAFTSTVFNLALIVLIWFWPQDARVLGWAMVAGALAQVTLQLPALRGAR
FT                   LRPMLRWRHPGVRRIGLLYAPVALGISFSFVGTLIDRQLAGSIDQQSAAYMRSATTFIQ
FT                   FALGLVAAAISIAILPTLSRLNSDGDEAGFRRILGIGLKVVLLLIVPMLVIFGLLGESV
FT                   VRILFEGGKFTAENTRITALVLLAYLPSMLAAAIDQPLIFAFYARKHTLLPNLVQAPAI
FT                   ASYFLVAGLSYRAWGMYGLIAGNVAQLTVHALVMAVVAHRRLRVFDGQAMLQASAKIAS
FT                   AALVMAASCWGILQLLPTTPSKFNALVLLLVAGGGSSLIYLGLLWCLKLDALQFFGAAL
FT                   QRKFKRKTA"
FT   sig_peptide     complement(530752..530844)
FT                   /locus_tag="Haur_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.708 at
FT                   residue 31"
FT   gene            complement(530841..531557)
FT                   /locus_tag="Haur_0453"
FT   CDS_pept        complement(530841..531557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0453"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: dra:DR_0450
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03104"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV26"
FT                   /protein_id="ABX03104.1"
FT                   /translation="MPTILSVWAHPDDEAFGPVGVLAQAHAAGYRTVIITATHGELGQI
FT                   SPELAINPENLGSVRLEELHQACQAIGVDRSIVWDYPDGGLALANATELRDKIVEVLNA
FT                   EQPAIVLTFGPDGIYGHPDHIAISMATTQAFAQYLALHPTIEQPRLYYQSVAPNSPRSV
FT                   NAASSNEYPDPLPATTIIDVSEYADTKRAALEAHATQRHDWQQFLDQADWFNTVYLHRV
FT                   YPSFGLNDQPETTLFA"
FT   gene            complement(531574..532248)
FT                   /locus_tag="Haur_0454"
FT   CDS_pept        complement(531574..532248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0454"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rrs:RoseRS_1043
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03105"
FT                   /db_xref="GOA:A9AV27"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV27"
FT                   /protein_id="ABX03105.1"
FT                   /translation="MTIQQTQRLLKVQILGMLDYNAAWELQRELVSQRSAETIPDTLVL
FT                   LEHPATYTIGRSGGYEHLLVSPETLQQRGAALIEVDRGGDITYHGPGQLVGYPILQIRD
FT                   HGRDLHQYLRMLEAVIIELLAEYGLSARRFPGYTGVWVGDRKIAAIGVRSNTRGVTSHG
FT                   FALNVTTNLADFTAIVPCGIHDYGVTSLAELLPVVPAFNDVQQRLIRIFLRVFDLHLIE
FT                   PV"
FT   gene            complement(532245..532679)
FT                   /locus_tag="Haur_0455"
FT   CDS_pept        complement(532245..532679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_2105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03106"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV28"
FT                   /protein_id="ABX03106.1"
FT                   /translation="MPVLIQLTTADHGGRVSTGKCGTAECGVSCNCGCPYTAMESRGRT
FT                   ETIEIIEAQYPNQWLGLVIPPEEDEFMPERAMLVAHSHDDNEVWDAMSRVTHNQVVHVY
FT                   FNGQYNADYVDWADSQPASYGSRLTQASPFGGEMISLMPL"
FT   gene            532816..533931
FT                   /locus_tag="Haur_0456"
FT   CDS_pept        532816..533931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0456"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: rca:Rcas_2343
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03107"
FT                   /db_xref="GOA:A9AV29"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV29"
FT                   /protein_id="ABX03107.1"
FT                   /translation="MVGRELYRLLQCPTCNSRDLAVYAEHVLCAGCRNQYPIHKGYIDL
FT                   MPRQTEFDYISKYVSEEESMGEELDYREMAPPLLAAGVRHRQIRRMLELKPTDIVFDNA
FT                   CGNGRFGLWNADAVGLLVGSDPAVLFADQALAEMELAQADSRRLPFVDGAFDKSLSVDV
FT                   LEHFPRDVIHDYLVETARVLKVGGRVAIFSNTREMSPIQPIINISKRLGKFFVKQGVYD
FT                   FEREARRKSDHIKDLKTWDDVEAALVEAGLKPVKVVFWNSVFTSFVEHVLMKLGESLIA
FT                   KRKTAKAASATVLTDEAVNASAGAQREIVARRAMRRHLTPTSPIYWALYTITLLMELDL
FT                   WLFGWMRTGPYFVLAEKVEGRYVPAPLPAEE"
FT   gene            534455..535135
FT                   /locus_tag="Haur_0457"
FT   CDS_pept        534455..535135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03108"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV30"
FT                   /protein_id="ABX03108.1"
FT                   /translation="MFKKLSLIASVVLMLIVTQFTPVEAQEQSRQMVLVAVDVSAMCSE
FT                   SIDSAKNHPCEKGSSISVYSMPLEDAQKQGYGEYVFITGDTTLDRLASKQLADTLHLQL
FT                   TNDKQKAPANTQACGSYYKSISRSFTMGGGVYKLDTSVQYKVNPTCQVSEETYRVKTSK
FT                   THYELLTWSINFPNVNVYNSIQSQPGLTWTSYAYNVWMNSGFQLSAETYFPGETHWEYY
FT                   TLYQ"
FT   sig_peptide     534455..534532
FT                   /locus_tag="Haur_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            535233..535799
FT                   /locus_tag="Haur_0458"
FT   CDS_pept        535233..535799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03109"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV31"
FT                   /protein_id="ABX03109.1"
FT                   /translation="MQRLIVAMLLLVILIGCRQQQTTQPLTPSPINSIDSRKIEAIILK
FT                   PFQNEQIQNLQMYPVAGLNEGMLFVYQLDSARGKAIGLLTGVETLGEFSIRSQSLDILG
FT                   PQKPYGFYLSNDGGQPNYIGYGYIQHPETIKQLRIILSDGNSLVVTGNTITGLVMPKHN
FT                   PPIRLEVVGIDGTIIEQNPITLPTP"
FT   sig_peptide     535233..535295
FT                   /locus_tag="Haur_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.458 at
FT                   residue 21"
FT   gene            complement(535805..536827)
FT                   /locus_tag="Haur_0459"
FT   CDS_pept        complement(535805..536827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0459"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sru:SRU_0369
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03110"
FT                   /db_xref="GOA:A9AV32"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV32"
FT                   /protein_id="ABX03110.1"
FT                   /translation="MASLTIEQIAELAHVSIATVSRVLNNQPHVRAEVRERVLAVMQEH
FT                   HYTPHAAARTLAGQRPKVIAVFISRTTATIFRNPTFSHLLQGMTEACNAKGYVLMVSLD
FT                   SANRADDPATKLLNGRSVDGRIVIPNTINDPLLPQLIADRVPMVLVGKHPLLHHIVSVD
FT                   IDHFAGSYQAVHHLLKLGHQSVGMIVGSLHALATHDQIEGYQQAYREAGLPIHPALIAT
FT                   GNETEQGGQAAIEQLLALQPRPSALFVSSAVMATGVLQTLHTQGLRVPDDITVVCFDDV
FT                   PTAASLNPSMTSLHQPMYDLGATAANVLIELIEGKTPSSENTILPISMIVRHENEVWGG
FT                   "
FT   gene            complement(536839..538194)
FT                   /locus_tag="Haur_0460"
FT   CDS_pept        complement(536839..538194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0460"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: mbu:Mbur_1925
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03111"
FT                   /db_xref="GOA:A9AV33"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV33"
FT                   /protein_id="ABX03111.1"
FT                   /translation="MATASIEKLGTAPIGKLLLAMSSQTTISLLVYTIYSITNTYVLSI
FT                   GINGLAAAGAAIIAPVLLALGAVSTTVGAGGASVVSRALGAHQPDRAARVVANTFIIFW
FT                   AAALIISVIGTLAIEPIVYLLGATESIAPYAIDYGRIIFLGAITSTGYSAIIRADGNTG
FT                   FSTAIWIIPVSLTIGFWWLLVIVFPLGMTGAAIATVLGQAASAGMSIYFFFFRKQRSYN
FT                   IRLSYFKPDWAIMREILLIGSPSLIKNLSASIMAIVTNNLLRTLGGTSALSVFAIVGSL
FT                   YSGLMTPQTGIIQGMQPIVGYNLGQRNLQRVWQTIKLSLRAAVGYGLLISSICLIIPSG
FT                   LISLLSHDQALIAEGQTALRLLALAYPLTGISLVSAAALQAAGWAKQALLLLVGSIIGI
FT                   KLPILLLGSQLFGLNGIWAAEAISELLLCGAAFWLLNKLRQQTYQPLGPEGN"
FT   gene            complement(538200..539177)
FT                   /locus_tag="Haur_0461"
FT   CDS_pept        complement(538200..539177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0461"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   afm:AFUA_3G11050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03112"
FT                   /db_xref="GOA:A9AV34"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV34"
FT                   /protein_id="ABX03112.1"
FT                   /translation="MYSTTKNAKTREQIATMVAHAFEGMQLAPHEQAIQELKDGWFNAA
FT                   YAISLADGREVVLKIAPLPDADVLSYERNIMQTEVATMRLVQQNPAIPVPTIYFFDESL
FT                   SMCDSPYFFMQKIAGDNLEHVRAALEPAVQAKVDQHIGAIIHEINQFSGSYFGYEGNPK
FT                   LRGDSWKATFITLIDALLADGQRKNVELEYSYAEIRAAVLKHAAALDEVTTPYLVHWDA
FT                   WNANFFVEHDKIVGIIDFERALWGDPLMEAQFRPFSGESLSNFMQGYGKIAFTPAEEQR
FT                   NQLYSLYLALVMAIECYYRNYDTDFVRTIARQLLGATMDWLKAD"
FT   gene            539504..540505
FT                   /locus_tag="Haur_0462"
FT   CDS_pept        539504..540505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO5233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03113"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV35"
FT                   /protein_id="ABX03113.1"
FT                   /translation="MNFREYRIAAPNVRSLCWHDQSLVDWVAGGTRYQLDGPIKRSSTV
FT                   YPFGFDAAVQSASGEVVVIYQRLGTKGLVLNNGQIVREINRSYYYADSYEYPIAILQHA
FT                   DLNEVLVHCPEKYNQLELEDVVTNRRLNEAERKPVEIFHSRLSVSPKGKWLVSAGWQWQ
FT                   PTHTVAIYNVDEIWAQPQILDTEGFCPSIQVDISSVSFLDEQTLLIITDEFANLSADLV
FT                   DTLVQRRGAHSIGYYDLLNRQFRATVEAEEIVGTAMALSERYVVGFYDHPKLFDCTTGK
FT                   VVQRWPDLATGRQTHSMIGRLDQSIPPIAFDQANQRFAVADAKGITVIELSL"
FT   gene            540620..541627
FT                   /locus_tag="Haur_0463"
FT   CDS_pept        540620..541627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO5233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03114"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV36"
FT                   /protein_id="ABX03114.1"
FT                   /translation="MHYREYRISAVGVRSLCWDKQKLIDWVTGTIYQLNGTADRFHRGY
FT                   GQTFDAAVQSTSGDLAVIYQRLGTAGMLIDRHKPLRTLTRDKYHATIYEYPVGFLHDAQ
FT                   GRELLIHCPERYLKLEIEEARTGRSAASLNKTLIERLRLWFAETDDRNPMDIFHSRLIQ
FT                   SPGGRWLLNAGWIWHPYDTFVLYEVADVLADPRMLDSNHFEFAYPIVAEISAAAFLDDQ
FT                   TLILVNSEYPEDDEESPKYHEDPLFHSGPYSIGSYDLINRRYRSVVKAEEIVGTMMPLS
FT                   ERYLIGFYKHPKLFDCTTGKIIQRWPQLNTGTQTSSLLMKPELIPPPFAFDQAN"
FT   gene            541729..542598
FT                   /locus_tag="Haur_0464"
FT   CDS_pept        541729..542598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03115"
FT                   /db_xref="GOA:A9AV37"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV37"
FT                   /protein_id="ABX03115.1"
FT                   /translation="MRRQKPLDWATLGPIAVLLGLLLLIVNQLNQPKNQYAPLSAYFND
FT                   AAASVPQSQLTPLPPTTLQAIEQSNAAGSSNQIDLVLEAELYQDQSNELASELQIALDY
FT                   VQERTNIRLAERVTVVISQDAQCGFHGVTYSDVRVIYIYSCAGVARSRVVNIAAHEFVH
FT                   QLEQDRYGAAHLSTDLVLSEGFATWGAGRYWLGSASDFTSFARDYQANGQALPLATHYA
FT                   GVGIDGMNVLYYQWASFVDYLINNYGREAFDQLYISGGERQPGAANYAAIYNRSFGLLE
FT                   AEWRQTLD"
FT   gene            542641..543540
FT                   /locus_tag="Haur_0465"
FT   CDS_pept        542641..543540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0465"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: rca:Rcas_0627 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03116"
FT                   /db_xref="GOA:A9AV38"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV38"
FT                   /protein_id="ABX03116.1"
FT                   /translation="MHPPFGPNLLELGPIVIRMYAIAILSGAMLGGWLGAHRARARGYN
FT                   PNIVWDWLIVGLILGVAGGRIWYVASSWPQYRDGPFIDMINTTKGGLAIHGAIVGAVLT
FT                   VIIAAWRTKTNALTWMDVLAPCLSVGQAIGRWGNFFNNEAYGGPVSNGLPWNLDIPAQY
FT                   RIRGTEQYDASTRFHPTFLYESLWNLGVLFSIVFIERRFRGRLRNGDSLLIYGVLYSIG
FT                   RFWIEDLRVDKLCTGGVGGAICNDSLSTARLTSIVLIVGCSALFVLRRVLQRNPPASSY
FT                   QQWDEPWQPEPETAKAAA"
FT   gene            543677..545101
FT                   /locus_tag="Haur_0466"
FT   CDS_pept        543677..545101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0466"
FT                   /product="expression regulator"
FT                   /note="KEGG: sco:SCO1748 expression regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03117"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV39"
FT                   /protein_id="ABX03117.1"
FT                   /translation="MFGVLRGCSPHLDQPTHAAWWSHICGMCLTLRDQHGQVARITTNY
FT                   DAALLSALYEAQRAEQGSRRTSVCALRGFRALDVVAADNHGSRYAAAVSLLMAAIRLRD
FT                   NVADRDGWAGKVPLVANTVAKRWDKKAEQTARELGFEPALLRQQAVAQAEVEALVNADF
FT                   CTYSAPTEAAVGAAFRHTAILANQPSNAEPLEQMGRMYGRMMLLLDSYNDVAEDQARGH
FT                   FNALCATPQAELRTVAHKIFNDAFANLRQQWQRLSLLQAHLVEVLLLNMLPAIGSKAFG
FT                   ACKRHSLACATVLPVAAALLPAMASDYDDDPSRRDPNRAYTGPTRALKPHENPEYQGQY
FT                   PQQPPYQGQYPQQPYQGYPPQSNPNDPSMLPPGSLPPASSHPVPPPGHYQDRKRDVAMG
FT                   AALCCCQSRSRRHHHSHRSRIVCCDDDCCDCCQCTCCCCDATDACEGDGCSCCECGGCG
FT                   ECGSCCECGDCCSCDC"
FT   gene            complement(545164..545610)
FT                   /locus_tag="Haur_0467"
FT   CDS_pept        complement(545164..545610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0467"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: sfr:Sfri_0206 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03118"
FT                   /db_xref="GOA:A9AV40"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV40"
FT                   /protein_id="ABX03118.1"
FT                   /translation="MASINKLLDKPGFGIAILRIVVGFIFFMHGLDKFNGGIEGTAGFL
FT                   TSLGIPAPTFMAILLIATELIGGIMLMLGLFTRYVAVAEAIAMVVALVTVHLDAGFSSR
FT                   EGGYEYVLALIAASVALVLLGSGSLALDNLLSPRLTGRQITARA"
FT   gene            complement(545911..548373)
FT                   /locus_tag="Haur_0468"
FT   CDS_pept        complement(545911..548373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0468"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: rrs:RoseRS_4468 iron
FT                   permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03119"
FT                   /db_xref="GOA:A9AV41"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV41"
FT                   /protein_id="ABX03119.1"
FT                   /translation="MCVPPSSNLRSKGRELLACRSRPLSVYYAVAQREQQQITFLGACM
FT                   WLRRFLLALVVSLLPWSAMAAEPSPAQASESVRSLLVQAQLILTNDPAQAQSLLNQAQA
FT                   LYDQALAKDLTNLAPQQAAEIATRWTDLAQALEKQDVAGFAQQRALLWTHLLKASYGIV
FT                   GQAIDTGKPEQALQWLPVREFRNATRFSRPNGDAARAIEQWKQAAYSAADARTALDADL
FT                   LDTYQAKLNESLRTLRSAAQKGNLIQQAEAGAAIQGYFAILEPAYRSQHPEKVDAALVN
FT                   AENLRQAALSNNQLEAAIGSFEGSLSGFRAAPLSPSEQVRRAGQMRRFLSLVPVEYERG
FT                   VRNGQVTLDLEIQEATTFRNGAAAAFSDLESLLIAIDSTKTQQVASDLRELETMLTAAA
FT                   QRTSVAEPDAVQAKVDHITTTLAEIMPAEWQKSSLEGDFDVIASMLDQMENAVAGDQYD
FT                   LAESARLEAYAVLESGPEARLIVFAPEYKAPIENLFWYGKDEFTGLAELIRQKASLSDI
FT                   RASRQALDKQLDLAQDALGGSSTPEAVATSAAVIVFREGLEAVLILASLLASLKIGEQR
FT                   GYRKPIWIGATLAMLATVLTWVLARGLITELIRRGDQEKIEAIVSLIAIAVLLLITNWF
FT                   FHKVYWTGWMANFHAQKRRIIGGKAGLWLGLITLGFTSIYREGVETVLFLQALVLEAST
FT                   QVVLAGVAMGLGGTALVGVLVFGLQAKLPHKKMLIVTGVMIGAVLLIMVGNTMHIMQLV
FT                   GWMPLHPIRSLEIPYWANMWLGFYATWEGIAAQVAAGAFVIGSYVIAEHLQHRKTEVAV
FT                   KRQSATAK"
FT   gene            complement(548512..549588)
FT                   /locus_tag="Haur_0469"
FT   CDS_pept        complement(548512..549588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03120"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV42"
FT                   /protein_id="ABX03120.1"
FT                   /translation="MYRWLCALTLVAVLAGCGAETAPTTQPTQAPAAGELGAIKTYLLG
FT                   KTGDLINSSTALETASQRYYDLAKAANFDYATLWSSKQAEVGTALNDAKAAWLKSSPTY
FT                   EQMEGIVAGVSSLADFDVTLDAGASAEEGGDSVVNYDLTLADGRTIAKPGNLFGVTEST
FT                   LWGTYDAFRVTDVEADINGNGTVEFGESLPEANVLLAAAQKLKATATELDTAAKAWEPT
FT                   DTDAFSALVVMVPTMNEYFDSWKNSRFVAGDSSTQRDFVAISRLADIGDILGSLQVVYD
FT                   SLSPKVAALDADQDRQIKTNLQALRDFVADVYKKEQAGQHFTAEESDLLGAEAQNRADA
FT                   ITGQVSQIAARLNIKISE"
FT   sig_peptide     complement(549523..549588)
FT                   /locus_tag="Haur_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.601 at
FT                   residue 22"
FT   gene            549987..551285
FT                   /locus_tag="Haur_0470"
FT   CDS_pept        549987..551285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0470"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: rrs:RoseRS_3197 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03121"
FT                   /db_xref="GOA:A9AV43"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV43"
FT                   /protein_id="ABX03121.1"
FT                   /translation="MLSDIASELGIVLVLLVANGVFAASELAMVSARRSRLEQQAADGD
FT                   LRAKKALQLADQPDRLLATVQVGITLIGTFAAAFGGANISKPFAEYLKTVPALAPYADS
FT                   IAFTVVVLLITYLSLIIGELVPKRLALLHADAIARNLAPLLAWLSWLTRPIVWVLTTSS
FT                   TVILTLIGQNKKPDSSVTEDDILYMTREGRAGGTVALHEEALISRVFDFSDRTARMLMT
FT                   PRPDVVAVSANTPLDEITRIAVEHGYSRMPVYEGDSLDRAIGTIYIKDVLPSMLGNDQR
FT                   QLRELVRPPTYVLEHEPVSKMLTLFRRTGSHMALVVDEYGQIAGILTLEDVLEELVGDI
FT                   RDEYDSNEEQTMVKRDDGSWLIDGSESYEVIATRLSIPINDDNDFVTIAGYVLNELHRL
FT                   PNVGDHVTWDEYDVEVIDMDGRRIDKVLIKKRA"
FT   sig_peptide     549987..550058
FT                   /locus_tag="Haur_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.926 at
FT                   residue 24"
FT   gene            551367..551957
FT                   /locus_tag="Haur_0471"
FT   CDS_pept        551367..551957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0471"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH0699 ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03122"
FT                   /db_xref="GOA:A9AV44"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV44"
FT                   /protein_id="ABX03122.1"
FT                   /translation="MLDLASALAQFPILETERLVLRQPVQADRDAVFAIMADPQVLRYF
FT                   GQLPMESPEQAERRLHNISQSFEQKIGVRWAITLRETGEWLGSGGFWRFMNEHARAEIG
FT                   YELAAAWWGKGIMVEALQAMLQFGFTTLKLHSIEAQIHPLNHGSRRVLEKLGFHQEGLL
FT                   RENYFDLVEQRFTDTAVFGLLGADWRLQHGLKD"
FT   gene            552040..552270
FT                   /locus_tag="Haur_0472"
FT   CDS_pept        552040..552270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03123"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV45"
FT                   /protein_id="ABX03123.1"
FT                   /translation="MRKQILASLLVLAILAGCSTTGSAPTTAPVVSQPTSAAPAATPAT
FT                   YPTPAEGNVVVEPTLEPAQYPVPQAYPAPTP"
FT   sig_peptide     552040..552111
FT                   /locus_tag="Haur_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.646 at
FT                   residue 24"
FT   gene            552446..553780
FT                   /locus_tag="Haur_0473"
FT   CDS_pept        552446..553780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0473"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: rrs:RoseRS_3749 NusA antitermination factor;
FT                   TIGRFAM: transcription termination factor NusA; PFAM: KH
FT                   type 1 domain protein; NusA domain protein; SMART: RNA
FT                   binding S1 domain protein; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03124"
FT                   /db_xref="GOA:A9AV46"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV46"
FT                   /protein_id="ABX03124.1"
FT                   /translation="MKSDFYAAISQIAAERGIPRESVQDVVEQALISAYRRYLGSNPPP
FT                   VDVKIELEPNTGRIRVYAEKQVVDEVMDDRFEIDIEDARNVRADVEIGETVYVESTPDD
FT                   FGRIAAQTAKQVVLQRIKEVERDHIYGEYFDREGEIVTATVQRTAKGNVILEVGRAEAI
FT                   LPQKEQISHDNYRHGQRLKVYLMEARRDDPRGPRLVASRTHKDLIKRLFEMEVPEIYNG
FT                   TVEIKSIAREPGLRSKVAVHARQEGIDPVGSCVGMRGIRIQNIVNELNGEKIDVVQWGA
FT                   DMRVFIANALSPAQVVEVHLDEGEKTATVVVPDKQLSLAIGKEGQNVRLAAKLVGWRID
FT                   IKSASSLLEEERAAAEAREAAASEQMLQEAALSTAKVETRKVRVDSLVTYQGRQYGPLP
FT                   VELIGEEVALRAAAQKLNIYFNDKLIASYIIDDEAGDSDETDTEA"
FT   gene            553784..554107
FT                   /locus_tag="Haur_0474"
FT   CDS_pept        553784..554107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0474"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   rrs:RoseRS_3750 protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03125"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV47"
FT                   /protein_id="ABX03125.1"
FT                   /translation="MAAQKQSPRPRHVPQRMCVACRRTESKRQLVRLVRLADQSVVVDP
FT                   SGKQAGRGAYLCAERPCWTNALKRGALERALRVELSAIDQQALQTIADQFPDAEPAVEA
FT                   AMN"
FT   gene            complement(554174..554599)
FT                   /locus_tag="Haur_0475"
FT   CDS_pept        complement(554174..554599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_6156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03126"
FT                   /db_xref="GOA:A9AV48"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV48"
FT                   /protein_id="ABX03126.1"
FT                   /translation="MLIVVLATATAAPGWNATATTRWNATAATAATTIATWAAATTALV
FT                   IIAVATTATAAATRAVTIVFAATGRTSTTRRLRPIAVTTATATTATVATATTAAATVTT
FT                   AAAATSGEAFTARFAIVCAITYAIASIFLRNWHLWSS"
FT   sig_peptide     complement(554540..554599)
FT                   /locus_tag="Haur_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.538 at
FT                   residue 20"
FT   gene            554627..556435
FT                   /locus_tag="Haur_0476"
FT   CDS_pept        554627..556435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0476"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   translation initiation factor IF-2 domain protein; KEGG:
FT                   rca:Rcas_1132 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03127"
FT                   /db_xref="GOA:A9AV49"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV49"
FT                   /protein_id="ABX03127.1"
FT                   /translation="MARPVAPARPRGPVELGPVMTVRELSEALSVGAADIIKEMLKQGI
FT                   LANINQQLDYETAAVIAAEFDIETSEHVPERMAGLVDDIGDALRAETAENLKTRPPVVT
FT                   IMGHVDHGKTKLLDAVRSTRVAEGEAGGITQHIGAYQVEIHGRKISFLDTPGHEAFTAM
FT                   RARGATVTDIVILVVAADDGVMPQTAEAIAHVKAAGVPMIVAINKIDVPGANPDRVRQQ
FT                   LAGEGVTTESWGGDVPDVEISAKHKKNIDGLLDMVLLVADLQELKANPDKPAIGTIVEA
FT                   ELDKGRGPVATVLIQNGTLRQDDIVVVGATHGKIRAMFTDIGRRIRIAEPATPVSIIGL
FT                   SEVPQAGDILQVLDDPRIAREVATVRQRQRQMEHMANQLGKATTLDEVYKQIQAGKIKD
FT                   LNIILKADVQGSIGAIEHSLAQLNEKQSEIQIKILHRGTGTISESDVSLAVASHAIIIG
FT                   FNARPDAAARRSAEANGIDIRFYNIIYQLIEDLNKAMIGMLDPEIKEVTDGFAEVRNTF
FT                   RLPSREVVAGLMMIDGKVTRNSLVRVLRSGVVLHDGRIGSLRRFKDDVREVLSGYECGI
FT                   QIDGFNDIETGDTMEFYRKEKIIRTS"
FT   gene            556534..556914
FT                   /locus_tag="Haur_0477"
FT   CDS_pept        556534..556914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0477"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG:
FT                   rrs:RoseRS_3752 ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03128"
FT                   /db_xref="GOA:A9AV50"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV50"
FT                   /protein_id="ABX03128.1"
FT                   /translation="MAKNKRVEQVAEEIKTILSNAIQFEIQDPRLGFVTLTSVNVSPDL
FT                   YHANINVSVMGDDTARKDSLATLDRAKGFLRRELGQQMKLRAVPELHFHLDVTIDTRQY
FT                   MDTLFNQVDEERRVNPPKLDDE"
FT   gene            556925..557917
FT                   /locus_tag="Haur_0478"
FT   CDS_pept        556925..557917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0478"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: rrs:RoseRS_3754
FT                   phosphoesterase, RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03129"
FT                   /db_xref="GOA:A9AV51"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV51"
FT                   /protein_id="ABX03129.1"
FT                   /translation="MLYTTIQQAAPALREAMTAARHILVTSHINPDGDAVGSSIGITRI
FT                   LRAMGCRVTMVLPTDLPSLAVVLPDAPEVGVYSQGASLPDDVDLVVLVDTGSISRIEPI
FT                   FSAERAYLAQRPLLVIDHHATNSGEGFLNLVMTEAAATCEILGLLAHAWNQAIDAETAT
FT                   ALLMGLVTDTQSFQTAHTSPRTLRVAADLLAVGGRLNDVMRSMMYGKPFAHAKALGLAM
FT                   ERMHDEGDIIWTEFTQAMQQGTGADDEAGDEITAYLSRVATAKAYVLFKERRDGTVKIS
FT                   LRSKPGIDVGSVAHALGGGGHREAAGATLQMGLAEARDLVLGELRAALA"
FT   gene            557966..558841
FT                   /locus_tag="Haur_0479"
FT   CDS_pept        557966..558841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0479"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; KEGG:
FT                   rrs:RoseRS_3755 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03130"
FT                   /db_xref="GOA:A9AV52"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV52"
FT                   /protein_id="ABX03130.1"
FT                   /translation="MLHGFLNIDKPQGITSTDVVRVVKRNARQKRVGHGGTLDPMATGV
FT                   LPIALGNATRLLEYLLEEERKAYTATLRLGITTDSDDVEGAVIAEAPIPPLDPALIESV
FT                   LSQFRGAINQVPPQYAAIRVDGKRMYEYAREGKHIELPARPITIEQLDLLAWDAQQLTI
FT                   AVDCSKGTYIRAIARDIGALLGCGAHLTALRRTRAGAFDLSNSIGLAELDQQPEVFAAA
FT                   LLPPQAAIANWPLINLADAIVADVRMGRVVQVDSQAERVGLLDQAGQLVAIAVLREAGY
FT                   QPIKVFAAEE"
FT   gene            complement(558966..559460)
FT                   /locus_tag="Haur_0480"
FT   CDS_pept        complement(558966..559460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03131"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV53"
FT                   /protein_id="ABX03131.1"
FT                   /translation="MDWIKRLGSMLLIGLIGLFVVGIVVDPGNANSATSTKLVQASGGP
FT                   TATPPPESVLQSPADNAVLAQPIAPNSWTFNWQGPRCGHKIYLNGPGDRNYIFNGTMGS
FT                   GPPPSSFTYSYTQTQALPADALEAWNWHVEYDCGSFQGQSVTRTFKVVPANFVYLPYAT
FT                   H"
FT   sig_peptide     complement(559362..559460)
FT                   /locus_tag="Haur_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.723 at
FT                   residue 33"
FT   gene            559868..560596
FT                   /locus_tag="Haur_0481"
FT   CDS_pept        559868..560596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03132"
FT                   /db_xref="GOA:A9AV54"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV54"
FT                   /protein_id="ABX03132.1"
FT                   /translation="MAAAQAPQSYQPIARPTVIPSVNTSMATPTTKPIAPTSIQLSPNS
FT                   ARSMLQPNRQQLLAQLQMFAYGLIGLGAVILVGLIFGLFVKGGLSGDLGGILGGGVEIG
FT                   GSAIHLLLLLLATLFEAGLSNGGIIAFVVIIIILLLPAYAIFAITTGSKIAKAIILNQM
FT                   PYSIKNLQIFSGIMIGFFGLIYALTNIQFKMNSNGLGGFGAEAGIGLGWGFTLSLFIML
FT                   GIFIGCIWYKNIALKLLVNP"
FT   gene            560607..561275
FT                   /locus_tag="Haur_0482"
FT   CDS_pept        560607..561275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0482"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   ana:alr2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03133"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV55"
FT                   /protein_id="ABX03133.1"
FT                   /translation="MEYGLESPINYEQKCLCILVVDTSGSMQGRPIDELNQGLQVFHQD
FT                   ISNSFSTAQRLEICLVEFNSQADCIVEPSLVDQFHMPILAVAGTTKLVDGVRLAIHKVQ
FT                   ERKSWYRSTGQPYYRPWIILMTDGEPDSDQDVAGLAREIQHGVNNKQFVFFPIGVQGAD
FT                   MRMLQQISTPDRPPMLLQGLRFEAFFDWLSASLSMVASSTDGQVIQLPSTSGWGILPVS
FT                   "
FT   gene            561332..562747
FT                   /locus_tag="Haur_0483"
FT   CDS_pept        561332..562747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0483"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   ava:Ava_B0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03134"
FT                   /db_xref="GOA:A9AV56"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV56"
FT                   /protein_id="ABX03134.1"
FT                   /translation="MKQNQRPLIFGLFTLLLLSSMLIGLLLIRLSTTKQQATVPNQQAA
FT                   TTKQQATATKQQPIANSRSMTITQSILLATLEAIPAPIPTIAPISNSDLAKLDLAKPTP
FT                   VLRAANNTKNDLITGFLWLSVLILGGYFLWSRWLGSLQLLPQDHPRPTQSRPKSLATPP
FT                   INPVQPKPSPAIVPMPASSPRPTAEPRRRNANYQLHIFQDSVIGLSHTQHGLPCQDSSA
FT                   HRALDNGWGVAVVADGLGSRKLSDRGSQFVVKHTCEKLFDLLHHYAWHKTNQLPTEQQW
FT                   QGYVKAAFYDVYKELLQEAKVNDQSIHEYACTLISVIYSPIGILVAHVGDGRAGYSDRY
FT                   GQWHSMITPHKGEEANEVMPFTADQVWKNPQELIECRVIQEPICGFVLMSDGCEKHTFQ
FT                   CSQFDQANERWHDPNQPHQQFFDRLQQLFREQKQKGCKAEELKKMFKDILLRGTTGFAN
FT                   ESDDKTMILGLWI"
FT   sig_peptide     561332..561436
FT                   /locus_tag="Haur_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.372 at
FT                   residue 35"
FT   gene            562767..563969
FT                   /locus_tag="Haur_0484"
FT   CDS_pept        562767..563969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0484"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   ter:Tery_2828 uncharacterized protein with protein kinase
FT                   and helix-hairpin-helix DNA-binding domains-like"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03135"
FT                   /db_xref="GOA:A9AV57"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV57"
FT                   /protein_id="ABX03135.1"
FT                   /translation="MMTFSYRTKQHIHVQLDQLNPLGKGGEGSVYSVINTPNYPNHCAK
FT                   IFHPNRLTADLERKINFMVDNQPSTLISTNYRIAWPIASLYHNKKFYGFIMPKAFDKSI
FT                   GLERVTQPQISLKGIDTQWIKYQRNDKQGMINCFKVCVNIAFIVNLIHQMKKYTFVDLK
FT                   PQNILVNLNGFVSITDIDSMQVYDPQKNLYYKSVVSTAEYSPPEYQSYLKKGGNITQEW
FT                   DNFSMAVIFYQLMTGVHPFAATFGGKFSNSTTIDDHISQSLFVFGDNRQTITKLPPLHT
FT                   YYQQIPLNIQQLFLRAFDKPVSQRPTAEEWGQNLFELVSKDSHLIASNTAVAALALPVK
FT                   SALKPAAQSTTGHVQMFQLTKASTHSQGSQSTKAPHKSYAWVGWLIVLVCIIVVIAVAN
FT                   A"
FT   gene            complement(563966..564871)
FT                   /locus_tag="Haur_0485"
FT   CDS_pept        complement(563966..564871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03136"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV58"
FT                   /protein_id="ABX03136.1"
FT                   /translation="MRFKTTSGASGDLFNPEFLARIERLALRSRRNLRGGLSGEHASRR
FT                   RLPAPTFSDHRAYSPGDDLRHVDWFAYARHEDLHLKLGETEQDINVTIALDCSASLDWG
FT                   HGELHKGRYALRLAAMLGYLGLTSNDQTTIWPFTSKLIKPFGPMVSRARGPDMLRYLSN
FT                   LNWAEQTSFTPVIQAVRRSAGGMLLIISDLWTSDLEPLLRAAAPPVWQVVVLHLLHPEE
FT                   IKPTLTGPVEFEDSETGQVLALELDQQTHKAYREKLVRWVRMHEQVCQRYGATYAGIRT
FT                   DRPLEQSILPFLRRRGIIGL"
FT   gene            complement(564843..566177)
FT                   /locus_tag="Haur_0486"
FT   CDS_pept        complement(564843..566177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03137"
FT                   /db_xref="GOA:A9AV59"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV59"
FT                   /protein_id="ABX03137.1"
FT                   /translation="MNINQQLTELHTELQRYHRQRLLIRAAWMTLGVLCLGLIGRNWLA
FT                   WPLSWPILSLIVILVAALGVVYAWKSILSPAHLAQLLDQQYQLNAQLSTASEFQNQRDG
FT                   FHAVNLERANRRLPSVARDATSRVLAPIALEWQSLGLAALLATGLFVLGQINAGLPAAT
FT                   TEPLSELASLATTEPPQQPAAEQDPAADPNQPVGSQPDQQPELGPEGQEIADALADGLS
FT                   DNGATRAAADALRRGDVQQASEELAKLADQADQLSPQTRNEIADGLEQAAEQLQDQPEV
FT                   AERLRNNADQLRGNPQNAADALEDLAQLTDQLDNAQADFGNGDQQQGQTSNDPQAGSDQ
FT                   QQGQTGQPETGQPNNNGAGNNSATGSRSSPPADPLGPDLDLPEAPPTGETTAGTGGDIS
FT                   ITLPGGEGTGGGNPESSGGSVPDNINDPANIPAELRDAIQDYFGR"
FT   gene            566338..568341
FT                   /locus_tag="Haur_0487"
FT   CDS_pept        566338..568341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0487"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: pna:Pnap_4499
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03138"
FT                   /db_xref="GOA:A9AV60"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV60"
FT                   /protein_id="ABX03138.1"
FT                   /translation="MTQAHTLDERAINTIRMLSVDGVQAANSGHPGLPMGAAAMAYVLW
FT                   TRHLKHNPANPDWADRDRFVLSAGHGSMLLYSLLHLTGYDLSLDDLKNFRQWHSKTAGH
FT                   PEYGYAAGIETTTGPLGQGFATGVGMAIAARHLAGTFNQPELEIVKHHIYAIVSDGDLE
FT                   EGISAEAASLAGHLKLGELIYLYDDNEISIEGDTSIAFTEDVPARFRAYGWHVQEIDGL
FT                   DPEQVDAALHAAKAVTDQPSLIVAHTVIGFGSPNRAGTAKAHGSPLGPDEVKLTKEALG
FT                   WPLEPTFYIPEEVLAHFRQALDHGAAAEQAWNELLERYTAAHPEKAADFKQRMSGELPA
FT                   GWDSTLPVWPADAKGVATRKSSETALNALAEQIPALIGGSADLAESTFTLIEHAQSFQA
FT                   DTPQGRNMHWGIREHAMVAAVNGMALHGGTIPYGATFLVFSDYCRASIRLAALMGIRTI
FT                   QVFTHDSIGVGEDGPTHQPIEHIPSLRIIPNLNVMRPGDANETSQAWRVAVSHKGPTLL
FT                   ALTRQNLPTLDRTRYASAEGVAQGGYVLADSAGQPELIIIATGSELQHAVAAYEQLSGE
FT                   GVKVRVVSMPSTLLFDAQSVEYRESVLPKAVTKRIAIEAAHPVTWYKYVGTEGDIIGID
FT                   HFGASAPINILMKEFGFTAENLIARAKALLAK"
FT   gene            568414..568863
FT                   /locus_tag="Haur_0488"
FT   CDS_pept        568414..568863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0488"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: rba:RB5998 ribose
FT                   5-phosphate epimerase (pentose phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03139"
FT                   /db_xref="GOA:A9AV61"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV61"
FT                   /protein_id="ABX03139.1"
FT                   /translation="MIMKIAVGTDHGGLILKQAVIEEVQRLGHEVLDFGTDSPASVDYP
FT                   DFAAAVGNAVVSGQAERGIAICGSGVGVTVAANKIKGVRACLCHDTYSAHQGVEHDDLN
FT                   VLCLGGRVIGPALAGEIVQAFLSATFHNEARFTRRLDKVIALENQ"
FT   gene            complement(568929..571535)
FT                   /locus_tag="Haur_0489"
FT   CDS_pept        complement(568929..571535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0489"
FT                   /product="Lysyl endopeptidase"
FT                   /EC_number="3.4.21.50"
FT                   /note="KEGG: sru:SRU_1622 lysyl endopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03140"
FT                   /db_xref="GOA:A9AV62"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV62"
FT                   /protein_id="ABX03140.1"
FT                   /translation="MVRSRWVFALLAITVLLSVIGAKVPFTAAQNQASTSDRPLALAQG
FT                   LKDLNTVAQIAVPELDLAKERADAAKRPSNLPTRFAKDYQTTLDIKQVASIEIVGNRTV
FT                   ARLRIDAPKALSINVGFTSYNLPKSGQLFLYSPDYRSILGPYSAADNEEHGQLWTPIVA
FT                   GDQMVIEYSADSGEFALADLTLSAINRGFSGFGIPRDLLVDKSGSCNVDVVCPEGDDWR
FT                   AEINSVAAYTRNGLDMCSGALINTTANDQKPYFLTANHCGITAENAATVVTYWNYESTL
FT                   CRTVGSAENGTPLPKPNTTMTGATLLANYAASDFALIELDDEVPTEYAPFWSGWNAQSG
FT                   DFPSVVAIHHPGVEEKRISFENQATQTTDYLGTTVPGGGTHIRVIDWDLGTTEGGSSGS
FT                   PLYDPNHRIVGQLHGGYAACGNDRDDWYGRISVSWNGGGSSTSRLKDWLDPTNSGSLVL
FT                   DGTGGTPAFTMNVNPASVAVCAPVSAQTTVNLGWVQGFSEPVTLSASNLPAGATASFTP
FT                   NPVISPTLSSQLTIGNLSTAMAGDYSVVIRGDSTTISRTTDLDLSISGGLPSAAPSLTA
FT                   PANNATNVSETPAFSWSSAAGATNYVLEVASDASFSNLVYTATTELTSLTSAPLSTNTK
FT                   HYWRVRAANACGVSANSSIFSFTTEAAPGDCPIGTETVVAFNETFDSDPSWTHGGTGDT
FT                   WAHGAFGYNGGNGIKAIDPDSTSDQWITTPAISLTEGLTPTLQFWNSQTIEDRNAGGCY
FT                   DGALVEVSTDGGSAWNQIPNSALLTDPYNGAINASTNPLNGSQAWCGDPQDWLKSVVDL
FT                   NAYNGQSVMFRFRLASDDSVGRPDGWKIDNVSVKACVAEAEPEGPSLVFLPAITKN"
FT   sig_peptide     complement(571470..571535)
FT                   /locus_tag="Haur_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.357 at
FT                   residue 22"
FT   gene            complement(571828..572697)
FT                   /locus_tag="Haur_0490"
FT   CDS_pept        complement(571828..572697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0490"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rrs:RoseRS_3934 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03141"
FT                   /db_xref="GOA:A9AV63"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV63"
FT                   /protein_id="ABX03141.1"
FT                   /translation="MRFVTLKTAVGPRPGIVLGDRVMLLDGYQSLQALIEAGDAGLDTI
FT                   KAALPDYQSRAGIQLNMDQLLAPLPRPLKNVFCVGLNYAAHARESLQAKGLEVKMPEHP
FT                   VFFTKPPTAINSPTGEIVIDPAVSERIDWEVELGVVIGKAGKNISHEQAMEHVWGYTVI
FT                   NDVSARDLQMRHQQFFKGKALDGSCPMGPWIITSDELTDPHNLVVRLRVNGEIKQESNT
FT                   NDLIFNIPTLIHVLSQGMTLEPGDIIATGTPAGVGFARTPQEFLRPGDLLETEVEGIGI
FT                   LRNPVVAG"
FT   gene            complement(572792..574024)
FT                   /locus_tag="Haur_0491"
FT   CDS_pept        complement(572792..574024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0491"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: sfu:Sfum_4027 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03142"
FT                   /db_xref="GOA:A9AV64"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV64"
FT                   /protein_id="ABX03142.1"
FT                   /translation="MEFLRRVPLFADLSLEGLQMLDSQARIRALPADAWLFHQRDRGDA
FT                   CYVVVSGTLRLVLEQGSSEETTLGLLGVGAFFGELSLLEPDGTRAAGAIAVVQSEVLEI
FT                   PIAAFETLLHTYPAIAYNMLRRVAAHVRRSDERRLEDLRHKNRLLTDAYTALEQAQAEA
FT                   LRRARAARELELGRELQRRLVPTIFPNLHGVVIAAATFPAYEMSGDFYEVRQLSEHMLS
FT                   IVMADVCDKGAGAALVMAMAKGLLLGMDQRHPLALVERFNQLIRATNLDAAVITMVYSH
FT                   LDIARRRFTYVRAGHDWPLHYRSKQGRVTMLEGGGMPVGITEEAFFEEMHTDLEPGDAL
FT                   VFYTDGLCDARNFAGDTYGRERLISAVQAYGRLPAHGLADAILGDVRAFQSGTPPIDDL
FT                   TLLVVKFNPEA"
FT   gene            574177..575307
FT                   /locus_tag="Haur_0492"
FT   CDS_pept        574177..575307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0492"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: tth:TTC1334 carboxypeptidase G2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03143"
FT                   /db_xref="GOA:A9AV65"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV65"
FT                   /protein_id="ABX03143.1"
FT                   /translation="MPRQLLTYVDACLPDLLDEMRQWIEIESFTRDITAVSWMVNVVGE
FT                   RLSKLGASVRKYNGKPQADHLLASWPGEGEPLLIVGHVDTVYPPGTIDQFPFRIDGDVV
FT                   RGPGVSDMKGCILLTCAALQALRHFSRWTSRPLKFLITTDEEIGSPTSRRYIEEQARGC
FT                   RAALIIESAEEGGWLKTWRKSVSMYDLTITGKPSHAGVAPELGISAIHELSYQIGQILP
FT                   LARPEIGTTINIGKINGGTATNVVAAEAHCTIDVRALKVGEAERVDQALHQLVPHLAGA
FT                   KLTLEGGVNRPAMEQTPATMALYAAAEQIANQLDLPIKASGTGGGSDGNFTSAIGVPTL
FT                   DGLGGWGSDSHSFDEWLSISQFAPRAALLARLIETL"
FT   gene            complement(575668..576774)
FT                   /locus_tag="Haur_0493"
FT   CDS_pept        complement(575668..576774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0493"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   kpn:KPN_01548 putative NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03144"
FT                   /db_xref="GOA:A9AV66"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV66"
FT                   /protein_id="ABX03144.1"
FT                   /translation="MSLFEPYTLPVSGVTLPNRLVLAPMTTYSGTPEGQISPGEVALLQ
FT                   RRAAGGFGTVITAACYVDRAGQAFINQWGCDNDDKLDSLRQAASAIKAEGAIAILQIHD
FT                   GGRMADPKVLIEPAPRSASAVAAERQGSLEPRAMSAAEVEKSIADFVAAAKRAAVAGFD
FT                   GVEIHGANTYLIQQFFSPHSNRRDDEWGGDLERRLRYPITLAKAVREAVGDQFIVGYRF
FT                   SPEEIENPGITIEDTLVLVDRLADCRLDYLHISLWNYAAGSMRNPESTQRLSPLVIEKL
FT                   AGRVPLMAVGSIETPEQAELPLHDGAELVALGRVALWEPDWPNKVKAGRSDLRQALPAK
FT                   DGDVICSLPKPLYELLIQRTGWVKVAAE"
FT   gene            complement(576904..577131)
FT                   /locus_tag="Haur_0494"
FT   CDS_pept        complement(576904..577131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03145"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV67"
FT                   /protein_id="ABX03145.1"
FT                   /translation="MYLAWFDDHPRKELRFKIAEAIFAYEDRFGERPNVVLVNATQIFN
FT                   EDVEGVRVVSRPYVRKDNFWVGIEGLVASS"
FT   gene            complement(577585..577938)
FT                   /locus_tag="Haur_0495"
FT   CDS_pept        complement(577585..577938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03146"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV68"
FT                   /protein_id="ABX03146.1"
FT                   /translation="MNEQEHWQGFITAFNEERFVDGVLQLEELWFPSRNDLYRGLIRLS
FT                   VALNQLRLGIVDSPRQLLASAYDMLAPFETNQHNLDIRRIREYIQDCASLIPADLRTGQ
FT                   GRIDWDLVPRIQL"
FT   gene            complement(577931..578227)
FT                   /locus_tag="Haur_0496"
FT   CDS_pept        complement(577931..578227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0496"
FT                   /product="ADP-ribosylation/crystallin J1"
FT                   /note="KEGG: pin:Ping_2477 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03147"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV69"
FT                   /protein_id="ABX03147.1"
FT                   /translation="MNNNTPASSQICPICNQPVQPMPRYPRYVCVDCRALAVDQHGRQV
FT                   EFFNTGFLGTGCAGSYRDDQSDYPSDQCWINGQRCTAREARFGGIVIEVAAHE"
FT   gene            complement(578205..578699)
FT                   /locus_tag="Haur_0497"
FT   CDS_pept        complement(578205..578699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03148"
FT                   /db_xref="GOA:A9AV70"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV70"
FT                   /protein_id="ABX03148.1"
FT                   /translation="MTEIIAELKSILPIVGMIVGGYLVLLWVASLVWSYRDIASRSNDI
FT                   LVQVLSTSMAFFLPFAGLLLYMLVRPRETLSQKYERELEETFMRRDIEDEHVCPNCQRS
FT                   IQADFILCPHCQTHLRRNCGNCDRVIDMTWQVCPYCAAPANTRINSQPLRQPEYEQQYA
FT                   R"
FT   gene            complement(578865..579575)
FT                   /locus_tag="Haur_0498"
FT   CDS_pept        complement(578865..579575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0498"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: rca:Rcas_3720 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03149"
FT                   /db_xref="GOA:A9AV71"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AV71"
FT                   /protein_id="ABX03149.1"
FT                   /translation="MSLFITFEGPEGSGKSTQARYLKDYLQQAGYPVILTREPGGTPIS
FT                   DAVRRLVLDGQWTAMEPTTETLLFAAARAQLVGEVILPYLKLGGIVLCDRYADSTFAHQ
FT                   GYGLGRNLTELREITRFATGGLQPDLTFFLDLPVEQGLQRKRKQRDDFRESSQLALPLP
FT                   HLPQPSPSQNEHWNRLDAREIAYHERVRSGYLEMIAADPQRWQVFDAGIERESLTEQLL
FT                   LAVQPHLTTIKTLS"
FT   gene            complement(579618..581315)
FT                   /locus_tag="Haur_0499"
FT   CDS_pept        complement(579618..581315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0499"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: AAA ATPase; KEGG: rca:Rcas_3721
FT                   single-stranded nucleic acid binding R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03150"
FT                   /db_xref="GOA:A9AV72"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV72"
FT                   /protein_id="ABX03150.1"
FT                   /translation="MLDRREITHNIDLLLSTLPPRLAEPLATHEQKDQVIEIVMDLGRL
FT                   PEARFRHDQSSFLSETEVSREDLDYVTERIGQFGEDNRAGIQRTLHRISAIRNRSGVVI
FT                   GLTCRVGRAVYGTIEIVRDLVEAGKSILILGKPGTGKTTMLREVARVLADDFLKRVVIV
FT                   DTSNEIAGDGDIPHPGIGRARRMQVARPAEQHNVMIEAVENHMPQVIVIDEIGTELEAQ
FT                   AARTIAERGVQLVGTAHGNTLENLMLNPTLSDLIGGIQAVTLGDEEARRRGTQKTVLER
FT                   KAPPTFDVLVEIQSWDDVTIYQEVASAVDSILQGNEPTAEQRTKDEQGEIVVHEGRPER
FT                   LDSEASTMLTRRGGYRSRERDRDRDHGERDWRRKSERREAQREERERYSLALNGSTSPK
FT                   TEEPSVLVKKPGKNAPAKIFAFGVSRNRLEKALDRLGITASLVREMEQATMVITLKNYY
FT                   RQHPTRLRDAEERGIPVYVLRSNTQTQMEECLGSAFEISISPSDPLSEAMEEVEEAISQ
FT                   VMDGSTESIELSPQSSYVRRLQHQIVERYNLQSESTGKEPRRRIRIFR"
FT   gene            complement(581350..582423)
FT                   /locus_tag="Haur_0500"
FT   CDS_pept        complement(581350..582423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03151"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV73"
FT                   /protein_id="ABX03151.1"
FT                   /translation="MIPVCNVAQRNRAYSSCNGESGLIRPVRLVDSLELRRTPYTYMLL
FT                   GSEHVLAGNHRPLGFALRCLMPFAQDRHTLVYHERGLRGYVQGWYRLNSADADLVYLAS
FT                   QPFRRGMRQPTDPDVWYRLLEAFVVRMGSRNIERIFAPLASNSPHLEVFRQLGFQSYAT
FT                   RQVWRTLTPDVAEGSSIIVLRPQQRRDPHAIQRLYEAITPATVVRYEGRTSRSWQLPVV
FT                   ARHGVRQRSWVLGRDGRDDILRAALHVWLGPHAAVMSLLIDPAEQRLASSVIRFGMSQL
FT                   ANAHQGVVYLLLPEYHGELHHNLEEIGFEHIGDQRLTVKELTVPLRNPLLRPVIEGTRE
FT                   SVVNPSLSSSVQSEPCI"
FT   gene            complement(582810..583178)
FT                   /locus_tag="Haur_0501"
FT   CDS_pept        complement(582810..583178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03152"
FT                   /db_xref="InterPro:IPR028962"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV74"
FT                   /protein_id="ABX03152.1"
FT                   /translation="MEMWHFTARVIAIEQLADENLLILGLADKTDQPAEYLTIQRSFDQ
FT                   DDFEAEASDLDGYCVCLPNGATDYRCIERWELELGHLHIHFNQPAQAVFQLAGVDLSLI
FT                   IDDQQHQQLQQTLNQLLT"
FT   gene            583543..584790
FT                   /locus_tag="Haur_0502"
FT   CDS_pept        583543..584790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0502"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   rca:Rcas_2015 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03153"
FT                   /db_xref="GOA:A9AV75"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV75"
FT                   /protein_id="ABX03153.1"
FT                   /translation="MDEQTQPGMDQSDVLPSTGLNATPQADYSGDDDRALLEEYLRDPA
FT                   HDYRNLKYGDSVDGTIVRVDRDEVLVDIGSKSEGVVPGREMTSLSSEERAELKVGDVLL
FT                   VTVVQTEDAEGRIVLSIDKARQEKSWRALQVNHEAGDVIHAAVTNYNKGGLLVNLSGVR
FT                   GFVPSSQVSSVSRGSDVQKQSDMAKLVGQTLPLKIIEINRSRNRLILSERQAVQEVRDS
FT                   RKDQLLEKLEPGAVRTGRVTSLCDFGAFVDIGGADGLVHLSELSWSRVKHPEEVLKVGD
FT                   AVSVYILSVDEDKKRIALSIKRTQAEPWTTVTDRYQIGQSVSGVVTQLTAFGAFVRLED
FT                   GIEGLIHISEMSDERIQHPRDVINEGDSVSARIIRIDPTRKRIGLSTRSGSAEATAEAT
FT                   AETATEEPSAAAEDEE"
FT   gene            585112..587625
FT                   /locus_tag="Haur_0503"
FT   CDS_pept        585112..587625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0503"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_1731 ATPase AAA-2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03154"
FT                   /db_xref="GOA:A9AV76"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV76"
FT                   /protein_id="ABX03154.1"
FT                   /translation="MGAYDKMSRRAKQVMSFAQEEARAFNHPYIGTEHLLLGLILEGEG
FT                   VAARVLAELGVTITKARNAVEFIVGHGDGPRSTAEIDLTARAKKVFEYAIDEARKLNHT
FT                   YISTEHILLGLVRNAEGVATGVLEIMNVGLDQVRTQVMRMMRQGVGGSSTPSPSAGGER
FT                   QAKQSKTPYLDALSTDLTELAEAGRLDPVVGRKDEIERVIQILSRRTKNNPALIGEPGV
FT                   GKTAIAEGLAQRIVADDVPDSLKGKRLVTLDMGALVAGTKYRGQFEERLKRVVDEIKES
FT                   RCILFIDEFHTIIGAGGAEGTLDAANILKPALSRGELQCIGATTLDEFRKYIEKDAALE
FT                   RRFQPVMVDEPTIEETIEILRGIKTRYEDFHQLQIEDEAITAAAVLSARYVPDRFLPDK
FT                   AIDLIDEASSRVRMYRSATPSALRDALRGLDAIRKEKDAALEEGQFEVVQDLRVREERM
FT                   LQRITDLEDEEEKTRGSEQRKGKPYVTQEDIAEVVAMWTGIPVMRLASEETERLMKMED
FT                   YLHERVIGQEEPISTIARAVRRARAGLKDPKRPIGSFIFLGPTGVGKTLLAKALAEFMF
FT                   GSEDALIKIDMSEFQERFNTSRLVGSPPGYVGYGEGGQLTDAVRRRPYSVVLFDEIEKA
FT                   HPDTFNLLLQVLEDGNLTDGKGRRVDFRNTVIIMTSNVGTEQIRRGSRIGFGGNRNTID
FT                   VEDTRKKVDDELKRMFRPEFLNRIDGTIIFHPLTDIEIRNIARLEVNRVRKQLVDHQID
FT                   LLVTDETLDLLAKRGYDPTYGARPLRRVITNMIEDGLAEGLLQGRFKDGDKIHIELEDN
FT                   EVVLRSEREAAELENPSVEPEAELV"
FT   gene            complement(587689..588492)
FT                   /locus_tag="Haur_0504"
FT   CDS_pept        complement(587689..588492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0504"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: sth:STH698
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03155"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV77"
FT                   /protein_id="ABX03155.1"
FT                   /translation="MKKFGLIIGGVIAIAVIGAIAYTLWLTSDVEVSTSTPVAATLVLP
FT                   TTAPTTAAAPATATTASDNTAAATATTGTEPTTDASQPAAAGAKIYRIDASQSSASYQV
FT                   RETFLQDNKIVDAVGVTKAIAGELLIDTATPANSQVGEIVVDISQLQSDSERRDNAIRR
FT                   EWLESSKYPNAVFKNGVISNLPSDLKEGVEFSFQITGDMTIHDTTNPLTFDVTATLNGD
FT                   TLTGKATTKFNMSSFNVDAPDIGGMLKAEDEVLLTLDLVATAVAQ"
FT   sig_peptide     complement(588427..588492)
FT                   /locus_tag="Haur_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.777 at
FT                   residue 22"
FT   gene            588521..589498
FT                   /locus_tag="Haur_0505"
FT   CDS_pept        588521..589498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0505"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   kra:Krad_0938 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03156"
FT                   /db_xref="GOA:A9AV78"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV78"
FT                   /protein_id="ABX03156.1"
FT                   /translation="MQQLDLLWETGDAAQALQQRFGWDAASASAWVSALLHEHYGLDDI
FT                   QIVRWSISAGNAIIWLKHDQECWIFKISADRDRHRQIEQSVELQHWLSVQQMSVPLIVP
FT                   TTAEQRVLKINERCVYLQRWLDGTPPNPDSSQQLWRIGEETAKLQRILSAYPQAGQLPQ
FT                   VLLPLEQVCMGLAAWLGNTADAAPLQQELAQLAQQGLEHLPSGVCHNDIRAANLLFNGD
FT                   QLQAVLDFEEVGWRCLVLELAWTAVHGLTMYRNWQPCTASQQQAIIAGYQSIRPLTEAE
FT                   LAILPSLCRLQSLYLLCSQGATAADAIQRLKEINFHSISPLNHP"
FT   gene            589697..590830
FT                   /locus_tag="Haur_0506"
FT   CDS_pept        589697..590830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0506"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: ava:Ava_4155 Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03157"
FT                   /db_xref="GOA:A9AV79"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV79"
FT                   /protein_id="ABX03157.1"
FT                   /translation="MDYGFATRAIHAGQDPESVTGAVIVPIYQTSTYAQRGVGDHTGYE
FT                   YSRTDNPTRTALQTCLAALEEAKHALVFASGLGASTTLMLMLKAGDHVICGDDVYGGTY
FT                   RLFQRVMTEHGLSFDFVDMADPEAVRAAIKPNTRLIWLETPTNPLLKLAPIAAITKVAR
FT                   EHGIWTIVDNTFASPYNQRPITLGADMVLHSTTKYIGGHSDVVGGAIMTSNDELYEKLK
FT                   FLQNAAGAVPGPFDCWLVLRGVKTLSIRMREHERNALAIAQFLTEHPAVEKVIYPGLPS
FT                   HPQHNLAREQMRGFGGMISILLKGGAEVANAMVSKTKLFTLAESLGGIESLIEVPAGMT
FT                   HMSVAGSKLEVPANLVRLSVGIEDINDLLRDLEQALA"
FT   gene            590927..593847
FT                   /pseudo
FT                   /locus_tag="Haur_0507"
FT                   /note="chromosome segregation ATPase-like protein"
FT   gene            complement(593894..594229)
FT                   /locus_tag="Haur_0509"
FT   CDS_pept        complement(593894..594229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03158"
FT                   /db_xref="GOA:A9AV80"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV80"
FT                   /protein_id="ABX03158.1"
FT                   /translation="MAQPDYHVPNNPKKPKFEWRFSVILNILNTSFSIMLVVLIFGGAC
FT                   GVDREAICRGISWMALSGSSWLAALLLLYSLMNFTRTLAFMRWFTIGLPLIPILFVAFV
FT                   YLRALFS"
FT   gene            complement(594264..594578)
FT                   /locus_tag="Haur_0510"
FT   CDS_pept        complement(594264..594578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03159"
FT                   /db_xref="GOA:A9AV81"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV81"
FT                   /protein_id="ABX03159.1"
FT                   /translation="MQEPNYHVPNNQPRSTFGIKLLCFFNLASVGLFGYAIIVMLNCSR
FT                   SECNVFSFMGLFIPSLLSSMILLLIGIYRFNQTPKRLRWITLGLPLLPMLGIYIAPFLG
FT                   "
FT   gene            complement(594670..595164)
FT                   /locus_tag="Haur_0511"
FT   CDS_pept        complement(594670..595164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03160"
FT                   /db_xref="GOA:A9AV82"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV82"
FT                   /protein_id="ABX03160.1"
FT                   /translation="MNRQQSDVPKPSLDQLIDDCFGYGIRLGTIIGGIYGFGLGVGFDI
FT                   FVGLVAAIIGLIYGFFMGLIGSPIVAIIIYNWRKWFAANFIGNLGLWLITPIILSSLHC
FT                   LSWYPFFAANYSLSEYIGLFFGRETQLFYFYIFIRYPNWLMSLLMLLFLPLFLDQLDSI
FT                   E"
FT   gene            complement(595249..595722)
FT                   /locus_tag="Haur_0512"
FT   CDS_pept        complement(595249..595722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03161"
FT                   /db_xref="GOA:A9AV83"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV83"
FT                   /protein_id="ABX03161.1"
FT                   /translation="MYHVPNNPNIQSSFASIFDACIQRGPGLGVSIGAIYGYYFTAIYG
FT                   LLVAGIIGGIVGVVGSMILAIVIYCWQQLFQTHNLGLYHLYWFAPLSIVSIYSLVGYSL
FT                   LSQQANLSEYFYQLLANVTVSNQLSRFVTWPSLIIIVTLVIGLPIILEKSQTP"
FT   gene            595893..595968
FT                   /locus_tag="Haur_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            595893..595968
FT                   /locus_tag="Haur_R0007"
FT                   /product="tRNA-Arg"
FT   gene            595994..596085
FT                   /locus_tag="Haur_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            595994..596085
FT                   /locus_tag="Haur_R0008"
FT                   /product="tRNA-Ser"
FT   gene            596146..596221
FT                   /locus_tag="Haur_R0009"
FT                   /note="tRNA-Arg2"
FT   tRNA            596146..596221
FT                   /locus_tag="Haur_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(596256..596888)
FT                   /locus_tag="Haur_0513"
FT   CDS_pept        complement(596256..596888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0513"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: vco:VC0395_0005 PnuC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03162"
FT                   /db_xref="GOA:A9AV84"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV84"
FT                   /protein_id="ABX03162.1"
FT                   /translation="MDLASFFDINTIAFTLFGYPMSYLELAGTIFNLWSVWLVGRGRIS
FT                   NWPIGLIGVVLFFVLFYQIQLYADTFEQVYYFFTGIYGWWHWSKPKEQAAKPRYSSRNY
FT                   NLLALGITVVGTLILAFIIGNLDQWLPAYFPAPATYVLIDSLTTVMSFTATILMAQRRI
FT                   ECWYYWITVDVIAIWLYSVKGTLLVALLYAIFLVLASNGWRLWRKAS"
FT   gene            complement(596897..597901)
FT                   /locus_tag="Haur_0514"
FT   CDS_pept        complement(596897..597901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0514"
FT                   /product="ATPase/kinase involved in NAD metabolism"
FT                   /note="KEGG: hch:HCH_06994 predicted ATPase/kinase involved
FT                   in NAD metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03163"
FT                   /db_xref="GOA:A9AV85"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV85"
FT                   /protein_id="ABX03163.1"
FT                   /translation="MRGLTLGKFAPLHKGHQLMIETALSEVAELQIIIYDSPEQTSVPL
FT                   PVRSAWLRELYPQAQVIEAWDGPSVIGNTREIQQLHEDYVIQQLGISNISHFYSSEFYG
FT                   EHMSQALGAINRQVDPPRNQVPISATQIRSDPYRYREFLHPRVYRDLIMKIVLLGAPST
FT                   GKTTLTATLAETFNTQWMPEYGREYWEQHQSNRRLTPQQLVEIAEGHREREEQRLLESN
FT                   RYLFVDTNALTTYHFALSYHGRAEPRLAQLADQAQQRYDLVLVCDSDIPYDDTWDRSGE
FT                   VQRTIFQKQLFAQLQQRRQPYYLISGPLEQRIAQVQSLLQRHQLYHNLLANPA"
FT   gene            complement(597910..598680)
FT                   /locus_tag="Haur_0515"
FT   CDS_pept        complement(597910..598680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0515"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: eba:ebA2633 putative
FT                   stomatin-like transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03164"
FT                   /db_xref="GOA:A9AV86"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV86"
FT                   /protein_id="ABX03164.1"
FT                   /translation="MGDDVLGLIILLLIIITITAIRFFPASIIYEHERGLLYKHGKFQR
FT                   VLEPGKYRFLRNAYQISKIDVRPSSLSLSGQEMFSADLISVKLNLLANFQIDQPDRWTH
FT                   SHISAQTVVYNELQVALREVIAGYTLDQLLADRSMIAPQILALVQPKANELGASIQTIQ
FT                   IKDFSLPAELKRAALQQAKVQRETAAALEQARGEQAVLRSLANAARMLERNPALMNLRV
FT                   LQALDSNKSNTIVLHVHQSNNDQTIDSEFTQPEV"
FT   gene            complement(598973..600397)
FT                   /locus_tag="Haur_0516"
FT   CDS_pept        complement(598973..600397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0516"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   dre:100000652 hypothetical protein LOC100000652"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03165"
FT                   /db_xref="GOA:A9AV87"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV87"
FT                   /protein_id="ABX03165.1"
FT                   /translation="MERSGRWTIRRVRSAVIATVLSTSVLLGGYAASAKDNKKVEVYPL
FT                   PVVDEKQPGSEQLPPPDKIVGGSAATAGEFPWQARIARNGSLHCGGSLIAPQWVLTAAH
FT                   CVQGFSVSSLSVVMGDHNWTTNEGTEQSRTIAQAVVHPSYNSSTYDNDIALLKLSSAVT
FT                   LNSRVAVIPFATSADSALYNAGVVSTVTGWGALTEGGSSPNVLYKVQVPVVSTATCNAS
FT                   NAYNGQITGNMVCAGYAAGGKDSCQGDSGGPFVAQSSGSWKLSGVVSWGDGCARANKYG
FT                   VYTKVSNYTSWINSYVGTVTPTSTPVPGTPVPTSTPVPGTPVPTSTPVPGGSLQNGGFE
FT                   SSASWVQSPSNIISTTRPRSGSYSAFLGGYNSGTDNIYQSVTVPSNGVLRYYWYMSTQE
FT                   SGSTVYDRLYVRLYNSSGSLITTLRTWSNASTKNTWTLDTISLSAYAGQTVRVQFVGTT
FT                   DSSLTTSFFVDDVTLQ"
FT   sig_peptide     complement(600293..600397)
FT                   /locus_tag="Haur_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.490 at
FT                   residue 35"
FT   gene            600712..602223
FT                   /locus_tag="Haur_0517"
FT   CDS_pept        600712..602223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0517"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   dsy:DSY1026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03166"
FT                   /db_xref="GOA:A9AV88"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV88"
FT                   /protein_id="ABX03166.1"
FT                   /translation="MGRKSKQGTSYLRLLREERGISLTEMVGLVGYTKGYISAVETGVS
FT                   KPTSSFLHAYERALGLDEGSLAASAEQAISQVLTTAQAGLMPEPPKLDPTLLPIANKGA
FT                   VLEGVQSILLQAIAMVTAAAKQSPWPGAEIVVTFQSEHDPLTVFPELAVPWRAALRQAL
FT                   HAGWNVVHLWRLRIENQHRFELIARMLSMLGYRGKYQPYLFPNHVLPGAPADVIIVPGQ
FT                   GALWLFGSRQSRHVDSGFFFPPDSPHYPLISQFATTMRSQTQPLLEVYPERSLDFKALA
FT                   LQFEVEDGAQLLLKEGLSFQSMPIAIRNACIQRILQAPLVRSLQEQTHLEVWCQQLLDH
FT                   HRQRVHLFEQFLQDRQHEARHVVTKTAILRLLSHGELPADDWLRDQPQSQLTVAEALAW
FT                   LRHVIWLLQVYPNYQLAIVDAIDPAYFPVAWKVEGRQTLILESWQAADTEDGRENVNII
FT                   IHDRTIAQSFREHFFNYWERLSNRERNKDCVIDWLQSQVMQPVKL"
FT   gene            602293..603741
FT                   /locus_tag="Haur_0518"
FT   CDS_pept        602293..603741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3198 putative cell surface protein OR
FT                   serine/threonine protein kinase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03167"
FT                   /db_xref="GOA:A9AV89"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV89"
FT                   /protein_id="ABX03167.1"
FT                   /translation="MANQWNPNMSPYRQDRSSCMPVLLIIFVLTLGIGGGIYFFVNNVM
FT                   SDAFESSITQVSSQMETAVVGSSANEPAIAGSVLYSSTQLAYDRNGDERNELLVQLSNN
FT                   SQYSMALLDGADGKPIWQTELGSESYELIALDQYVAVIKERDFRLFNSQDGTFGWQTRL
FT                   TDRLQSSPPMLFIADDLLVIQTYDNILTAYELKTGSQRWQKPLEASYASDLVRLGDELC
FT                   GTERDAESLEFVVCYALKTGEQRQAIQLNNDWTEQVEWIADPLSNDGILRLQSDPEPIT
FT                   LSAIGLDQQQRWSVELDEAFYYSFRGSEQRFANSSDHIAIGAEQHIAIITAERKVVMYS
FT                   LTDYALTPLGFDNDVLYVSAVKQRGTNTVSILAINAQTAELIWRLDDLGESHEWSGSGK
FT                   IQGVVVPGEGMIFGWLDPEIDDLVRVQLLKRQDGTVGWSFQQQMFIGQVPVLTRTGNAL
FT                   LIQTSDGLTMTNLRTGESLWTLTR"
FT   gene            complement(603787..604572)
FT                   /locus_tag="Haur_0519"
FT   CDS_pept        complement(603787..604572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03168"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV90"
FT                   /protein_id="ABX03168.1"
FT                   /translation="MSELRGFSLSQEELFVCLIVADLPLPLGFDDLANQVFGDLPEQYQ
FT                   QYLLGAAERSLIAHGLLELTDDQPVLEPMVAEWLSIISQPSQTWVILHQPAGQKQQANY
FT                   IHHAKQQYLFHRGQGGIHQLIALPHTREIVQAALDIIEPAEVEVAETLTGSLSEAVFRS
FT                   IASMRTIKREQVVEQLQAGGLTANVAEAFGQSFEQLRSISALALLQNKPESSVQQAFTL
FT                   VCGEQQQWLLVPEAEGSLYVRNLDLNALVQVLHNFAHPQ"
FT   gene            604739..606220
FT                   /locus_tag="Haur_0520"
FT   CDS_pept        604739..606220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0520"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: sth:STH1564 putative
FT                   4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03169"
FT                   /db_xref="GOA:A9AV91"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV91"
FT                   /protein_id="ABX03169.1"
FT                   /translation="MSTKIPTTFGDLREWIAFLEKRGELKRIKTPVSADLEITEITDRV
FT                   SKMKQGQGNVALLFENVIGSDLPVLINGVGTEQRMAWALGLEKLDDLRARLASVVKPEV
FT                   PEGVFDKLKKVSELSEIVRYRPKTVASAPCQDIVWTGDQIDLNKLPILKCWPDDGGRYV
FT                   TLTTVISRDPYKGIRNVGMYRVQVYDEKTVGMHWQIHKGGTEHQREALRKGGVKLPVAV
FT                   AIGGDYATIYSGSAPLPPGIDEIMLAGWLRRERVEMVKCKTIDLEVPANAEIILEGYVD
FT                   PSESRLEGPFGDHTGYYSLADQYPVMHLTAITMRKDAIYPTTIVGYPPQEDYWLGKATE
FT                   RLFLPLMQLVVPEVIDVNMPAEGTFHNLLVVSIKKKYPGQVRKVMYGLWGLMLMSLTKF
FT                   IIVVDEDIDVQDMNQVLFHVTSNVDPQRDTVIVEGPLDALDHSADHFAYGHKMGIDATR
FT                   KRQDIDRFPREWPQDIRMTQSIVDRVTKRWREYGF"
FT   gene            606393..607205
FT                   /locus_tag="Haur_0521"
FT   CDS_pept        606393..607205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03170"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV92"
FT                   /protein_id="ABX03170.1"
FT                   /translation="MNSHTQYLTLVATVATTQAWNLTPEQHQHIATLLAHYSQHATNAP
FT                   LTDITINLWHDYATVQAALDPLHPEHEAVCHQVYQYILHCLKQRHVLGVDDLYLDDRSP
FT                   DVCAYADVIQKLGQFRFEARLSTYIYQITRRAVLQWRRATNALKRGGMGFNQQPNDATS
FT                   RSIQQIVYLSQSHLEQDSLVAPDPSVDDLVVLRQLKREVLKVVVTMDDDPLYAVAQRLW
FT                   NELLFEQTNISALAQAEGLTVNELFNLRARLGRRCRGVVESWREGFGE"
FT   gene            607326..608513
FT                   /locus_tag="Haur_0522"
FT   CDS_pept        607326..608513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0522"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rca:Rcas_3206 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03171"
FT                   /db_xref="GOA:A9AV93"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV93"
FT                   /protein_id="ABX03171.1"
FT                   /translation="MSNEREPVLLSAARTPIGKFGGSLADLTAPQLGAIAIKAALERAG
FT                   INGDVVDEVIMGNVVGAGLGQAPARQAALGAGVPDSVSALTINKVCGSGLKAVMLAASM
FT                   IKAGDAELIVAGGMENMSRAPYLLPQARFGYRLGNGEIQDAVVHDGLWCAVEHHHMGNS
FT                   AEWVADACNVSREMQDEFAYNSHRKAAAAIARGAFKNEIVPVELKSRKGTTIFDTDEPV
FT                   RADSTVEALAKLKPAFKADGSVTAGNAPGITDGASALVVASMAKAQQLGAKPLARITGY
FT                   AQAGVKPLEIFTAPAFAVRRLLEVTNTSLADYDLYEFNEAFAAQALANGHDLKIDWDRL
FT                   NVNGGAVALGHPIGASGARVLTTLVYALQERGGKRGLATLCLGGGEAVALAIELI"
FT   gene            608884..608958
FT                   /locus_tag="Haur_R0010"
FT                   /note="tRNA-Lys1"
FT   tRNA            608884..608958
FT                   /locus_tag="Haur_R0010"
FT                   /product="tRNA-Lys"
FT   gene            complement(608993..610381)
FT                   /pseudo
FT                   /locus_tag="Haur_0523"
FT   gene            complement(610763..611473)
FT                   /locus_tag="Haur_0524"
FT   CDS_pept        complement(610763..611473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0524"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: rca:Rcas_3988 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03172"
FT                   /db_xref="GOA:A9AV94"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV94"
FT                   /protein_id="ABX03172.1"
FT                   /translation="MTNAVWEREETITCERCQDSGVLGYRYSDDKTRKAIEYIPCDCRK
FT                   PTILQKHGDLSLVAKKTFETFVSLPQVAPLAQACMDYASDPKGWLLLSGPYGCGKSHLA
FT                   AAIAHAVVASGKSAMFFVVPDLFDALRETFDGQQGESFQQRFDRIRNVPLLVLDDAGTE
FT                   HLTSWAKEKHFQLINHRYNRELPTVFTTNEDLKRFDGRIASRLADVALVEHLDFTGIAD
FT                   YRRLNLAKRRGKAA"
FT   gene            complement(611470..612483)
FT                   /locus_tag="Haur_0525"
FT   CDS_pept        complement(611470..612483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03173"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV95"
FT                   /protein_id="ABX03173.1"
FT                   /translation="MNSGMPSRAGVSNRVCCTLFVNLWRNVQPILLMMESRRCMAPQSD
FT                   RIQVRWRNGWTAIPHTILRDSRLSRSARLLWGILASYAGNEEAAWPQQKDLAQACAEDD
FT                   KVPHIRTIQRWLKELETYGWLASIQTRHGNIYELFESQQRDTSVEETTPVSCQTRHQDR
FT                   VRGDTSVVSEATPVSHGLINKNQLIRNNNNTPAAQPKKPTDTETYRLLRDRQVWTAKKH
FT                   AHEPLEIIQAYLDHVGPNYPAAQIALDLKAGVHHRLTPEPEPSPPHTEPANDDRRPAWI
FT                   GLDQWQGLTSNQRDALQYAQLVNGRIQAQYDDWTEMIYKRWGPLANRLVEAAGGTQ"
FT   gene            complement(612597..612938)
FT                   /locus_tag="Haur_0526"
FT   CDS_pept        complement(612597..612938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03174"
FT                   /db_xref="GOA:A9AV96"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV96"
FT                   /protein_id="ABX03174.1"
FT                   /translation="MLYTILTAIIAGLACAVLMVAIHGLLWHRHWRLSRPQAYTVGTAC
FT                   IGIVLTIWALLLNQPATIIGFWAIAGLAGSADLVAWWIRSRLQRIETEAEAAGFIRGQI
FT                   VGLDNDGQN"
FT   sig_peptide     complement(612864..612938)
FT                   /locus_tag="Haur_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.361 at
FT                   residue 25"
FT   gene            613341..613763
FT                   /locus_tag="Haur_0527"
FT   CDS_pept        613341..613763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0527"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03175"
FT                   /db_xref="GOA:A9AV97"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV97"
FT                   /protein_id="ABX03175.1"
FT                   /translation="MSMIATGAYLWTLREAIGLSRDDVAHEAGTNNVQIMRIEKGEIDT
FT                   RGSLLLSVVRAVKGNAEHIAQLLLDASATEEDGRNLAISWINRETTSAIDEFIADVKKD
FT                   NKVSEALKLIQQLEALDPSSLDRLLGYGQSLLDRNR"
FT   gene            614213..615277
FT                   /locus_tag="Haur_0528"
FT   CDS_pept        614213..615277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0528"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: kpn:KPN_04707 putative site-specific DNA
FT                   methylas; TIGRFAM: DNA-cytosine methyltransferase; PFAM:
FT                   C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03176"
FT                   /db_xref="GOA:A9AV98"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV98"
FT                   /protein_id="ABX03176.1"
FT                   /translation="MVGAVIDLFCGVGGLTHGLILEGFGVLAGIDNDPSCKYAYEQNNR
FT                   TRFIEKSITEVDGRELNALYPNNQHKILVGCAPCQDFSQYTKKSRTGTKWQLLTEFSRL
FT                   IREIEPDIISMENVPEVRTFNRGEVFNNFIQALEQLGYHVSHSVVHCPDYGIPQQRDRL
FT                   VLFAAKQGVIKIIPPTHTPENYRTVREVIGSLPPITAGGHWEGDSMHAASRLEDINLRR
FT                   IQHSVPGGTWADWPEELIAECHKKESGESYGSVYGRMEWDKVAPTITTQCNGYGNGRFG
FT                   HPEQDRAISLREAALLQTFPRSYQFAPEGQLKFKTVSRQIGNAVPVALGRVIAKSIKRF
FT                   LEGLHERQRVRIII"
FT   gene            615246..617075
FT                   /locus_tag="Haur_0529"
FT   CDS_pept        615246..617075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03177"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AV99"
FT                   /protein_id="ABX03177.1"
FT                   /translation="MSDSGYELSFSLNTLNHLSEGLYSNIPAVLSELVANAWDADATEV
FT                   SINIRQDEIVIQDNGIGMSIEDANTKFLRIGHQKREDSANTISGRHVMGRKGIGILAIF
FT                   GIANIAEVYSCKDGVPHGFIIRKGDIERGISSDVTLYRPSPVPQDDLSIESGTKIILRE
FT                   IKSSIVNAEKTLRTDLARRFTIINNNCNFSVIINNIPISDNDRDYLNKVQFLWYLGEES
FT                   SKYADFFTKLKKSFEITNLVDGMSGITVKGWIGTVYRPSNIPTSHRTISIFAHGKMIQE
FT                   DILIDITDAGVYRQYIIGEIEADFMDSDDEDDIITSNRQRIKQTDPRYLKLLQYVKADI
FT                   MRVIASMWTNLRKEYPSKPKKEEVNDSSSSKDANSSEQENTNASSDSSNTTDASSDSSN
FT                   TTDASSETNDGDVEDNSFFDDDIPEPSPPPKQEITTAFREMKNLVKNSNIPDQMKNIIL
FT                   YDIQQAAYAYKGTSFKACIVMLGAILEGVMLGTIQRTDVLEYLITLQTVPKPLSDLGPR
FT                   NPKFADRTVLAQYIGTTFSFQDCKEIIELCVQGTNKLGVDILQTVRNSIHPGSVLKDMK
FT                   QLARFNHQSAVGYIAKLHEIINLVILWNPPSIP"
FT   gene            617437..618519
FT                   /locus_tag="Haur_0530"
FT   CDS_pept        617437..618519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03178"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA0"
FT                   /protein_id="ABX03178.1"
FT                   /translation="MSYPQPSMPPYMQPVPPNKPGWRKNIKWIAIGSVVFVCSCLGLAY
FT                   NQGSKLQAEQTATAIVVANVTATAQQSNTNATSEAVAIAATVEQDNANATKEAIAIAAT
FT                   QTEEARPTNTPVPTNTPLPPTATPFVAEIGQSNPIGQWEITILDISIANDFSEAATGKW
FT                   LVVHGTITNKGDDHLIGKQELKVRTDTKTIELDRNASNQAAKRLNVTSIGDLGGKMIKR
FT                   GEREEWAIAFDIPQDSNELWFTLEGTDAVKFGAIGETAELPTVTPRPTATAVPDLATEA
FT                   GAIDVCKQAVKQRLTHPSTADFPWFDYQTVQEGDLTWYVQSTVKAKNSFNLEVEFVWVC
FT                   KVTYEGNSRWNIDDVQMAEQ"
FT   gene            618720..619586
FT                   /locus_tag="Haur_0531"
FT   CDS_pept        618720..619586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0531"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03179"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA1"
FT                   /protein_id="ABX03179.1"
FT                   /translation="MQPQETTRRELTTLSHAAVGITLWLEHNNHGWSAFLSTPKMTIQH
FT                   IGSRYYEFFVDELIQHAINYADEVAEEFNPTPAAPAAPLKPAKKKPTRKQPKQPVCYCQ
FT                   CCSPTQGATGVTYCLKDKEYVAHNGGELIGYFPTSDAASSKLNKLRYEILSREFPEQPA
FT                   HKFFEPLEDELTREPAASSASAIPQAPSYFVIGQLVGQLRQLYAGKKVQLNAINKAFSE
FT                   LAVPGWSWDGSSLTIRSRSNPSILYHVNGDTCQCTAFAKGATCWHRAAYKILLQAAAAP
FT                   NHYQKAA"
FT   gene            620290..620706
FT                   /locus_tag="Haur_0532"
FT   CDS_pept        620290..620706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03180"
FT                   /db_xref="GOA:A9AVA2"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA2"
FT                   /protein_id="ABX03180.1"
FT                   /translation="MLIPIDNIPIFKSIIKIALIEDMEPAMIESLIPMLGIVASAIAIA
FT                   LLTKHPKQQLISSASAVVFWFAVWCVLVGPEYLLFVAYLVWLVVLAVVIVMAINMARAL
FT                   LRTFQKEAHKRPEPTTHYPPITQGDIDQGINQIR"
FT   gene            620755..621171
FT                   /locus_tag="Haur_0533"
FT   CDS_pept        620755..621171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03181"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA3"
FT                   /protein_id="ABX03181.1"
FT                   /translation="MEVEVTVKGIIVFDEAGVYGEYEEVEIETKAVWIPGFGLLVNANI
FT                   GIGGHYPLLHCAGFDSTTHAEAVRTAVAYSDAVIHHLTKHEAMVKTIDTYMSAKKAFYA
FT                   QGGTNAKLEGAFLDSQEPLDQVWATFTFTPEAYE"
FT   gene            621406..621636
FT                   /locus_tag="Haur_0534"
FT   CDS_pept        621406..621636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03182"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA4"
FT                   /protein_id="ABX03182.1"
FT                   /translation="MAAWIYTADGEFESLAEAIEAYKERVRKQEQEEHRAALQAAQHDP
FT                   GVQSWIELANNEAALQSVAKHILPIKPITTA"
FT   gene            621672..622127
FT                   /locus_tag="Haur_0535"
FT   CDS_pept        621672..622127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03183"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA5"
FT                   /protein_id="ABX03183.1"
FT                   /translation="MTQPFTTIKPKLEAPFPMDIIEIKPTVVTKDKTRALAIAYAEVRA
FT                   YQDRLDAVVGGEWAVTYRPLGPGAVICQLTLVGITREDVGEAEQTDPNKATVAVAQAFK
FT                   RACSAFGLGRYLYSMPKVWAEYDQEKKCFVYPDRIIAHMYKQIGIKV"
FT   gene            622407..622802
FT                   /locus_tag="Haur_0536"
FT   CDS_pept        622407..622802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03184"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA6"
FT                   /protein_id="ABX03184.1"
FT                   /translation="MEIDAIRSHLATTYPSVTSAIITKGKRTIEGEEYETIEFVKKVGT
FT                   KGLDLVAALEEIPPAWDLFDLFSTKPPVPIEKLLAGGLTFGEAMLMNLDTELSKRFEKK
FT                   YNREESALCLHLAELPASADQDLPLGW"
FT   gene            622814..623740
FT                   /locus_tag="Haur_0537"
FT   CDS_pept        622814..623740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03185"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA7"
FT                   /protein_id="ABX03185.1"
FT                   /translation="MTPAGFSDETIIKEWNDVLHGVRLMQRYDPSYYEQIRDEPLTLVK
FT                   GKSCFIRMAYLVEDLVSTTMNFQDYMEWRQEDFDPYDDADDIANDDPALSESYSLDLRF
FT                   EIAGQWLDETPLAVFGLPIHAGEAGDMFHLAMWLTRYPFHTTPYDVMRFDGDRYFVKDK
FT                   EIFQALKTFDPLPEHIHIHGLIQELNRKKIYGFELGTLIQYALRITGDVFADVSMAELE
FT                   VGGWDDGIDWANPDMVASVQDRQRRADALCSQFHDFAAWLDRNNEYAIDILLNIYGAAA
FT                   VVLANDTQRPATLMELVNANDEVPQTI"
FT   gene            623751..624389
FT                   /locus_tag="Haur_0538"
FT   CDS_pept        623751..624389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_C0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03186"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA8"
FT                   /protein_id="ABX03186.1"
FT                   /translation="MFDKSPKLQLDFFDNAVIMTRREPSGWSSYPVDVSEVAKVLSGIP
FT                   QSSGLLPQNTLGYGSYKGSSFYCMYIPPKSITIELANNDRLTIPIPPLVWRGWKQNYQI
FT                   WALATEAYPLASTPLFMAPFPNVYPNAMICWGDSDDRLPAGPSTMQAMLDLFLIGSRFN
FT                   THLVGGKSMRSSGNIINLYHRIKGKAMYPLHDLCATDLVLENVLEGGFA"
FT   gene            624386..625039
FT                   /locus_tag="Haur_0539"
FT   CDS_pept        624386..625039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03187"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVA9"
FT                   /protein_id="ABX03187.1"
FT                   /translation="MIPNLHRYHIVTEAEPYPPNQPGLTWLIAANGIFKSGCDRHQRLI
FT                   IQVSEQRIDLPGMVAIMPMIHWFNYPKRLPSAWLSMLLADAQKASIITNGVARPIEKQY
FT                   FVVNKDDRLKLIIAPQQASALRVHYQMPSAPIFVDIHSHHGMPAYFSATDDADDTGLSI
FT                   SCVIGNIYSNPEIICRLNIYGQHQVVPITTIFDGCGPFADVGQREGDRYANAQF"
FT   gene            625020..625898
FT                   /locus_tag="Haur_0540"
FT   CDS_pept        625020..625898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0540"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   ava:Ava_C0069 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03188"
FT                   /db_xref="GOA:A9AVB0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022500"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB0"
FT                   /protein_id="ABX03188.1"
FT                   /translation="MQMLSFEPIAPFVIGNQSRFHITIVGAGGTGSYIVQTVARLMAHA
FT                   NEKGSPKIDVTLVDGDTIEAKNIGRQLFAPAEIGRNKAQSLATRFNQALGLKIQAIPTM
FT                   IDQYSLPHVDRYQWHQSAALDKRPYSIVVGAVDNAEARKVIHDGLAKYVFNLWIDSGNH
FT                   EHGGQVLVGNCVAPHKLKGSFALEGMVQSLPAPSLMAPSLITPPEPLPESQQLDCATAM
FT                   ENNRQSLLINQQMASIVGQYLHQIIFTQRLTTFETIVDMSTLTMRSTPITVSNVAQCLG
FT                   VTSAFLKGINA"
FT   gene            625895..626815
FT                   /locus_tag="Haur_0541"
FT   CDS_pept        625895..626815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2661 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03189"
FT                   /db_xref="InterPro:IPR021451"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB1"
FT                   /protein_id="ABX03189.1"
FT                   /translation="MTTQLTLFDYNALDTETRVIVQQKAVEIRDRMRSAAQAVIEIGER
FT                   LIDVKERLGHGKFGQWLDAEFQWSADTARNYMNVAERFGQNPKISEFAPSALYLLAAPS
FT                   TPEDARTEAINLAEQGQKITHAVAKQIVTTHKEQAAPKPKPAAAPAVPKPEPKLEIPPM
FT                   LIIGDKTVPSAEFTGTPTPNTIDDSESEELASQPLVETPSEQPDLPPMLTIGQPSPAAA
FT                   VEIDTKPLAYAIVVQELARQMVTLANQRVKLLEDQIEAQGKEVIQPFIDTEQMAEAAAS
FT                   FIGTPAFKSQAGLLAFGVKVNLRDF"
FT   gene            626851..628089
FT                   /locus_tag="Haur_0542"
FT   CDS_pept        626851..628089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03190"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB2"
FT                   /protein_id="ABX03190.1"
FT                   /translation="MTFVLGFKRFTYLGISMMQPLTNISKAVDRIIESLPQLQPVLEST
FT                   TYRLGDDSIIIRNKYPEYRNQLKLHKDLLSNIILEELDNKEFNFIIDESDINFIEFDRI
FT                   SSKRSVSKNINHNFNIENNINLNFYTSQSIDVIDSGISQYLDDFKKRMVWPHYKIIRKK
FT                   ENSSKIVYEISFISIGELGFITDMTGKIYLRKIGGGGFNIKYINPFHIKDNIDKLVEFH
FT                   LEEFDKIKKWHNFEIDILESSIDSSRNIIVISREIFEYIEYSLKEDEIIEDNDLYRINR
FT                   NNEYYVNLDRIKELSKIQSKDFDITKLVKLCLELNISFSNECYFAAIFILRAIIDHIPP
FT                   IFGHINFDNVVSNYKGNSGKKILNHLLVTLKNTAHINIHKPISRKEIIPNRQQVDFKSE
FT                   IDFLLSEIIQELS"
FT   gene            628574..629512
FT                   /locus_tag="Haur_0543"
FT   CDS_pept        628574..629512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03191"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB3"
FT                   /protein_id="ABX03191.1"
FT                   /translation="MASSLAIGLNPIELHILLLVARLGRLLSRHLRTAWGHPFTVTIQT
FT                   VNRTLAKLVDAKLLTYCEHFQSHGYDPRGALGWTRHGRLYSLTPLGWEIVKQAFPMLEE
FT                   GSERLAPTMFNPQHQAEHQIEYAEVITSLIQSLPYVPGIVGMSSYIEMDLGPTARPRAD
FT                   GIVVVRRWADATQTDRERSSLYPWLGVSQQAGQIDQLYAIEIDRGTEELSIITGKAHSY
FT                   GELYRSKYWEGRYQWPLIAFTVPSERRKRAVLDAWEIGWPGSQLLIATIDEVRESGILT
FT                   PIWTTQYTKDGQRIQQPHRFLKVKWFEKIVA"
FT   gene            630304..633585
FT                   /locus_tag="Haur_0544"
FT   CDS_pept        630304..633585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu0233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03192"
FT                   /db_xref="GOA:A9AVB4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB4"
FT                   /protein_id="ABX03192.1"
FT                   /translation="MYAQRVANFVQEYQRYINNSANEEELRSGFYLAATNALGIPNFTL
FT                   ERGRQDIRRNRVILEFKNKGLFRGQSTSLKFKEAQDQLINRYIPQQSLRDGRRPSDYIG
FT                   VCFDGEHLAFTFVEPDQTVRVTKLLPFDEHSAGALVMALDVDDRRELTPQNVIDDFGPS
FT                   SFIARQTLQALWHHLNVSLDMGVKRIHMLFTEWKSLFQQGTSIGTRGRQKLQAYLQSVG
FT                   LPESADITRLLFVLHTYHALFFKLLAAEVVLTNAIIPGMTQTDFCFSTAGLPDRSLIKL
FT                   LVDDIEESKVFRRVNILNFVEGTFFTWYTHEAPAGLIEAIRQIMQRLNLYRLSDLQLER
FT                   TRDIVKYVYEQIVPEPLRHSLGEYFTPEWLVEFTLDRVGYQGSQILDQKILDPCCGSGN
FT                   FLIHAIERYKQAAHAQGWDDSAILHGITNHIFGFDLNPLAMLTARVNYLIAISDLLKTS
FT                   SAVEIPVYQADAVYIPKPRPDDPTIYRYDISTRLTGCPILALDIPVSLIHKQHLFARVL
FT                   EEMEESINEHQHTSAFITHLKRNPEFCRVEDHLDWIPYLEKMFNDIQFLESRSWNRIWC
FT                   RIARNYFASVAIGSCDIVAGNPPWVRWSELPQLYAEKIKPICDEYGIFSDERFFGGNEL
FT                   DISGMITYTVIDQWLDEGGKLAFILPQNHLQSQSSGGFRQFQIRETPLEVLQVDDFSEV
FT                   KPFRRVGNRPAVITIYKGRATTYPVPYNIWKRITPTTISENVSYATAAENLLSIPHEAY
FT                   ALEDAGKRWSILPLGRFPLLSMLNGEDRSIEGRKGIVTDLNGAYFIRILGHGYRTGTLR
FT                   FKTSPDQGQKPVPERTYEIEADLVYPLIKGAKNVQPFYATTSELAVIVPNKGINSSSMP
FT                   SMSRLTYQGYPLAARYFQSLNRDVLIDGVGLLDQRSTWRTRMRPFLEKQYADNLADIPF
FT                   YAIYNVGDYTFAPYKVVWAEMSGSLKAAVISDGLVPYIEQRKIIIPDHKIYFASFSSEK
FT                   YAHFICALLNSSIIREFVDSFTIKLQVGTIFKHLRLPKFDLENAEHLSLVDLSITAHNT
FT                   MNKTNGSGNIEAFIEQIDIIAVRLLAKFAATITDQLQQEGFNLEF"
FT   gene            complement(633661..635367)
FT                   /locus_tag="Haur_0545"
FT   CDS_pept        complement(633661..635367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0545"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: cch:Cag_0325
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03193"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVB5"
FT                   /protein_id="ABX03193.1"
FT                   /translation="MGNTYIESETAPIGDFINKVEALKVPVFQRSFAWTEDEIKLLWDD
FT                   ITAIIELPQPEYFLGSMVFKKKDGYYEIIDGQQRITAIYIILSCIRNIYRINSDTQRNE
FT                   WFNREYFGKIDINTLTINSKFQMNEINNPFFQKYIVSESNIEEIEENIKNLPKKDTNHL
FT                   LGKAIKQIYSLLIERQKEFSGTEFSSDALLSIHNIIQKHIYVLILKVSDEADAYTIFET
FT                   LNDRGLGLTTMELLKNHIFEKSGMYLPSVQNEWSILRDNLLHSDPSDRFIHHYWTSIHG
FT                   RTSKPQLFRLMRKQVNTPIQAVEFARSLRTSARLYAAFGNPNDDYWNDHEKQTRDNLEV
FT                   LDILDAQQVMPVLLAAVQKFNPTEFRKLTYALVVMAVRYNLIGELRTGVISNYYSDIPK
FT                   KIHSGELNKSIKVCREFRSIYPTDEEFEEAFSTKVLSDAKKSRYLLIELEKNFNGGSSQ
FT                   VSNDPRKVNLEHILPQNPSNEWIDTITQAGDDLRKYIYKLGNQALVSTTPNKKSGAKGF
FT                   IYKNTNLYSKETQIYYTHMLTQYSTWLPADIIRRQKELAKQAVKTWRIEFS"
FT   gene            complement(635451..637577)
FT                   /locus_tag="Haur_0546"
FT   CDS_pept        complement(635451..637577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0546"
FT                   /product="ATP-dependent endonuclease of the OLD
FT                   family-like"
FT                   /note="KEGG: tko:TK0773 predicted ATP-dependent
FT                   endonuclease, OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03194"
FT                   /db_xref="GOA:A9AVV6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVV6"
FT                   /protein_id="ABX03194.1"
FT                   /translation="MKITDVIIKNFRSIEHAQLNGCGDINVLIGKNNAGKSNILLAITT
FT                   FFEFMERGKLFTFIEDSKDTINFFNNSEDSIIEISIKFNISQSDIDNLKIYKPENNTKN
FT                   TYTKLSITIVNLLDKKSKVNAKILKNITLEGDKSNHELLDIINNNLSNLVQYHIILNYI
FT                   SSETLILNEIKEKNKSGFEQAISMLNNIIKSNNREHFNDIKKGAKNQELLDNLIEERIK
FT                   SNNNDELSVIEGILNTTKHSNIDLEKLILSLKEIVQRISNHFHHIKERRPELDINDANV
FT                   FLELKKKKASKATLQRIQTIANMVLGITIDAFVEDDNSDPVLDVDNFLIQVNGYGVKEA
FT                   LRIIFDYEIHRPKVVLIEEPELHLHPSLEMNLMRYLKEISAECQIFMTTHSTNFIDTGD
FT                   VKNVYLVSKNESTTVRALNTEEAASLIPQELGLRLSSLFMYDKLIFVEGKLDEEILRTW
FT                   TATLGVNLSQHNIGFVTMEGVFNQTYYAAEATLDFLSKKQIQTWFLIDRDERDQQQIDR
FT                   IKQPLSGKSNVRVLNKREIENYLFVPRAIAQFLRDKGQISGLQATTEGITEEMIQQQIT
FT                   TCVETCKQQVIEKRIAARLPALRFDREVLFPKKPKAGDLVSRSIQELDRLTALLSDAKA
FT                   QFPAIAQEEASAIEARWPTEKMNLVQGDVLLDAVFRVYGLRFNKSRDGAALAALMTDEE
FT                   IDQEIKAFFKTITQ"
FT   gene            complement(637897..639582)
FT                   /locus_tag="Haur_0547"
FT   CDS_pept        complement(637897..639582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03195"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVV7"
FT                   /protein_id="ABX03195.1"
FT                   /translation="MSMQYAISLYDPFTNVQLARFDRQVTDATLSTNGLTVSVRLVPFI
FT                   AKTLYAQARLLTAVVQRSDGKTLRYRTVTLRLIDQGLAIECHNLIVTLDDLEYDGWWSV
FT                   TKLDGWLPVETASSTPERWEMRHDDGTISLSPRKNEQFSNAKGIGRQSLFIPANLNTTG
FT                   FQVIQFDWRSKGPTNWLATFLAAERDYSSQTGATTIALGNGTAQTGSLCFTFAARPLVS
FT                   VAMYYNAALATYIGETGDDYLKISNLRVATVTTNMVNTTTSGAIAIGTAFVPVASTLNI
FT                   AVGQRLTIESGGVNSESVVVLAVNATQFQAAFTKTHVLGVTVRGIVVTDKEIVEDVLSR
FT                   NLTTNPGSGIKQSSARIIKSSRDCLEAAWSAASGLSVVQELADQAQYVTYVDDAQYLYY
FT                   GPKETGRTFALVDGSIELEKALGEATNQIRVAYKNASNQPLYTAFAEHASERYALGIVR
FT                   QRTIASETTDSTEAATLRSVALTDAAPTVRASLNVRAVRNEYNVREPLDLLSRGDVITI
FT                   GDLSGAINKRSYTLAETSVNLMTGEVSVTPEAPIKQLDLWLAQA"
FT   gene            complement(639592..640968)
FT                   /locus_tag="Haur_0548"
FT   CDS_pept        complement(639592..640968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03196"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVV8"
FT                   /protein_id="ABX03196.1"
FT                   /translation="MTTMQLLRNGSVVIDFMPAGVNPTEGTTCYWLVDGSWQPQVPQRD
FT                   RRLISNGEQFQPSVQSFAVNIFGGTNEDQAWAAYHALMVLLDDAERFYEEGYSSAVVWR
FT                   TKPSDNTVHSDMLVMGRAGDTPMVGTSPTLIQDNDVWWILNVPVMFLCRPLRCATASTN
FT                   SSTSASANIANIHQPNFSGSAAPLESPTNLTLNVAAATNGTTINGLIAVAPRGKMVKSA
FT                   AWLFAPSPTQFGWSRQIQASGVYATDNLLCFYNFPSVTPSYSPNGVLTDIGPLNSRSII
FT                   QWAMLKTTAPFLITPVVRSNGALIEGRATLVDSATPIIVPLGQTSAPYLITGHQLKLTN
FT                   LTNAGAIYINAILTIAADAGGWSVIPFASLPLPSTATTITVDARYLSNPDASLTWTNAG
FT                   VTQAVPTDSNPLALTKDLQLDVNLFAVNGNAWSATTENAASARTMTVQASRLNGAIIPL
FT                   "
FT   gene            complement(641054..645097)
FT                   /locus_tag="Haur_0549"
FT   CDS_pept        complement(641054..645097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0549"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: cbf:CLI_1889 phage tail tape measure protein,
FT                   TP901 family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03197"
FT                   /db_xref="GOA:A9AVV9"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVV9"
FT                   /protein_id="ABX03197.1"
FT                   /translation="MADEELGRAIIKIGADDAELDRSISNAETKAKGFAQSLAESLSTA
FT                   LTTAIAGAVAAAGAALAGLAVTGVNAFAGFQQQMNSVFTLLPGISQQAMQQMGEQVKDF
FT                   AVEFGALPEKVIPALYEALSSGVPKDNVFSFLETAQKAAIGGVTDTQTTVDGLTSVVNA
FT                   YGADVLSVQDASDQMFTAVAYGKTTFAELASTLYNVNPIAASLGVSFSDVSAAIAAMTS
FT                   QGVPTAQTTTMLRQLFVELSQSGGEVSELFQQLSGTSFKSFIESGGNVQQALQLLEQHA
FT                   NASGVGINDLFSSVEAGSAALTLTGRGTEMFTGALDAMQNSAGATEAAYNQMDQGLVRA
FT                   FDGIRAQFAVLQTNIGNALAPTVQAFADWLAEAMPRISAVVVGAFERIGTAVQMVGPYF
FT                   LDFASTASEAFGLFIDLASSAVQWGSNIATQLANGIMGGAGAVVDSLGYIGDLVTYWLE
FT                   PHSPPKLLPNIDTWGRDTAQVWMDGWNDARLPTDGLLAYLETELQSIEDAQQRVKEAAQ
FT                   EKQLLALINSTGGKDSDREQAKLELAALKLRQKIREEQAKAAEQEVKKPKATGGGGGGG
FT                   KSPMDDAAKKAEAAARAQWEYSFSIAGTADRLQMLKDKQAAYATTDAEYWRLQGQINQE
FT                   EQKRQAELNKLAKEQRDYELSLMSTEDQLARLRQEQGQYAEGSAEYNDIQQEINKAEKQ
FT                   RQRELEEVKRKQDEAAKAERDYQYATADTAGKLAILQGELANTNADQSEYWRIKTQISQ
FT                   LEAQQQKELEASAEKMKGVGGAAKGAAKGVGALVPPFTKVKDGADETNQSMQDAATGAE
FT                   VAADRYADLKDRQVEMANATAPVPSLIDRIRNAFSQAAPFIESVKGAFMGIATLFTGMG
FT                   LVSLFTGLAGAVAALVSPMGLLVAGAAALGLAWQTNFANIRTITGEVFNAVQTTVQTAF
FT                   GLITSWFRENGEQIVTFLRDAWGRIEGIVSTVLGAVGTVIQTALDAIRSFLEQHGEEIK
FT                   GVLTMAWETIQVVIDGALDVIDGAIIPFFHGIATFLSDHKDQITGLLSGAWSIIKGIVE
FT                   AAMSVIQGVIKTVTAVIHGDWSGAWTAIKDVFAGLWNGIIDIVKGALEVVWNLLVVAWD
FT                   LIGTGIRTAWDGISDYFRTMFGGVLDNLDGFLEQFKNGVAVAWQWIKDASAAVWDEITN
FT                   GIVEAFRGILSGIKSPLNLMITAVNKLIEGANTVGSALGFGGIPLIPYLADGVKNWAGG
FT                   LAFASEPWKGIEAMRTRGGDFALLPPGISNIPRGAEVFTAEETKGMTARMVVPQGGMVG
FT                   ARGMEGASGTTIVNYYTYEIAVDAREAMNPAAVEAAAIRGAEKAIKNYVEKANIQKKTN
FT                   PFGK"
FT   gene            complement(645386..645670)
FT                   /locus_tag="Haur_0550"
FT   CDS_pept        complement(645386..645670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03198"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW0"
FT                   /protein_id="ABX03198.1"
FT                   /translation="MYAVYGIPPHELYEETVLELLPSYLRRMHNEREQQAMLIATKVGT
FT                   MLFGDDTKGKGKGTSKRKKANQPASTRSEVNYVSASQLIANMKARSVRP"
FT   gene            complement(645706..646107)
FT                   /locus_tag="Haur_0551"
FT   CDS_pept        complement(645706..646107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03199"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW1"
FT                   /protein_id="ABX03199.1"
FT                   /translation="MAVMLSLTIGGEVKEIRKLPFRQNQDFKKKLIDVAKKVMPQVDQM
FT                   SKPPATNEEGKQSGEALTAYIVTMLESVDGLLEDALSLIIAYASGAIPKSIDDEILDEE
FT                   IIDAFLCIANAAVPIKKLQVLAAGFSSIG"
FT   gene            complement(646171..646767)
FT                   /locus_tag="Haur_0552"
FT   CDS_pept        complement(646171..646767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03200"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW2"
FT                   /protein_id="ABX03200.1"
FT                   /translation="MPTDVAAVTMSNAKLLYAPVGTTLPADSLAVGAAWPVGWVQYGLT
FT                   SAPLVVAYSYETKAPEIQEALGAVKRKKVSEELTAETTMAQLDFAGLPSTWGGTNTVVA
FT                   SGVGQVGKETFKIGGAAQLPIRMWGFEAEQEDEEGNVFPVRGFIWKATSEEGGELEFSK
FT                   EDWTGIPLKLSALEDLSKTKGERLFQLVRVVEAAS"
FT   gene            complement(646800..647186)
FT                   /locus_tag="Haur_0553"
FT   CDS_pept        complement(646800..647186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03201"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW3"
FT                   /protein_id="ABX03201.1"
FT                   /translation="MVDPIAAIITAMSTPTVTALVSNRVWVGPDLPQGYTPDVGPAILF
FT                   VIRGGGFDYTRTILSPSLYVQLYGTDEGVCIDLWRTCCDAWMDRGNGVTRLRPDSSAMP
FT                   RLLRTQTTLWLFALSGWTAHIKNY"
FT   gene            complement(647186..647611)
FT                   /locus_tag="Haur_0554"
FT   CDS_pept        complement(647186..647611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03202"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW4"
FT                   /protein_id="ABX03202.1"
FT                   /translation="MAKKGVAQYQSFAKRFRVRIDGATRDLLNEAALAGEGYAKQNMMA
FT                   NNSIDTGFALNSIHAVLVDGQGVDSSTTDLPDKHGDVVQRTSAGLPAMGDNTSAVGCAA
FT                   NYAIYIELRAPFLFPALDQVKADFGGIVQVVRRKRGL"
FT   gene            complement(647614..648018)
FT                   /locus_tag="Haur_0555"
FT   CDS_pept        complement(647614..648018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03203"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW5"
FT                   /protein_id="ABX03203.1"
FT                   /translation="MLPMRPTEFTVMQATHTDAMRDQCVLMEPQTSAGRNNKPVITYTD
FT                   AGSSACGFNPSTANGVASEEVLDSTAVVITKPTLRLPAGTVIRASWRVRITHRNGQVLT
FT                   PALTFEVVGDPATLGTAIVVELATVTREEV"
FT   gene            complement(648035..648427)
FT                   /locus_tag="Haur_0556"
FT   CDS_pept        complement(648035..648427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03204"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW6"
FT                   /protein_id="ABX03204.1"
FT                   /translation="MAHTDGSIKAVMQEELLETATVLNWTDVSNAGYNAALRRTLRRLN
FT                   LPNVAASANDPLLETVAIIEVWRSVVNATVTAINFEADGGKFDRKAMHDHAVRMLKQLE
FT                   AEFVTNQPVVVEEAPMSGTLDTFSRW"
FT   gene            complement(648428..648847)
FT                   /locus_tag="Haur_0557"
FT   CDS_pept        complement(648428..648847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03205"
FT                   /db_xref="GOA:A9AVW7"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW7"
FT                   /protein_id="ABX03205.1"
FT                   /translation="MSTKVKVTLTDSWMHLGTTYLPGVHTLDESIANILVAANATTDVQ
FT                   SIEPVAAEPVQRVEQPATPNADGDAGTPTTDGGQAPAEPSVELVSVVGSKAAASLAAAG
FT                   YTTYGDAVAADDATLSAIDGIGEATIKKLREYKAA"
FT   gene            complement(648897..649982)
FT                   /locus_tag="Haur_0558"
FT   CDS_pept        complement(648897..649982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03206"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW8"
FT                   /protein_id="ABX03206.1"
FT                   /translation="MDIASLLNQARADGTLTRLMRNVLAQFGRPQRRYLGAELLPERMV
FT                   EENQYTEESIRYRTIVANGGTRYGPAQKKGGDLIGTFDVKLANSDIARELSGRDYDILL
FT                   RYLGRNASMDAIAALTNWAETTLNLALIEVNEAWRWQAIVDASVIIEGDNAFREPVALT
FT                   NPAGHRVNVADDWADPTYDPFQDIYAMADLLQSKGYTVGRMFAGTPVLTKLARNPKVAA
FT                   RTSHFVANNGGALELVAGRASLMGVNMALQMDGLPPIERYDLRYNTQNGDVRFLHEQAF
FT                   VLVALTGRNEELDIPDGEQTLITDTLGYTAIGKPAGHSEPGRVINTEFKTDKPPRIEGQ
FT                   AWQTSFPILAEPEAVAVLKNI"
FT   gene            complement(650041..650661)
FT                   /locus_tag="Haur_0559"
FT   CDS_pept        complement(650041..650661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03207"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVW9"
FT                   /protein_id="ABX03207.1"
FT                   /translation="MAGVIGTVNQLTSPIWAGDFLDREHLMPGGAKVDASQFLATDGAI
FT                   ITLSANALVSATSISVTALANPIPANTMLRFGAGKYAYSTAAAAAGATSIAVEALPVAL
FT                   SSGDKATYNGSGTKPVTIVSGTLIGRTWAERDAGTAFGPAADADEEIYFLAFDISDATK
FT                   NNDADLYRYNSIVKETFVPGWAGLSSTLKAFVRSHYQCTVGRA"
FT   gene            complement(650664..651392)
FT                   /locus_tag="Haur_0560"
FT   CDS_pept        complement(650664..651392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF2026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03208"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX0"
FT                   /protein_id="ABX03208.1"
FT                   /translation="MVRFFRSVKLFTADNGGGGSGSGNGGNPPPANPPANPPANPPASG
FT                   GNQPDIAGQIANLIARQGSPDAALMLLMQENYQYRDQNRQLRERVPDGAVVLSGDDVQR
FT                   WRDYQALGQLDELRTRLTEREQAQTELATLRTQATMRTVAEAMQWKPSVLERLAGNVTF
FT                   ITKTEGDKTTITVKDGDGETPLDAYAEKHWGEFMPALTIDSNPARRGTGFVHQGGGNPK
FT                   KDDPITTHNQRMGYSLPKRG"
FT   gene            complement(651407..651670)
FT                   /locus_tag="Haur_0561"
FT   CDS_pept        complement(651407..651670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03209"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX1"
FT                   /protein_id="ABX03209.1"
FT                   /translation="MMPLHPQCRCTLLPILRGREPLAIPTGKQWFLEQSAKTQRDMLGP
FT                   GRYALWQRGAFQFEDLATVHSGGIWGANAQVTTVNALRQLQS"
FT   gene            complement(651670..652398)
FT                   /locus_tag="Haur_0562"
FT   CDS_pept        complement(651670..652398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03210"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX2"
FT                   /protein_id="ABX03210.1"
FT                   /translation="MIDAVAIANQFRAELQAQNASAMDDLTKRWRTVEAALKAEMEALA
FT                   FQMSQAKADGQTVSESQLYANERYQALLVQLQRELAKYNADAAAIIQAQQLSFASMGAE
FT                   QATAWLRYSGAIQGSFTQLNSGAFENIAALARADNPLALLLSNAYPETAQAMTDALLSG
FT                   LALGKNPRITARMMVNDGLATSLNHALLVTRDQSIRASRVAALQQYQTSGLAAAYMRIA
FT                   ARGVPVWPVWRSMARSIRPT"
FT   gene            complement(652395..653966)
FT                   /locus_tag="Haur_0563"
FT   CDS_pept        complement(652395..653966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03211"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX3"
FT                   /protein_id="ABX03211.1"
FT                   /translation="MPTAFDNLSVEAAKKRLPTTPEAVKSAVLFRDGDHWQGGAAWTGP
FT                   APASTDKGATEVMTRIQREFVSSNVIAEVIERHANGAVGREPQWSYALRRPLLEEEQPN
FT                   TQEQALLDEAEAAMTSWWDQRNVLGILQESIATAVVHGRAVLRLFVPPAVVEGGVIQRQ
FT                   PSLADALNLIWLDGLSPEQAGVSRDTATMQACGVYVYTNDAKQEVAEVTFLDGLDTVMR
FT                   TLEGEAVTGETRLPLMGHLLMIEITCKPLIGLPMQQMQKALNMTLTMLQHNIVISGFVE
FT                   RVMTNAQMPFDEVDDPTNPGKKTRVYRPYDIGPGKTTNLVGLPMREKDGQIERITGYTT
FT                   PSVQWRDPVPVGTFIDTDAAIYSRMLKECKQLHALLSGDAVASGESRKQALLDFAMSLG
FT                   PTATALKQLVRWVLEAALALAAHFAGRAQAFDSLRADVTPRLWLGSLSSEERNFLLAAY
FT                   EKGAISHDLFLSLIEVEDVDAEKARIAAEQEEKQARSARSLGAALAMQQARLDSGAAST
FT                   GLEQPQ"
FT   gene            complement(653980..655413)
FT                   /locus_tag="Haur_0564"
FT   CDS_pept        complement(653980..655413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03212"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX4"
FT                   /protein_id="ABX03212.1"
FT                   /translation="MSKAVELAKCHADPAYFTHNYGRIDDAQGLGDGSGDMPFTLWPAQ
FT                   IEVLWTLLLQRLILILKARQLGISWLCCAYALWLCLFQPGKVVLIFSKGQGEADEMLHR
FT                   VKRLYERLPDWMREASPALVTDNTTELEWANGSRVKSLPATKGAGRSFTASLVILDEAG
FT                   FLIWAKQLYTALKPTIDGGGQLIVLSTANGIGNLFHQLWVKALSAKNRFKTIFLPWWAR
FT                   PTRDAQWYQEQLEEYTDLDMVRQEYPSTAQEAFLVSGRTRFKMPWLLQQTPSDGLAAES
FT                   LPDALDKLDGVTMYQLPQQGRRYILAADVAEGLEHGDFCAATLIDAVSWEEMVSVHGKW
FT                   EPDEYARILMALSDGYGATVAVERNNHGHAVLTTMKLAGFTRIVYGLDGRAGWLTNAQT
FT                   KPQMIDLLATALRDVLVKIRNQTALNELAIYRILKNGGTGAPAGYHDDFVMAWAIALMV
FT                   ASQPTEVEDEAIAGSWDSY"
FT   gene            complement(655341..656042)
FT                   /locus_tag="Haur_0565"
FT   CDS_pept        complement(655341..656042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0565"
FT                   /product="Terminase small subunit"
FT                   /note="PFAM: Terminase small subunit; KEGG: lca:LSEI_1935
FT                   phage terminase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03213"
FT                   /db_xref="GOA:A9AVX5"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX5"
FT                   /protein_id="ABX03213.1"
FT                   /translation="MTNPEAEKPLTTRQRRFVDEYLVDFNATKAAIRAGYAERSARSIG
FT                   SENLTKPNIKAEIARRADDIISKTEIVGRLAQQARTSMDDFFFIGEEERTVIKRRILVS
FT                   VDKKGSSKEIVLEEVEEKAMRPATYLSLVKAEHRGVMHLIKKYSVGPKGESIELYDAQG
FT                   ALITLGKYHAMWVDRAEHTGRGGAPIPIDSPAMAQAADELKQWREEQCRKLSNWQSAMP
FT                   TLPTSPTTTDE"
FT   gene            complement(656272..656607)
FT                   /locus_tag="Haur_0566"
FT   CDS_pept        complement(656272..656607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03214"
FT                   /db_xref="GOA:A9AVX6"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX6"
FT                   /protein_id="ABX03214.1"
FT                   /translation="MTLTQTLLALMIVAVLSFVIGFLKSIAPKAAEALHTWADANLGAE
FT                   QRDALYGAVKAGLRAAEAHGLKAEDLLAKAVQVASGYLTQYGLPFSETLLRDLVMAEKY
FT                   KKTQESE"
FT   sig_peptide     complement(656515..656607)
FT                   /locus_tag="Haur_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.290 at
FT                   residue 31"
FT   gene            complement(656604..657053)
FT                   /locus_tag="Haur_0567"
FT   CDS_pept        complement(656604..657053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03215"
FT                   /db_xref="GOA:A9AVX7"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX7"
FT                   /protein_id="ABX03215.1"
FT                   /translation="MDSLLIGAVVWLIGLTIVVMVGAWMFARGYLSVVRENVSLKAELH
FT                   AVRDAAKRELAALSAQFDLAMSALRREVINARERWTIDAYALMDAQLYIQALEDTCHHH
FT                   QIPLPKKPRRAGLDRPTTSPRTDEQHNGLDPIDEYLSPLNTGASL"
FT   gene            complement(657213..657455)
FT                   /locus_tag="Haur_0568"
FT   CDS_pept        complement(657213..657455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03216"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX8"
FT                   /protein_id="ABX03216.1"
FT                   /translation="MWDMWDMWDKVMKFQIFYCSHCGTPLGFIPHDGFALICGIACITT
FT                   TTPITCGACKNQTIWYAPKRQRRKKQRLGIVRQTT"
FT   gene            complement(657585..658079)
FT                   /locus_tag="Haur_0569"
FT   CDS_pept        complement(657585..658079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03217"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVX9"
FT                   /protein_id="ABX03217.1"
FT                   /translation="MVQPDTSCITPQSLADLPLTLANESADTNDFATDTNDFEQLPLLF
FT                   DEFNILEWRREIKERGKYWQWRKGSGDYRPSRYGGTFDQLDDERKAQYAVNKHIYGRNR
FT                   AAQTQAQEKESDTNQPNQSAVQTSDTNRSAGDVAQRDRLLPDQRRTIEVQPESSRITPS
FT                   A"
FT   gene            complement(658100..658894)
FT                   /locus_tag="Haur_0570"
FT   CDS_pept        complement(658100..658894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03218"
FT                   /db_xref="GOA:A9AVY0"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY0"
FT                   /protein_id="ABX03218.1"
FT                   /translation="MLEQHNRQSIKSLIIFGSGLAYVLSIVMMEVLVGFALGDISESPL
FT                   MQALVGIGILGTFISACLIPLALHYWLAPGTQFIVGILFWLVDVAVLAINATTSYQLIK
FT                   KLELSSFFTMWQLAIPFIGPAITIIGWGLVYLADDGQKDRQSDRLLETSKRALMREAEY
FT                   ARVSAEHEFAMKQIAQVKQSLMMALQASDIAKVAEQGAYNSALQITRQIVGLPLNGSNH
FT                   DQTESLHSQTHDHIEPQQELPFDTTPIIYTNNEGYADQPKND"
FT   gene            complement(659052..659546)
FT                   /locus_tag="Haur_0571"
FT   CDS_pept        complement(659052..659546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03219"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY1"
FT                   /protein_id="ABX03219.1"
FT                   /translation="MIINQAMLWRQFDTTITNLEQALNTCPEHLWERQLWPDEPNQWVA
FT                   AGFSRFWYLAYHTLFWLDLYLTGAEEGFMPPAPFDLVEMQANESLPRTYTRAELLEYLA
FT                   HCRQACQTTITNLSAEQALRNCSFPWGQVPFGELLLYNLRHVQEHAAHLHMFLGMQASK
FT                   A"
FT   gene            complement(659653..660426)
FT                   /locus_tag="Haur_0572"
FT   CDS_pept        complement(659653..660426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0572"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Activator of Hsp90
FT                   ATPase 1 family protein; KEGG: xau:Xaut_1920 activator of
FT                   HSP90 ATPase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03220"
FT                   /db_xref="GOA:A9AVY2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY2"
FT                   /protein_id="ABX03220.1"
FT                   /translation="MEQELIFRALADPSRRQLLDLLFERDGRTLKELEAALPMTRFGVM
FT                   KHLRVLEEASLIVTRKVGRERLHYLNPVPIQLISDRWINKYAAARAMALVDLKMVLEGG
FT                   SSMTTAAKPKLVYQTIIRASQQQVWEAIIKPEFTTRYYYGCTVDTNLAVGSAFNYQRSN
FT                   GAAIVEGQVVEVDAPNRLVHTYHSLWPPMNEDAPTKVTWELEAMPGGITKVTVVHEDFQ
FT                   GETATYQGLNSGGWTWILSNLKTLLETGEALPEEY"
FT   gene            660581..661138
FT                   /locus_tag="Haur_0573"
FT   CDS_pept        660581..661138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0573"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: ava:Ava_1936 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03221"
FT                   /db_xref="GOA:A9AVY3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY3"
FT                   /protein_id="ABX03221.1"
FT                   /translation="MAKLHPELTPELQAFIAQQPLFFVASAPLAADGHVNLSPKGLDCL
FT                   RIHSPQQVAYLDLTGSGNETSAHMLENGRITLMFCAFVGAPRILRLYGRGRVILPTMAE
FT                   WEPELAQFPHYPCIRQIVLVAVERVQTSCGFGVPLMELVGQRDTALRWAEAKGEQGLAT
FT                   YRSEKNLASIDGLPTHLASEAG"
FT   gene            complement(661191..662186)
FT                   /locus_tag="Haur_0574"
FT   CDS_pept        complement(661191..662186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0574"
FT                   /product="CRISPR-associated RAMP protein, Cmr6 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr6
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   pth:PTH_1923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03222"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY4"
FT                   /protein_id="ABX03222.1"
FT                   /translation="MRRTALAQIKPAPNTHAGLWLNRFLTEGSADDESKAKASLVEQVA
FT                   GLQIPALYTHFYNRWAANLEQAGATFRKAEVQGRMIVGLGNTSPIETSICLHHTYGVPY
FT                   IPGSAIKGLVAAYARQQLGDDWTKGSETQAEKPLNAYQTMFGHPESAGYLTFFDALYIP
FT                   NSSQPLAIDVMTPHHMTYQQGNLQAPTDFDSPNPVAFLSATGSYLFAIGGDQAWVTAAF
FT                   AILEKALLEYGVGAKTSSGYGRLKLASPPRDPKQDALEQFLADFNRLRPNQFVSQISRY
FT                   IQQWEELQGIPQKLEAAETIIKMARVVMREKDLLTKQWFTKVSEFIEQHS"
FT   gene            complement(662179..662589)
FT                   /locus_tag="Haur_0575"
FT   CDS_pept        complement(662179..662589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0575"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cmr5 family;
FT                   PFAM: CRISPR-associated protein TM1791.1; KEGG:
FT                   pth:PTH_1924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03223"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY5"
FT                   /protein_id="ABX03223.1"
FT                   /translation="MSMSQRQTLEQRYATKVYAKANAYSGESKDIRTRYGNLAFTLPIM
FT                   IRSAGLVQALHFASTRKKAEQKQFLEDLADVLGYQNTQELLDQSRTAQITEYMRLTRQT
FT                   LAVLVWFKRFAQSILDLEASEATESDSGENNA"
FT   gene            complement(662589..663425)
FT                   /locus_tag="Haur_0576"
FT   CDS_pept        complement(662589..663425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0576"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr4
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   pth:PTH_1925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03224"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY6"
FT                   /protein_id="ABX03224.1"
FT                   /translation="MQTHVIFVHALSPIHAGTGQSVDVIDLPIAREKATNLPYIPGSSI
FT                   KGVIRDVSPASESLKKQLFGDVEQAGDAIFADQRLLLLPIRSLYGTFAWVTSPYVLSRF
FT                   AREAQTSNLWLPEIKRSELALISQNSVLSYQQKVYLEDLDLEATPGADAWAGWLAKQLF
FT                   PDKPDWQTILQERLCIVPDEIFNFLVTTATEITARIRLDDNTKVVTKGGLWYEEALPAE
FT                   TILAGIVAINDQKRSANRDQVITAIIEVANQGIIQLGGNATVGCGLCQLTIAQGDR"
FT   gene            complement(663428..664747)
FT                   /locus_tag="Haur_0577"
FT   CDS_pept        complement(663428..664747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0577"
FT                   /product="CRISPR-associated RAMP protein, Cmr1 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr1
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   ttj:TTHB162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03225"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY7"
FT                   /protein_id="ABX03225.1"
FT                   /translation="MMFNRKPSAESSVNCPDVKKIENHKPPIEPIIRNYRLITPLMGGG
FT                   VKAGENDSNFLIRPSSIRGQLRFWWRACFGGSHQPQSHDALLADMFARESALFGKAADS
FT                   QSSGASAVQVEIEVINSGSQFRVIAKNGQEVKISAMNSPYGYSAFPLQDKQNASVREGI
FT                   EFKLTIHLKSAEQREELEKVLWAWQTFGGIGARTRRGFGVLQALDKANHRFAFANKAEL
FT                   QQHIRAIIGNRSYWPNGVPHLAPTMQLRLIKPKPNQTALNIWADLLRCYKEFRQQRNDG
FT                   NQPNRPGRSRWPEPDALRRLTRQRSRLHEQPLSTIDAFPRGEFGLPIIFHFKDSDDPGD
FT                   SELRLQANHEFSQQKGDRFASPMLLKPVASTGQLFGLIAVFEGSTLDGRQAIIKNRRIT
FT                   AAAVIIDVSESQARTIVDKQRRPMLTNPSIITSFLETIEE"
FT   gene            complement(664744..665934)
FT                   /locus_tag="Haur_0578"
FT   CDS_pept        complement(664744..665934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttj:TTHB161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03226"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY8"
FT                   /protein_id="ABX03226.1"
FT                   /translation="MTLDLWLIQPFNSLVIADGRPFENQPGARAKSLSFPPPSVTVGGF
FT                   RARAGVKANYNFSAKLSDPEYTNLLAMQVRGPILLKETVDLLIPFVAIPADALIRQDGA
FT                   NVTCYRLQPLDPRYFPTEQTDLVLGQQPDQPRFSLVGSQQHTKGKAPANLPRFWNWERL
FT                   FLPWLINPPIQPFDLEQQRAAGQMLDLEGDTRTHVGIKPSTQIAEDGQLFQTQGLSFQS
FT                   LEAGYGLGLWSSTPIDPAVASLGAERRLVEWYRVPSGTAAGIETIEPSILAAIVQTKHC
FT                   RIILLTPAIWDAGFYPKHLPTFGLPMTATIKAVVNPRPEYVSGWDLRLQRPKATRRLAA
FT                   AGTVLFVELTGSDAEIEQWARQLWFSNISSSEQAAKDGFGLAVLGIWNDGYLQELA"
FT   gene            complement(665931..667817)
FT                   /locus_tag="Haur_0579"
FT   CDS_pept        complement(665931..667817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0579"
FT                   /product="CRISPR-associated protein, Crm2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Crm2 family;
FT                   KEGG: tth:TT_P0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03227"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="InterPro:IPR040942"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVY9"
FT                   /protein_id="ABX03227.1"
FT                   /translation="MNRSLLLIALGPVQEFIEQARRTRDVWFGSWVLSHLAKKVAQTLP
FT                   REGLIFPTGDSLPSPEAENSDPSTERISYSNQILVIVPDAQAAITHAKAAFDQEIDQFV
FT                   NILLKTKQINWLEGLSEEQREQQLIKQLKDLFEFQYVYVDLPDDQHYAQQRKKLYQLYA
FT                   ARKNTRNFGLIDWQQDPQNMKRSDKSSLDGWHTLIANGAKSGENLSAVDLLKRMLKPQD
FT                   LDQAYPKGLDGFPSTSHMAALAFAEHVNQSTLARQGWERYINNLRSTGYRITEYLPRVQ
FT                   RFDRIALFPSENTNRDFFDGSLVFESRLGEDFANTDLNTVIIKQARGYLEDFITAYAKQ
FT                   RPNPYYAIIAADGDKMGNLIDSISDVQIHRDLSKVVTTFAKDAAQILENDYQAAVIYAG
FT                   GDDVLALLPLHTLLAATKKISDLFIEYMQPLAEQQAVSTPTLSVGVAIVHHLEALQDSI
FT                   QLARKAEKLAKKPRNALAIILSKRNGSDKTIVGQWDTEFYQHLTKLVELHCQQTIPDGF
FT                   IFELDELLKRFDFGLINDRTELQQTLKIIEHETLRILKRKQIQSAGEATFLAADVINLL
FT                   QNIIGYCSSHSSNSDQADQYLRDFIAMNLVARELANVQALFEKTQPQGVPQL"
FT   gene            complement(668182..668943)
FT                   /locus_tag="Haur_0580"
FT   CDS_pept        complement(668182..668943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03228"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ0"
FT                   /protein_id="ABX03228.1"
FT                   /translation="MQRFLGFMLIGLLLLACGQTTGQQIESAASVAQVAQAEPTDEPTA
FT                   KPTRTPRPTNTPRPTAKPKPTRTPRPTATATPIPEPVVLSGVGQTVTDAFMPPSAVSII
FT                   KLTHTGRRNFIVKAYNAEGDESYLVNEIGRYAGSRVLYGDSSSFLEIDADGEWTAEIVP
FT                   IGLEATAADGLSGTGDLVSGLFMPNQEGPIPFNFTHNGDSNFIVQVTCQGGMDYAQNEI
FT                   GTVDGSAIVKFSEGPCLWDVQADGDWTISPK"
FT   sig_peptide     complement(668875..668943)
FT                   /locus_tag="Haur_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.920 at
FT                   residue 23"
FT   gene            complement(669016..669987)
FT                   /locus_tag="Haur_0581"
FT   CDS_pept        complement(669016..669987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0581"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: pca:Pcar_0295 HNH
FT                   endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03229"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR011396"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ1"
FT                   /protein_id="ABX03229.1"
FT                   /translation="MLAQYQRAFEKLKLSPSQAWPESTHFRAPYKPLMLLAVSDLISVG
FT                   TLTHNFIEYSEFLLETFDRYWRIIFDSTKFANPIQPFFYLKSEGFWHLQAQPGMQQRLA
FT                   ATKDIKTINQLNQLVLGATLDQALFELLQQPFARTQLRQSLIQQYFTPELWTALGMIAQ
FT                   INTEIFDYSKLLIEQSQRMFREIPATDAPYQVEVRSSAFRQIVVPSYDYCCAICGIRVI
FT                   TPEGRSAAEAAHIIPWSRSYNDDPRNGVALCGLHHWVFDQGLLTITPSYKIQISPLVDD
FT                   QPPANQTLLAFTRQSIQLPNQAHLYPNPIALNWHNQFVYRND"
FT   gene            670030..670908
FT                   /locus_tag="Haur_0582"
FT   CDS_pept        670030..670908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0582"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bur:Bcep18194_A4858 phenazine biosynthesis PhzC/PhzF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03230"
FT                   /db_xref="GOA:A9AVZ2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ2"
FT                   /protein_id="ABX03230.1"
FT                   /translation="MQIEVQIVNAFIDGDAGGNPAGVVLQADGLSAAQKLAVAQQVGLS
FT                   ETAFVSKSDVATIKLEFFTPTRQIAHCGHATIATFSLLRQLNRVPTGQLAKETIDGLRE
FT                   IIVADDQAFMQQLAPRYQAFALTDPIAQQALRSLNIPSGDLLRGTVPTLVNTGNSFLII
FT                   GLASEQTLAELQPDFGQIQQISEQLDLIGYYLFTPATKQAGRSAGTRMFAPRYGIREEA
FT                   GTGMAAGPLACYLYDQLGLQQTSFLIEQGWLMQPSSPSVIEVQLSLVDGAIQSLLAGGR
FT                   AKVMQTLQVEL"
FT   gene            complement(670915..671508)
FT                   /locus_tag="Haur_0583"
FT   CDS_pept        complement(670915..671508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03231"
FT                   /db_xref="GOA:A9AVZ3"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ3"
FT                   /protein_id="ABX03231.1"
FT                   /translation="MKDISDKYIRKRIDDYSINNSYSIVSRIVMRQYLQKNFLIGIVLF
FT                   LFILIVSISMNGLFLVKMIAASIISIGLLSFFTFFETILYTDKKAYILFLIIKHFQQTN
FT                   IQPYQLTTLKDITALEASIVGTKTASTLIIITILITLGPVIVQKVHPLATAIATIVLLL
FT                   ILFTQILQGYADALIRQAIAMYEEQQALLKKLLE"
FT   gene            complement(671651..672403)
FT                   /locus_tag="Haur_0584"
FT   CDS_pept        complement(671651..672403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0584"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rca:Rcas_2286 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03232"
FT                   /db_xref="GOA:A9AVZ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ4"
FT                   /protein_id="ABX03232.1"
FT                   /translation="MNGTTHILVVEDDPAIGRLLLMHLREAGWQAILANTGMTGLRLWA
FT                   SDCFQIVLLDVMLPDLSGWELCQQLRAESNVPILMLTAKASDDDVVRGLNLGADDYLTK
FT                   PFSQAQLIARVQRLIQRQALLEPAPRLPSLTVEPAEPQPTRPPSGAALLREARQKAGIS
FT                   LYAAERRTGIRWDYLQAIEQGAFMQIPLKHIKPLLLQYCELLQVDARPVFAHAQQVYLA
FT                   SPEYHQRRNWPWLVAVSCIIVIVIVMLW"
FT   gene            complement(672400..676284)
FT                   /locus_tag="Haur_0585"
FT   CDS_pept        complement(672400..676284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0585"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: rrs:RoseRS_1528 PBS lyase
FT                   heat domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03233"
FT                   /db_xref="GOA:A9AVZ5"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ5"
FT                   /protein_id="ABX03233.1"
FT                   /translation="MAIAPFDRLLLPRLRRAQRQRSYARYVQARWAERFPARVLPTIGS
FT                   LVLQLSPIPANGHQANLWQALQLNQRIRLVGGLGSGRSFVLINMLLQWCATQERLPGLF
FT                   PILLHVPSATESPDATLARTLAEAGFANDRMGIERGLAAGKWMLLLDDLEEAQPHIAEH
FT                   WRNWLFDLTERYPALAAVATDHATNPNWAGWATWQVQAPDATILEQWLRQLLPNEEPAL
FT                   LLPPLLNDGRGRLVAERFADVAILAATYPTHGFSANRVRMYAAAVDRALRPIAGADLPK
FT                   VRTALAGLGYAWLQGEQIKAVYWLQPSLVALNGLVQVDQRGLVRFRSPLFALFCAALHL
FT                   AAHHAWHDFDLDNPLWHELLPLTAGLLADPAPLYNAIRGNRPLTSQRVRLLGRCLREHH
FT                   VPIAGWSAAIIRALVHVARHEPAYTEQIWHLLESMESVVSATIAEQLSNGSEGEAWALQ
FT                   VVRSLPSHLALDYLLDMLSDSRLSYNTRQSAAQQLFAMHDVQLTPRLISLAQRQHDDWG
FT                   QLLVNYLLAQNSHAGRCYLQEQLHAGRMIFYLHCEPNGARFVVATASALLDDHQLDQVV
FT                   HLHASLALQGCATERTAPALLNACTAASAPLRAAARQALLQATPSLAVRALGRLVLGDD
FT                   VHWTARHEALHELLRFESNGANPLLLRVVTSQLPLAARLEAAQAIMQRQNETSERLIRL
FT                   LEQPQLGNALRSGIIYRSDPQTQPLFMQRLLGLACDQSAFMVRTAAISTLAKLKNDESQ
FT                   AVLAGIVENERHDLQALQAAIVGLGTRRDESGIWALRTIVIGELPQQLELAWQHELPMG
FT                   YLHEPPIQWPIASFSPALQWRWAEALAVGNTSADEPTSLAELVAREVHNLRAAAAQALS
FT                   TIGGSAARSVLYEALTGNPDRYSLTVAPVVAAQLANCDAEYELAQTIGAGQPLLRWVAA
FT                   NTLSQQAQAKPSLHQMLINNQLDPQTRSAMLTALSGDNHLAPLLETMIVDDHTPLSLRV
FT                   DAVHSFHKLHMAHSEGLMLALLTSNHAEPALHVAAMDCLVAPVSEASLNTVRQILRDPR
FT                   PTLEVAAAALRCLGRVADRESIALFLRYAQHDSPSLAIPAMDGLRLLQEPTAIALLNRL
FT                   AQAGGKSTRIRLHALRVLLELEGAIHLGLVRELATTGSIGTRLLALEILLAAAKNPLDS
FT                   LEFLRPHNPLPLRLRVAQALAETADEATLQQLAELLHNDREALAIRSLALSSLCQARYT
FT                   PVLAEVETLAADQTAPLSLRRRAIDGLRAWRNEPTTMLTLSQLAESADPASSAWALAVL
FT                   LDLPLLQEAA"
FT   gene            676455..677354
FT                   /locus_tag="Haur_0586"
FT   CDS_pept        676455..677354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0586"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   cph:Cpha266_0765 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03234"
FT                   /db_xref="GOA:A9AVZ6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ6"
FT                   /protein_id="ABX03234.1"
FT                   /translation="MLRLFSAIQLGTLELTNRLVATPSPSRFSHGGGFLNRSLIVEYGR
FT                   WSSYGIGLIISEPVLVQANSNLPRPALSADAHIQAFRNLNQCLHEYQSHCLPLLSLVSQ
FT                   PESQLQPSNWPTLREQMVLAAWRAYAAGSPGIVIDANAGSLFHQLRVSKQVPPTSRSQL
FT                   LLEIIEAIRGWLGRQFVVGVRLVVDDLVPDGVSLQESRVLAHELVAAGVDLLDLVVGRS
FT                   VAPIAQFPGWQIPLVAGIRSIVDVPLIAHGMLGDPWIAEEMLREGCADLVGLEAAISAT
FT                   PHWPIWARQQLEREAEAA"
FT   gene            677418..677783
FT                   /locus_tag="Haur_0587"
FT   CDS_pept        677418..677783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0587"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rrs:RoseRS_3355 two component transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03235"
FT                   /db_xref="GOA:A9AVZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ7"
FT                   /protein_id="ABX03235.1"
FT                   /translation="MAKTIFIMDDDLALQMVMEIALREVGYEVVLANNGVEGIAQLETL
FT                   KPDLIISDIMMPEMDGVEAFNQIRERIQDEGIPMVIVTALNRKPWFSDLEEEGAVILQK
FT                   PFEVDTFIDLINTMVSD"
FT   gene            678026..678808
FT                   /locus_tag="Haur_0588"
FT   CDS_pept        678026..678808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_269280 uncharacterized Cys-rich
FT                   domain containing protein Pfam: PLAC8 PROSITE: CYS_RICH
FT                   PRO_RICH SER_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03236"
FT                   /db_xref="GOA:A9AVZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ8"
FT                   /protein_id="ABX03236.1"
FT                   /translation="MSDRPNEDKKLHDPKATVQLTADDLAAMRAELQQEKDKANQFATA
FT                   RLSEADIAPATNKKLENPYATVQLNPEEMAALRAEAQRVKAEAQAAQAAQAAPVAPAPD
FT                   NISSMRGGAVANTPPAPAAPQSFPDQTVIMSPGQARAQYGNAPVDQSYAPPAQQQYAPP
FT                   AQQQQYAPPAQQQQYAPPPQQYAPPAQQQYAPPPQPGYGQNYQNVQQTYNPPAQTGFSA
FT                   PPAPLNTNENFFQKYGVYLLIGFGAMLIVAAILLLVIG"
FT   gene            678856..679611
FT                   /locus_tag="Haur_0589"
FT   CDS_pept        678856..679611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0589"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sma:SAV5596 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03237"
FT                   /db_xref="GOA:A9AVZ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9AVZ9"
FT                   /protein_id="ABX03237.1"
FT                   /translation="MIELLHTIEASVQQVAAEACSLIQVPPFVAMLHPDDPAPWFNYAM
FT                   PIAGLETAAANLPALRQVFHAQQRQLRFEWTRELWPELEAILRDAGIKVDHINPQMICL
FT                   PEQFKPYHNPAVSLRMLTTADDLAHYRQVTRLGFGDYSAISQADVDSLHDALTDGWRYA
FT                   MATIEGELAAVGGYKPTSLGVVELVAIATLPAWRRRGAAASLTSFLVADHFANAGKLAF
FT                   LFAADAIAQATYAKIGFQQIATHLAATEE"
FT   gene            679819..681375
FT                   /locus_tag="Haur_0590"
FT   CDS_pept        679819..681375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0590"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: rrs:RoseRS_0293 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03238"
FT                   /db_xref="GOA:A9AW00"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW00"
FT                   /protein_id="ABX03238.1"
FT                   /translation="MRRWLYIGLAVLLIGCGQALKATSSEVAPSTKPAAAPTIDLTALI
FT                   TWQPVPAYTPQIPTPTNIPIPTPIPDAWPNEQALALRPEFAGDATHSTMPRYAMQITLE
FT                   PNVGRYSGSQIITYTNTTGASINSLVLRSYNNFPPDAQGDGGDTTLEVTKAWSNGNELN
FT                   LAREAENTAFRLNLATSLAPNQQVVISTQFAGTIKAWPDGSYPLLSAYPMLAVWDAAAN
FT                   DWRMDVTRFPDRVFAETALYRVQLKLPAEYQVIGAGTLLEQNADRTSRTYVSGPVREWA
FT                   AALGQFSVSTSSIDGIDVNAYGPDYLDLARVREMAIGALTSYQAKIGAYPYRKLDLHVM
FT                   PWDSGGGIEYPAYTIILVNDGINRDADYVVFHEVAHQWWYGLLGNDVYREAWLDEAMAS
FT                   YLTYVATQDVLGQAAADSYYSGEIERLALSNQANGNWPAGLAINQYPSFNSYYRAVYGK
FT                   GAAMLHQLRIKLGDQSFFQGLAQLNDQKRYQIITRSDFQSVMEQSSGQALGEWLDGWLN
FT                   W"
FT   sig_peptide     679819..679884
FT                   /locus_tag="Haur_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.765 at
FT                   residue 22"
FT   gene            complement(681340..682311)
FT                   /locus_tag="Haur_0591"
FT   CDS_pept        complement(681340..682311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0591"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ter:Tery_2865 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03239"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW01"
FT                   /protein_id="ABX03239.1"
FT                   /translation="MTQEFVTQFWGVRGSHPSTGADFIKTGGNTSCVEMRVAGQQLIFD
FT                   AGTGIVELGQQLVQQPNPRPILILLSHYHHDHIQGLPHFAPLYREDQMIYIVAPWNLYQ
FT                   DRVWELLASASSHSMLAERPGLLARRRTLLIEGGERLWWNADAATPLRVAADADELCPT
FT                   GSVEIRSYHSLGHPRGGSMCYRVEHNAVSAIYATDIESYIGTDQRLANFARNSELIIHD
FT                   AHYTPAEYANPKASRQGWGHSTWAMAIELAQAANIKHVALFHHEPAHTDSQIDQIEADA
FT                   QAVYPLAFVAREGMQVDLLEQTSERSQGESISPVEPAIQPLA"
FT   gene            complement(682335..682622)
FT                   /locus_tag="Haur_0592"
FT   CDS_pept        complement(682335..682622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0592"
FT                   /product="NADH:ubiquinone oxidoreductase, NADH-binding 51
FT                   kD subunit"
FT                   /note="KEGG: pth:PTH_2011 NADH:ubiquinone oxidoreductase,
FT                   NADH-binding 51 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03240"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW02"
FT                   /protein_id="ABX03240.1"
FT                   /translation="MNQQSTYRIYLCHGLHCGSQLGHVQQAFEQALAAANLTATVELRL
FT                   SNCLGRCERGPNAIIQPGRVVYCQLNSTAINRIVHEHLLINTPIVELRDE"
FT   gene            complement(682992..684185)
FT                   /locus_tag="Haur_0593"
FT   CDS_pept        complement(682992..684185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0593"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: rca:Rcas_1646 response regulator receiver
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03241"
FT                   /db_xref="GOA:A9AW03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW03"
FT                   /protein_id="ABX03241.1"
FT                   /translation="MAGSTRVLYIEDNHDNQRLVRRVLATRGYQIIIANDGNEGWKSAQ
FT                   TDRPDLILMDINLPGLNGYELTTKFKATPQLASVPIVALTANTTPGDRERALAAGCDGY
FT                   ISKPIDPRALPDLVASYIGGTREVLETAEAPSVMREYSQQLVGRLESHVRELETANNRL
FT                   TRLDQAKNDFLATISHELRTPLTVIHGYIDLLNMQALGPVSDGQREALELMKRNSTRLL
FT                   RHINDLIYLQQVRSNQMDFAQADLRGLVQSICNDMQPTFLEKNQTLVRNIYVSGIQTPL
FT                   MIHMDVHGVDNAVRHLLENATQYTAQGGVIQVSVYQDDQLVRVSIRDNGVGIPEDDFER
FT                   IFEPFVRLDDTLASIGGAGLGLVIAKHVAEAHNGTVSLESTVGVGSIFTLQLPVNHQ"
FT   gene            complement(684201..686843)
FT                   /locus_tag="Haur_0594"
FT   CDS_pept        complement(684201..686843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0594"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; Cache domain
FT                   protein; KEGG: rrs:RoseRS_1308 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03242"
FT                   /db_xref="GOA:A9AW04"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW04"
FT                   /protein_id="ABX03242.1"
FT                   /translation="MTSQPRNVRFGVQARVLLLALGVSLPALIIVGWLSLNGISQARLA
FT                   AVKQSENTLLIQAENMLMSRAIDKAELYDQALLSVQRQVQTMVNITQQAFSRPLDRLAD
FT                   TRPDPFWLAGSGPTLIPPDQLRLTVARARQITGALQSNVDLNPLISLGYLATKEGVMVL
FT                   DDVRVVSVLPDGFDARKRPWYQAAEKATGPTWVGTYVDAVTNQLNITVSAPVKVNNQLI
FT                   GVIGMDLLLTTIQSDVLRIDAGSSGYAFVMDHDGNILIRPELEAGNTRWDETFKKQNLF
FT                   ESNDPNFVSLRENIRNDMAGVTRLQLDGGDRYLAYSPMRTVGWVVALVLPIDDVISPAR
FT                   DASLAIEREQEQLRRNFLAVLLITSGLIIILATGLARTIIRPLRDLEVGAQRIASGQLD
FT                   QELVVHGNDEIGRLSLSFNQMTTALREKVDALEVNAQQMAAINETSNELKRLRSLNTVL
FT                   DHIPQLLCQRLGFDRAVLYLLRDEVIEVVSASFGPNNYELEYDFMRAALSEPITIDSDT
FT                   IEASVIKSRQAVIVDNPWEHPQVIQAKQFISGGDSYVQAPILGREKVLGLISADYYEQG
FT                   RLVTVQDAALLLNFADMVGLTIENAFSFQNLEDLVAQRTGELREALDRAQAADRLKSQF
FT                   LASISHELRTPLNAIIGFSTVLLDELSPLLVEEQREDLETINKNGRYLLDLINDILDMA
FT                   RIEAGKFALHREATAVLPVVQSAVDIMHGLNSKPVTMRIDIAPDLPRMDVDPTRLRQIV
FT                   INLISNAVKFTDRGQIVVRAIRRVVQEATPIGSHYLLPGDWIVISVQDTGIGMDAEALG
FT                   KLFQEFQQVHAGARGILGSGLGLSITRRLVDLHDGDLWVDSKVGVGSTFSFAIATASIP
FT                   APIEQQSPS"
FT   gene            687290..688465
FT                   /locus_tag="Haur_0595"
FT   CDS_pept        687290..688465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03243"
FT                   /db_xref="GOA:A9AW05"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR030147"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW05"
FT                   /protein_id="ABX03243.1"
FT                   /translation="MSEHQSEQDVGVDSPATPSLLQRNRWLRRLMKFGFVVVGLFFFIL
FT                   ALRLLSKGAGGLGPFLTKTLGIENALNTLGFGWLFAYGVLSGSPVAGIALSFLDSKVID
FT                   PLQAFTMITGSRLGASFIVLVIGFIYFLRGREKAASLSIGVLALSVTATTYLPALAIGY
FT                   WLLTDSGLDQVRIALPSAIFDFVEQVFDPIVAWLIRTIDSGIVNIFGTTPATTGVLPAT
FT                   SVVIFVVGVGTLLFAFNLLDKALPQVDAEHNAFGRVGGLIYRPWAMFLLGAFVTSLTLS
FT                   VSVSLSILVPLSARGFIRRENTLPYIMGANITTFIDTLIASLLIKDPFAFTVVLAEIIS
FT                   ITVISLIILVFLYRPYERLILRLLDRVVNDTPMLVTFMVVMVVTPILLLFI"
FT   gene            688475..689305
FT                   /locus_tag="Haur_0596"
FT   CDS_pept        688475..689305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0596"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rca:Rcas_3007 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03244"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW06"
FT                   /protein_id="ABX03244.1"
FT                   /translation="MKPFNLMIYLDGSSAARRMVAYLAPLARKSHVKTTFLVDEAHQDE
FT                   AEMYFFNAEQLLQSDQAPTRTIRGATPERAIVLETRASQPDLVAFGPLRKEGWRRWLGQ
FT                   SAIGSLARRLTCSMLLMQGRPNELRRALVCAAGGPATLHDAQMTASIIEPLGGQVTILH
FT                   IVSQLSLTYKPEERDPERLADLVMEKQGEVARNIAAAKTILTDRGITTTVRIRAGMVLE
FT                   EIQEELKTGGYDLLVIGAHRARTPLDRVLLEDVSAEILFNSPIPVLLVQNTSDF"
FT   gene            689327..689926
FT                   /locus_tag="Haur_0597"
FT   CDS_pept        689327..689926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0597"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   rrs:RoseRS_1454 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03245"
FT                   /db_xref="GOA:A9AW07"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW07"
FT                   /protein_id="ABX03245.1"
FT                   /translation="MAVLLLDNYDSFTYNLYQYFCELGAEVVVKRNDEIEVDDIRHMEA
FT                   IDRIVISPGPCTPAEAGISVPLIRELCMEYPILGVCLGHQSIGAAFGGRVIRAPQLRHG
FT                   KTSPITHLNVGIFAGVPSPFTATRYHSLIVEESSLPSDLEATAWSDDGLIMGLRHRTLP
FT                   IEGVQFHPESIMTEHGKVLLANFLSIAKPELAEVRG"
FT   gene            690086..690298
FT                   /locus_tag="Haur_0598"
FT   CDS_pept        690086..690298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03246"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW08"
FT                   /protein_id="ABX03246.1"
FT                   /translation="MQQLTLKPEEVPANLAEWLRASQQTTILLAVELDADGYLSLQALP
FT                   EVDPQLVPRVRKAMAQYAETLRRLL"
FT   gene            690295..690693
FT                   /locus_tag="Haur_0599"
FT   CDS_pept        690295..690693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0599"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   Death-on-curing protein; KEGG: ana:alr9029 putative death
FT                   on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03247"
FT                   /db_xref="GOA:A9AW09"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW09"
FT                   /protein_id="ABX03247.1"
FT                   /translation="MTHYLGLTDAFMLQAMVIQHIGGIHGITEQGFEKLATALAAPQQT
FT                   MFGEDLYPDTFSKAAALFDALIHGHCFSDGNKRTALLAMIEFLARNGYAFNTPDDDSLY
FT                   DWILLVAAERGMDREQQAAWIAQRCEQL"
FT   gene            690690..691106
FT                   /locus_tag="Haur_0600"
FT   CDS_pept        690690..691106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0600"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   Death-on-curing protein; KEGG: sth:STH876 death on curing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03248"
FT                   /db_xref="GOA:A9AW10"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW10"
FT                   /protein_id="ABX03248.1"
FT                   /translation="MSEEVPLHYITLEEALHIRDAIAEAHGESFDVLRFQQLLSALATP
FT                   FQSMFGEELFPTLCAKAGMLLAGLIRNHPFWDGNKRIAMAITARFLALNGYQLTVDAAE
FT                   ADQFTTALAMHRQDYETASSWLAQHSRPIGENRS"
FT   gene            691183..691794
FT                   /locus_tag="Haur_0601"
FT   CDS_pept        691183..691794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0601"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bja:blr3042 putative RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03249"
FT                   /db_xref="GOA:A9AW11"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW11"
FT                   /protein_id="ABX03249.1"
FT                   /translation="MAIADDHAQSERSDAVLLEAITTNNDMLALQQLFDRYRQQLFQTA
FT                   LGITRDQQLAEEVLQDCFYRLYRHAKKLDGSMPLAPWLYRVTVNLCYSRIKRQRPWYEP
FT                   FHQLAERLRASSRSAPDVVAERREMQDVVRQTLERLSPQHRAVLVLHYFHDYSLTEIAE
FT                   ILECPEGTIKSRLFYARKILKEQLYQAAIEGEPLIDGISF"
FT   gene            691823..693577
FT                   /locus_tag="Haur_0602"
FT   CDS_pept        691823..693577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0602"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: rca:Rcas_0284 multi-sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03250"
FT                   /db_xref="GOA:A9AW12"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW12"
FT                   /protein_id="ABX03250.1"
FT                   /translation="MSISVPRITPRLLMSGDPLFSLVRLISLGLILVVGARIDQHTVIP
FT                   PTTPFGLIWWAYAIYGLVMAGSAFVPRFRNLPSWIFIVDFGFIALFALFSGLPPALLVA
FT                   LIMLPTVWASTNRSPAQAVGTGVGAAIVYAGITLYRRFGDAGNVGSEEMFVSIAVNCTA
FT                   LILVSWLVSTLSGQSSEINREHVIAARRDVDSAQRDAEAYRDRMRALYEVAYKLSTTMN
FT                   FQTVLDATVTESIRLINGRSSVVLLPTGEPDELYVAAGVGVGSGDLNLRIAIEPTGIMA
FT                   SILASGTPRILNDLRQSHALSSVPSMQNCACVCCVPLSAGRRNYGIVVVGVDRNEINED
FT                   ELGMVSALANYAIIAMLNAQLVGELRDERTKLISKEEEVRQQLARDLHDGPAQSVAAIT
FT                   MNIEFVKRLLEREPSRVMQELTKMGELARRTTYDIRTLLFELRPLTLDSQGLVATLREY
FT                   VTRFKDGTTQVILEETVGELRLDAKREGTLFNIIQEASNNAMKHAQAKHIWIRLTRQGD
FT                   ELMATVQDDGKGFDLQAVRANYSKRGSFGLLNIDERARMVGGSAEMTSAVGAGTTVRVI
FT                   VPLDASSI"
FT   gene            693956..695263
FT                   /locus_tag="Haur_0603"
FT   CDS_pept        693956..695263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0603"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: rrs:RoseRS_4541 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03251"
FT                   /db_xref="GOA:A9AW13"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW13"
FT                   /protein_id="ABX03251.1"
FT                   /translation="MLQTYQDAMDWIYSFLDSEKKLPKNPTEFNLPRVKAMLELLGNPQ
FT                   LRYPAVIVAGTKGKGSTCAFLESIIRQSGLKVGFFSSPHLHSYRERMQINRELISQSQL
FT                   VDLINQVRPLLEPLDPEVGSPTTYEIGVVLGLYYFATQAIELAVLEIGLGGRYDAINTV
FT                   NPVLSVIASISYDHTAILGDTLAKIAYEKAGIIKQHVPVISTVQQAEAAEVIAQVAAEQ
FT                   AAPLFIAGMAGLQEQASGVVAEYPLVIVPEQLGLKGEFQMQNAQLATSAALLLRELGFP
FT                   ISDDAIRQGLATTQWPARFEQIANEPLTLVDGAHNGDSARVLLQALKQNYSNRPLTLVL
FT                   GTSSDKDIQAIIQQLSNSATHLITTCSRHPRALAPEKLAELIQQHVNRPVHQTNSVAEA
FT                   LTLAQQLTSAAGLICVTGSLFVAAEARETHGLAQPD"
FT   gene            695360..695731
FT                   /locus_tag="Haur_0604"
FT   CDS_pept        695360..695731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0604"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ter:Tery_4000 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03252"
FT                   /db_xref="GOA:A9AW14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW14"
FT                   /protein_id="ABX03252.1"
FT                   /translation="MHILLVEDHEMNRDMLKRRLERRDFQVSVAVDGQEAIDLVESLMP
FT                   DIILMDMSLPNVDGWTATRIIKANPAVNQIPIIGLTAHAMAGDRERCLEAGCNEYEIKP
FT                   VDFTSLVSKIQALVEDTPL"
FT   gene            695728..696795
FT                   /locus_tag="Haur_0605"
FT   CDS_pept        695728..696795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0605"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.2"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   response regulator receiver; KEGG: ter:Tery_3999
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03253"
FT                   /db_xref="GOA:A9AW15"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW15"
FT                   /protein_id="ABX03253.1"
FT                   /translation="MTATQPRILVVDDSEDNRYLLQRQLLRRNYGVVLAENGQQALDYV
FT                   QSHTIDLILLDIMMPVMNGFEVLQNLKQNEQLRHIPVIIVSAADDMENVVKGIQMGAED
FT                   YLAKPFNTTLLRARIEASLEKKRLHDQEQAYLQAIALEQAQSNRLLRNILPQTIADQLK
FT                   DQQANIAEYFSSVSVLFADIVGFTELSGHINAKELVAWLNRLFSRFDQMTLDVGLEKIK
FT                   TIGDAYMVAAGLPIAQPDHAERLALFATSMLAEIEQITMPNGKPLQMRIGIHSGPVVAG
FT                   VIGTIKFSYDLWGDTVNIASRMESSAHPNTIQVSAETYALLQDHEHFSLQPRHGVEMKH
FT                   LGTRTTYILNRHRHH"
FT   gene            696810..699167
FT                   /locus_tag="Haur_0606"
FT   CDS_pept        696810..699167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0606"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; KEGG: rca:Rcas_2639
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03254"
FT                   /db_xref="GOA:A9AW16"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9AW16"
FT                   /protein_id="ABX03254.1"
FT                   /translation="MHWQIPSYTFPTLIASSVSFAIAIIVSRRRFVSQMWPFAILAFTV
FT                   AFWTLGYAWELVSVDLATKVIFAKTQYLGIATPPVAWVAYALYYTGQERFVTKRSFLYA
FT                   MIIPAITIVLVWTNEWHHLIWTKTEIAMYGEYTMLQTYYGPWFWVHTAYSYVFMAAGTL
FT                   ILLQALVLSSSLYQNQIIALILSAIAPWVTNAFHILGYRPFPYLDLTPFGFVISTVALA
FT                   WGALRYRLFDTIPIARHILMENLSEGVIFLDAKRRVMDMNATAGKLLDIRPDQQIGQSA
FT                   IVSILERLDAPQSDDSDEHLRWEYTLHRDEKKLVLDVQLSPLSDRNRYLGHLLLLRDIT
FT                   ERHQYEDLLRSQRNLFAGLVEVARATSAQIDLDQTLQSTLDVALHLTTAEQGSIFLLDQ
FT                   HQMVTHSILAREKATRIEQQNLVGRVMRQGLAGWIVAHNQIALIKDTHTDDRWLHLPNA
FT                   PYNARSVLALPIFGTAGILGILMLLHSEVDHFRQEHSELMEAATAQISFAIGNAHVYQT
FT                   QQQLTRELSRAKDAAEAASQTKSQFLANMSHELRTPLTAIIGYADVMREDLLDSNDQIY
FT                   LADLDRIRSAGAHLLGLINDVLDLSKIEAGKMPVYWEQTRVSILLNDVITTVRPQIDRN
FT                   HNSLMIDQTYHNLMFWTDISKLRRVLINLLGNAAKFTDHGTISLSLFLDETDEPACLQI
FT                   RVCDTGIGMTAEQVANLFQNFSQADASTTRKYGGTGLGLAISRNLCKLMGGDIEVTSEL
FT                   GHGSTFIVKLPWVEQPFSDQREVGSDGPPYLF"
FT   gene            complement(699118..700401)
FT                   /locus_tag="Haur_0607"
FT   CDS_pept        complement(699118..700401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Haur_0607"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: sth:STH3191 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Haur_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABX03255"
FT                   /db_xref="GOA:A9AW17"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AW17"
FT                   /protein_id="